2JWKA

Solution structure of the periplasmic domain of tolr from haemophilus influenzae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein tolR
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
total genus 17
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwkA00
2JWLA 2PFUA 2JWKA
chains in the Genus database with same CATH superfamily
1GLAG 3CC2N 3TTCA 3TSPA 3ASMA 2P9SA 2O8CA 4BACA 2FBTA 3VEXA 4X62K 4JI8K 1VSMA 3O9QA 5C0YA 3VQ4A 3O08A 3JAMO 1BISA 3EN9A 3HSTB 4DSIA 1SZ2A 2P9NB 3ZSVA 2I5JA 1VSKA 4H5VA 1VSDA 4NXNK 4LH5A 5BN9A 5B8HA 4QS8A 5M1KA 2O4IA 4JKDA 1WSEA 3NF7A 1U45A 3LWLA 1BI4B 3KK7A 2NRXA 3O9TA 4YOVA 4OVLA 3HI0A 3OYEA 2GUPA 4C8KA 2Q1NA 3RWUA 1DKGD 1SL2A 2X6NA 4FVMA 1NGAA 3DLLL 3LZJA 1CZ9A 2BANA 1JLEA 2W40A 1RDUA 1KLNA 2YHYA 1NG9A 3IKMA 4IO9L 4Z4HA 1XMOK 4EHTA 3MXMA 3OJSA 4GMJB 4M3UA 4ELUA 2B4JA 2RHKA 2R7YA 5FRMA 5KGWA 4LFAK 5I42A 1BCOA 3F5TA 4J2DA 1IJJA 2D0AA 4YDUA 4JKFA 1CXQA 3EEQA 1WBBA 3JYTA 4JRPA 3AO1A 3C95A 3RMDA 1NMDA 3AVNA 1Q9YA 3V1RA 3VF6A 5AJ3K 3MXIA 4FJJA 3AO2A 3SZ2A 1JL2A 4CHNA 4H5NA 1X9JA 4RTFD 3J8AA 4IOXA 3H6EA 1W97L 1VSFA 3M1FA 1N6QA 4B9NA 4JKBA 2YHBA 3G4SN 2QKBA 4ZTJA 2VYPA 1NU0A 3OYLA 1UA1A 1CLQA 3HYFA 3VQ9A 4B3TK 4FWLA 3WQTA 2D1KA 2Z1IA 4WE1A 5AR0A 3JS6A 1VQNN 2RE2A 4IOCL 3VQ5A 2E2NA 4B3SK 1LW0A 3P39A 4M63C 4DTJA 4O44A 5BRFA 1KAYA 5C12A 2G8FA 4Z4CA 3HL8A 2NRTA 1KAXA 3QINA 4CFDA 3RR8A 3ZCMA 3MX5A 1VQ4N 4FPAA 2QWLA 1TAUA 3CIPA 4B08A 4DSFA 1X3NA 1VAZA 3UKUB 1NJIO 3TSQA 1A5WA 4XH1A 4IFYA 2FSJA 3S3MA 3RRGA 4BVPA 4DQRA 4KHNA 1V4TA 1HNWK 2W42A 1RFQA 3K9KA 2H3GX 3M6GA 3NH2A 4NXMK 3KLEA 3VEWA 4KH6A 4B8CA 4DSEA 2QXLA 3H08A 1REVA 1QSLA 4PY5A 4J2AA 2XY5A 1DLOA 3AGKA 4DQ8A 3SUPA 3VEZA 2PZSA 4A5BA 2BGGA 3ISNC 5KI6A 4DS4A 4CIFA 1S1XA 1YIJN 2VWKA 4KTQA 4I9LA 1OKJA 1UA0A 3MAQA 2NRHA 1DEJA 4G1QA 1TV6A 3HK2A 3LDNA 5MLCQ 3S3NA 4ELVA 1HLUA 1KVCA 3CJ9A 4DFJA 4IDKA 1S6PA 4E1NA 1TKDA 1VQKN 4MLHA 4FK0A 2FF6A 2A41A 4WYBA 3ZSOA 2E8AA 4OKEA 4CBUA 3NCIA 4CERA 4C8OA 1NK5A 2QWPA 1R59O 1YVNA 4CZIA 3T1AA 4DSLA 4CZGA 1OH8A 4WF9L 3M8QA 2F8SA 4E7KA 4DFKA 5HRRA 3EZWA 4DV6K 4FJ7A 5KTQA 1QZ5A 3G0ZA 5EY4A 4CGGA 3KK1A 2YX6A 3EO3A 3IFRA 4BRAA 4V19S 4RW7A 2DFFA 1BUPA 3AVHA 1RT7A 1NKCA 1NGJA 1HX1A 4JKCA 3R8EA 2VG5A 2E6LA 1ATSA 1NKBA 1RTHA 4QOZB 2IAJA 3VQQA 3P1GA 1YI2N 2O8EB 3FZFA 3HOSA 3E1YA 2YNFA 2VQEK 4IO8A 4PKHA 4KFBA 4IXCA 3SQ0A 1RDDA 1YJWN 5AQUA 4FM1A 5HRNA 4ELTA 3KLFA 4LF6K 3DLRA 3VEYA 4B9QA 4DQSA 3T69A 3ATVA 3O8MA 4BQLA 3L8BA 3TAQA 4DLEA 4BRIA 2O8EA 4M3RA 1HJOA 4DFPA 5DM6L 3G10A 1I94K 3FFIA 3ENHA 2UXBK 1YUWA 3DYAA 1NGEA 3VQDA 1K6YA 4WFBL 1D8YA 3VGKA 2PYLA 3O80A 5J2QA 3ZLJA 3K5OA 1IG9A 4B9LA 3ZSXA 2D0OA 4PKGA 1M1KO 1RT1A 4NYNA 5CYMA 4DTXA 4JRQA 3CCMN 2P5GA 4DQPA 1HKCA 3DMJA 1RBVA 3CFPA 3WXMB 1YF5L 4MO4A 4HCBA 5JLFA 3LP3A 1VQ7N 3PV8A 5AZIB 4YDUC 3B6OA 2QI2A 1T03A 4BWJA 1BG3A 5CZ1A 4CFAA 4DR6K 4BR0A 3LDOA 5AQTA 2IS3A 3EE8A 2XY6A 1N32K 3S3OA 3A5OC 4N76A 1K8KB 2FF3B 5AQJA 3HP6A 3AVIA 1BQMA 1J5EK 4E1JA 4LSLA 4XH5A 4IZ9A 4PHTX 1TL1A 3OS1A 3R3LA 4CJKA 4L3QA 3VEOA 3QEWA 2Q31A 2QWOA 2G8KA 1WAFA 1BQNA 5C10A 1BOTO 3C6AA 1NJZA 4CIGA 3CM6A 2YHWA 3CC7N 1VQ8N 3TABA 4Q5VA 2F96A 1K8KA 4KBOA 2O8DB 2ITMA 3ZX0A 3RMAA 4FSVA 2A42A 3QFPA 4ID5A 1ASWA 2KQ2A 3MN7A 2IOCA 3LM2A 4E1MA 4FJ8A 3CCLN 3NF6A 3D6RA 4YOUA 2KZMA 2B5JA 3CQ8A 4JK8A 2HVIA 3CQXA 4M3XA 3SYZA 4PL7A 3B8AX 5GAGP 3MXJA 4DU3A 3C6UA 3LP1A 4FVUA 2GTDA 4NCBA 2P9KA 3J81O 3RSEB 3R1XA 3E9PA 5BPLA 3ID6A 2QA4N 3D7EO 4DV3K 4ILGB 1C0GA 4BG9A 5CE3A 3BF1A 5KPRA 3MX2A 2HVHA 1OH7A 4CJ3A 4OJRA 4AHSA 3I8BA 4C23A 3CCSN 3NGIA 4H0TB 1S1UA 1KFDA 4H0VB 5C2DA 3OYCA 1SL1A 4GV6A 3PX0A 4W5NA 3VENA 2P9PA 4PUOA 4DQQA 2ZJRL 2O8FB 5GINA 2OA8A 3P5JA 1RT3A 1RBRA 3AVKA 3MN9A 2E4LA 4CBXA 3TAMA 1KAZA 3D0PA 4M3YA 5AQVA 4CK1A 4KHUA 4H4OA 2QW9A 1YXQA 3BGRA 2OPRA 4BRCA 3ZT3A 3CG7A 2UUAK 1TKZA 4CHZA 2E2QA 1VQ5N 4W5OA 3ZSZA 4OLAA 1TK5A 3DLEA 1NGIA 2GUIA 3AA4A 5BR9A 1RNHA 4CK3A 4DUZK 2WONA 1QE1A 2CH6A 1EXQA 2CGKA 1Z05A 3U9DA 4DV4K 4DTUA 2UXDK 3U9ZA 3CF5L 1LAWA 3SV3A 2VWBA 2NNWA 3L3UA 4JK7A 1HQEA 4JLHA 3AVMA 3ULEB 4MDAA 4B8AB 1XUPO 4FZYA 3I55N 4LF8K 4B9UA 1XNQK 4OGCA 4XEIA 1S1VA 2HOEA 1YJ9N 3EYZA 4FW2A 4BROA 2HMIA 1FKOA 4GVMA 4IJAA 4BGAA 5BRDA 4OGEA 2P9IA 1RT6A 4BRQA 3MEGA 4O8UA 5HRPA 2KTQA 1WSGA 5KPTA 4FJ5A 5HRSA 3ULEA 3THVA 2JWLA 1NGCA 1X9WA 4DCHA 4CCHA 4DLGA 1JLCA 3ENBA 3QDKA 5HLFA 4GKJK 4FXDA 1T3VA 2JWKA 2HNYA 4DF8A 1IH7A 4CE9A 1WSHA 1H1VA 3WXIA 1NGFA 3DLKA 3IRXA 3VQ8A 4BC3A 1T8EA 4IG3A 3ENOA 3GDQA 5C24A 5LJVA 1L3UA 3K5MA 4RW4A 4YORA 3VMFB 4DSJA 4UY8O 3OYDA 4YNQA 4FWOA 3HBTA 4KTWA 4BREA 4F2SA 5A2QO 3CFRA 1X9SA 3QLHA 4CEEA 1LCUA 4CJEA 4HCCA 5AQOA 3F73A 1ZBIA 3D45A 4KB0A 2IGIA 1NJXA 4ID1A 1QS4A 2P9SB 4IG0A 3LM9A 5AQKA 1JLFA 3CPWM 4CGJA 2E1ZA 3I8DA 2KKZA 1V4SA 4ICLA 1DTQA 3M8RA 4K8XA 5M1OA 4DTPA 4U7BA 1TKXA 4B1UB 2IC3A 1SKRA 4BC5A 2OANA 2F4VK 4AILC 4J2BA 4CF9A 1T44A 4RW8A 4E19A 1E3MA 4DTRA 2VG7A 3L4QA 3BDPA 2W41A 3AA5X 5JS1A 3TANA 4RG8A 1WLJA 3SLCA 1P8ZA 1GLBG 2VWJA 4B9TA 2EX3A 4X64K 3U3YA 2Q36A 3CMAN 4KHPK 3ITHA 4CZJA 4JKHA 4H5RA 4E0DA 4N41A 1ATNA 3O9UA 2Q0UA 3BY5A 3SAGA 4CESA 1ESVA 3QIPA 4FZZA 4LSNA 