2JWKA

Solution structure of the periplasmic domain of tolr from haemophilus influenzae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolR
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 17
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwkA00
2JWKA 2JWLA 2PFUA
chains in the Genus database with same CATH superfamily
1RTIA 4B9MA 5M1KA 3RVCA 2RHKA 4FLUA 4F2RA 2ZE2A 3V9SA 4O4GA 3ZT0A 5A2QO 1XHZA 4BE1A 2ZQBA 2F96A 1KTQA 4RW7A 4CBWA 3R8EA 4FZXC 1VQ6N 3KWIA 4YOTA 1SL0A 5AQPA 3THWA 1NKCA 4RW8A 3K58A 2VCPA 2DTUA 1A5WA 3VGKA 1YITN 4FWKA 2FXUA 2KHOA 3O8MA 4IWVA 1MWMA 4CJ4A 3AARA 4KH5A 3OYGA 1HLUA 4IXCA 4QS9A 4BGAA 2G8IA 3N4QA 4R79A 4CK3A 4DU1A 1YJWN 1X9JA 4JK8A 3DLLL 3DAWA 1T8EA 5I9EB 1S6PA 3VQAA 5KQDA 2W6LA 4FWRA 3SZ2A 5AQHA 4CERA 3FR0A 3NH0A 1RT5A 4JEPA 3DLBA 4F3TA 1RFQA 2IGIA 1JLAA 1DTTA 2YHAA 5C0YA 4KHNA 3U3YA 2B6AA 3VTHA 3K5MA 1NK5A 3K0SA 3AA4A 3VQ4A 2OPPA 4AILC 4C8LA 4CHQA 4CFCA 3LZJA 1LWEA 4YHHK 1Z05A 3J81O 4JLHA 1HUXA 4JKGA 4WYBA 1T03A 4BRQA 3D7EO 3SYZA 5GIPA 5FDLA 4CK1A 3IS9A 4F2SA 1GLBG 4PL7A 4DG1A 4BY9C 4BRNA 3A2FA 4A62A 3P38A 5KPZA 3ZX0A 3SPYA 3O9UA 2RE2A 4KTZA 3NE6A 4DR4K 3MK6A 3VEOA 5KPTA 3U9ZA 1OH6A 2QEXN 1RTJA 2V52B 2IDOA 1QE1A 5EX5A 4M41A 2P5OA 1KAZA 4JI6K 4FJIA 1S6QA 3HSTB 1VQKN 5KQ8A 1MA9B 4JI5K 1D9FA 4FK2A 5MLCQ 4Z4IA 4AH9A 3QERA 3PO4A 4HTLA 3HPHA 3SBGA 1Y97A 3PLAA 1NGCA 5DMRA 1Q8IA 3CC4N 3ZCMA 2XY5A 2BANA 3VEYA 4WE1A 4BRIA 4DR3K 3HOSA 3DLHA 3TU5A 4AQYK 3AO4A 1BQNA 1X3MA 2P9KA 3WXIA 4CZEA 5J2QA 3PO5A 1HJOA 2BDPA 1JLQA 1IG9A 5FROA 1C0TA 5C12A 3WNFA 4CEDA 1IJJA 2G8FA 1E3MA 2IVNA 1XNRK 1T05A 4Z0UA 1UWBA 3L2UA 1IBMK 4HVJA 1TUYA 4OPHA 5EVZA 2E8AA 4FJJA 4M3RA 1W0HA 4BC3A 4CJ5A 2IVOA 4CE9A 3RWUA 4CF1A 2GTDA 1T6DA 4C8OA 4X62K 1NOZA 1K8KA 3FZKA 4JKFA 2H3GX 3RTVA 1UOCA 3VN5A 4YORA 1NJWA 2W42A 3THXB 1SAZA 3EY1A 4FLWA 1NJIO 2KLAA 3WNHA 1KAXA 1JLFA 3HSCA 3HP9A 3KIOA 3VQCA 1VQ8N 3ZT1A 4W5QA 3CJ7A 4FWQA 4AHVA 3P1GA 3LDQA 1V4SA 4B8CA 3HJFA 3LDLA 4A2AA 1HMVA 3HK2A 4OGCA 4FW1A 5ELZA 1NJYA 3V6DA 3K5OA 4CZMA 2WC9A 4XH1A 3VQDA 1J6ZA 4YOWA 3VENA 4H4MA 3CF5L 3WQTA 1QQCA 1NGDA 3L2WA 3KZBA 4OKEA 2CGLA 1OH5A 1VQ5N 1RBRA 3WNGA 3SQ1A 3R3LA 3DLGA 4EAHD 1X1PA 1RBUA 4JKBA 4CEOA 1KSPA 1BI4A 1SL1A 1BA0A 1RT3A 3HYFA 2V7ZA 4DFKA 3WXJA 3L6QA 2HF4A 3VESA 4ISGA 2IAJA 4B3TK 3KK7A 3WNEA 4RW9A 4CBUA 1TVRA 2IC3A 1WUAA 3FZLA 2W41A 5KRTA 3KK3A 3AVHA 4CIGA 4UQGA 5J2NA 1RNHA 4DTNA 2HBLA 3G0ZA 2UXCK 4OKJA 4MQ3A 4CEZA 1XC3A 3HT3A 3AA3A 1SS6A 1VQMN 4IG0A 4FJ9A 4GVEA 4IO8A 3ZT3A 1HYSA 4BC5A 1BUPA 3DXMA 3U8XA 3LPTA 1HQUA 4DQSA 4KHWA 3KK1A 2F8TA 5SZTA 3M8QA 5AQMA 1NGIA 3M3ZA 4LC9B 3EE9A 5I42A 3SBTA 1Y64A 5H1SQ 4BREA 3AVFA 2A1SA 4CZGA 3DLRA 3MXJA 5HRNA 3AA5X 2NRXA 4GKJK 2IOCA 4DSJA 2VGNA 4DV5K 1KFDA 1H1VA 3OYBA 3KLHA 4YOYA 1VSHA 5AQRA 1YVUA 4KTQA 4ILHA 4KI6A 3BZKA 2Q1NA 4AHTA 3QLHA 5C10A 4KREA 4LY7A 1HX1A 4A2BA 4DF4A 2J4RA 2DFFA 5D3GA 1EWRA 3U3GA 3MX5A 3CCEN 3NGZA 4CJPA 4KI4A 1OKJA 5AQOA 5AQNA 3PUFA 4IKFA 1X3NA 2KW4A 4BR4A 3SI6A 4PL8A 3D2FB 4DF8A 4ID1A 1TK5A 1KCFA 3OBYA 4B9TA 1HKGA 2YHYA 3KVGA 4DMNA 3BZCA 2OCEA 3K9KA 4JS5A 3WQUA 2GELA 1TKZA 3K5LA 2GUIA 3NF6A 4FVUA 3TSUA 2O8BA 1VSEA 3CMEN 4JHDA 4DU3A 4GKKK 4CGDA 4YOUA 3C65A 2ZM6K 1S22A 3OJSA 3EN9A 5BRDA 5J2MA 3SCXA 1BA1A 5GADP 1U04A 2FBVA 1X9WA 2ZD1A 4B1YB 2F9TA 4FK4A 3RR8A 4B3OA 2O8FA 5DK5A 2E20A 3QESA 1U2VA 2GX9A 5M1NA 4RG8A 1N32K 3ZSWA 4FJ7A 3IMXA 2QXLA 2GUPA 2O8CA 3BF1A 1K9MO 4BC4A 1GLLO 2OZSA 1RBVA 3M1FA 3DRPA 3DJCA 1IG8A 1VSLA 3OTOK 2FC0A 1WNSA 4DFJA 1G99A 4CECA 5DM7L 1E4FT 5T7BA 1UA0A 3LP1A 4JYAK 1YAGA 4HUFA 1QTMA 3G71N 4O44A 1VSKA 1KQSM 2I5JA 3QEPA 2YX6A 5GIOA 2BUPA 3UKRA 3MCPA 2DPNA 4OJRA 3V9WA 4FJXA 4FO0A 1Q9YA 3KLIA 3E66A 2P5GA 1K8AO 3OYMA 3W3DA 1ZBUA 3U6FA 4EZ6A 2A42A 4DFMA 3FZMA 4CIEA 4FLYA 1HNZK 4ILGB 3H6EA 1HNIA 4WQ5A 3VEVA 1IV0A 4CGGA 3LM2A 4X66K 2FF6A 1KVCA 2PFUA 1LAVA 1WN7A 3M8PA 4FWLA 2A3ZA 2NRRA 2XHBA 3P5JA 4DKWA 4CHPA 3I8BA 1VRTA 1YJ9N 2E2PA 3D0PA 1YJNN 3SNNA 2Q0RA 3MXMA 1S1UA 1NGJA 3AVMA 4H5WA 3ZLJA 3H45C 3FLCO 3ULEA 4NB4A 3O9QA 4IJNA 3OS0A 1JXBA 1SKRA 1T6CA 4YNQA 4B9UA 5AQWA 2XY7A 1YIJN 2A40A 4KHUA 3LALA 4YDUC 1J5EK 4BRAA 2HSTA 1GLFO 5GAGP 1NOYA 4Y0WA 3OA9A 4CIFA 2P9LB 1JL2A 4DTMA 1SKSA 3U9DA 3RR7A 1GOBA 3VQ9A 4E0DA 1D9DA 3VQQA 4HCBA 3J80O 4JAXA 4FJLA 3KLGA 4PKHA 3FZFA 4W5RA 1XMQK 2E2QA 3QEXA 1NGFA 3VQ6A 1BIUA 4E7LA 2DFEA 1NWKA 1N36K 4PQUA 4B3SK 2YKMA 3MX2A 1NG9A 4PHTX 3MEDA 3VTIA 2WTUA 2BTFA 4CD3A 3AVCA 4FOIA 1MU2A 2UUAK 3AY9A 4GV6A 3DLEA 4JI1K 3S3NA 4Z4CA 4E7HA 5JMVA 1J54A 1BL3A 2NUBA 3H3NO 3ZSQA 4FJHA 4FLTA 1KLNA 3SAHA 2QKBA 4H5TA 3MXIA 3PY8A 3SV4A 4FJ5A 4KB0A 4LF6K 4DQIA 4DV0K 3C7NB 1TAUA 5HBMA 1Q82O 1JCEA 3J7ZO 4G9ZA 4ZTFA 3T1AA 3H3OB 1C0FA 4JKAA 1TGOA 3V1RA 4J2EA 3E01A 3I55N 2D1KA 3V9ZA 1RDWX 4NYNA 2VQEK 4DQ8A 1JCFA 2NRZA 3VERA 2CH6A 5BR9A 1EX4A 1VQ4N 2HMIA 2RF2A 5AQTA 4CJFA 2I7PA 3CPEA 4CJKA 4I6MB 4IFYA 4CJ3A 3A5MC 1DGKN 3CMAN 1NBWA 4DSIA 3AA2A 4J2AA 1BGXT 2YNFA 4DR2K 1NGBA 3SMPA 4M42A 1SUQA 2JWLA 4WQ5C 1WOQA 1DEJA 3MDQA 3TI0A 5EY4A 3CC7N 3OVNA 4O5FA 1BG3A 5CY4A 2HHQA 4GY2B 4JRPA 3RSEA 4BRKA 4FYDA 1HKCA 3KWGA 4IFVA 3VETA 1S1TA 4FWPA 4H0XB 3FZHA 4NXMK 2F9WA 3UIQA 1C0GA 3LDSA 5BR8K 3O9RA 4WF9L 4CZJA 5DM6L 1S1VA 5BRHA 4FM2A 3NAEA 3BP8A 3P39A 4BG9A 4CZFA 3QMLA 4CZKA 5AQUA 3K57A 1ZBHA 3BY5A 4KPYA 4KHQA 1TKXA 2Q31A 4K25A 5E26A 4CEAA 3VF4A 1TUUA 2QA4N 1JXEA 4JKEA 4WFAL 4J2DA 4W5OA 1ASUA 2FSNA 4KTWA 1WSFA 3G4SN 3HPGA 4FZZA 2E6MA 2YHBA 1U47A 4LSLA 4LF9K 5AQFA 1HRHA 2E2OA 3C6AA 1U48A 2ASOA 5K14A 3TAQA 4V19S 2E88A 3UB5A 4DV2K 3O4QA 3LWMA 2E1ZA 4MLEA 1TKDA 4N41A 1VAZA 1YHQN 3T3FA 5JLHA 4C8MA 2Z1HA 3OS1A 1W9HA 4Q5VA 4E7KA 3QB0A 4O55A 5JS1A 3OY9A 5AQGA 1XI1A 2E6LA 1LW2A 5ADXA 1VSFA 3PX6A 3BDPA 1WSJA 5BN9A 3DRRA 2XY6A 1JL1A 1BISA 4JI0K 5B8HA 3B6PA 4DV7K 5EXWA 3M6GA 3FFIA 4FJGA 4ZHRA 4EZ9A 1WB9A 3CM6A 3NHGA 1NMDA 3V9XA 2ZWHA 1WAJA 2NLXA 1TAQA 1L3TA 4OO1J 5M1OA 2ASMA 1K8KB 4CEEA 3OS2A 4FJKA 3VQ8A 4B9VA 4H5RA 2X6NA 2HOEA 4B8AB 4Q0BA 4UY8O 4DLGA 3ULDA 5J1EA 2GV9A 4PA1A 2LSNA 4IDKA 4FW2A 1K6YA 3D2EB 3ENBA 3I0RA 4H0TB 3NVKA 1EO1A 3FFKB 1S5JA 4BDYA 2UXBK 3VQ7A 1RT4A 2KFNA 4JI8K 3MAQA 4CF8A 3V1OA 3OYLA 1HNVA 4PUOA 4CJRA 3EYZA 3EZWA 3T69A 4M3YA 3DXKB 3CQXA 1NGHA 4OPAA 1HJRA 1VQLN 4EHUA 4KHYA 1VSJA 4NLBA 3AVGA 2Q36A 4CGIA 4FWMA 2E5LK 4I9LA 2Q97A 3Q7BA 1RTDA 4DTRA 5FPNA 3HTVA 4G1QA 2JWKA 3V81A 5JICA 5AR0A 4IZ9A 1XC9A 4F4KA 