5AQHA 3S9HA 1MDUB 1GLCG 2HHWA 5AQQA 4FCYA 4CF1A 3PIPL 1KQSM 1HKBA 4KH4A 4U67L 3OYMA 1MWKA 4JNEA 3OYFA 2OZSA 4CJTA 4BR7A 5CYQA 4JI5K 3GL1A 2YNGA 5ADXH 3VA0A 3AVBA 1XNRK 5FPDA 5JVGL 4IJNA 2G8HA 1Q86O 2KHOA 4CJVA 5BPMA 4KV8A 3F9MA 4BG8A 3OS2A 3QEVA 2IIRA 1ZBLA 2EWSA 2HSTA 5AZJA 5BN8A 2OZMA 2Q2RA 4BRHA 3E01A 3QMLA 2X78A 5E41A 5EVZA 4BE1A 4LFCK 3QIOA 5AQLA 4FJNA 1NOZA 3PSFA 1RCHA 4K41A 1JCFA 4GY2B 2F8TA 1C0FA 3VQBA 1NLVA 1QQCA 1SS6A 4DHYA 1SUQA 2DPNA 3MWPA 4LF4K 1IV0A 3AAQA 1QTMA 4M7XA 1OVQA 2IVNA 2HHXA 4H03B 2ZE2A 2HBKA 3OYKA 2V51B 3T19A 3VOVA 4MFBA 2ZJQL 4E7LA 3SQ2A 2PYJA 2NLXA 2PY5A 4JKEA 1A5VA 1L3TA 4BR5A 3QETA 1KC8O 3ALYA 1QVGM 1LWFA 3DRSA 4RWTA 4M42A 4CGDA 4KPYA 3L0QA 3E9OA 5HBMA 1IKXA 4B9VA 4GV9A 1VSLA 3D2FB 4CJLA 3LDPA 3QEXA 2BDPA 1DTTA 3IMXA 3KWGA 4B1WB 4OPHA 1B9FA 4NB4A 2AA4A 4H4MA 3ZSYA 4JD2B 4AQYK 4O0JA 2DFHA 1TUYA 1C1BA 4KI4A 3KJVA 2ZJPL 1JCGA 4EAHD 4EP5A 4CZKA 2FBYA 5M1NA 4OLBA 4CBWA 4NCAA 3D2FA 1GLFO 1UOCA 1NGDA 2GWKA 2GV9A 1HNVA 3OYJA 4CFCA 1YT3A 4JD2A 3TTDA 1A5XA 4BRMA 1T7PA 4LD0A 5AQSA 1Q82O 4DU4A 1YITN 4BDZA 4KREA 4WFNL 3VQEA 3G6EN 3IG1A 3FGUA 3E9LA 1XC9A 2KLAA 1KVBA 4W5QA 4CJSA 5F1XA 2ZM6K 1L3VA 4JYAK 3DXMB 4JI2K 1HKGA 1N5YA 5GAEP 3HRGA 1TK0A 1ILYA 1KVAA 4DMNA 4YOYA 3NH1A 2G8WA 1SV5A 3LPUA 2ZGZA 2HHTA 4J2EA 3O4QA 5FLXO 3QNOA 4YOTA 1WSIA 1OH5A 2YV0X 3BF3A 3DXMA 4CEZA 1QSSA 1C6VA 1ZBHA 2CGJA 4C8LA 4IWVA 1KCFA 2Q3SA 2ZQBA 5FRNA 3CJ1A 1WSJA 5DMRA 1C0UA 2PFUA 1N34K 1C1CA 5KRTA 4M3TA 3PSIA 4MQ3A 4Z94A 3PUFA 1BA1A 4JN4A 3GE1A 5AQXA 1K9MO 5T7BA 3I0SA 1EO1A 3ZSQA 4HWIA 4BVOA 4E3SA 4JI7K 4DR5K 2WTUA 3O4NA 1KRPA 2VGNA 1WUAA 4KRFA 2OTJN 3SUOA 3WXLA 3SUNA 2JLEA 1S3XA 4B1XB 2NRZA 4PQUA 4LY7A 1ZYQA 1S1WA 3HM8A 4B9MA 1JXEA 5FPMA 1NGGA 3QB0A 1NK4A 4HUFA 2HW3A 4B3RK 3FZMA 1F21A 5ADXA 3P4IA 3HO1A 5AQFA 2A6AA 2NUBA 1RDBA 3P31A 3SMSA 1HNIA 3M3ZA 4CF0A 3HPOA 3KKRA 3SQ1A 2IVPA 3SBGA 1HPZA 2WC9A 3FFKB 4ISFA 1HYVA 1QSYA 3QEPA 4CD3A 3CHWA 1LWEA 3DOLA 4GVEA 1VSJA 3ULDA 3A0IX 1TUUA 2YHXA 2V7ZA 4CHOA 1YHQN 3VF4A 4WFAL 3TPQA 3O1WA 4O55A 1SKWA 3L6QA 1UWBA 4AM7A 4R79A 3VQPA 4CJPA 4RW9A 3PIOL 1NNEA 4AHCA 4WQ4A 4PWDA 4FLZA 4DR3K 5IWAK 2ZGYA 4CJRA 1J9AA 4ISGA 1YTUA 2A5XA 4BQZA 3MN6A 1BU6O 4FJGA 1CXUA 4C1NK 1KXPA 5H1SQ 1RBUA 4LF7K 4CECA 3I56N 4B9SA 3H45C 3KK2A 2AJQA 4QAGA 1NOYA 1Y64A 5D3GA 4CGHA 4DG1A 1FW6A 4FWMA 3AV9A 3VQ6A 3O3FA 1GOBA 5JMVA 3LAMA 3FLCO 2OPPA 2OPQA 4MLEA 3PY8A 4BRNA 3HT3A 3K5NA 3QEIA 3OTOK 1JKHA 2JGUA 1MWMA 3L2RA 4E7IA 3OY9A 2KFNA 3U4LA 2VGMA 3VESA 2J4RA 5ELZA 4C8NA 1HNXK 4F3OA 5DM7L 2UUCK 2X74A 3PX6A 4FLXA 5F0XA 1Y97A 1WN7A 2P9KB 1VQPN 1GLEG 3V4IA 3TWHA 1BO5O 4GNIA 1WOQA 4K8ZA 5I3UA 4M7YA 4FLVA 3V81A 3LANA 3ZSRA 3OJUA 1EWRA 3O3HA 2F7TA 4DU1A 3KKSA 3B6PA 1EETA 4JHDB 3N4PA 5KPZA 1RDCA 4I9QA 3DXKB 3FZLA 4IFVA 1SKSA 3NMUA 4A57A 3KK3A 1O1WA 5AQPA 1TKTA 4O4GA 2P9PB 1FKPA 1D5AA 2QWNA 2HHUA 3MEEA 1SQKA 3CM5A 5M1PA 2I7NA 2KW4A 4JHDA 3V9SA 3NGZA 1XMQK 3CETA 3DXKA 3C65A 3S41A 1ASVA 1VSHA 2QTDA 4HTLA 3RR7A 4CHYA 2X6SA 3J80O 3HPHA 2QEXN 2GX9A 2EHGA 5GIPA 2DY4A 3VTHA 4FJ9A 1I39A 3V9WA 4CI6A 1QHAA 2VG6A 4DUYK 4GW6A 3WXKA 1E4GT 4K25A 3MK6A 1X1PA 2YNHA 2XO7A 1W2BM 2NRVA 1JLBA 4GV3A 3THXB 3VEVA 3PO4A 3KVGA 4JI3K 5TKWA 4A59A 3SAHA 2YJEA 3CCJN 3RTVA 5LJWA 1U2VA 2WBNA 1N36K 3NHGA 4DV2K 3J7ZO 3CCVN 3OBWA 1TYQA 2BUPA 2XRIA 3PLAA 1BCMA 1WNSA 1TL3A 3OYGA 4BRLA 4XIUA 2QWMA 3HJFA 4BR9A 3VGMA 1WAJA 4CZMA 3THXA 3GG4A 3AVGA 4ZHRA 1NK8A 4AHTA 3L2UA 2UXCK 4H0XB 3LL3A 4DS5A 1U49A 5DK5A 1XWLA 3BP8A 1VQ9N 2W6KA 4L8RB 1XHXA 4OO1J 3SI6A 4DSKA 2P9IB 3IAYA 3A8YA 1JLGA 3FZKA 2DFEA 4R5PA 4BDYA 1ZXOA 4KHSA 4CGFA 3U3GA 3M5RA 3DRRA 1JCEA 2CGLA 1TK8A 2RPIA 3SBTA 3NVMA 2QM1A 5CZ2A 1LAVA 4JAXA 3LDSA 3THWA 4DTSA 1EKEA 5J2MA 4EZ9A 5GADP 4O5FA 4CJFA 5HL7L 1Q18A 3NAEA 4FJLA 3AO4A 5KQDA 3AY9A 1QHTA 2D0BA 3HPGA 4CGIA 5SWMA 4IEEA 2W6LA 3QBWA 4CFBA 3U8XA 4X66K 3CYMA 3NBPA 1CZAN 4BWMA 4EZ6A 4CEAA 4DTNA 3EL2A 4K42A 5C25A 1NWKA 2E88A 1W0HA 2GELA 1QVFM 5E84A 3F9KA 5AQZA 4Q0BA 2OTLN 4HTUA 3BUZB 1LW2A 2AP1A 3EE9A 3RVCA 1NM1A 4BRPA 4YHHK 4DR4K 4FK2A 3A5LC 1VQMN 4OKKA 1U4BA 1NK6A 3SQ4A 2HMPA 5CR4A 3I0RA 4MDBA 4A61A 3L2VA 3SJHA 1E4FT 4BE2A 4EIAA 1ITGA 4WQ4C 1EWQA 3TTFA 3CI5A 4FLUA 1FJGK 3AVCA 2G8UA 1ZC6A 2UUBK 2YKNA 4M3ZA 5FPNA 2Z1GA 3DI6A 1Z26A 1S9EA 3OA9A 2A1SA 1W7AA 4Y1CA 3MCPA 3SNNA 4NLBA 2P9UB 2FBXA 3C7NA 5KRSA 4OPKA 4CVNE 3VQ7A 1GLJO 3T7ZA 1HUXA 3K2PA 3M8PA 3KLHA 1EQYA 5BR8K 4FLYA 1SL0A 1BWFO 1Z6RA 2A3ZA 4F4KA 4CJUA 4HUEA 4M45A 1C1AA 3O1BA 2YJFA 3KD1E 1VHXA 3OW2M 3T1YK 4OX9K 4KTZA 1J53A 4J8FA 4FJXA 5M1FA 2FBVA 3HSCA 4QS9A 2P9UA 4UQGA 4I7FA 2ZD1A 4YOXA 3MDQA 4KO0A 4BRDA 4LFBK 2E20A 4JKGB 4ILHA 5J2NA 5LMUK 2FSKA 3EKSA 4KI6A 3P38A 3NGYA 4FK4A 1NK0A 2YI1A 3ATUA 3TAPA 4BC2A 4OPJA 4IFEA 3SPZA 2QKKA 4I6MB 3D2EB 4K0KK 2BTFA 2GWJA 2HHHK 1NKEA 1UAXA 3KD5E 4JKGA 5FPEA 4KAZA 1MU2A 4CF2A 1IG8A 5HOOA 5LMNK 5BREA 3LP0A 4WQ5A 4LH4A 2P5OA 5LL6Z 3QERA 1IBKK 3K59A 3AA2A 5AZJB 4E7JA 4BRGA 4FW1A 3PX4A 5I9EB 3KWIA 4I6MA 3D2EA 2E1YA 2D4WA 1RDAA 3VGLA 3A2FA 2Q97A 3K58A 3K0SA 1HMVA 2P9NA 1RILA 1OVYA 5AQYA 1D9FA 1QZ6A 3AA3A 1NBWA 3WXJA 4JI6K 3ZYYX 4LF9K 3AAPA 1X3MA 1JLAA 3CCUN 4H0PA 