4E1NA 3J8AA 3LP3A 2FBYA 4MO4A 3QNOA 3JS6A 3IUCA 4MFBA 5BRFA 4X65K 2FBXA 3WEEB 3AGKA 1L3SA 1EWQA 3OBWA 2Q2RA 4F8RA 1TYQB 2CH5A 4AHRA 5LJVA 4DU4A 3QNNA 4NXNK 4PKIA 4JNEA 2D0OA 4CJLA 5AZJB 4B1VA 4JI7K 4KB1A 2NNWA 4H5VA 4AHCA 3RRHA 4BG8A 2P9PB 4FLVA 3MN7A 3CCJN 4H8KA 3AO2A 3HI0A 3PSFA 5LJWA 1CLQA 3NGYA 3EKSA 1UA1A 1LCUA 2OA8A 3NCIA 3LP2A 5J2PA 4M3XA 1DT9A 1DTQA 2P9IB 3LDPA 1D4XA 3R6MA 3VF2A 3CERA 1HKBA 3G25A 4L8RB 1Q18A 3FE1A 5CHIA 4CZHA 1BCOA 4ICLA 2ETJA 4U67L 3H1VX 1CZ9A 1JLBA 4M7YA 1WBBA 1KVBA 2F8SA 2Q3SA 3TSPA 1L3VA 3LAMA 3ASMA 2YHWA 5BPNA 4C1NK 5AZIB 4C8KA 3HZ6A 4CHOA 4HHTA 1XMOK 3NBPA 3KK2A 2HF3A 3IDHA 5F2RA 2VGMA 3L2QA 3LWLA 2WOMA 3H08A 4K42A 1NU0A 3IAYA 5AQIA 3OW2M 2W6KA 3OYIA 1DLOA 3GL1A 1Z26A 4O0JA 3M8SA 4O8UA 3VQ5A 2HHHK 3OYCA 3KLEA 3I56N 5AQSA 2O4IA 3NVMA 3SJHA 3TTDA 2B4JA 1QZ6A 3WXKA 2F4VK 2P51A 3ZETB 3LAKA 4KRFA 1I39A 2A1RA 2QM1A 2HNZA 2HHWA 1SQKA 4BR7A 4N56A 2G8KA 1V4TA 4LH5A 4N47A 4FCYA 1QZ5A 2XO7A 4MDAA 1KLMA 4CEBA 3CJCA 3O3FA 4DV1K 4Z4GA 4HCCA 3E9PA 4DR5K 4AHSA 4OKKA 3A5NC 1IKVA 1P90A 5AQQA 3V9UA 4YDUA 3RMAA 4DTJA 3JSMA 2VG6A 2G8HA 2KTQA 3MWPA 1JLCA 3HBTA 2OPQA 3CD6N 4DR1K 2Y1JA 3KJVA 1RGIA 4MDBA 1ZBLA 2EX3A 4IEIA 1TKTA 4NCGA 4M3UA 4QS7A 2GWKA 3GOIA 3R9PA 1NMNA 1X9SA 2OZMA 5AQLA 1VQON 3SAFA 1UAXA 3KD1E 4KHSA 3O1BA 4RW4A 4DR7K 2HVHA 4I9QA 3TAMA 1GLEG 3AVIA 1YI2N 3CQYA 2UXDK 4CFBA 4ID5A 1XNQK 1ASWA 2UYTA 5C25A 4DSLA 4KBOA 3VPZA 4H03B 1C1AA 4Y1DA 3HOTA 4FJ8A 4A61A 4JD2B 3I8DA 1U49A 4BROA 2YJEA 4CF0A 5HLFA 2ZGYA 2YNIA 4DSFA 5JS2A 2NRHA 4K8XA 1JJ2M 4BC2A 4LFBK 2HHVA 4QCLA 2QWQA 4HWIA 4GV3A 3LL3A 2O8DB 2O4GA 3AV9A 1FKOA 4F3OA 3E1YA 2D0PA 5GAHP 3LDOA 4DFPA 2GBZA 2PAVA 4GVMA 4WFNL 4CZIA 3VEZA 3DWLA 4MO5A 2O8EB 3CM5A 3PV8A 1OVQA 4OLAA 1N6QA 3QBWA 1VK0A 4XH5A 4ELTA 4E1MA 1ZYQA 4CFDA 2ZJRL 1EXQA 1T7PA 1S9GA 4KAZA 4M63C 1QQNA 1Q9XA 3NF8A 2KZMA 4C23A 2QWOA 4BRFA 4FK0A 1NNEA 3D2FA 1ATNA 3O3GA 2P9NB 3VA3A 4LF5K 4I2QA 3ISNC 1O13A 2HHXA 3QEWA 4CVNE 3TSQA 4RW6A 3SQ4A 3O4NA 1LWFA 1ATRA 2QXFA 5HOOA 3O9SA 3ZT4A 3HRGA 4JV5K 3UKUB 4YY3K 3KKSA 1QSSA 1RDAA 1GLDG 3KKRA 3M8RA 3ZEUB 3CETA 3OHRA 4CJEA 4BRMA 3CG7A 4CGJA 2ITGA 1A5XA 2AP1A 1WLJA 3L4IA 3THVA 2OPSA 3ALYA 4M7XA 2B5JA 2G8VA 2E4LA 2P9SB 3F9MA 1ASVA 3FGUA 4A59A 4N76A 3NH1A 5HP1A 3ITHA 3U4LA 3PIOL 5CYMA 5LMUK 3VEXA 3F73A 3TANA 1KVAA 1T3VA 4OVLA 4DTUA 4LF4K 1ILYA 1B9DA 1SKWA 1TL3A 4KKOA 4DHYA 4H0YB 1B9FA 5BPLA 4O0IA 4JKDA 4DQRA 2P9UB 4DTOA 3THYA 4BQLA 5F1XA 1D5AA 3QO9A 4JN4A 3T1YK 1QHAA 3LP0A 1Z25A 4W5NA 4O5BA 2HHSA 1ZXOA 4IFEA 4BE0A 1NK0A 2G8UA 3DI6A 3C6TA 1VQPN 1QS4A 1OH7A 4Z4HA 3H1QA 3AVNA 5GINA 1LAWA 5ADXH 4PWDA 3E9OA 1CXQA 2PYLA 1REVA 3QFUA 4LD0A 3CCRN 3SUQA 4QS8A 4EFHA 3AVLA 3BUZB 3QICA 3ZSXA 4DTPA 3JAMO 3RMDA 1VSIA 4CJUA 2QKKA 4CHNA 4JKCA 4FLXA 1U6ZA 4KHPK 1RT7A 4ISFA 4K41A 2A5XA 3P83D 2QW9A 3GE1A 3THWB 1QVFM 4BDZA 3PX4A 2QWPA 1GLAG 2YKNA 2ATQA 2YV0X 4BWJA 3ENHA 4LSNA 1YVNA 3T7ZA 1NGAA 2VYPA 3IRXA 3HM8A 4DUZK 4OGEA 4FM1A 1S9EA 4E89A 4GMJB 5TKYA 3BEXA 5AFUA 2UU9K 3O1WA 2YI1A 2P9LA 4BRLA 2HNYA 5FPEA 1M1KO 1SV5A 3G6EN 1X9MA 2RKIA 3CQ8A 5CR4A 3CHWA 1BQMA 1TL1A 4E7JA 4LF8K 1EKEA 4H5NA 3NH2A 3MMVA 1B92A 4CJ7A 3KHYA 4J8FA 3OYFA 3PSIA 3AO1A 5C2FA 3SUPA 2ITMA 2NRTA 4E3SA 4BRGA 1IBKK 4BQZA 3J7YP 2AA4A 3ZX3A 4E19A 1WAFA 4WQ4A 2GEMA 2EWSA 3S3OA 4JKGB 4ELUA 1S3XA 4FM0A 1WSIA 1YXQA 2OANA 2BE2A 3TWHA 3K9JA 3CCLN 5FLXO 3QBXA 3QIOA 3V4IA 3ZSRA 2RPIA 3HO1A 3TR8A 3CJBA 4GW6A 3DMJA 5HRPA 3VEWA 4XEIA 3PX0A 4RCHA 3EZ5A 5FPDA 1VQ9N 5C24A 4B9LA 2NRWA 5BN8A 4MLHA 4BWMA 4KFBA 2QK9A 1YTUA 1U4BA 4LH4A 4JK9A 2HVIA 3CYMA 3VQEA 3C7NA 1N8RO 2HNDA 3SK3A 1NKEA 1W2BM 1CXUA 1VSMA 5CZ1A 2AJQA 5CE3A 1JKHA 4DR6K 3HP6A 3HL8A 1M90O 4I2PA 1BCMA 3N4PA 4DLEA 4B9QA 3F9KA 4PY5A 3CIPA 4FOEA 1RT2A 4I6MA 3TTCA 3TAFA 2PYJA 4YOVA 3O4WA 4HTUA 1SL2A 3K2PA 3AVJA 2DY4A 3W0LA 3CI5A 2P9KB 4BRHA 3IKMA 4IJAA 4W5TA 1VSDA 3MN5A 4BR5A 2JLEA 3D6RA 2KZZA 4FSVA 1FKPA 3CFOA 1CZAN 3CFRA 1VRUA 4DSKA 2FSJA 4B1XB 3B8AX 4B1UB 2Z1GA 4HUEA 4CF9A 4J2BA 4B1ZA 5M1QA 1C1BA 3GDQA 1GLJO 3F2KA 4DB3A 2HW3A 4CGHA 4BR9A 2QTDA 3UE5A 3QEIA 1W7AA 3NFAA 1VHXA 4IG3A 1FK9A 4EP5A 4C1NI 4F9OA 3F5TA 4Z4FA 3NF7A 2Z1JA 4JK7A 3ZX2A 4CHZA 1HYZA 4CJTA 4DV4K 2YJFA 5SWMA 3OYEA 5E84A 3SJJA 3ENOA 4ELVA 4Y1CA 1LWCA 2WFBA 3E9LA 3I0SA 5AQVA 3CCQN 3IFRA 3WXLA 3OYKA 3L8BA 1IBLK 2CGJA 4CI6A 4DUYK 3NMUA 1HNXK 4AHUA 3VOVA 1E4GT 2NRVA 1ZBIA 3MWTA 3P31A 1S1WA 3O9TA 1NLVA 1J5OA 4B3MK 5JVGL 2YCHA 2CGKA 1KFSA 3CXCM 4O8KA 2HHTA 5GAEP 4M3WA 3TTFA 1RDBA 2X6SA 3OYAA 2P1JA 1BI4B 3ZSOA 4DWIA 4DTXA 1KC8O 3ATVA 2VG5A 4CJSA 4WQ4C 2OTLN 4IOXA 2FF3B 4ISEA 3A8YA 3O6WA 5AJ3K 3HXMA 4FXDA 2A6AA 1RBSA 1HPZA 3O3HA 3KLFA 3S9HA 4LFAK 4KO0A 4WCEL 5E41A 2GWJA 3P4IA 1QVGM 4IO9L 4BR2A 3J7AP 1FXXA 3VGLA 4WFBL 4BACA 3RMBA 3GG4A 3C95A 5I3UA 4ZTJA 1TK8A 2ZGZA 2YNGA 3GBTA 1K73O 1MWKA 3DXMB 3ZSVA 3V1QA 3KTQA 4IDHA 1WSGA 2RN2A 4RTFD 5BREA 4Z4EA 3D2EA 1U45A 1EQYA 3QINA 1DKGD 3CPWM 3CFPA 1BU6O 2FSKA 1L5UA 1BDGA 3C94A 2UUCK 1JLEA 2HBKA 1BHLA 1QSLA 4M3ZA 2V7YA 3H46O 4DTSA 2FBTA 3ID6A 4CW7B 4CJWA 3WUHA 2V51B 5AQYA 2WUSA 1BO5O 3DXKA 2IVPA 5KRSA 5AQKA 2G8WA 1HR0K 3AVBA 1NJZA 1MDUB 4AM7A 3A5OC 5JVHL 1JLGA 3T1HK 3JYTA 1RCHA 2HBMA 2UUBK 2D0BA 4FL9A 4M45A 3DRSA 3LANA 1LW0A 5AQJA 3AO5A 4DV3K 2ASPA 5KPRA 2OPRA 3CCMN 3SPZA 4CEQA 2IIRA 3ATUA 5HL7L 1NK4A 1EP4A 4C8NA 5JLFA 2VQFK 4BRPA 2JGUA 1NKBA 1NK8A 4K8ZA 3VA0A 1RDUA 2X74A 1J53A 2D5RA 3TPQA 2D0AA 4IOAL 3WEEA 3TAGA 1ZC6A 2O8BB 3THXA 4PKGA 4JHDB 2W40A 3C6UA 4FWSA 4YOXA 3OJUA 3SQ2A 1TYQA 3K59A 1YUWA 4R5PA 3KD5E 1J9AA 1EETA 4H0PA 5AZJA 5F0XA 3VQPA 1LV5A 5FRNA 2O8FB 1KAYA 1N5YA 2P9PA 3TABA 1U2VB 2ZJQL 5C42A 1ATSA 2X78A 2QWMA 3QDKA 1HQEA 1ESVA 2QWLA 2I7NA 2O8CB 3AGRA 2QWNA 3VGMA 1G15A 2HMPA 3EE8A 4Z94A 3CCVN 4IBNA 3SUNA 1D8YA 3S41A 1HNWK 3CCUN 3T19A 2P9IA 3D45A 2QWRA 4CHYA 5KTQA 3MCAB 2FLOA 5C2DA 2ZJPL 5LMNK 3TAPA 3L2RA 1KRPA 1T44A 1Q7YO 3MN6A 4IOCL 5FPMA 3CJ9A 1C6VA 1RDDA 2VG7A 4A57A 2HBJA 3QIPA 3K5NA 4GNIA 4YFUA 4B9SA 1C0UA 3AO3A 3CJAA 2BGGA 3UKRB 4EHTA 4B08A 5AZIA 3L3UA 1IH7A 1YT3A 4HUGA 3TAEA 3AVKA 4BDPA 1S1XA 3R1XA 4JRQA 1I3AA 3HM9A 1IKXA 2Q0UA 3DLKA 5C15A 3SAGA 1SZ2A 1VQNN 2QI2A 3VF6A 5M1FA 4LFCK 1ZBFA 3C0BA 5IT9O 4CZLA 4JI4K 3SUOA 4H0VB 3O5BA 4BR0A 4FVMA 1O1WA 4FWNA 4BE2A 1Q86O 5CZ2A 4GV9A 2E1YA 3DM2A 1IO2A 3NDKA 4OX9K 4DQQA 4CF2A 4CESA 3ZETA 3O80A 3EL2A 4AF1A 3ULEB 3RRGA 4IEEA 4QOZB 1QQMA 4CJQA 4DSEA 4KV8A 3DYAA 3HVRA 2YNHA 3OYDA 3LM9A 3L2VA 1RT6A 3QETA 3O08A 2BH1A 1NK7A 4OPJA 5KGXA 1WBDA 4K43A 1LOTB 2E2NA 3MECA 1KD1O 2KKZA 1NGGA 1BWFO 3L4QA 2YHXA 4FLZA 3MEGA 3CJ1A 4BGBA 3L0QA 3QEVA 1IKWA 2VWBA 5AFUH 1QQOA 4JKHA 4M3TA 2XY8A 1BOTO 1KXPA 4ILJA 4CBXA 1ITGA 3THYB 3TARA 1FW6A 3EKUA 3LDNA 1HYVA 2R7YA 3EEQA 4DV6K 3CCSN 4NLCA 4CJVA 1BIZA 4DQPA 1R59O 3ID8A 1S72N 1IKYA 1HPMA 4XH4A 1QSYA 3ZSYA 5AQXA 3G10A 1Z6RA 3A5LC 3S3MA 3Q7CA 2PY5A 4B9NA 3SQ0A 3VMFB 1OVYA 4A5BA 1YTAA 2XRIA 3MEEA 4FPAA 5LL6Z 4B3RK 4JD2A 3HPOA 3SLCA 4KH4A 1OH8A 3QFPA 2VWKA 1CZBA 2VWJA 2PZSA 3B6OA 4CFAA 2WBNA 1QHTA 1XHXA 4AM6A 4BRCA 1RT1A 1P8ZA 2HB5A 4EP4A 1VQ7N 1XWLA 4DCHA 3AVAA 3ZYYX 2O8DA 3VQBA 2IS3A 2F7TA 2Y1IA 1FJGK 1ZBSA 3CC2N 1RDCA 3SV3A 1JCGA 3MN9A 4K0KK 4E1JA 5EU7A 1WSHA 2O8EA 4E7IA 2PBDA 4CD1A 1N33K 3BGRA 3PIPL 3OYNA 3C6HA 4QAGA 3DOKA 4H0OA 1NJXA 1C1CA 4I7FA 4TSXA 5HROA 5IWAK 1RBTA 2KQ2A 3AAPA 1N34K 2P9NA 4FZYA 3JXUA 4EIAA 3RSEB 4BVPA 4N5SA 3RMCA 1A5VA 3LPUA 3OYHA 4NCBA 2OTJN 4FJNA 4CGFA 2OYQA 3NF9A 1Q81O 4X64K 2WONA 3WXMB 3UKUA 5BPMA 5CYQA 4NO7A 4FWOA 1RTHA 4CK2A 5FRMA 3I33A 4FJMA 3ZEUA 4H4OA 2DFHA 4A5AA 5AQZA 4XIUA 1W97L 1TV6A 3HVTA 1WSEA 4JS4A 5KI6A 2A41A 3ZSZA 5TKWA 4BRDA 1XQSC 5KGWA 4OPKA 1NM1A 2P9SA 4NYFA 1TK0A 3SMSA 1RILA 4L3QA 1R0AA 1I94K 4CCHA 2D4WA 2NZTA 4CEFA 1GOCA 1NGEA 1F21A 3NGIA 1XUPO 4DS4A 4JI3K 4BVOA 2Z1IA 4FPBA 5EOYA 3WT0A 3EO3A 4NCAA 1GLCG 4JI2K 3AAQA 3LZIA 2D0CA 3L3VA 2P9UA 1GOAA 1NK9A 1L3UA 3ZT2A 2EHGA 5HRSA 3OYJA 5HRRA 4OLBA 3BF3A 4KH6A 4DS5A 4U7BA 4LF7K 5M1PA 2HHUA 5LY3A 3M5RA 3A0IX 3IG1A 2KFZA 1C0MA 1YF5L 4RWTA 2ZF5O 3DOLA 1NK6A 4B1WB
chains in the Genus database with same CATH topology
1NGJA 4H5WA 5M1KA 3RVCA 2RHKA 3E9PA 1KC8O 3ATVA 3H45C 3FLCO 4WQ4C 3A5NC 3ULEA 2OTLN 4NB4A 3O9QA 5AQQA 1P90A 4YDUA 4IJNA 4IOXA 2FF3B 4ISEA 3A8YA 3O6WA 1T6CA 2A6AA 4CBWA 3R8EA 1VQ6N 3KWIA 3MWPA 5AQWA 4WCEL 1YIJN 4YOTA 3HBTA 2GWJA 3P4IA 1QVGM 3CD6N 2A40A 5AQPA 4IO9L 4YDUC 2VCPA 4BRAA 4BR2A 2HSTA 1GLFO 3VGLA 5GAGP 4Y0WA 1RGIA 3GG4A 4MDBA 3OA9A 4WFBL 2P9LB 4IEIA 3VGKA 1YITN 4FWKA 2FXUA 2KHOA 3O8MA 2GWKA 4QS7A 3U9DA 3GOIA 4IWVA 3R9PA 2ZGZA 1MWMA 5AQLA 3GBTA 1K73O 1VQON 1MWKA 3SAFA 3DXMB 3AARA 3O1BA 4JAXA 4KH5A 4IDHA 1HLUA 4IXCA 4QS9A 1GLEG 4RTFD 4BGAA 4PKHA 3FZFA 5BREA 1YI2N 3N4QA 3CQYA 4R79A 1YJWN 2E2QA 1X9JA 3D2EA 4JK8A 1EQYA 3DLLL 1DKGD 3DAWA 5I9EB 2UYTA 5KQDA 1NGFA 3CPWM 4KBOA 4FWRA 1BU6O 5AQHA 3VPZA 2FSKA 4H03B 1BDGA 3FR0A 1NWKA 3HOTA 4JEPA 1RFQA 4A61A 4JD2B 3MX2A 2HBKA 4BROA 4PHTX 3VTIA 2BTFA 2YJEA 4CD3A 5C0YA 4FOIA 2ZGYA 2V7YA 3AY9A 4GV6A 3H46O 3ID6A 3WUHA 2NRHA 2V51B 3VTHA 5AQYA 1JJ2M 2WUSA 1BO5O 4BC2A 3DXKA 2IVPA 5JMVA 5AQKA 3H3NO 2QWQA 1MDUB 3SAHA 4HWIA 4GV3A 4H5TA 3LL3A 4AM7A 3A5OC 5JVHL 1Z05A 1HUXA 4JKGA 4WYBA 3E1YA 2D0PA 4BRQA 2HBMA 3LDOA 5GAHP 4FL9A 3D7EO 2PAVA 5GIPA 5AQJA 4WFNL 4CZIA 3VEZA 3DWLA 4MO5A 3C7NB 2ASPA 5KPRA 3CCMN 1GLBG 4PL7A 1JCEA 3J7ZO 1Q82O 4G9ZA 2IIRA 3ATUA 3QBWA 5HL7L 4XH5A 4BY9C 5JLFA 3H3OB 4BRNA 4BRPA 1C0FA 4A62A 4JKAA 3P38A 5KPZA 2ZJRL 3ZX0A 3O9UA 1RDUA 2D1KA 2RE2A 4M63C 1RDWX 1QQNA 3I55N 3MK6A 3VEOA 4DQ8A 1JCFA 3TPQA 5KPTA 2NRZA 3U9ZA 3VERA 3WEEA 4IOAL 1ZC6A 4C23A 2QEXN 2QWOA 4BRFA 2V52B 2CH6A 5BR9A 4PKGA 4JHDB 5EX5A 1VQ4N 1KAZA 1ATNA 2W40A 3D2FA 4FWSA 5AQTA 5H1SQ 4YOXA 1TYQA 2I7PA 3CPEA 1YUWA 2P9NB 4I6MB 3A5MC 1DGKN 3CMAN 1VQKN 1NBWA 5KQ8A 1MA9B 5AZJA 4H0PA 5F0XA 5MLCQ 1O13A 4HTLA 1KAYA 1NGBA 2P9PA 3SBGA 3SMPA 3TSQA 1U2VB 2ZJQL 2JWLA 1ATRA 4WQ5C 1ATSA 1DEJA 1WOQA 3MDQA 3PLAA 5HOOA 1NGCA 3O9SA 5EY4A 2QWMA 3QDKA 3HRGA 4O5FA 1BG3A 3CC7N 3UKUB 1ESVA 3CC4N 2QWLA 2I7NA 4GY2B 3AGRA 2QWNA 1GLDG 3RSEA 3VEYA 3VGMA 4BRIA 4BRKA 1HKCA 3HOSA 3KWGA 2HMPA 3EE8A 3TU5A 4Z94A 3VETA 3CCVN 3S41A 4H0XB 4FWPA 3CETA 3FZHA 3ZEUB 2F9WA 3CCUN 2P9IA 1X3MA 2P9KA 1C0GA 3WXIA 3OHRA 4CZEA 3O9RA 4BRMA 1HJOA 4WF9L 4CZJA 2QWRA 2AP1A 5DM6L 5C12A 3L4IA 5BRHA 3MCAB 2FLOA 5C2DA 2ZJPL 1IJJA 1T44A 3BP8A 4M7XA 1Q7YO 3MN6A 3P39A 4IOCL 2IVNA 4BG9A 5FPMA 3CJ9A 4CZFA 2P9SB 4A57A 2HBJA 3QMLA 3F9MA 4CZKA 1TUYA 3FGUA 4GNIA 4OPHA 5EVZA 5AQUA 2E8AA 4A59A 2Q31A 3CJAA 4K25A 5E26A 4BC3A 3U4LA 1TUUA 3UKRB 3VF4A 4EHTA 3PIOL 2IVOA 2QA4N 3VEXA 2GTDA 1T6DA 5AZIA 4JKEA 1T3VA 1K8KA 3FZKA 4JKFA 1ILYA 4WFAL 2H3GX 2FSNA 4DHYA 4YORA 3G4SN 4H0YB 5BPLA 4JKDA 1SAZA 1NJIO 2KLAA 2P9UB 3R1XA 1KAXA 5AQFA 3C6AA 2E2OA 3HSCA 4BQLA 2Q0UA 5F1XA 4JN4A 5C15A 1VQ8N 1QHAA 2ASOA 3SAGA 1SZ2A 1VQNN 2QI2A 2E88A 1ZXOA 3CJ7A 4FWQA 3UB5A 3VF6A 5M1FA 3LDQA 4IFEA 1V4SA 2E1ZA 1VQPN 4MLEA 3C0BA 4CZLA 3LDLA 3H1QA 1VAZA 4A2AA 1YHQN 5JLHA 4H0VB 5GINA 5ADXH 5ELZA 3E9OA 3O5BA 4BR0A 4CZMA 2WC9A 3QB0A 3QFUA 4XH1A 1J6ZA 4FWNA 4YOWA 3VENA 1Q86O 5AQGA 2E1YA 3WQTA 3CF5L 3CCRN 4GV9A 5ADXA 4QS8A 4EFHA 1NGDA 5BN9A 3O80A 3ZETA 3EL2A 4AF1A 3ULEB 3BUZB 3QICA 4IEEA 3KZBA 2CGLA 1VQ5N 5B8HA 1QQMA 3R3LA 4JKCA 1U6ZA 4EAHD 3LM9A 4ISFA 4K41A 5EXWA 3M6GA 2A5XA 4JKBA 3O08A 2BH1A 2QW9A 4K43A 1LOTB 1BA0A 2E2NA 3GE1A 1KD1O 1QVFM 2KKZA 1NMDA 1NGGA 2V7ZA 1BWFO 3WXJA 2ZWHA 3L6QA 2HF4A 2QWPA 3L4QA 3VESA 2NLXA 4ISGA 1GLAG 4OO1J 2YHXA 3CJ1A 5M1OA 4BGBA 2ASMA 1K8KB 3L0QA 4H5RA 3ENHA 2VWBA 5AFUH 1QQOA 3KK7A 2HOEA 1YVNA 4JKHA 3T7ZA 1NGAA 4CBUA 2VYPA 4UY8O 1WUAA 3FZLA 2W41A 1BOTO 1KXPA 4ILJA 3HM8A 4CBXA 5TKYA 5AFUA 3BEXA 3ENBA 3D2EB 4H0TB 2HBLA 3O1WA 2YI1A 3NVKA 2P9LA 4BRLA 1EO1A 5FPEA 1XC3A 1M1KO 3G6EN 3FFKB 1SS6A 3EKUA 1VQMN 3LDNA 4GVEA 4IO8A 4BC5A 5CR4A 1BUPA 3DXMA 3CHWA 3U8XA 3CCSN 4NLCA 1R59O 4H5NA 3ID8A 3MMVA 1S72N 1HPMA 4XH4A 5AQMA 4CJ7A 3KHYA 1NGIA 4J8FA 3M3ZA 4LC9B 3EE9A 5AQXA 1Z6RA 3A5LC 5C2FA 3Q7CA 3SBTA 3EZWA 3T69A 1Y64A 2ITMA 1OVYA 3DXKB 3CQXA 1NGHA 3VMFB 4OPAA 4A5BA 2NRTA 4BREA 4FPAA 4CZGA 1VQLN 4EHUA 4BRGA 2NRXA 4JD2A 4NLBA 4BQZA 3SLCA 2AA4A 2VGNA 3ZX3A 4KH4A 3QFPA 4WQ4A 2GEMA 1H1VA 2EWSA 2Q36A 4YOYA 5AQRA 4FWMA 4JKGB 4ILHA 1S3XA 2Q97A 1YXQA 2Q1NA 3Q7BA 2OANA 5C10A 2WBNA 3K9JA 3CCLN 4AM6A 3QBXA 4BRCA 1P8ZA 5FPNA 1HX1A 3HTVA 4A2BA 2JWKA 2J4RA 3CJBA 5JICA 5AR0A 4IZ9A 3VEWA 1VQ7N 4XEIA 3MX5A 4RCHA 4DCHA 3J8AA 5FPDA 1VQ9N 3ZYYX 3CCEN 4MO4A 2NRWA 5BN8A 2F7TA 3JS6A 4MLHA 1OKJA 1ZBSA 5AQOA 3IUCA 5AQNA 5BRFA 3CC2N 4JK9A 1JCGA 3WEEB 3AGKA 1X3NA 3MN9A 3OBWA 2Q2RA 4BR4A 4E1JA 4PL8A 3D2FB 3C7NA 1N8RO 1TYQB 2CH5A 2PBDA 4CD1A 5LJVA 3OBYA 1HKGA 2YHYA 4JNEA 4PKIA 2D0OA 3KVGA 5AZJB 4B1VA 3PIPL 3C6HA 3K9KA 3SK3A 1W2BM 2NNWA 4H5VA 3WQUA 2GELA 4BG8A 2P9PB 4H0OA 5CE3A 4FVUA 