1BI4A 4CHQA 3LAKA 5FDLA 3WNGA 5BPNA 3OS0A 3HM9A 3TAGA 3THYB 1QQOA 3CD6N 1IBMK 4ISEA 1T6CA 4FJIA 2FSNA 4AM6A 3H3OB 5FROA 5F2RA 1YAGA 4F3TA 2D0CA 3OYNA 3OHRA 3DRPA 3DLGA 1N8RO 3THYA 5EXWA 4DFMA 4N5SA 5JS2A 4K43A 1BA0A 3J7YP 2CH5A 3CPEA 4B3OA 5AQMA 2ETJA 3RRHA 3AO3A 4TSXA 3LPTA 3T1HK 5CHIA 4EP4A 5EOYA 1NGBA 4F9OA 3AVLA 3CCRN 4O0IA 1S6QA 1TAQA 1LOTB 1SAZA 2HB5A 1QQMA 3L4IA 1RBSA 3ZX2A 2ITGA 3BZCA 2NRRA 3UE5A 3ZSWA 4AHRA 4B3MK 4DV1K 1HJRA 3DJCA 4H5TA 3OVNA 4CEQA 5JLHA 4PKIA 3ZX3A 4FYDA 1HYZA 2WUSA 5HROA 4FO0A 3OYAA 3HP9A 3NF9A 2LSNA 1U48A 4B1ZA 1G99A 1VQ6N 5HP1A 1M90O 1NK9A 3K9JA 1XI1A 2XY8A 2D0PA 1RT4A 3ID8A 2OPSA 1ASUA 1VRUA 3G25A 1VRTA 1RTDA 3VETA 4CEBA 3VQCA 1L5UA 1O13A 5M1QA 2UYTA 3WUHA 3U6FA 2E2OA 3ZT0A 4FLTA 1LWCA 2XY7A 4BR2A 3CC4N 1GLLO 5E26A 2Y1JA 3SAFA 4CJ5A 3UKUA 3KTQA 3CERA 3GBTA 3MCAB 3WEEB 3QESA 5GAHP 4FWQA 2BH1A 1HQUA 1Z25A 2GBZA 4PA1A 1S72N 2P51A 4DV5K 5AFUH 4DR1K 3ZT1A 1IBLK 2KFZA 1K73O 4FOIA 3FE1A 4JI1K 4CZEA 2YHAA 2F9TA 3WEEA 4YFUA 3DAWA 3HOTA 1P90A 3CJBA 4O8KA 3WQUA 3NH0A 1J54A 5K14A 4IBNA 2ZWHA 1ZBFA 3WNEA 4EHUA 2YKMA 5JICA 5EX5A 4AHUA 3V1OA 1S1TA 4E89A 1X9MA 2NZTA 1C0MA 1T6DA 3JSMA 3KZBA 3NE6A 3V6DA 1VQON 4FM0A 4BR4A 3TR8A 4LC9B 4JV5K 2E6MA 1IKVA 4KKOA 1Q7YO 1GOCA 4DKWA 1YTAA 1EX4A 5LY3A 4PL8A 4Y0WA 4Z4IA 1HYSA 4BRFA 2ATQA 4X65K 4CZHA 3QNNA 4JI0K 1RGIA 4FZXC 4FWPA 5AQWA 3W3DA 2YCHA 3NF8A 4DR2K 5IT9O 1XC3A 1RT2A 3FZHA 1WBDA 4FLWA 4H5WA 4FWNA 3MWTA 2HHQA 4CZLA 1RBTA 3V9UA 3C94A 3Q7CA 3G71N 4Z4GA 1HRHA 4WQ5C 3DLBA 4B1YB 3LZIA 2VQFK 3FR0A 4WCEL 4ZTFA 1BHLA 3AVFA 3TAFA 2Q0RA 5AQNA 3SUQA 4DF4A 4FJHA 2KZZA 2HF3A 2O8BB 3WNHA 4EFHA 4LF5K 3VTIA 2P9LB 3CJAA 4CJQA 1LV5A 4F2RA 2A1RA 4H0YB 4KH5A 4DQIA 2NRWA 1VK0A 4NLCA 1YJNN 1FXXA 4FWRA 3CMEN 2ASMA 3SCXA 2ASOA 2YNIA 2OCEA 3HZ6A 4Z0UA 5C2FA 1NJWA 1J6ZA 1S9GA 2O8BA 4XH4A 1BDGA 4KB1A 4AHVA 4Y1DA 3O3GA 2P9LA 1IO2A 3TAEA 2WFBA 2FLOA 1ATRA 4DV0K 3H3NO 3MECA 4JI4K 4C1NI 3SV4A 3CCEN 3VPZA 2DTUA 1D4XA 1BL3A 1Q81O 3E66A 3A5MC 3ZT2A 3KHYA 4CIEA 4DV7K 5AQRA 4CJ7A 5KGXA 2WOMA 5SZTA 4O5BA 4CF8A 3O9RA 3ZETB 4CW7B 2F9WA 3V1QA 4CEDA 4JS5A 2FXUA 3LDQA 1Q9XA 3HTVA 1JL1A 4NYFA 5AZIA 4E7HA 1U47A 4NCGA 5TKYA 3CFOA 3MMVA 3L2QA 3CQYA 3W0LA 2Z1HA 3AARA 4FPBA 4I2PA 1U04A 3ZETA 1DGKN 3N4QA 3VA3A 3VERA 4H8KA 4CHPA 3MEDA 4F8RA 1RT5A 2ZF5O 2QK9A 4W5TA 4KHQA 3V9XA 2QWQA 4KHYA 2IDOA 1HPMA 1BGXT 4FOEA 3QFUA 3CJ7A 3DOKA 4BY9C 3C6TA 3K5LA 4MO5A 3AGRA 1B92A 2P1JA 3AVJA 3T3FA 4Z4EA 2V7YA 2GEMA 3EY1A 4G9ZA 1S22A 4JKAA 3O5BA 2O8DA 1WSFA 3KIOA 4KHWA 1IKYA 1U2VB 3A5NC 5AFUA 4M41A 1KSPA 4QCLA 4CJ4A 1NJYA 1TYQB 3QBXA 5EU7A 4RCHA 4HUGA 3O4WA 3L2WA 4JEPA 1KTQA 1KFSA 3C0BA 4JS4A 3VQAA 1J5OA 4YY3K 5BRHA 2HHSA 2UU9K 1U6ZA 2RN2A 3AO5A 3RSEA 4AF1A 3NDKA 4AH9A 1NMNA 5GIOA 3NVKA 1ZBSA 3IDHA 3Q7BA 2I7PA 1XQSC 3QO9A 4FL9A 3J7AP 1RTIA 3TU5A 3GOIA 1HR0K 3P83D 4CK2A 3EZ5A 5AQIA 4BRKA 2BE2A 4HHTA 3DM2A 3SPYA 3LWMA 4BE0A 2OYQA 1T05A 3LP2A 4FWSA 3L3VA 1JXBA 3EKUA 1W9HA 1G15A 2O8FA 4OKJA 1VQLN 3HXMA 1KD1O 3V9ZA 3THWB 4JK9A 2E5LK 1OH6A 3R9PA 3VF2A 3CXCM 4FJKA 2A40A 5C42A 5AQGA 3DWLA 1IKWA 3DLHA 3H1QA 1L3SA 1BIZA 5J1EA 4CEOA 3TSUA 1Q8IA 4CJWA 1JLQA 4BDPA 1N33K 3H1VX 1QQNA 4DR7K 3BEXA 3CJCA 3OBYA 4DB3A 3ZT4A 2B6AA 3M8SA 4FJMA 2O4GA 4N47A 3JXUA 4BC4A 2HNZA 3KLGA 3TI0A 1MA9B 3C6HA 3O9SA 3BZKA 1BIUA 3OYBA 2QXFA 3QICA 4IDHA 4HVJA 3WT0A 3RMBA 2RKIA 3LDLA 4CEFA 2HBJA 2HHVA 2ASPA 3KLIA 3SMPA 4IKFA 3UIQA 4YOWA 3TARA 1FK9A 2PAVA 3LALA 4B1VA 1TGOA 4OPAA 2PBDA 2VCPA 1B9DA 1YVUA 3HVTA 3NFAA 3ZEUB 3IS9A 3CCQN 3K57A 1K8AO 1R0AA 3IUCA 3R6MA 4RW6A 1GOAA 1VSIA 4FM2A 1I3AA 4QS7A 3C7NB 3MN5A 3VN5A 4H0OA 1EP4A 1WB9A 3H46O 4ILJA 4N56A 1C0TA 4I2QA 1TVRA 1RTJA 3RMCA 4GKKK 3UB5A 5CY4A 2V52B 3UKRB 4Z4FA 2FC0A 1NK7A 4A2AA 1XHZA 1VSEA 4IEIA 3ZEUA 4IOAL 1ZBUA 4W5RA 3O6WA 4DTMA 3HVRA 3SK3A 1KLMA 4FWKA 3OYIA 5C15A 2G8IA 4A62A 4DWIA 3F2KA 3UKRA 2QWRA 2XHBA 4CZFA 4DTOA 1DT9A 1D9DA 1CZBA 1RDWX 1HNZK 3SJJA 2HBLA 5JVHL 1GLDG 1S5JA 2D5RA 2HNDA 4CD1A 5J2PA 2RF2A 2HBMA 2O8CB 4M3WA 2Z1JA 3OYHA 4C8MA 4A5AA 4NO7A 3I33A 4A2BA 2G8VA 3PO5A 3WNFA 2IVOA 3AVAA 4BGBA 1NGHA 2E2PA 2HF4A 5KQ8A 2Y1IA 1JJ2M
chains in the Genus database with same CATH topology
1GLAG 3CC2N 3TTCA 3TSPA 3PIOL 4B1ZA 2P9SA 1G99A 4WQ4A 1VQ6N 4BRCA 1M90O 3K9JA 3VEXA 3O9QA 5C0YA 2D0PA 2ZGYA 3ID8A 3O08A 2E2QA 1VQ5N 4ISGA 3G25A 2A5XA 3EN9A 4BQZA 1SZ2A 2P9NB 3MN6A 1BU6O 1NGIA 3VETA 4C1NK 1O13A 4H5VA 5BR9A 1KXPA 5M1QA 2UYTA 3WUHA 5BN9A 5B8HA 4QS8A 5M1KA 5H1SQ 2CH6A 2E2OA 4JKDA 3I56N 3H45C 2CGKA 1Z05A 4BR2A 3CC4N 3U9DA 1Y64A 1GLLO 5E26A 3SAFA 3KK7A 2NRXA 3O9TA 3UKUA 4YOVA 3U9ZA 4FWMA 3CERA 3GBTA 3HI0A 3MCAB 3WEEB 5JMVA 3CF5L 5GAHP 4FWQA 2BH1A 2GUPA 2NNWA 2VWBA 3FLCO 2Q1NA 4JK7A 4MLEA 4BRNA 1DKGD 3ULEB 4MDAA 1S72N 1XUPO 3I55N 5AFUH 1NGAA 1MWMA 4XEIA 2HOEA 1K73O 1YJ9N 4FOIA 3U4LA 2VGMA 3FE1A 3DLLL 3VESA 2W40A 4BROA 1RDUA 2J4RA 4IJAA 5ELZA 4BGAA 5BRDA 2YHYA 4CZEA 3IKMA 5DM7L 2P9IA 4IO9L 4BRQA 4O8UA 2F9TA 4EHTA 3WEEA 3DAWA 5F0XA 5KPTA 3HOTA 1P90A 3CJBA 4O8KA 3WQUA 2P9KB 1VQPN 1GLEG 2ZWHA 3ULEA 2RHKA 1BO5O 4GNIA 1WOQA 2JWLA 4M7YA 1NGCA 4EHUA 4DCHA 5JICA 5EX5A 2F7TA 4JHDB 3N4PA 3F5TA 2NZTA 