3TSUA 3MN7A 3CCJN 1M90O 3N4PA 3CMEN 4JHDA 3HI0A 5LJWA 4B9QA 4YOUA 3CIPA 3AAPA 3C65A 4FOEA 1S22A 2P9NA 4I6MA 3TTCA 3EN9A 5BRDA 3EKSA 1BA1A 3JXUA 5GADP 3O4WA 1LCUA 3RSEB 4BVPA 4EIAA 4YOVA 4B1YB 2OTJN 2F9TA 3W0LA 1DT9A 2P9IB 3CI5A 1D4XA 2P9KB 2E20A 3IKMA 3LDPA 1U2VA 4IJAA 2GX9A 4BRHA 3MN5A 4BR5A 3D6RA 5M1NA 1Q81O 4FSVA 3R6MA 3VF2A 3CERA 1HKBA 3G25A 3WXMB 3UKUA 1Q18A 5BPMA 3FE1A 5CHIA 3IMXA 1CZAN 4NO7A 2QXLA 2GUPA 4CZHA 4U67L 3H1VX 3BF1A 1K9MO 4FWOA 2FSJA 4B1XB 4BC4A 1GLLO 4M7YA 3B8AX 3I33A 3M1FA 4B1UB 3ZEUA 3DJCA 3TSPA 5M1QA 4B1ZA 1IG8A 4A5AA 5AQZA 3GDQA 1GLJO 3F2KA 4DB3A 2YHWA 5BPNA 1W97L 4BR9A 1G99A 5DM7L 4C1NK 1E4FT 2QTDA 5AZIB 3UE5A 2A41A 3HZ6A 1YAGA 5TKWA 4BRDA 1XQSC 3G71N 4C1NI 4F9OA 1NM1A 2HF3A 2P9SA 3F5TA 3IDHA 5F2RA 2VGMA 3SMSA 1KQSM 4L3QA 2D4WA 4JK7A 2YX6A 3ZX2A 5GIOA 2BUPA 2NZTA 3UKRA 4K42A 3MCPA 2YJFA 2DPNA 1NGEA 5AQIA 5E84A 1XUPO 4FO0A 3OW2M 3E66A 3ENOA 3GL1A 1K8AO 4BVOA 2WFBA 3E9LA 5AQVA 3W3DA 3CCQN 4FPBA 2A42A 5EOYA 3EO3A 3WT0A 3IFRA 4O8UA 3FZMA 3WXLA 1GLCG 4ILGB 3H6EA 3AAQA 5AQSA 3I56N 2CGJA 4CI6A 2P9UA 4WQ5A 3VEVA 3NMUA 3NVMA 3VOVA 3LM2A 3SJHA 1E4GT 2NRVA 2FF6A 2PFUA 4FWLA 3MWTA 3TTDA 2A3ZA 1QZ6A 2NRRA 3BF3A 3P31A 3WXKA 4DKWA 4KH6A 4U7BA 3O9TA 3ZETB 1NLVA 2QM1A 5JVGL 2YCHA 5M1PA 1SQKA 3I8BA 4BR7A 5LY3A 1V4TA 3M5RA 3A0IX 2CGKA 1QZ5A 3CXCM 1YF5L 2E2PA 4O8KA 1YJ9N 4MDAA 2ZF5O 5GAEP 4RWTA 3TTFA 2Q0RA 3CJCA 1YJNN 4B1WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWK A;  2JWL A;  2PFU A; 
#chains in the Genus database with same CATH topology
 1RTI A;  4B9M A;  5M1K A;  3RVC A;  2RHK A;  4FLU A;  4F2R A;  2ZE2 A;  3V9S A;  4O4G A;  3ZT0 A;  5A2Q O;  1XHZ A;  4BE1 A;  2ZQB A;  2F96 A;  1KTQ A;  4RW7 A;  4CBW A;  3R8E A;  4FZX C;  1VQ6 N;  3KWI A;  4YOT A;  1SL0 A;  5AQP A;  3THW A;  1NKC A;  4RW8 A;  3K58 A;  2VCP A;  2DTU A;  1A5W A;  3VGK A;  1YIT N;  4FWK A;  2FXU A;  2KHO A;  3O8M A;  4IWV A;  1MWM A;  4CJ4 A;  3AAR A;  4KH5 A;  3OYG A;  1HLU A;  4IXC A;  4QS9 A;  4BGA A;  2G8I A;  3N4Q A;  4R79 A;  4CK3 A;  4DU1 A;  1YJW N;  1X9J A;  4JK8 A;  3DLL L;  3DAW A;  1T8E A;  5I9E B;  1S6P A;  3VQA A;  5KQD A;  2W6L A;  4FWR A;  3SZ2 A;  5AQH A;  4CER A;  3FR0 A;  3NH0 A;  1RT5 A;  4JEP A;  3DLB A;  4F3T A;  1RFQ A;  2IGI A;  1JLA A;  1DTT A;  2YHA A;  5C0Y A;  4KHN A;  3U3Y A;  2B6A A;  3VTH A;  3K5M A;  1NK5 A;  3K0S A;  3AA4 A;  3VQ4 A;  2OPP A;  4AIL C;  4C8L A;  4CHQ A;  4CFC A;  3LZJ A;  1LWE A;  4YHH K;  1Z05 A;  3J81 O;  4JLH A;  1HUX A;  4JKG A;  4WYB A;  1T03 A;  4BRQ A;  3D7E O;  3SYZ A;  5GIP A;  5FDL A;  4CK1 A;  3IS9 A;  4F2S A;  1GLB G;  4PL7 A;  4DG1 A;  4BY9 C;  4BRN A;  3A2F A;  4A62 A;  3P38 A;  5KPZ A;  3ZX0 A;  3SPY A;  3O9U A;  2RE2 A;  4KTZ A;  3NE6 A;  4DR4 K;  3MK6 A;  3VEO A;  5KPT A;  3U9Z A;  1OH6 A;  2QEX N;  1RTJ A;  2V52 B;  2IDO A;  1QE1 A;  5EX5 A;  4M41 A;  2P5O A;  1KAZ A;  4JI6 K;  4FJI A;  1S6Q A;  3HST B;  1VQK N;  5KQ8 A;  1MA9 B;  4JI5 K;  1D9F A;  4FK2 A;  5MLC Q;  4Z4I A;  4AH9 A;  3QER A;  3PO4 A;  4HTL A;  3HPH A;  3SBG A;  1Y97 A;  3PLA A;  1NGC A;  5DMR A;  1Q8I A;  3CC4 N;  3ZCM A;  2XY5 A;  2BAN A;  3VEY A;  4WE1 A;  4BRI A;  4DR3 K;  3HOS A;  3DLH A;  3TU5 A;  4AQY K;  3AO4 A;  1BQN A;  1X3M A;  2P9K A;  3WXI A;  4CZE A;  5J2Q A;  3PO5 A;  1HJO A;  2BDP A;  1JLQ A;  1IG9 A;  5FRO A;  1C0T A;  5C12 A;  3WNF A;  4CED A;  1IJJ A;  2G8F A;  1E3M A;  2IVN A;  1XNR K;  1T05 A;  4Z0U A;  1UWB A;  3L2U A;  1IBM K;  4HVJ A;  1TUY A;  4OPH A;  5EVZ A;  2E8A A;  4FJJ A;  4M3R A;  1W0H A;  4BC3 A;  4CJ5 A;  2IVO A;  4CE9 A;  3RWU A;  4CF1 A;  2GTD A;  1T6D A;  4C8O A;  4X62 K;  1NOZ A;  1K8K A;  3FZK A;  4JKF A;  2H3G X;  3RTV A;  1UOC A;  3VN5 A;  4YOR A;  1NJW A;  2W42 A;  3THX B;  1SAZ A;  3EY1 A;  4FLW A;  1NJI O;  2KLA A;  3WNH A;  1KAX A;  1JLF A;  3HSC A;  3HP9 A;  3KIO A;  3VQC A;  1VQ8 N;  3ZT1 A;  4W5Q A;  3CJ7 A;  4FWQ A;  4AHV A;  3P1G A;  3LDQ A;  1V4S A;  4B8C A;  3HJF A;  3LDL A;  4A2A A;  1HMV A;  3HK2 A;  4OGC A;  4FW1 A;  5ELZ A;  1NJY A;  3V6D A;  3K5O A;  4CZM A;  2WC9 A;  4XH1 A;  3VQD A;  1J6Z A;  4YOW A;  3VEN A;  4H4M A;  3CF5 L;  3WQT A;  1QQC A;  1NGD A;  3L2W A;  3KZB A;  4OKE A;  2CGL A;  1OH5 A;  1VQ5 N;  1RBR A;  3WNG A;  3SQ1 A;  3R3L A;  3DLG A;  4EAH D;  1X1P A;  1RBU A;  4JKB A;  4CEO A;  1KSP A;  1BI4 A;  1SL1 A;  1BA0 A;  1RT3 A;  3HYF A;  2V7Z A;  4DFK A;  3WXJ A;  3L6Q A;  2HF4 A;  3VES A;  4ISG A;  2IAJ A;  4B3T K;  3KK7 A;  3WNE A;  4RW9 A;  4CBU A;  1TVR A;  2IC3 A;  1WUA A;  3FZL A;  2W41 A;  5KRT A;  3KK3 A;  3AVH A;  4CIG A;  4UQG A;  5J2N A;  1RNH A;  4DTN A;  2HBL A;  3G0Z A;  2UXC K;  4OKJ A;  4MQ3 A;  4CEZ A;  1XC3 A;  3HT3 A;  3AA3 A;  1SS6 A;  1VQM N;  4IG0 A;  4FJ9 A;  4GVE A;  4IO8 A;  3ZT3 A;  1HYS A;  4BC5 A;  1BUP A;  3DXM A;  3U8X A;  3LPT A;  1HQU A;  4DQS A;  4KHW A;  3KK1 A;  2F8T A;  5SZT A;  3M8Q A;  5AQM A;  1NGI A;  3M3Z A;  4LC9 B;  3EE9 A;  5I42 A;  3SBT A;  1Y64 A;  5H1S Q;  4BRE A;  3AVF A;  2A1S A;  4CZG A;  3DLR A;  3MXJ A;  5HRN A;  3AA5 X;  2NRX A;  4GKJ K;  2IOC A;  4DSJ A;  2VGN A;  4DV5 K;  1KFD A;  1H1V A;  3OYB A;  3KLH A;  4YOY A;  1VSH A;  5AQR A;  1YVU A;  4KTQ A;  4ILH A;  4KI6 A;  3BZK A;  2Q1N A;  4AHT A;  3QLH A;  5C10 A;  4KRE A;  4LY7 A;  1HX1 A;  4A2B A;  4DF4 A;  2J4R A;  2DFF A;  5D3G A;  1EWR A;  3U3G A;  3MX5 A;  3CCE N;  3NGZ A;  4CJP A;  4KI4 A;  1OKJ A;  5AQO A;  5AQN A;  3PUF A;  4IKF A;  1X3N A;  2KW4 A;  4BR4 A;  3SI6 A;  4PL8 A;  3D2F B;  4DF8 A;  4ID1 A;  1TK5 A;  1KCF A;  3OBY A;  4B9T A;  1HKG A;  2YHY A;  3KVG A;  4DMN A;  3BZC A;  2OCE A;  3K9K A;  4JS5 A;  3WQU A;  2GEL A;  1TKZ A;  3K5L A;  2GUI A;  3NF6 A;  4FVU A;  3TSU A;  2O8B A;  1VSE A;  3CME N;  4JHD A;  4DU3 A;  4GKK K;  4CGD A;  4YOU A;  3C65 A;  2ZM6 K;  1S22 A;  3OJS A;  3EN9 A;  5BRD A;  5J2M A;  3SCX A;  1BA1 A;  5GAD P;  1U04 A;  2FBV A;  1X9W A;  2ZD1 A;  4B1Y B;  2F9T A;  4FK4 A;  3RR8 A;  4B3O A;  2O8F A;  5DK5 A;  2E20 A;  3QES A;  1U2V A;  2GX9 A;  5M1N A;  4RG8 A;  1N32 K;  3ZSW A;  4FJ7 A;  3IMX A;  2QXL A;  2GUP A;  2O8C A;  3BF1 A;  1K9M O;  4BC4 A;  1GLL O;  2OZS A;  1RBV A;  3M1F A;  3DRP A;  3DJC A;  1IG8 A;  1VSL A;  3OTO K;  2FC0 A;  1WNS A;  4DFJ A;  1G99 A;  4CEC A;  5DM7 L;  1E4F T;  5T7B A;  1UA0 A;  3LP1 A;  4JYA K;  