3ENBA 1IJJA 1T6DA 3QDKA 4R79A 5KPZA 1T3VA 2JWKA 4YDUA 3KZBA 4JKFA 3DXKB 3FZLA 3NMUA 1VQON 4A57A 4BR4A 4LC9B 1H1VA 1NMDA 5AQPA 3WXIA 1Q7YO 1NGFA 3VF6A 4DKWA 4BC3A 2P9PB 5LY3A 3ENOA 4PL8A 2QWNA 3GDQA 5LJVA 4Y0WA 1SQKA 5M1PA 4BRFA 4H5NA 2I7NA 1X9JA 4RTFD 4YORA 4CZHA 3VMFB 4UY8O 1RGIA 3J8AA 4IOXA 4JHDA 4FWPA 5AQWA 3W3DA 2YCHA 3H6EA 1W97L 4FWOA 3HBTA 4BREA 3M1FA 1XC3A 3CETA 3DXKA 3C65A 3S41A 3FZHA 4JKBA 3G4SN 1YJNN 4H5WA 4FWNA 3MWTA 1LCUA 2QTDA 4HTLA 4CZLA 2VYPA 5AQOA 4FWLA 3WQTA 3Q7CA 2D1KA 3G71N 2QEXN 5AR0A 2GX9A 5GIPA 3JS6A 4WQ5C 1VQNN 3VTHA 4B1YB 2P9SB 2RE2A 3FR0A 4CI6A 4WCEL 3LM9A 1QHAA 5AQKA 4IOCL 3WXKA 3CPWM 1E4GT 2Q0RA 2E1ZA 4K25A 2KKZA 1V4SA 3MK6A 5AQNA 2E2NA 1W2BM 2NRVA 3P39A 4M63C 5M1OA 5BRFA 4U7BA 4GV3A 2HF3A 1KAYA 3KVGA 3VEVA 5C12A 5TKWA 4A59A 4B1UB 3SAHA 2YJEA 4BC5A 4EFHA 2OANA 5LJWA 3CCJN 3VTIA 2P9LB 1U2VA 3CJAA 2NRTA 1KAXA 2WBNA 4H0YB 1T44A 4KH5A 2NRWA 3J7ZO 3MX5A 1VQ4N 4NLCA 4FPAA 3CCVN 2QWLA 4FWRA 3OBWA 3L4QA 1TYQA 2BUPA 2ASMA 2W41A 3CIPA 3PLAA 2ASOA 3SLCA 3HZ6A 1X3NA 1P8ZA 4BRLA 1GLBG 1VAZA 2QWMA 3UKUB 5C2FA 4BR9A 1NJIO 3VGMA 3TSQA 4CZMA 1J6ZA 4XH1A 2FSJA 3GG4A 4XH4A 2Q36A 3CMAN 4BVPA 1BDGA 1V4TA 2P9LA 4H0XB 3CMEN 1RFQA 3K9KA 3LL3A 4CZJA 4JKHA 2H3GX 3BP8A 4H5RA 1VQ9N 3M6GA 1ATNA 2WFBA 3O9UA 2Q0UA 4KH6A 2FLOA 1ATRA 3VEWA 4OO1J 2QXLA 3SAGA 3H3NO 4C1NI 1ESVA 3CCEN 3VPZA 2P9IB 5AQHA 1MDUB 1D4XA 1GLCG 3A8YA 3AGKA 4DQ8A 3FZKA 5AQQA 3PIPL 3VEZA 1KQSM 1HKBA 1ZXOA 4KH4A 4A5BA 4U67L 3E66A 1MWKA 3A5MC 4JNEA 3KHYA 1Q81O 3M5RA 1JCEA 2CGLA 5AQRA 4CJ7A 1YIJN 4BR7A 3SBTA 3NVMA 1OKJA 2QM1A 3GL1A 3O9RA 3ZETB 2NRHA 4JAXA 1DEJA 5ADXH 3LDNA 5MLCQ 2F9WA 5GADP 4O5FA 1HLUA 5HL7L 1Q18A 5FPDA 5JVGL 2FXUA 3LDQA 4IJNA 3CJ9A 1Q86O 3HTVA 2KHOA 5AZIA 5BPMA 5KQDA 1VQKN 3AY9A 4MLHA 3F9MA 5TKYA 2FF6A 2A41A 4IEEA 4WYBA 4BG8A 3MMVA 3QBWA 2IIRA 3U8XA 2EWSA 3CQYA 3W0LA 2HSTA 2E8AA 5AZJA 1CZAN 5BN8A 3AARA 2Q2RA 4FPBA 4BRHA 4CBUA 3QMLA 3ZETA 3EL2A 1DGKN 3N4QA 5EVZA 4K42A 1NWKA 2E88A 3VERA 2QWPA 2GELA 1JJ2M 1QVFM 1R59O 1YVNA 5AQLA 5E84A 4CZIA 5AQZA 4CZGA 2ZF5O 4K41A 1JCFA 2OTLN 4WF9L 3BUZB 2AP1A 3EE9A 4GY2B 1NM1A 3RVCA 4BRPA 3EZWA 3A5LC 1C0FA 2QWQA 1VQMN 1NLVA 1QZ5A 1HPMA 5EY4A 4FOEA 3QFUA 3CJ7A 1SS6A 4DHYA 2DPNA 2HMPA 3MWPA 5CR4A 4BY9C 2YX6A 3EO3A 3IFRA 4MDBA 4BRAA 4MO5A 4A61A 3AAQA 3AGRA 3SJHA 1E4FT 4M7XA 2IVNA 4EIAA 4H03B 1BUPA 4WQ4C 2HBKA 2V51B 3VOVA 3TTFA 2V7YA 1NGJA 1HX1A 2GEMA 3CI5A 2ZJQL 4G9ZA 1S22A 4JKAA 3O5BA 4JKCA 3R8EA 2NLXA 1ATSA 1ZC6A 4JKEA 1U2VB 4BR5A 5FPNA 1QVGM 1KC8O 1YI2N 3A5NC 4RWTA 3OA9A 5AFUA 3FZFA 3HOSA 3E1YA 3L0QA 3E9OA 3MCPA 4NLBA 4IO8A 2P9UB 4PKHA 1TYQB 3QBXA 3C7NA 4IXCA 1YJWN 4RCHA 5AQUA 1GLJO 3O4WA 3T7ZA 1HUXA 4GV9A 4JEPA 3D2FB 3C0BA 3LDPA 1EQYA 1BWFO 3VEYA 1Z6RA 2A3ZA 5BRHA 3IMXA 3KWGA 4B1WB 4OPHA 4B9QA 4NB4A 3T69A 3ATVA 1U6ZA 2AA4A 3O1BA 2YJFA 3O8MA 3RSEA 4AF1A 4BQLA 4JD2B 3OW2M 1TUYA 4BRIA 4J8FA 1HJOA 5DM6L 2ZJPL 5GIOA 5M1FA 3HSCA 1JCGA 4EAHD 4QS9A 2P9UA 4CZKA 1ZBSA 3IDHA 3Q7BA 5M1NA 3ENHA 3NVKA 2I7PA 1YUWA 1XQSC 1NGEA 4YOXA 3MDQA 4BRDA 4FL9A 4CBWA 4WFBL 3D2FA 1GLFO 2E20A 4JKGB 4ILHA 1NGDA 2GWKA 3TU5A 3GOIA 3VGKA 2FSKA 3EKSA 3O80A 5AQIA 3P38A 2YI1A 4BRKA 4JD2A 3ATUA 3TTDA 2D0OA 4PKGA 4BC2A 4BRMA 4FWSA 5AQSA 3EKUA 1M1KO 1Q82O 1YITN 4IFEA 1VQLN 4WFNL 4I6MB 3D2EB 3CCMN 2BTFA 2GWJA 3G6EN 1KD1O 4JK9A 3R9PA 1HKCA 3FGUA 3E9LA 2KLAA 5F1XA 3WXMB 4JKGA 3VF2A 1YF5L 4MO4A 5FPEA 3CXCM 5JLFA 1IG8A 1VQ7N 3DXMB 2A40A 4YDUC 5AZIB 5HOOA 5AQGA 5BREA 1HKGA 4WQ5A 5GAEP 3DWLA 3HRGA 1ILYA 3H1QA 2QI2A 4YOYA 3TSUA 5AZJB 1BG3A 4BRGA 5I9EB 3KWIA 4I6MA 3D2EA 2E1YA 4BR0A 2D4WA 2ZGZA 3H1VX 3LDOA 1QQNA 5AQTA 3BEXA 3CJCA 3EE8A 3OBYA 3VGLA 4DB3A 4YOTA 2Q97A 3A5OC 1K8KB 2FF3B 5AQJA 3JXUA 4BC4A 3BF3A 3DXMA 1MA9B 2P9NA 3C6HA 4E1JA 2CGJA 4XH5A 1OVYA 3O9SA 5AQYA 4IWVA 4IZ9A 4PHTX 1QZ6A 3R3LA 1NBWA 3QICA 4IDHA 4L3QA 3WT0A 3WXJA 3VEOA 3LDLA 2Q31A 2QWOA 3ZYYX 3CJ1A 2HBJA 2ASPA 3AAPA 3SMPA 5C10A 2PFUA 1BOTO 3C6AA 1X3MA 3CCUN 4YOWA 4H0PA 2YHWA 3CC7N 1VQ8N 2PAVA 4B1VA 4Z94A 1K8KA 4KBOA 1BA1A 4JN4A 3GE1A 4OPAA 2PBDA 5AQXA 2ITMA 1K9MO 2VCPA 5BPNA 3ZX0A 4FSVA 1EO1A 4HWIA 4BVOA 2A42A 3QFPA 1QQOA 3CCQN 3ZEUB 3CD6N 3MN7A 1K8AO 3IUCA 3LM2A 3R6MA 3CCLN 3D6RA 4YOUA 4QS7A 2VGNA 4ISEA 4JK8A 1WUAA 3C7NB 3MN5A 1T6CA 3CQXA 4H0OA 4PL7A 3H46O 2FSNA 4AM6A 4ILJA 3B8AX 3H3OB 5GAGP 5F2RA 1YAGA 2OTJN 3UB5A 2V52B 3UKRB 4FVUA 2GTDA 2P9KA 3WXLA 3OHRA 3RSEB 3R1XA 4A2AA 3E9PA 1S3XA 4IEIA 2NRZA 4B1XB 5BPLA 1N8RO 3ID6A 2QA4N 3D7EO 3ZEUA 4IOAL 5EXWA 4ILGB 1C0GA 4BG9A 5CE3A 3BF1A 5KPRA 3HM8A 3MX2A 4K43A 3O6WA 1BA0A 2CH5A 5FPMA 3CPEA 1NGGA 3QB0A 3SK3A 5AQMA 3FZMA 5ADXA 3P4IA 3I8BA 4FWKA 4C23A 5AQFA 3CCSN 2A6AA 5C15A 4A62A 5CHIA 3F2KA 3P31A 3SMSA 5EOYA 4H0TB 1NGBA 3M3ZA 4AM7A 5C2DA 3UKRA 4H0VB 2QWRA 4GV6A 4F9OA 4CZFA 3VENA 1DT9A 3CCRN 1RDWX 2P9PA 2IVPA 3SBGA 2WC9A 2HBLA 3FFKB 4ISFA 1LOTB 5JVHL 1GLDG 1SAZA 4CD1A 2ZJRL 4CD3A 1QQMA 3L4IA 3CHWA 5GINA 3ZX2A 2HBMA 4GVEA 4A5AA 3A0IX 1TUUA 2NRRA 3UE5A 2YHXA 4NO7A 3I33A 4A2BA 3MN9A 2V7ZA 2IVOA 4CBXA 4BGBA 1KAZA 1NGHA 1YHQN 3VF4A 4WFAL 3DJCA 4H5TA 3TPQA 2E2PA 5AQVA 5JLHA 3O1WA 2HF4A 4PKIA 3ZX3A 2WUSA 2QW9A 5KQ8A 3L6QA 4FO0A 1YXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWL A;  2PFU A;  2JWK A; 