1YAG A;  4HUF A;  1QTM A;  3G71 N;  4O44 A;  1VSK A;  1KQS M;  2I5J A;  3QEP A;  2YX6 A;  5GIO A;  2BUP A;  3UKR A;  3MCP A;  2DPN A;  4OJR A;  3V9W A;  4FJX A;  4FO0 A;  1Q9Y A;  3KLI A;  3E66 A;  2P5G A;  1K8A O;  3OYM A;  3W3D A;  1ZBU A;  3U6F A;  4EZ6 A;  2A42 A;  4DFM A;  3FZM A;  4CIE A;  4FLY A;  1HNZ K;  4ILG B;  3H6E A;  1HNI A;  4WQ5 A;  3VEV A;  1IV0 A;  4CGG A;  3LM2 A;  4X66 K;  2FF6 A;  1KVC A;  2PFU A;  1LAV A;  1WN7 A;  3M8P A;  4FWL A;  2A3Z A;  2NRR A;  2XHB A;  3P5J A;  4DKW A;  4CHP A;  3I8B A;  1VRT A;  1YJ9 N;  2E2P A;  3D0P A;  1YJN N;  3SNN A;  2Q0R A;  3MXM A;  1S1U A;  1NGJ A;  3AVM A;  4H5W A;  3ZLJ A;  3H45 C;  3FLC O;  3ULE A;  4NB4 A;  3O9Q A;  4IJN A;  3OS0 A;  1JXB A;  1SKR A;  1T6C A;  4YNQ A;  4B9U A;  5AQW A;  2XY7 A;  1YIJ N;  2A40 A;  4KHU A;  3LAL A;  4YDU C;  1J5E K;  4BRA A;  2HST A;  1GLF O;  5GAG P;  1NOY A;  4Y0W A;  3OA9 A;  4CIF A;  2P9L B;  1JL2 A;  4DTM A;  1SKS A;  3U9D A;  3RR7 A;  1GOB A;  3VQ9 A;  4E0D A;  1D9D A;  3VQQ A;  4HCB A;  3J80 O;  4JAX A;  4FJL A;  3KLG A;  4PKH A;  3FZF A;  4W5R A;  1XMQ K;  2E2Q A;  3QEX A;  1NGF A;  3VQ6 A;  1BIU A;  4E7L A;  2DFE A;  1NWK A;  1N36 K;  4PQU A;  4B3S K;  2YKM A;  3MX2 A;  1NG9 A;  4PHT X;  3MED A;  3VTI A;  2WTU A;  2BTF A;  4CD3 A;  3AVC A;  4FOI A;  1MU2 A;  2UUA K;  3AY9 A;  4GV6 A;  3DLE A;  4JI1 K;  3S3N A;  4Z4C A;  4E7H A;  5JMV A;  1J54 A;  1BL3 A;  2NUB A;  3H3N O;  3ZSQ A;  4FJH A;  4FLT A;  1KLN A;  3SAH A;  2QKB A;  4H5T A;  3MXI A;  3PY8 A;  3SV4 A;  4FJ5 A;  4KB0 A;  4LF6 K;  4DQI A;  4DV0 K;  3C7N B;  1TAU A;  5HBM A;  1Q82 O;  1JCE A;  3J7Z O;  4G9Z A;  4ZTF A;  3T1A A;  3H3O B;  1C0F A;  4JKA A;  1TGO A;  3V1R A;  4J2E A;  3E01 A;  3I55 N;  2D1K A;  3V9Z A;  1RDW X;  4NYN A;  2VQE K;  4DQ8 A;  1JCF A;  2NRZ A;  3VER A;  2CH6 A;  5BR9 A;  1EX4 A;  1VQ4 N;  2HMI A;  2RF2 A;  5AQT A;  4CJF A;  2I7P A;  3CPE A;  4CJK A;  4I6M B;  4IFY A;  4CJ3 A;  3A5M C;  1DGK N;  3CMA N;  1NBW A;  4DSI A;  3AA2 A;  4J2A A;  1BGX T;  2YNF A;  4DR2 K;  1NGB A;  3SMP A;  4M42 A;  1SUQ A;  2JWL A;  4WQ5 C;  1WOQ A;  1DEJ A;  3MDQ A;  3TI0 A;  5EY4 A;  3CC7 N;  3OVN A;  4O5F A;  1BG3 A;  5CY4 A;  2HHQ A;  4GY2 B;  4JRP A;  3RSE A;  4BRK A;  4FYD A;  1HKC A;  3KWG A;  4IFV A;  3VET A;  1S1T A;  4FWP A;  4H0X B;  3FZH A;  4NXM K;  2F9W A;  3UIQ A;  1C0G A;  3LDS A;  5BR8 K;  3O9R A;  4WF9 L;  4CZJ A;  5DM6 L;  1S1V A;  5BRH A;  4FM2 A;  3NAE A;  3BP8 A;  3P39 A;  4BG9 A;  4CZF A;  3QML A;  4CZK A;  5AQU A;  3K57 A;  1ZBH A;  3BY5 A;  4KPY A;  4KHQ A;  1TKX A;  2Q31 A;  4K25 A;  5E26 A;  4CEA A;  3VF4 A;  1TUU A;  2QA4 N;  1JXE A;  4JKE A;  4WFA L;  4J2D A;  4W5O A;  1ASU A;  2FSN A;  4KTW A;  1WSF A;  3G4S N;  3HPG A;  4FZZ A;  2E6M A;  2YHB A;  1U47 A;  4LSL A;  4LF9 K;  5AQF A;  1HRH A;  2E2O A;  3C6A A;  1U48 A;  2ASO A;  5K14 A;  3TAQ A;  4V19 S;  2E88 A;  3UB5 A;  4DV2 K;  3O4Q A;  3LWM A;  2E1Z A;  4MLE A;  1TKD A;  4N41 A;  1VAZ A;  1YHQ N;  3T3F A;  5JLH A;  4C8M A;  2Z1H A;  3OS1 A;  1W9H A;  4Q5V A;  4E7K A;  3QB0 A;  4O55 A;  5JS1 A;  3OY9 A;  5AQG A;  1XI1 A;  2E6L A;  1LW2 A;  5ADX A;  1VSF A;  3PX6 A;  3BDP A;  1WSJ A;  5BN9 A;  3DRR A;  2XY6 A;  1JL1 A;  1BIS A;  4JI0 K;  5B8H A;  3B6P A;  4DV7 K;  5EXW A;  3M6G A;  3FFI A;  4FJG A;  4ZHR A;  4EZ9 A;  1WB9 A;  3CM6 A;  3NHG A;  1NMD A;  3V9X A;  2ZWH A;  1WAJ A;  2NLX A;  1TAQ A;  1L3T A;  4OO1 J;  5M1O A;  2ASM A;  1K8K B;  4CEE A;  3OS2 A;  4FJK A;  3VQ8 A;  4B9V A;  4H5R A;  2X6N A;  2HOE A;  4B8A B;  4Q0B A;  4UY8 O;  4DLG A;  3ULD A;  5J1E A;  2GV9 A;  4PA1 A;  2LSN A;  4IDK A;  4FW2 A;  1K6Y A;  3D2E B;  3ENB A;  3I0R A;  4H0T B;  3NVK A;  1EO1 A;  3FFK B;  1S5J A;  4BDY A;  2UXB K;  3VQ7 A;  1RT4 A;  2KFN A;  4JI8 K;  3MAQ A;  4CF8 A;  3V1O A;  3OYL A;  1HNV A;  4PUO A;  4CJR A;  3EYZ A;  3EZW A;  3T69 A;  4M3Y A;  3DXK B;  3CQX A;  1NGH A;  4OPA A;  1HJR A;  1VQL N;  4EHU A;  4KHY A;  1VSJ A;  4NLB A;  3AVG A;  2Q36 A;  4CGI A;  4FWM A;  2E5L K;  4I9L A;  2Q97 A;  3Q7B A;  1RTD A;  4DTR A;  5FPN A;  3HTV A;  4G1Q A;  2JWK A;  3V81 A;  5JIC A;  5AR0 A;  4IZ9 A;  1XC9 A;  4F4K A;  4E1N A;  3J8A A;  3LP3 A;  2FBY A;  4MO4 A;  3QNO A;  3JS6 A;  3IUC A;  4MFB A;  5BRF A;  4X65 K;  2FBX A;  3WEE B;  3AGK A;  1L3S A;  1EWQ A;  3OBW A;  2Q2R A;  4F8R A;  1TYQ B;  2CH5 A;  4AHR A;  5LJV A;  4DU4 A;  3QNN A;  4NXN K;  4PKI A;  4JNE A;  2D0O A;  4CJL A;  5AZJ B;  4B1V A;  4JI7 K;  4KB1 A;  2NNW A;  4H5V A;  4AHC A;  3RRH A;  4BG8 A;  2P9P B;  4FLV A;  3MN7 A;  3CCJ N;  4H8K A;  3AO2 A;  3HI0 A;  3PSF A;  5LJW A;  1CLQ A;  3NGY A;  3EKS A;  1UA1 A;  1LCU A;  2OA8 A;  3NCI A;  3LP2 A;  5J2P A;  4M3X A;  1DT9 A;  1DTQ A;  2P9I B;  3LDP A;  1D4X A;  3R6M A;  3VF2 A;  3CER A;  1HKB A;  3G25 A;  4L8R B;  1Q18 A;  3FE1 A;  5CHI A;  4CZH A;  1BCO A;  4ICL A;  2ETJ A;  4U67 L;  3H1V X;  1CZ9 A;  1JLB A;  4M7Y A;  1WBB A;  1KVB A;  2F8S A;  2Q3S A;  3TSP A;  1L3V A;  3LAM A;  3ASM A;  2YHW A;  5BPN A;  4C1N K;  5AZI B;  4C8K A;  3HZ6 A;  4CHO A;  4HHT A;  1XMO K;  3NBP A;  3KK2 A;  2HF3 A;  3IDH A;  5F2R A;  2VGM A;  3L2Q A;  3LWL A;  2WOM A;  3H08 A;  4K42 A;  1NU0 A;  3IAY A;  5AQI A;  3OW2 M;  2W6K A;  3OYI A;  1DLO A;  3GL1 A;  1Z26 A;  4O0J A;  3M8S A;  4O8U A;  3VQ5 A;  2HHH K;  3OYC A;  3KLE A;  3I56 N;  5AQS A;  2O4I A;  3NVM A;  3SJH A;  3TTD A;  2B4J A;  1QZ6 A;  3WXK A;  2F4V K;  2P51 A;  3ZET B;  3LAK A;  4KRF A;  1I39 A;  2A1R A;  2QM1 A;  2HNZ A;  2HHW A;  1SQK A;  4BR7 A;  4N56 A;  2G8K A;  1V4T A;  4LH5 A;  4N47 A;  4FCY A;  1QZ5 A;  2XO7 A;  4MDA A;  1KLM A;  4CEB A;  3CJC A;  3O3F A;  4DV1 K;  4Z4G A;  4HCC A;  3E9P A;  4DR5 K;  4AHS A;  4OKK A;  3A5N C;  1IKV A;  1P90 A;  5AQQ A;  3V9U A;  4YDU A;  3RMA A;  4DTJ A;  3JSM A;  2VG6 A;  2G8H A;  2KTQ A;  3MWP A;  1JLC A;  3HBT A;  2OPQ A;  3CD6 N;  4DR1 K;  2Y1J A;  3KJV A;  1RGI A;  4MDB A;  1ZBL A;  2EX3 A;  4IEI A;  1TKT A;  4NCG A;  4M3U A;  4QS7 A;  2GWK A;  3GOI A;  3R9P A;  1NMN A;  1X9S A;  2OZM A;  5AQL A;  1VQO N;  3SAF A;  1UAX A;  3KD1 E;  4KHS A;  3O1B A;  4RW4 A;  4DR7 K;  2HVH A;  4I9Q A;  3TAM A;  1GLE G;  3AVI A;  1YI2 N;  3CQY A;  2UXD K;  4CFB A;  4ID5 A;  1XNQ K;  1ASW A;  2UYT A;  5C25 A;  4DSL A;  4KBO A;  3VPZ A;  4H03 B;  1C1A A;  4Y1D A;  3HOT A;  4FJ8 A;  4A61 A;  4JD2 B;  3I8D A;  1U49 A;  4BRO A;  2YJE A;  4CF0 A;  5HLF A;  2ZGY A;  2YNI A;  4DSF A;  5JS2 A;  2NRH A;  4K8X A;  1JJ2 M;  4BC2 A;  4LFB K;  2HHV A;  4QCL A;  2QWQ A;  4HWI A;  4GV3 A;  3LL3 A;  2O8D B;  2O4G A;  3AV9 A;  1FKO A;  4F3O A;  3E1Y A;  2D0P A;  5GAH P;  3LDO A;  4DFP A;  2GBZ A;  2PAV A;  4GVM A;  4WFN L;  4CZI A;  3VEZ A;  3DWL A;  4MO5 A;  2O8E B;  3CM5 A;  3PV8 A;  1OVQ A;  4OLA A;  1N6Q A;  3QBW A;  1VK0 A;  4XH5 A;  4ELT A;  4E1M A;  1ZYQ A;  4CFD A;  2ZJR L;  1EXQ A;  1T7P A;  1S9G A;  4KAZ A;  4M63 C;  1QQN A;  1Q9X A;  3NF8 A;  2KZM A;  4C23 A;  2QWO A;  4BRF A;  4FK0 A;  1NNE A;  3D2F A;  1ATN A;  3O3G A;  2P9N B;  3VA3 A;  4LF5 K;  4I2Q A;  3ISN C;  1O13 A;  2HHX A;  3QEW A;  4CVN E;  3TSQ A;  4RW6 A;  3SQ4 A;  3O4N A;  1LWF A;  1ATR A;  2QXF A;  5HOO A;  3O9S A;  3ZT4 A;  3HRG A;  4JV5 K;  3UKU B;  4YY3 K;  3KKS A;  1QSS A;  1RDA A;  1GLD G;  3KKR A;  3M8R A;  3ZEU B;  3CET A;  3OHR A;  4CJE A;  4BRM A;  3CG7 A;  4CGJ A;  2ITG A;  1A5X A;  2AP1 A;  1WLJ A;  3L4I A;  3THV A;  2OPS A;  3ALY A;  4M7X A;  2B5J A;  2G8V A;  2E4L A;  2P9S B;  3F9M A;  1ASV A;  3FGU A;  4A59 A;  4N76 A;  3NH1 A;  5HP1 A;  3ITH A;  3U4L A;  3PIO L;  5CYM A;  5LMU K;  3VEX A;  3F73 A;  3TAN A;  1KVA A;  1T3V A;  4OVL A;  4DTU A;  4LF4 K;  1ILY A;  1B9D A;  1SKW A;  1TL3 A;  4KKO A;  4DHY A;  4H0Y B;  1B9F A;  5BPL A;  4O0I A;  4JKD A;  4DQR A;  2P9U B;  4DTO A;  3THY A;  4BQL A;  5F1X A;  1D5A A;  3QO9 A;  4JN4 A;  3T1Y K;  1QHA A;  3LP0 A;  1Z25 A;  4W5N A;  4O5B A;  2HHS A;  1ZXO A;  4IFE A;  4BE0 A;  1NK0 A;  2G8U A;  3DI6 A;  3C6T A;  1VQP N;  1QS4 A;  1OH7 A;  4Z4H A;  3H1Q A;  3AVN A;  5GIN A;  1LAW A;  5ADX H;  4PWD A;  3E9O A;  1CXQ A;  2PYL A;  1REV A;  3QFU A;  4LD0 A;  3CCR N;  3SUQ A;  4QS8 A;  4EFH A;  3AVL A;  3BUZ B;  3QIC A;  3ZSX A;  4DTP A;  3JAM O;  3RMD A;  1VSI A;  4CJU A;  2QKK A;  4CHN A;  4JKC A;  4FLX A;  1U6Z A;  4KHP K;  1RT7 A;  4ISF A;  4K41 A;  2A5X A;  3P83 D;  2QW9 A;  3GE1 A;  3THW B;  1QVF M;  4BDZ A;  3PX4 A;  2QWP A;  1GLA G;  2YKN A;  2ATQ A;  2YV0 X;  4BWJ A;  3ENH A;  4LSN A;  1YVN A;  3T7Z A;  1NGA A;  2VYP A;  3IRX A;  3HM8 A;  4DUZ K;  4OGE A;  4FM1 A;  1S9E A;  4E89 A;  4GMJ B;  5TKY A;  3BEX A;  5AFU A;  2UU9 K;  3O1W A;  2YI1 A;  2P9L A;  4BRL A;  2HNY A;  5FPE A;  1M1K O;  1SV5 A;  3G6E N;  1X9M A;  2RKI A;  3CQ8 A;  5CR4 A;  3CHW A;  1BQM A;  1TL1 A;  4E7J A;  4LF8 K;  1EKE A;  4H5N A;  3NH2 A;  3MMV A;  1B92 A;  4CJ7 A;  3KHY A;  4J8F A;  3OYF A;  3PSI A;  3AO1 A;  5C2F A;  3SUP A;  2ITM A;  2NRT A;  4E3S A;  4BRG A;  1IBK K;  4BQZ A;  3J7Y P;  2AA4 A;  3ZX3 A;  4E19 A;  1WAF A;  4WQ4 A;  2GEM A;  2EWS A;  3S3O A;  4JKG B;  4ELU A;  1S3X A;  4FM0 A;  1WSI A;  1YXQ A;  2OAN A;  2BE2 A;  3TWH A;  3K9J A;  3CCL N;  5FLX O;  3QBX A;  3QIO A;  3V4I A;  3ZSR A;  2RPI A;  3HO1 A;  3TR8 A;  3CJB A;  4GW6 A;  3DMJ A;  5HRP A;  3VEW A;  4XEI A;  3PX0 A;  4RCH A;  3EZ5 A;  5FPD A;  1VQ9 N;  5C24 A;  4B9L A;  2NRW A;  5BN8 A;  4MLH A;  4BWM A;  4KFB A;  2QK9 A;  1YTU A;  1U4B A;  4LH4 A;  4JK9 A;  2HVI A;  3CYM A;  3VQE A;  3C7N A;  1N8R O;  2HND A;  3SK3 A;  1NKE A;  1W2B M;  1CXU A;  1VSM A;  5CZ1 A;  2AJQ A;  5CE3 A;  1JKH A;  4DR6 K;  3HP6 A;  3HL8 A;  1M90 O;  4I2P A;  1BCM A;  3N4P A;  4DLE A;  4B9Q A;  3F9K A;  4PY5 A;  3CIP A;  4FOE A;  1RT2 A;  4I6M A;  3TTC A;  3TAF A;  2PYJ A;  4YOV A;  3O4W A;  4HTU A;  1SL2 A;  3K2P A;  3AVJ A;  2DY4 A;  3W0L A;  3CI5 A;  2P9K B;  4BRH A;  3IKM A;  4IJA A;  4W5T A;  1VSD A;  3MN5 A;  4BR5 A;  2JLE A;  3D6R A;  2KZZ A;  4FSV A;  1FKP A;  3CFO A;  1CZA N;  3CFR A;  1VRU A;  4DSK A;  2FSJ A;  4B1X B;  3B8A X;  4B1U B;  2Z1G A;  4HUE A;  4CF9 A;  4J2B A;  4B1Z A;  5M1Q A;  1C1B A;  3GDQ A;  1GLJ O;  3F2K A;  4DB3 A;  2HW3 A;  4CGH A;  4BR9 A;  2QTD A;  3UE5 A;  3QEI A;  1W7A A;  3NFA A;  1VHX A;  4IG3 A;  1FK9 A;  4EP5 A;  4C1N I;  4F9O A;  3F5T A;  4Z4F A;  3NF7 A;  2Z1J A;  4JK7 A;  3ZX2 A;  4CHZ A;  1HYZ A;  4CJT A;  4DV4 K;  2YJF A;  5SWM A;  3OYE A;  5E84 A;  3SJJ A;  3ENO A;  4ELV A;  4Y1C A;  1LWC A;  2WFB A;  3E9L A;  3I0S A;  5AQV A;  3CCQ N;  3IFR A;  3WXL A;  3OYK A;  3L8B A;  1IBL K;  2CGJ A;  4CI6 A;  4DUY K;  3NMU A;  1HNX K;  4AHU A;  3VOV A;  1E4G T;  2NRV A;  1ZBI A;  3MWT A;  3P31 A;  1S1W A;  3O9T A;  1NLV A;  1J5O A;  4B3M K;  5JVG L;  2YCH A;  2CGK A;  1KFS A;  3CXC M;  4O8K A;  2HHT A;  5GAE P;  4M3W A;  3TTF A;  1RDB A;  2X6S A;  3OYA A;  2P1J A;  1BI4 B;  3ZSO A;  4DWI A;  4DTX A;  1KC8 O;  3ATV A;  2VG5 A;  4CJS A;  4WQ4 C;  2OTL N;  4IOX A;  2FF3 B;  4ISE A;  3A8Y A;  3O6W A;  5AJ3 K;  3HXM A;  4FXD A;  2A6A A;  1RBS A;  1HPZ A;  3O3H A;  3KLF A;  3S9H A;  4LFA K;  4KO0 A;  4WCE L;  5E41 A;  2GWJ A;  3P4I A;  1QVG M;  4IO9 L;  4BR2 A;  3J7A P;  1FXX A;  3VGL A;  4WFB L;  4BAC A;  3RMB A;  3GG4 A;  3C95 A;  5I3U A;  4ZTJ A;  1TK8 A;  2ZGZ A;  2YNG A;  3GBT A;  1K73 O;  1MWK A;  3DXM B;  3ZSV A;  3V1Q A;  3KTQ A;  4IDH A;  1WSG A;  2RN2 A;  4RTF D;  5BRE A;  4Z4E A;  3D2E A;  1U45 A;  1EQY A;  3QIN A;  1DKG D;  3CPW M;  3CFP A;  1BU6 O;  2FSK A;  1L5U A;  1BDG A;  3C94 A;  2UUC K;  1JLE A;  2HBK A;  1BHL A;  1QSL A;  4M3Z A;  2V7Y A;  3H46 O;  4DTS A;  2FBT A;  3ID6 A;  4CW7 B;  4CJW A;  3WUH A;  2V51 B;  5AQY A;  2WUS A;  1BO5 O;  3DXK A;  2IVP A;  5KRS A;  5AQK A;  2G8W A;  1HR0 K;  3AVB A;  1NJZ A;  1MDU B;  4AM7 A;  3A5O C;  5JVH L;  1JLG A;  3T1H K;  3JYT A;  1RCH A;  2HBM A;  2UUB K;  2D0B A;  4FL9 A;  4M45 A;  3DRS A;  3LAN A;  1LW0 A;  5AQJ A;  3AO5 A;  4DV3 K;  2ASP A;  5KPR A;  2OPR A;  3CCM N;  3SPZ A;  4CEQ A;  2IIR A;  3ATU A;  5HL7 L;  1NK4 A;  1EP4 A;  4C8N A;  5JLF A;  2VQF K;  4BRP A;  2JGU A;  1NKB A;  1NK8 A;  4K8Z A;  3VA0 A;  1RDU A;  2X74 A;  1J53 A;  2D5R A;  3TPQ A;  2D0A A;  4IOA L;  3WEE A;  3TAG A;  1ZC6 A;  2O8B B;  3THX A;  4PKG A;  4JHD B;  2W40 A;  3C6U A;  4FWS A;  4YOX A;  3OJU A;  3SQ2 A;  1TYQ A;  3K59 A;  1YUW A;  4R5P A;  3KD5 E;  1J9A A;  1EET A;  4H0P A;  5AZJ A;  5F0X A;  3VQP A;  1LV5 A;  5FRN A;  2O8F B;  1KAY A;  1N5Y A;  2P9P A;  3TAB A;  1U2V B;  2ZJQ L;  5C42 A;  1ATS A;  2X78 A;  2QWM A;  3QDK A;  1HQE A;  1ESV A;  2QWL A;  2I7N A;  2O8C B;  3AGR A;  