#chains in the Genus database with same CATH topology
 1GLA G;  3CC2 N;  3TTC A;  3TSP A;  3ASM A;  2P9S A;  2O8C A;  4BAC A;  2FBT A;  3VEX A;  4X62 K;  4JI8 K;  1VSM A;  3O9Q A;  5C0Y A;  3VQ4 A;  3O08 A;  3JAM O;  1BIS A;  3EN9 A;  3HST B;  4DSI A;  1SZ2 A;  2P9N B;  3ZSV A;  2I5J A;  1VSK A;  4H5V A;  1VSD A;  4NXN K;  4LH5 A;  5BN9 A;  5B8H A;  4QS8 A;  5M1K A;  2O4I A;  4JKD A;  1WSE A;  3NF7 A;  1U45 A;  3LWL A;  1BI4 B;  3KK7 A;  2NRX A;  3O9T A;  4YOV A;  4OVL A;  3HI0 A;  3OYE A;  2GUP A;  4C8K A;  2Q1N A;  3RWU A;  1DKG D;  1SL2 A;  2X6N A;  4FVM A;  1NGA A;  3DLL L;  3LZJ A;  1CZ9 A;  2BAN A;  1JLE A;  2W40 A;  1RDU A;  1KLN A;  2YHY A;  1NG9 A;  3IKM A;  4IO9 L;  4Z4H A;  1XMO K;  4EHT A;  3MXM A;  3OJS A;  4GMJ B;  4M3U A;  4ELU A;  2B4J A;  2RHK A;  2R7Y A;  5FRM A;  5KGW A;  4LFA K;  5I42 A;  1BCO A;  3F5T A;  4J2D A;  1IJJ A;  2D0A A;  4YDU A;  4JKF A;  1CXQ A;  3EEQ A;  1WBB A;  3JYT A;  4JRP A;  3AO1 A;  3C95 A;  3RMD A;  1NMD A;  3AVN A;  1Q9Y A;  3V1R A;  3VF6 A;  5AJ3 K;  3MXI A;  4FJJ A;  3AO2 A;  3SZ2 A;  1JL2 A;  4CHN A;  4H5N A;  1X9J A;  4RTF D;  3J8A A;  4IOX A;  3H6E A;  1W97 L;  1VSF A;  3M1F A;  1N6Q A;  4B9N A;  4JKB A;  2YHB A;  3G4S N;  2QKB A;  4ZTJ A;  2VYP A;  1NU0 A;  3OYL A;  1UA1 A;  1CLQ A;  3HYF A;  3VQ9 A;  4B3T K;  4FWL A;  3WQT A;  2D1K A;  2Z1I A;  4WE1 A;  5AR0 A;  3JS6 A;  1VQN N;  2RE2 A;  4IOC L;  3VQ5 A;  2E2N A;  4B3S K;  1LW0 A;  3P39 A;  4M63 C;  4DTJ A;  4O44 A;  5BRF A;  1KAY A;  5C12 A;  2G8F A;  4Z4C A;  3HL8 A;  2NRT A;  1KAX A;  3QIN A;  4CFD A;  3RR8 A;  3ZCM A;  3MX5 A;  1VQ4 N;  4FPA A;  2QWL A;  1TAU A;  3CIP A;  4B08 A;  4DSF A;  1X3N A;  1VAZ A;  3UKU B;  1NJI O;  3TSQ A;  1A5W A;  4XH1 A;  4IFY A;  2FSJ A;  3S3M A;  3RRG A;  4BVP A;  4DQR A;  4KHN A;  1V4T A;  1HNW K;  2W42 A;  1RFQ A;  3K9K A;  2H3G X;  3M6G A;  3NH2 A;  4NXM K;  3KLE A;  3VEW A;  4KH6 A;  4B8C A;  4DSE A;  2QXL A;  3H08 A;  1REV A;  1QSL A;  4PY5 A;  4J2A A;  2XY5 A;  1DLO A;  3AGK A;  4DQ8 A;  3SUP A;  3VEZ A;  2PZS A;  4A5B A;  2BGG A;  3ISN C;  5KI6 A;  4DS4 A;  4CIF A;  1S1X A;  1YIJ N;  2VWK A;  4KTQ A;  4I9L A;  1OKJ A;  1UA0 A;  3MAQ A;  2NRH A;  1DEJ A;  4G1Q A;  1TV6 A;  3HK2 A;  3LDN A;  5MLC Q;  3S3N A;  4ELV A;  1HLU A;  1KVC A;  3CJ9 A;  4DFJ A;  4IDK A;  1S6P A;  4E1N A;  1TKD A;  1VQK N;  4MLH A;  4FK0 A;  2FF6 A;  2A41 A;  4WYB A;  3ZSO A;  2E8A A;  4OKE A;  4CBU A;  3NCI A;  4CER A;  4C8O A;  1NK5 A;  2QWP A;  1R59 O;  1YVN A;  4CZI A;  3T1A A;  4DSL A;  4CZG A;  1OH8 A;  4WF9 L;  3M8Q A;  2F8S A;  4E7K A;  4DFK A;  5HRR A;  3EZW A;  4DV6 K;  4FJ7 A;  5KTQ A;  1QZ5 A;  3G0Z A;  5EY4 A;  4CGG A;  3KK1 A;  2YX6 A;  3EO3 A;  3IFR A;  4BRA A;  4V19 S;  4RW7 A;  2DFF A;  1BUP A;  3AVH A;  1RT7 A;  1NKC A;  1NGJ A;  1HX1 A;  4JKC A;  3R8E A;  2VG5 A;  2E6L A;  1ATS A;  1NKB A;  1RTH A;  4QOZ B;  2IAJ A;  3VQQ A;  3P1G A;  1YI2 N;  2O8E B;  3FZF A;  3HOS A;  3E1Y A;  2YNF A;  2VQE K;  4IO8 A;  4PKH A;  4KFB A;  4IXC A;  3SQ0 A;  1RDD A;  1YJW N;  5AQU A;  4FM1 A;  5HRN A;  4ELT A;  3KLF A;  4LF6 K;  3DLR A;  3VEY A;  4B9Q A;  4DQS A;  3T69 A;  3ATV A;  3O8M A;  4BQL A;  3L8B A;  3TAQ A;  4DLE A;  4BRI A;  2O8E A;  4M3R A;  1HJO A;  4DFP A;  5DM6 L;  3G10 A;  1I94 K;  3FFI A;  3ENH A;  2UXB K;  1YUW A;  3DYA A;  1NGE A;  3VQD A;  1K6Y A;  4WFB L;  1D8Y A;  3VGK A;  2PYL A;  3O80 A;  5J2Q A;  3ZLJ A;  3K5O A;  1IG9 A;  4B9L A;  3ZSX A;  2D0O A;  4PKG A;  1M1K O;  1RT1 A;  4NYN A;  5CYM A;  4DTX A;  4JRQ A;  3CCM N;  2P5G A;  4DQP A;  1HKC A;  3DMJ A;  1RBV A;  3CFP A;  3WXM B;  1YF5 L;  4MO4 A;  4HCB A;  5JLF A;  3LP3 A;  1VQ7 N;  3PV8 A;  5AZI B;  4YDU C;  3B6O A;  2QI2 A;  1T03 A;  4BWJ A;  1BG3 A;  5CZ1 A;  4CFA A;  4DR6 K;  4BR0 A;  3LDO A;  5AQT A;  2IS3 A;  3EE8 A;  2XY6 A;  1N32 K;  3S3O A;  3A5O C;  4N76 A;  1K8K B;  2FF3 B;  5AQJ A;  3HP6 A;  3AVI A;  1BQM A;  1J5E K;  4E1J A;  4LSL A;  4XH5 A;  4IZ9 A;  4PHT X;  1TL1 A;  3OS1 A;  3R3L A;  4CJK A;  4L3Q A;  3VEO A;  3QEW A;  2Q31 A;  2QWO A;  2G8K A;  1WAF A;  1BQN A;  5C10 A;  1BOT O;  3C6A A;  1NJZ A;  4CIG A;  3CM6 A;  2YHW A;  3CC7 N;  1VQ8 N;  3TAB A;  4Q5V A;  2F96 A;  1K8K A;  4KBO A;  2O8D B;  2ITM A;  3ZX0 A;  3RMA A;  4FSV A;  2A42 A;  3QFP A;  4ID5 A;  1ASW A;  2KQ2 A;  3MN7 A;  2IOC A;  3LM2 A;  4E1M A;  4FJ8 A;  3CCL N;  3NF6 A;  3D6R A;  4YOU A;  2KZM A;  2B5J A;  3CQ8 A;  4JK8 A;  2HVI A;  3CQX A;  4M3X A;  3SYZ A;  4PL7 A;  3B8A X;  5GAG P;  3MXJ A;  4DU3 A;  3C6U A;  3LP1 A;  4FVU A;  2GTD A;  4NCB A;  2P9K A;  3J81 O;  3RSE B;  3R1X A;  3E9P A;  5BPL A;  3ID6 A;  2QA4 N;  3D7E O;  4DV3 K;  4ILG B;  1C0G A;  4BG9 A;  5CE3 A;  3BF1 A;  5KPR A;  3MX2 A;  2HVH A;  1OH7 A;  4CJ3 A;  4OJR A;  4AHS A;  3I8B A;  4C23 A;  3CCS N;  3NGI A;  4H0T B;  1S1U A;  1KFD A;  4H0V B;  5C2D A;  3OYC A;  1SL1 A;  4GV6 A;  3PX0 A;  4W5N A;  3VEN A;  2P9P A;  4PUO A;  4DQQ A;  2ZJR L;  2O8F B;  5GIN A;  2OA8 A;  3P5J A;  1RT3 