2QWN A;  3VGM A;  1G15 A;  2HMP A;  3EE8 A;  4Z94 A;  3CCV N;  4IBN A;  3SUN A;  1D8Y A;  3S41 A;  1HNW K;  3CCU N;  3T19 A;  2P9I A;  3D45 A;  2QWR A;  4CHY A;  5KTQ A;  3MCA B;  2FLO A;  5C2D A;  2ZJP L;  5LMN K;  3TAP A;  3L2R A;  1KRP A;  1T44 A;  1Q7Y O;  3MN6 A;  4IOC L;  5FPM A;  3CJ9 A;  1C6V A;  1RDD A;  2VG7 A;  4A57 A;  2HBJ A;  3QIP A;  3K5N A;  4GNI A;  4YFU A;  4B9S A;  1C0U A;  3AO3 A;  3CJA A;  2BGG A;  3UKR B;  4EHT A;  4B08 A;  5AZI A;  3L3U A;  1IH7 A;  1YT3 A;  4HUG A;  3TAE A;  3AVK A;  4BDP A;  1S1X A;  3R1X A;  4JRQ A;  1I3A A;  3HM9 A;  1IKX A;  2Q0U A;  3DLK A;  5C15 A;  3SAG A;  1SZ2 A;  1VQN N;  2QI2 A;  3VF6 A;  5M1F A;  4LFC K;  1ZBF A;  3C0B A;  5IT9 O;  4CZL A;  4JI4 K;  3SUO A;  4H0V B;  3O5B A;  4BR0 A;  4FVM A;  1O1W A;  4FWN A;  4BE2 A;  1Q86 O;  5CZ2 A;  4GV9 A;  2E1Y A;  3DM2 A;  1IO2 A;  3NDK A;  4OX9 K;  4DQQ A;  4CF2 A;  4CES A;  3ZET A;  3O80 A;  3EL2 A;  4AF1 A;  3ULE B;  3RRG A;  4IEE A;  4QOZ B;  1QQM A;  4CJQ A;  4DSE A;  4KV8 A;  3DYA A;  3HVR A;  2YNH A;  3OYD A;  3LM9 A;  3L2V A;  1RT6 A;  3QET A;  3O08 A;  2BH1 A;  1NK7 A;  4OPJ A;  5KGX A;  1WBD A;  4K43 A;  1LOT B;  2E2N A;  3MEC A;  1KD1 O;  2KKZ A;  1NGG A;  1BWF O;  3L4Q A;  2YHX A;  4FLZ A;  3MEG A;  3CJ1 A;  4BGB A;  3L0Q A;  3QEV A;  1IKW A;  2VWB A;  5AFU H;  1QQO A;  4JKH A;  4M3T A;  2XY8 A;  1BOT O;  1KXP A;  4ILJ A;  4CBX A;  1ITG A;  3THY B;  3TAR A;  1FW6 A;  3EKU A;  3LDN A;  1HYV A;  2R7Y A;  3EEQ A;  4DV6 K;  3CCS N;  4NLC A;  4CJV A;  1BIZ A;  4DQP A;  1R59 O;  3ID8 A;  1S72 N;  1IKY A;  1HPM A;  4XH4 A;  1QSY A;  3ZSY A;  5AQX A;  3G10 A;  1Z6R A;  3A5L C;  3S3M A;  3Q7C A;  2PY5 A;  4B9N A;  3SQ0 A;  3VMF B;  1OVY A;  4A5B A;  1YTA A;  2XRI A;  3MEE A;  4FPA A;  5LL6 Z;  4B3R K;  4JD2 A;  3HPO A;  3SLC A;  4KH4 A;  1OH8 A;  3QFP A;  2VWK A;  1CZB A;  2VWJ A;  2PZS A;  3B6O A;  4CFA A;  2WBN A;  1QHT A;  1XHX A;  4AM6 A;  4BRC A;  1RT1 A;  1P8Z A;  2HB5 A;  4EP4 A;  1VQ7 N;  1XWL A;  4DCH A;  3AVA A;  3ZYY X;  2O8D A;  3VQB A;  2IS3 A;  2F7T A;  2Y1I A;  1FJG K;  1ZBS A;  3CC2 N;  1RDC A;  3SV3 A;  1JCG A;  3MN9 A;  4K0K K;  4E1J A;  5EU7 A;  1WSH A;  2O8E A;  4E7I A;  2PBD A;  4CD1 A;  1N33 K;  3BGR A;  3PIP L;  3OYN A;  3C6H A;  4QAG A;  3DOK A;  4H0O A;  1NJX A;  1C1C A;  4I7F A;  4TSX A;  5HRO A;  5IWA K;  1RBT A;  2KQ2 A;  3AAP A;  1N34 K;  2P9N A;  4FZY A;  3JXU A;  4EIA A;  3RSE B;  4BVP A;  4N5S A;  3RMC A;  1A5V A;  3LPU A;  3OYH A;  4NCB A;  2OTJ N;  4FJN A;  4CGF A;  2OYQ A;  3NF9 A;  1Q81 O;  4X64 K;  2WON A;  3WXM B;  3UKU A;  5BPM A;  5CYQ A;  4NO7 A;  4FWO A;  1RTH A;  4CK2 A;  5FRM A;  3I33 A;  4FJM A;  3ZEU A;  4H4O A;  2DFH A;  4A5A A;  5AQZ A;  4XIU A;  1W97 L;  1TV6 A;  3HVT A;  1WSE A;  4JS4 A;  5KI6 A;  2A41 A;  3ZSZ A;  5TKW A;  4BRD A;  1XQS C;  5KGW A;  4OPK A;  1NM1 A;  2P9S A;  4NYF A;  1TK0 A;  3SMS A;  1RIL A;  4L3Q A;  1R0A A;  1I94 K;  4CCH A;  2D4W A;  2NZT A;  4CEF A;  1GOC A;  1NGE A;  1F21 A;  3NGI A;  1XUP O;  4DS4 A;  4JI3 K;  4BVO A;  2Z1I A;  4FPB A;  5EOY A;  3WT0 A;  3EO3 A;  4NCA A;  1GLC G;  4JI2 K;  3AAQ A;  3LZI A;  2D0C A;  3L3V A;  2P9U A;  1GOA A;  1NK9 A;  1L3U A;  3ZT2 A;  2EHG A;  5HRS A;  3OYJ A;  5HRR A;  4OLB A;  3BF3 A;  4KH6 A;  4DS5 A;  4U7B A;  4LF7 K;  5M1P A;  2HHU A;  5LY3 A;  3M5R A;  3A0I X;  3IG1 A;  2KFZ A;  1C0M A;  1YF5 L;  4RWT A;  2ZF5 O;  3DOL A;  1NK6 A;  4B1W B; 
#chains in the Genus database with same CATH homology
 1NGJ A;  4H5W A;  5M1K A;  3RVC A;  2RHK A;  3E9P A;  1KC8 O;  3ATV A;  3H45 C;  3FLC O;  4WQ4 C;  3A5N C;  3ULE A;  2OTL N;  4NB4 A;  3O9Q A;  5AQQ A;  1P90 A;  4YDU A;  4IJN A;  4IOX A;  2FF3 B;  4ISE A;  3A8Y A;  3O6W A;  1T6C A;  2A6A A;  4CBW A;  3R8E A;  1VQ6 N;  3KWI A;  3MWP A;  5AQW A;  4WCE L;  1YIJ N;  4YOT A;  3HBT A;  2GWJ A;  3P4I A;  1QVG M;  3CD6 N;  2A40 A;  5AQP A;  4IO9 L;  4YDU C;  2VCP A;  4BRA A;  4BR2 A;  2HST A;  1GLF O;  3VGL A;  5GAG P;  4Y0W A;  1RGI A;  3GG4 A;  4MDB A;  3OA9 A;  4WFB L;  2P9L B;  4IEI A;  3VGK A;  1YIT N;  4FWK A;  2FXU A;  2KHO A;  3O8M A;  2GWK A;  4QS7 A;  3U9D A;  3GOI A;  4IWV A;  3R9P A;  2ZGZ A;  1MWM A;  5AQL A;  3GBT A;  1K73 O;  1VQO N;  1MWK A;  3SAF A;  3DXM B;  3AAR A;  3O1B A;  4JAX A;  4KH5 A;  4IDH A;  1HLU A;  4IXC A;  4QS9 A;  1GLE G;  4RTF D;  4BGA A;  4PKH A;  3FZF A;  5BRE A;  1YI2 N;  3N4Q A;  3CQY A;  4R79 A;  1YJW N;  2E2Q A;  1X9J A;  3D2E A;  4JK8 A;  1EQY A;  3DLL L;  1DKG D;  3DAW A;  5I9E B;  2UYT A;  5KQD A;  1NGF A;  3CPW M;  4KBO A;  4FWR A;  1BU6 O;  5AQH A;  3VPZ A;  2FSK A;  4H03 B;  1BDG A;  3FR0 A;  1NWK A;  3HOT A;  4JEP A;  1RFQ A;  4A61 A;  4JD2 B;  3MX2 A;  2HBK A;  4BRO A;  4PHT X;  3VTI A;  2BTF A;  2YJE A;  4CD3 A;  5C0Y A;  4FOI A;  2ZGY A;  2V7Y A;  3AY9 A;  4GV6 A;  3H46 O;  3ID6 A;  3WUH A;  2NRH A;  2V51 B;  3VTH A;  5AQY A;  1JJ2 M;  2WUS A;  1BO5 O;  4BC2 A;  3DXK A;  2IVP A;  5JMV A;  5AQK A;  3H3N O;  2QWQ A;  1MDU B;  3SAH A;  4HWI A;  4GV3 A;  4H5T A;  3LL3 A;  4AM7 A;  3A5O C;  5JVH L;  1Z05 A;  1HUX A;  4JKG A;  4WYB A;  3E1Y A;  2D0P A;  4BRQ A;  2HBM A;  3LDO A;  5GAH P;  4FL9 A;  3D7E O;  2PAV A;  5GIP A;  5AQJ A;  4WFN L;  4CZI A;  3VEZ A;  3DWL A;  4MO5 A;  3C7N B;  2ASP A;  5KPR A;  3CCM N;  1GLB G;  4PL7 A;  1JCE A;  3J7Z O;  1Q82 O;  4G9Z A;  2IIR A;  3ATU A;  3QBW A;  5HL7 L;  4XH5 A;  4BY9 C;  5JLF A;  3H3O B;  4BRN A;  4BRP A;  1C0F A;  4A62 A;  4JKA A;  3P38 A;  5KPZ A;  2ZJR L;  3ZX0 A;  3O9U A;  1RDU A;  2D1K A;  2RE2 A;  4M63 C;  1RDW X;  1QQN A;  3I55 N;  3MK6 A;  3VEO A;  4DQ8 A;  1JCF A;  3TPQ A;  5KPT A;  2NRZ A;  3U9Z A;  3VER A;  3WEE A;  4IOA L;  1ZC6 A;  4C23 A;  2QEX N;  2QWO A;  4BRF A;  2V52 B;  2CH6 A;  5BR9 A;  4PKG A;  4JHD B;  5EX5 A;  1VQ4 N;  1KAZ A;  1ATN A;  2W40 A;  3D2F A;  4FWS A;  5AQT A;  5H1S Q;  4YOX A;  1TYQ A;  2I7P A;  3CPE A;  1YUW A;  2P9N B;  4I6M B;  3A5M C;  1DGK N;  3CMA N;  1VQK N;  1NBW A;  5KQ8 A;  1MA9 B;  5AZJ A;  4H0P A;  5F0X A;  5MLC Q;  1O13 A;  4HTL A;  1KAY A;  1NGB A;  2P9P A;  3SBG A;  3SMP A;  3TSQ A;  1U2V B;  2ZJQ L;  2JWL A;  1ATR A;  4WQ5 C;  1ATS A;  1DEJ A;  1WOQ A;  3MDQ A;  3PLA A;  5HOO A;  1NGC A;  3O9S A;  5EY4 A;  2QWM A;  3QDK A;  3HRG A;  4O5F A;  1BG3 A;  3CC7 N;  