A;  1RBR A;  3AVK A;  3MN9 A;  2E4L A;  4CBX A;  3TAM A;  1KAZ A;  3D0P A;  4M3Y A;  5AQV A;  4CK1 A;  4KHU A;  4H4O A;  2QW9 A;  1YXQ A;  3BGR A;  2OPR A;  4BRC A;  3ZT3 A;  3CG7 A;  2UUA K;  1TKZ A;  4CHZ A;  2E2Q A;  1VQ5 N;  4W5O A;  3ZSZ A;  4OLA A;  1TK5 A;  3DLE A;  1NGI A;  2GUI A;  3AA4 A;  5BR9 A;  1RNH A;  4CK3 A;  4DUZ K;  2WON A;  1QE1 A;  2CH6 A;  1EXQ A;  2CGK A;  1Z05 A;  3U9D A;  4DV4 K;  4DTU A;  2UXD K;  3U9Z A;  3CF5 L;  1LAW A;  3SV3 A;  2VWB A;  2NNW A;  3L3U A;  4JK7 A;  1HQE A;  4JLH A;  3AVM A;  3ULE B;  4MDA A;  4B8A B;  1XUP O;  4FZY A;  3I55 N;  4LF8 K;  4B9U A;  1XNQ K;  4OGC A;  4XEI A;  1S1V A;  2HOE A;  1YJ9 N;  3EYZ A;  4FW2 A;  4BRO A;  2HMI A;  1FKO A;  4GVM A;  4IJA A;  4BGA A;  5BRD A;  4OGE A;  2P9I A;  1RT6 A;  4BRQ A;  3MEG A;  4O8U A;  5HRP A;  2KTQ A;  1WSG A;  5KPT A;  4FJ5 A;  5HRS A;  3ULE A;  3THV A;  2JWL A;  1NGC A;  1X9W A;  4DCH A;  4CCH A;  4DLG A;  1JLC A;  3ENB A;  3QDK A;  5HLF A;  4GKJ K;  4FXD A;  1T3V A;  2JWK A;  2HNY A;  4DF8 A;  1IH7 A;  4CE9 A;  1WSH A;  1H1V A;  3WXI A;  1NGF A;  3DLK A;  3IRX A;  3VQ8 A;  4BC3 A;  1T8E A;  4IG3 A;  3ENO A;  3GDQ A;  5C24 A;  5LJV A;  1L3U A;  3K5M A;  4RW4 A;  4YOR A;  3VMF B;  4DSJ A;  4UY8 O;  3OYD A;  4YNQ A;  4FWO A;  3HBT A;  4KTW A;  4BRE A;  4F2S A;  5A2Q O;  3CFR A;  1X9S A;  3QLH A;  4CEE A;  1LCU A;  4CJE A;  4HCC A;  5AQO A;  3F73 A;  1ZBI A;  3D45 A;  4KB0 A;  2IGI A;  1NJX A;  4ID1 A;  1QS4 A;  2P9S B;  4IG0 A;  3LM9 A;  5AQK A;  1JLF A;  3CPW M;  4CGJ A;  2E1Z A;  3I8D A;  2KKZ A;  1V4S A;  4ICL A;  1DTQ A;  3M8R A;  4K8X A;  5M1O A;  4DTP A;  4U7B A;  1TKX A;  4B1U B;  2IC3 A;  1SKR A;  4BC5 A;  2OAN A;  2F4V K;  4AIL C;  4J2B A;  4CF9 A;  1T44 A;  4RW8 A;  4E19 A;  1E3M A;  4DTR A;  2VG7 A;  3L4Q A;  3BDP A;  2W41 A;  3AA5 X;  5JS1 A;  3TAN A;  4RG8 A;  1WLJ A;  3SLC A;  1P8Z A;  1GLB G;  2VWJ A;  4B9T A;  2EX3 A;  4X64 K;  3U3Y A;  2Q36 A;  3CMA N;  4KHP K;  3ITH A;  4CZJ A;  4JKH A;  4H5R A;  4E0D A;  4N41 A;  1ATN A;  3O9U A;  2Q0U A;  3BY5 A;  3SAG A;  4CES A;  1ESV A;  3QIP A;  4FZZ A;  4LSN A;  5AQH A;  3S9H A;  1MDU B;  1GLC G;  2HHW A;  5AQQ A;  4FCY A;  4CF1 A;  3PIP L;  1KQS M;  1HKB A;  4KH4 A;  4U67 L;  3OYM A;  1MWK A;  4JNE A;  3OYF A;  2OZS A;  4CJT A;  4BR7 A;  5CYQ A;  4JI5 K;  3GL1 A;  2YNG A;  5ADX H;  3VA0 A;  3AVB A;  1XNR K;  5FPD A;  5JVG L;  4IJN A;  2G8H A;  1Q86 O;  2KHO A;  4CJV A;  5BPM A;  4KV8 A;  3F9M A;  4BG8 A;  3OS2 A;  3QEV A;  2IIR A;  1ZBL A;  2EWS A;  2HST A;  5AZJ A;  5BN8 A;  2OZM A;  2Q2R A;  4BRH A;  3E01 A;  3QML A;  2X78 A;  5E41 A;  5EVZ A;  4BE1 A;  4LFC K;  3QIO A;  5AQL A;  4FJN A;  1NOZ A;  3PSF A;  1RCH A;  4K41 A;  1JCF A;  4GY2 B;  2F8T A;  1C0F A;  3VQB A;  1NLV A;  1QQC A;  1SS6 A;  4DHY A;  1SUQ A;  2DPN A;  3MWP A;  4LF4 K;  1IV0 A;  3AAQ A;  1QTM A;  4M7X A;  1OVQ A;  2IVN A;  2HHX A;  4H03 B;  2ZE2 A;  2HBK A;  3OYK A;  2V51 B;  3T19 A;  3VOV A;  4MFB A;  2ZJQ L;  4E7L A;  3SQ2 A;  2PYJ A;  2NLX A;  2PY5 A;  4JKE A;  1A5V A;  1L3T A;  4BR5 A;  3QET A;  1KC8 O;  3ALY A;  1QVG M;  1LWF A;  3DRS A;  4RWT A;  4M42 A;  4CGD A;  4KPY A;  3L0Q A;  3E9O A;  5HBM A;  1IKX A;  4B9V A;  4GV9 A;  1VSL A;  3D2F B;  4CJL A;  3LDP A;  3QEX A;  2BDP A;  1DTT A;  3IMX A;  3KWG A;  4B1W B;  4OPH A;  1B9F A;  4NB4 A;  2AA4 A;  4H4M A;  3ZSY A;  4JD2 B;  4AQY K;  4O0J A;  2DFH A;  1TUY A;  1C1B A;  4KI4 A;  3KJV A;  2ZJP L;  1JCG A;  4EAH D;  4EP5 A;  4CZK A;  2FBY A;  5M1N A;  4OLB A;  4CBW A;  4NCA A;  3D2F A;  1GLF O;  1UOC A;  1NGD A;  2GWK A;  2GV9 A;  1HNV A;  3OYJ A;  4CFC A;  1YT3 A;  4JD2 A;  3TTD A;  1A5X A;  4BRM A;  1T7P A;  4LD0 A;  5AQS A;  1Q82 O;  4DU4 A;  1YIT N;  4BDZ A;  4KRE A;  4WFN L;  3VQE A;  3G6E N;  3IG1 A;  3FGU A;  3E9L A;  1XC9 A;  2KLA A;  1KVB A;  4W5Q A;  4CJS A;  5F1X A;  2ZM6 K;  1L3V A;  4JYA K;  3DXM B;  4JI2 K;  1HKG A;  1N5Y A;  5GAE P;  3HRG A;  1TK0 A;  1ILY A;  1KVA A;  4DMN A;  4YOY A;  3NH1 A;  2G8W A;  1SV5 A;  3LPU A;  2ZGZ A;  2HHT A;  4J2E A;  3O4Q A;  5FLX O;  3QNO A;  4YOT A;  1WSI A;  1OH5 A;  2YV0 X;  3BF3 A;  3DXM A;  4CEZ A;  1QSS A;  1C6V A;  1ZBH A;  2CGJ A;  4C8L A;  4IWV A;  1KCF A;  2Q3S A;  2ZQB A;  5FRN A;  3CJ1 A;  1WSJ A;  5DMR A;  1C0U A;  2PFU A;  1N34 K;  1C1C A;  5KRT A;  4M3T A;  3PSI A;  4MQ3 A;  4Z94 A;  3PUF A;  1BA1 A;  4JN4 A;  3GE1 A;  5AQX A;  1K9M O;  5T7B A;  3I0S A;  1EO1 A;  3ZSQ A;  4HWI A;  4BVO A;  4E3S A;  4JI7 K;  4DR5 K;  2WTU A;  3O4N A;  1KRP A;  2VGN A;  1WUA A;  4KRF A;  2OTJ N;  3SUO A;  3WXL A;  3SUN A;  2JLE A;  1S3X A;  4B1X B;  2NRZ A;  4PQU A;  4LY7 A;  1ZYQ A;  1S1W A;  3HM8 A;  4B9M A;  1JXE A;  5FPM A;  1NGG A;  3QB0 A;  1NK4 A;  4HUF A;  2HW3 A;  4B3R K;  3FZM A;  1F21 A;  5ADX A;  3P4I A;  3HO1 A;  5AQF A;  2A6A A;  2NUB A;  1RDB A;  3P31 A;  3SMS A;  1HNI A;  3M3Z A;  4CF0 A;  3HPO A;  3KKR A;  3SQ1 A;  2IVP A;  3SBG A;  1HPZ A;  2WC9 A;  3FFK B;  4ISF A;  1HYV A;  1QSY A;  3QEP A;  4CD3 A;  3CHW A;  1LWE A;  3DOL A;  4GVE A;  1VSJ A;  3ULD A;  3A0I X;  1TUU A;  2YHX A;  2V7Z A;  4CHO A;  1YHQ N;  3VF4 A;  4WFA L;  3TPQ A;  3O1W A;  4O55 A;  1SKW A;  3L6Q A;  1UWB A;  4AM7 A;  4R79 A;  3VQP A;  4CJP A;  4RW9 A;  3PIO L;  1NNE A;  4AHC A;  4WQ4 A;  4PWD A;  4FLZ A;  4DR3 K;  5IWA K;  2ZGY A;  4CJR A;  1J9A A;  4ISG A;  1YTU A;  2A5X A;  4BQZ A;  3MN6 A;  1BU6 O;  4FJG A;  1CXU A;  4C1N K;  1KXP A;  5H1S Q;  1RBU A;  4LF7 K;  4CEC A;  3I56 N;  4B9S A;  3H45 C;  3KK2 A;  2AJQ A;  4QAG A;  1NOY A;  1Y64 A;  5D3G A;  4CGH A;  4DG1 A;  1FW6 A;  4FWM A;  3AV9 A;  3VQ6 A;  3O3F A;  1GOB A;  5JMV A;  3LAM A;  3FLC O;  2OPP A;  2OPQ A;  4MLE A;  3PY8 A;  4BRN A;  3HT3 A;  3K5N A;  3QEI A;  3OTO K;  1JKH A;  2JGU A;  1MWM A;  3L2R A;  4E7I A;  3OY9 A;  2KFN A;  3U4L A;  2VGM A;  3VES A;  2J4R A;  5ELZ A;  4C8N A;  1HNX K;  4F3O A;  5DM7 L;  2UUC K;  2X74 A;  3PX6 A;  4FLX A;  5F0X A;  1Y97 A;  1WN7 A;  2P9K B;  1VQP N;  1GLE G;  3V4I A;  3TWH A;  1BO5 O;  4GNI A;  1WOQ A;  4K8Z A;  5I3U A;  4M7Y A;  4FLV A;  3V81 A;  3LAN A;  3ZSR A;  3OJU A;  1EWR A;  3O3H A;  2F7T A;  4DU1 A;  3KKS A;  3B6P A;  1EET A;  4JHD B;  3N4P A;  5KPZ A;  1RDC A;  4I9Q A;  3DXK B;  3FZL A;  4IFV A;  1SKS A;  3NMU A;  4A57 A;  3KK3 A;  1O1W A;  5AQP A;  1TKT A;  4O4G A;  2P9P B;  1FKP A;  1D5A A;  2QWN A;  2HHU A;  3MEE A;  1SQK A;  3CM5 A;  5M1P A;  2I7N A;  2KW4 A;  4JHD A;  3V9S A;  3NGZ A;  1XMQ K;  3CET A;  3DXK A;  3C65 A;  3S41 A;  1ASV A;  1VSH A;  2QTD A;  4HTL A;  3RR7 A;  4CHY A;  2X6S A;  3J80 O;  3HPH A;  2QEX N;  2GX9 A;  2EHG A;  5GIP A;  2DY4 A;  3VTH A;  4FJ9 A;  1I39 A;  3V9W A;  4CI6 A;  1QHA A;  2VG6 A;  4DUY K;  4GW6 A;  3WXK A;  1E4G T;  4K25 A;  3MK6 A;  1X1P A;  2YNH A;  2XO7 A;  1W2B M;  2NRV A;  1JLB A;  4GV3 A;  3THX B;  3VEV A;  3PO4 A;  3KVG A;  4JI3 K;  5TKW A;  4A59 A;  3SAH A;  2YJE A;  3CCJ N;  3RTV A;  5LJW A;  1U2V A;  2WBN A;  1N36 K;  3NHG A;  4DV2 K;  3J7Z O;  3CCV N;  3OBW A;  1TYQ A;  2BUP A;  2XRI A;  3PLA A;  1BCM A;  1WNS A;  1TL3 A;  3OYG A;  4BRL A;  4XIU A;  2QWM A;  3HJF A;  4BR9 A;  3VGM A;  1WAJ A;  4CZM A;  3THX A;  3GG4 A;  3AVG A;  4ZHR A;  1NK8 A;  4AHT A;  3L2U A;  2UXC K;  4H0X B;  3LL3 A;  4DS5 A;  1U49 A;  5DK5 A;  1XWL A;  3BP8 A;  1VQ9 N;  2W6K A;  4L8R B;  1XHX A;  4OO1 J;  3SI6 A;  4DSK A;  2P9I B;  3IAY A;  3A8Y A;  1JLG A;  3FZK A;  2DFE A;  4R5P A;  4BDY A;  1ZXO A;  4KHS A;  4CGF A;  3U3G A;  3M5R A;  3DRR A;  1JCE A;  2CGL A;  1TK8 A;  2RPI A;  3SBT A;  3NVM A;  2QM1 A;  5CZ2 A;  1LAV A;  4JAX A;  3LDS A;  3THW A;  4DTS A;  1EKE A;  5J2M A;  4EZ9 A;  5GAD P;  4O5F A;  4CJF A;  5HL7 L;  1Q18 A;  3NAE A;  4FJL A;  3AO4 A;  5KQD A;  3AY9 A;  1QHT A;  2D0B A;  3HPG A;  4CGI A;  5SWM A;  4IEE A;  2W6L A;  3QBW A;  4CFB A;  3U8X A;  4X66 K;  3CYM A;  3NBP A;  1CZA N;  4BWM A;  4EZ6 A;  4CEA A;  4DTN A;  3EL2 A;  4K42 A;  5C25 A;  1NWK A;  2E88 A;  1W0H A;  2GEL A;  1QVF M;  5E84 A;  3F9K A;  5AQZ A;  4Q0B A;  2OTL N;  4HTU A;  3BUZ B;  1LW2 A;  2AP1 A;  3EE9 A;  3RVC A;  1NM1 A;  4BRP A;  4YHH K;  4DR4 K;  4FK2 A;  3A5L C;  1VQM N;  4OKK A;  1U4B A;  1NK6 A;  3SQ4 A;  2HMP A;  5CR4 A;  3I0R A;  4MDB A;  4A61 A;  3L2V A;  3SJH A;  1E4F T;  4BE2 A;  4EIA A;  1ITG A;  4WQ4 C;  1EWQ A;  3TTF A;  3CI5 A;  4FLU A;  1FJG K;  3AVC A;  2G8U A;  1ZC6 A;  2UUB K;  2YKN A;  4M3Z A;  5FPN A;  2Z1G A;  3DI6 A;  1Z26 A;  1S9E A;  3OA9 A;  2A1S A;  1W7A A;  4Y1C A;  3MCP A;  3SNN A;  4NLB A;  2P9U B;  2FBX A;  3C7N A;  5KRS A;  4OPK A;  4CVN E;  3VQ7 A;  1GLJ O;  3T7Z A;  1HUX A;  3K2P A;  3M8P A;  3KLH A;  1EQY A;  5BR8 K;  4FLY A;  1SL0 A;  1BWF O;  1Z6R A;  2A3Z A;  4F4K A;  4CJU A;  4HUE A;  4M45 A;  1C1A A;  3O1B A;  2YJF A;  3KD1 E;  1VHX A;  3OW2 M;  3T1Y K;  4OX9 K;  4KTZ A;  1J53 A;  4J8F A;  4FJX A;  5M1F A;  2FBV A;  3HSC A;  4QS9 A;  2P9U A;  4UQG A;  4I7F A;  2ZD1 A;  4YOX A;  3MDQ A;  4KO0 A;  4BRD A;  4LFB K;  2E20 A;  4JKG B;  4ILH A;  5J2N A;  5LMU K;  2FSK A;  3EKS A;  4KI6 A;  3P38 A;  3NGY A;  4FK4 A;  1NK0 A;  2YI1 A;  3ATU A;  3TAP A;  4BC2 A;  4OPJ A;  4IFE A;  3SPZ A;  2QKK A;  4I6M B;  3D2E B;  4K0K K;  2BTF A;  2GWJ A;  2HHH K;  1NKE A;  1UAX A;  3KD5 E;  4JKG A;  5FPE A;  4KAZ A;  1MU2 A;  4CF2 A;  1IG8 A;  5HOO A;  5LMN K;  5BRE A;  3LP0 A;  4WQ5 A;  4LH4 A;  2P5O A;  5LL6 Z;  3QER A;  1IBK K;  3K59 A;  3AA2 A;  5AZJ B;  4E7J A;  4BRG A;  4FW1 A;  3PX4 A;  5I9E B;  3KWI A;  4I6M A;  3D2E A;  2E1Y A;  2D4W A;  1RDA A;  3VGL A;  3A2F A;  2Q97 A;  3K58 A;  3K0S A;  1HMV A;  2P9N A;  1RIL A;  1OVY A;  5AQY A;  1D9F A;  1QZ6 A;  3AA3 A;  1NBW A;  3WXJ A;  4JI6 K;  3ZYY X;  4LF9 K;  3AAP A;  1X3M A;  1JLA A;  3CCU N;  4H0P A;  1BI4 A;  4CHQ A;  3LAK A;  5FDL A;  3WNG A;  5BPN A;  3OS0 A;  3HM9 A;  3TAG A;  3THY B;  1QQO A;  3CD6 N;  1IBM K;  4ISE A;  1T6C A;  4FJI A;  2FSN A;  4AM6 A;  3H3O B;  5FRO A;  5F2R A;  1YAG A;  4F3T A;  2D0C A;  3OYN A;  3OHR A;  3DRP A;  3DLG A;  1N8R O;  3THY A;  5EXW A;  4DFM A;  4N5S A;  5JS2 A;  4K43 A;  1BA0 A;  3J7Y P;  2CH5 A;  3CPE A;  4B3O A;  5AQM A;  2ETJ A;  3RRH A;  3AO3 