3UKU B;  1ESV A;  3CC4 N;  2QWL A;  2I7N A;  4GY2 B;  3AGR A;  2QWN A;  1GLD G;  3RSE A;  3VEY A;  3VGM A;  4BRI A;  4BRK A;  1HKC A;  3HOS A;  3KWG A;  2HMP A;  3EE8 A;  3TU5 A;  4Z94 A;  3VET A;  3CCV N;  3S41 A;  4H0X B;  4FWP A;  3CET A;  3FZH A;  3ZEU B;  2F9W A;  3CCU N;  2P9I A;  1X3M A;  2P9K A;  1C0G A;  3WXI A;  3OHR A;  4CZE A;  3O9R A;  4BRM A;  1HJO A;  4WF9 L;  4CZJ A;  2QWR A;  2AP1 A;  5DM6 L;  5C12 A;  3L4I A;  5BRH A;  3MCA B;  2FLO A;  5C2D A;  2ZJP L;  1IJJ A;  1T44 A;  3BP8 A;  4M7X A;  1Q7Y O;  3MN6 A;  3P39 A;  4IOC L;  2IVN A;  4BG9 A;  5FPM A;  3CJ9 A;  4CZF A;  2P9S B;  4A57 A;  2HBJ A;  3QML A;  3F9M A;  4CZK A;  1TUY A;  3FGU A;  4GNI A;  4OPH A;  5EVZ A;  5AQU A;  2E8A A;  4A59 A;  2Q31 A;  3CJA A;  4K25 A;  5E26 A;  4BC3 A;  3U4L A;  1TUU A;  3UKR B;  3VF4 A;  4EHT A;  3PIO L;  2IVO A;  2QA4 N;  3VEX A;  2GTD A;  1T6D A;  5AZI A;  4JKE A;  1T3V A;  1K8K A;  3FZK A;  4JKF A;  1ILY A;  4WFA L;  2H3G X;  2FSN A;  4DHY A;  4YOR A;  3G4S N;  4H0Y B;  5BPL A;  4JKD A;  1SAZ A;  1NJI O;  2KLA A;  2P9U B;  3R1X A;  1KAX A;  5AQF A;  3C6A A;  2E2O A;  3HSC A;  4BQL A;  2Q0U A;  5F1X A;  4JN4 A;  5C15 A;  1VQ8 N;  1QHA A;  2ASO A;  3SAG A;  1SZ2 A;  1VQN N;  2QI2 A;  2E88 A;  1ZXO A;  3CJ7 A;  4FWQ A;  3UB5 A;  3VF6 A;  5M1F A;  3LDQ A;  4IFE A;  1V4S A;  2E1Z A;  1VQP N;  4MLE A;  3C0B A;  4CZL A;  3LDL A;  3H1Q A;  1VAZ A;  4A2A A;  1YHQ N;  5JLH A;  4H0V B;  5GIN A;  5ADX H;  5ELZ A;  3E9O A;  3O5B A;  4BR0 A;  4CZM A;  2WC9 A;  3QB0 A;  3QFU A;  4XH1 A;  1J6Z A;  4FWN A;  4YOW A;  3VEN A;  1Q86 O;  5AQG A;  2E1Y A;  3WQT A;  3CF5 L;  3CCR N;  4GV9 A;  5ADX A;  4QS8 A;  4EFH A;  1NGD A;  5BN9 A;  3O80 A;  3ZET A;  3EL2 A;  4AF1 A;  3ULE B;  3BUZ B;  3QIC A;  4IEE A;  3KZB A;  2CGL A;  1VQ5 N;  5B8H A;  1QQM A;  3R3L A;  4JKC A;  1U6Z A;  4EAH D;  3LM9 A;  4ISF A;  4K41 A;  5EXW A;  3M6G A;  2A5X A;  4JKB A;  3O08 A;  2BH1 A;  2QW9 A;  4K43 A;  1LOT B;  1BA0 A;  2E2N A;  3GE1 A;  1KD1 O;  1QVF M;  2KKZ A;  1NMD A;  1NGG A;  2V7Z A;  1BWF O;  3WXJ A;  2ZWH A;  3L6Q A;  2HF4 A;  2QWP A;  3L4Q A;  3VES A;  2NLX A;  4ISG A;  1GLA G;  4OO1 J;  2YHX A;  3CJ1 A;  5M1O A;  4BGB A;  2ASM A;  1K8K B;  3L0Q A;  4H5R A;  3ENH A;  2VWB A;  5AFU H;  1QQO A;  3KK7 A;  2HOE A;  1YVN A;  4JKH A;  3T7Z A;  1NGA A;  4CBU A;  2VYP A;  4UY8 O;  1WUA A;  3FZL A;  2W41 A;  1BOT O;  1KXP A;  4ILJ A;  3HM8 A;  4CBX A;  5TKY A;  5AFU A;  3BEX A;  3ENB A;  3D2E B;  4H0T B;  2HBL A;  3O1W A;  2YI1 A;  3NVK A;  2P9L A;  4BRL A;  1EO1 A;  5FPE A;  1XC3 A;  1M1K O;  3G6E N;  3FFK B;  1SS6 A;  3EKU A;  1VQM N;  3LDN A;  4GVE A;  4IO8 A;  4BC5 A;  5CR4 A;  1BUP A;  3DXM A;  3CHW A;  3U8X A;  3CCS N;  4NLC A;  1R59 O;  4H5N A;  3ID8 A;  3MMV A;  1S72 N;  1HPM A;  4XH4 A;  5AQM A;  4CJ7 A;  3KHY A;  1NGI A;  4J8F A;  3M3Z A;  4LC9 B;  3EE9 A;  5AQX A;  1Z6R A;  3A5L C;  5C2F A;  3Q7C A;  3SBT A;  3EZW A;  3T69 A;  1Y64 A;  2ITM A;  1OVY A;  3DXK B;  3CQX A;  1NGH A;  3VMF B;  4OPA A;  4A5B A;  2NRT A;  4BRE A;  4FPA A;  4CZG A;  1VQL N;  4EHU A;  4BRG A;  2NRX A;  4JD2 A;  4NLB A;  4BQZ A;  3SLC A;  2AA4 A;  2VGN A;  3ZX3 A;  4KH4 A;  3QFP A;  4WQ4 A;  2GEM A;  1H1V A;  2EWS A;  2Q36 A;  4YOY A;  5AQR A;  4FWM A;  4JKG B;  4ILH A;  1S3X A;  2Q97 A;  1YXQ A;  2Q1N A;  3Q7B A;  2OAN A;  5C10 A;  2WBN A;  3K9J A;  3CCL N;  4AM6 A;  3QBX A;  4BRC A;  1P8Z A;  5FPN A;  1HX1 A;  3HTV A;  4A2B A;  2JWK A;  2J4R A;  3CJB A;  5JIC A;  5AR0 A;  4IZ9 A;  3VEW A;  1VQ7 N;  4XEI A;  3MX5 A;  4RCH A;  4DCH A;  3J8A A;  5FPD A;  1VQ9 N;  3ZYY X;  3CCE N;  4MO4 A;  2NRW A;  5BN8 A;  2F7T A;  3JS6 A;  4MLH A;  1OKJ A;  1ZBS A;  5AQO A;  3IUC A;  5AQN A;  5BRF A;  3CC2 N;  4JK9 A;  1JCG A;  3WEE B;  3AGK A;  1X3N A;  3MN9 A;  3OBW A;  2Q2R A;  4BR4 A;  4E1J A;  4PL8 A;  3D2F B;  3C7N A;  1N8R O;  1TYQ B;  2CH5 A;  2PBD A;  4CD1 A;  5LJV A;  3OBY A;  1HKG A;  2YHY A;  4JNE A;  4PKI A;  2D0O A;  3KVG A;  5AZJ B;  4B1V A;  3PIP L;  3C6H A;  3K9K A;  3SK3 A;  1W2B M;  2NNW A;  4H5V A;  3WQU A;  2GEL A;  4BG8 A;  2P9P B;  4H0O A;  5CE3 A;  4FVU A;  3TSU A;  3MN7 A;  3CCJ N;  1M90 O;  3N4P A;  3CME N;  4JHD A;  3HI0 A;  5LJW A;  4B9Q A;  4YOU A;  3CIP A;  3AAP A;  3C65 A;  4FOE A;  1S22 A;  2P9N A;  4I6M A;  3TTC A;  3EN9 A;  5BRD A;  3EKS A;  1BA1 A;  3JXU A;  5GAD P;  3O4W A;  1LCU A;  3RSE B;  4BVP A;  4EIA A;  4YOV A;  4B1Y B;  2OTJ N;  2F9T A;  3W0L A;  1DT9 A;  2P9I B;  3CI5 A;  1D4X A;  2P9K B;  2E20 A;  3IKM A;  3LDP A;  1U2V A;  4IJA A;  2GX9 A;  4BRH A;  3MN5 A;  4BR5 A;  3D6R A;  5M1N A;  1Q81 O;  4FSV A;  3R6M A;  3VF2 A;  3CER A;  1HKB A;  3G25 A;  3WXM B;  3UKU A;  1Q18 A;  5BPM A;  3FE1 A;  5CHI A;  3IMX A;  1CZA N;  4NO7 A;  2QXL A;  2GUP A;  4CZH A;  4U67 L;  3H1V X;  3BF1 A;  1K9M O;  4FWO A;  2FSJ A;  4B1X B;  4BC4 A;  1GLL O;  4M7Y A;  3B8A X;  3I33 A;  3M1F A;  4B1U B;  3ZEU A;  3DJC A;  3TSP A;  5M1Q A;  4B1Z A;  1IG8 A;  4A5A A;  5AQZ A;  3GDQ A;  1GLJ O;  3F2K A;  4DB3 A;  2YHW A;  5BPN A;  1W97 L;  4BR9 A;  1G99 A;  5DM7 L;  4C1N K;  1E4F T;  2QTD A;  5AZI B;  3UE5 A;  2A41 A;  3HZ6 A;  1YAG A;  5TKW A;  4BRD A;  1XQS C;  3G71 N;  4C1N I;  4F9O A;  1NM1 A;  2HF3 A;  2P9S A;  3F5T A;  3IDH A;  5F2R A;  2VGM A;  3SMS A;  1KQS M;  4L3Q A;  2D4W A;  4JK7 A;  2YX6 A;  3ZX2 A;  5GIO A;  2BUP A;  2NZT A;  3UKR A;  4K42 A;  3MCP A;  2YJF A;  2DPN A;  1NGE A;  5AQI A;  5E84 A;  1XUP O;  4FO0 A;  3OW2 M;  3E66 A;  3ENO A;  3GL1 A;  1K8A O;  4BVO A;  2WFB A;  3E9L A;  5AQV A;  3W3D A;  3CCQ N;  4FPB A;  2A42 A;  5EOY A;  3EO3 A;  3WT0 A;  3IFR A;  4O8U A;  3FZM A;  3WXL A;  1GLC G;  4ILG B;  3H6E A;  3AAQ A;  5AQS A;  3I56 N;  2CGJ A;  4CI6 A;  2P9U A;  4WQ5 A;  3VEV A;  3NMU A;  3NVM A;  3VOV A;  3LM2 A;  3SJH A;  1E4G T;  2NRV A;  2FF6 A;  2PFU A;  4FWL A;  3MWT A;  3TTD A;  2A3Z A;  1QZ6 A;  2NRR A;  3BF3 A;  3P31 A;  3WXK A;  4DKW A;  4KH6 A;  4U7B A;  3O9T A;  3ZET B;  1NLV A;  2QM1 A;  5JVG L;  2YCH A;  5M1P A;  1SQK A;  3I8B A;  4BR7 A;  5LY3 A;  1V4T A;  3M5R A;  3A0I X;  2CGK A;  1QZ5 A;  3CXC M;  1YF5 L;  2E2P A;  4O8K A;  1YJ9 N;  4MDA A;  2ZF5 O;  5GAE P;  4RWT A;  3TTF A;  2Q0R A;  3CJC A;  1YJN N;  4B1W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...