A;  4TSX A;  3LPT A;  3T1H K;  5CHI A;  4EP4 A;  5EOY A;  1NGB A;  4F9O A;  3AVL A;  3CCR N;  4O0I A;  1S6Q A;  1TAQ A;  1LOT B;  1SAZ A;  2HB5 A;  1QQM A;  3L4I A;  1RBS A;  3ZX2 A;  2ITG A;  3BZC A;  2NRR A;  3UE5 A;  3ZSW A;  4AHR A;  4B3M K;  4DV1 K;  1HJR A;  3DJC A;  4H5T A;  3OVN A;  4CEQ A;  5JLH A;  4PKI A;  3ZX3 A;  4FYD A;  1HYZ A;  2WUS A;  5HRO A;  4FO0 A;  3OYA A;  3HP9 A;  3NF9 A;  2LSN A;  1U48 A;  4B1Z A;  1G99 A;  1VQ6 N;  5HP1 A;  1M90 O;  1NK9 A;  3K9J A;  1XI1 A;  2XY8 A;  2D0P A;  1RT4 A;  3ID8 A;  2OPS A;  1ASU A;  1VRU A;  3G25 A;  1VRT A;  1RTD A;  3VET A;  4CEB A;  3VQC A;  1L5U A;  1O13 A;  5M1Q A;  2UYT A;  3WUH A;  3U6F A;  2E2O A;  3ZT0 A;  4FLT A;  1LWC A;  2XY7 A;  4BR2 A;  3CC4 N;  1GLL O;  5E26 A;  2Y1J A;  3SAF A;  4CJ5 A;  3UKU A;  3KTQ A;  3CER A;  3GBT A;  3MCA B;  3WEE B;  3QES A;  5GAH P;  4FWQ A;  2BH1 A;  1HQU A;  1Z25 A;  2GBZ A;  4PA1 A;  1S72 N;  2P51 A;  4DV5 K;  5AFU H;  4DR1 K;  3ZT1 A;  1IBL K;  2KFZ A;  1K73 O;  4FOI A;  3FE1 A;  4JI1 K;  4CZE A;  2YHA A;  2F9T A;  3WEE A;  4YFU A;  3DAW A;  3HOT A;  1P90 A;  3CJB A;  4O8K A;  3WQU A;  3NH0 A;  1J54 A;  5K14 A;  4IBN A;  2ZWH A;  1ZBF A;  3WNE A;  4EHU A;  2YKM A;  5JIC A;  5EX5 A;  4AHU A;  3V1O A;  1S1T A;  4E89 A;  1X9M A;  2NZT A;  1C0M A;  1T6D A;  3JSM A;  3KZB A;  3NE6 A;  3V6D A;  1VQO N;  4FM0 A;  4BR4 A;  3TR8 A;  4LC9 B;  4JV5 K;  2E6M A;  1IKV A;  4KKO A;  1Q7Y O;  1GOC A;  4DKW A;  1YTA A;  1EX4 A;  5LY3 A;  4PL8 A;  4Y0W A;  4Z4I A;  1HYS A;  4BRF A;  2ATQ A;  4X65 K;  4CZH A;  3QNN A;  4JI0 K;  1RGI A;  4FZX C;  4FWP A;  5AQW A;  3W3D A;  2YCH A;  3NF8 A;  4DR2 K;  5IT9 O;  1XC3 A;  1RT2 A;  3FZH A;  1WBD A;  4FLW A;  4H5W A;  4FWN A;  3MWT A;  2HHQ A;  4CZL A;  1RBT A;  3V9U A;  3C94 A;  3Q7C A;  3G71 N;  4Z4G A;  1HRH A;  4WQ5 C;  3DLB A;  4B1Y B;  3LZI A;  2VQF K;  3FR0 A;  4WCE L;  4ZTF A;  1BHL A;  3AVF A;  3TAF A;  2Q0R A;  5AQN A;  3SUQ A;  4DF4 A;  4FJH A;  2KZZ A;  2HF3 A;  2O8B B;  3WNH A;  4EFH A;  4LF5 K;  3VTI A;  2P9L B;  3CJA A;  4CJQ A;  1LV5 A;  4F2R A;  2A1R A;  4H0Y B;  4KH5 A;  4DQI A;  2NRW A;  1VK0 A;  4NLC A;  1YJN N;  1FXX A;  4FWR A;  3CME N;  2ASM A;  3SCX A;  2ASO A;  2YNI A;  2OCE A;  3HZ6 A;  4Z0U A;  5C2F A;  1NJW A;  1J6Z A;  1S9G A;  2O8B A;  4XH4 A;  1BDG A;  4KB1 A;  4AHV A;  4Y1D A;  3O3G A;  2P9L A;  1IO2 A;  3TAE A;  2WFB A;  2FLO A;  1ATR A;  4DV0 K;  3H3N O;  3MEC A;  4JI4 K;  4C1N I;  3SV4 A;  3CCE N;  3VPZ A;  2DTU A;  1D4X A;  1BL3 A;  1Q81 O;  3E66 A;  3A5M C;  3ZT2 A;  3KHY A;  4CIE A;  4DV7 K;  5AQR A;  4CJ7 A;  5KGX A;  2WOM A;  5SZT A;  4O5B A;  4CF8 A;  3O9R A;  3ZET B;  4CW7 B;  2F9W A;  3V1Q A;  4CED A;  4JS5 A;  2FXU A;  3LDQ A;  1Q9X A;  3HTV A;  1JL1 A;  4NYF A;  5AZI A;  4E7H A;  1U47 A;  4NCG A;  5TKY A;  3CFO A;  3MMV A;  3L2Q A;  3CQY A;  3W0L A;  2Z1H A;  3AAR A;  4FPB A;  4I2P A;  1U04 A;  3ZET A;  1DGK N;  3N4Q A;  3VA3 A;  3VER A;  4H8K A;  4CHP A;  3MED A;  4F8R A;  1RT5 A;  2ZF5 O;  2QK9 A;  4W5T A;  4KHQ A;  3V9X A;  2QWQ A;  4KHY A;  2IDO A;  1HPM A;  1BGX T;  4FOE A;  3QFU A;  3CJ7 A;  3DOK A;  4BY9 C;  3C6T A;  3K5L A;  4MO5 A;  3AGR A;  1B92 A;  2P1J A;  3AVJ A;  3T3F A;  4Z4E A;  2V7Y A;  2GEM A;  3EY1 A;  4G9Z A;  1S22 A;  4JKA A;  3O5B A;  2O8D A;  1WSF A;  3KIO A;  4KHW A;  1IKY A;  1U2V B;  3A5N C;  5AFU A;  4M41 A;  1KSP A;  4QCL A;  4CJ4 A;  1NJY A;  1TYQ B;  3QBX A;  5EU7 A;  4RCH A;  4HUG A;  3O4W A;  3L2W A;  4JEP A;  1KTQ A;  1KFS A;  3C0B A;  4JS4 A;  3VQA A;  1J5O A;  4YY3 K;  5BRH A;  2HHS A;  2UU9 K;  1U6Z A;  2RN2 A;  3AO5 A;  3RSE A;  4AF1 A;  3NDK A;  4AH9 A;  1NMN A;  5GIO A;  3NVK A;  1ZBS A;  3IDH A;  3Q7B A;  2I7P A;  1XQS C;  3QO9 A;  4FL9 A;  3J7A P;  1RTI A;  3TU5 A;  3GOI A;  1HR0 K;  3P83 D;  4CK2 A;  3EZ5 A;  5AQI A;  4BRK A;  2BE2 A;  4HHT A;  3DM2 A;  3SPY A;  3LWM A;  4BE0 A;  2OYQ A;  1T05 A;  3LP2 A;  4FWS A;  3L3V A;  1JXB A;  3EKU A;  1W9H A;  1G15 A;  2O8F A;  4OKJ A;  1VQL N;  3HXM A;  1KD1 O;  3V9Z A;  3THW B;  4JK9 A;  2E5L K;  1OH6 A;  3R9P A;  3VF2 A;  3CXC M;  4FJK A;  2A40 A;  5C42 A;  5AQG A;  3DWL A;  1IKW A;  3DLH A;  3H1Q A;  1L3S A;  1BIZ A;  5J1E A;  4CEO A;  3TSU A;  1Q8I A;  4CJW A;  1JLQ A;  4BDP A;  1N33 K;  3H1V X;  1QQN A;  4DR7 K;  3BEX A;  3CJC A;  3OBY A;  4DB3 A;  3ZT4 A;  2B6A A;  3M8S A;  4FJM A;  2O4G A;  4N47 A;  3JXU A;  4BC4 A;  2HNZ A;  3KLG A;  3TI0 A;  1MA9 B;  3C6H A;  3O9S A;  3BZK A;  1BIU A;  3OYB A;  2QXF A;  3QIC A;  4IDH A;  4HVJ A;  3WT0 A;  3RMB A;  2RKI A;  3LDL A;  4CEF A;  2HBJ A;  2HHV A;  2ASP A;  3KLI A;  3SMP A;  4IKF A;  3UIQ A;  4YOW A;  3TAR A;  1FK9 A;  2PAV A;  3LAL A;  4B1V A;  1TGO A;  4OPA A;  2PBD A;  2VCP A;  1B9D A;  1YVU A;  3HVT A;  3NFA A;  3ZEU B;  3IS9 A;  3CCQ N;  3K57 A;  1K8A O;  1R0A A;  3IUC A;  3R6M A;  4RW6 A;  1GOA A;  1VSI A;  4FM2 A;  1I3A A;  4QS7 A;  3C7N B;  3MN5 A;  3VN5 A;  4H0O A;  1EP4 A;  1WB9 A;  3H46 O;  4ILJ A;  4N56 A;  1C0T A;  4I2Q A;  1TVR A;  1RTJ A;  3RMC A;  4GKK K;  3UB5 A;  5CY4 A;  2V52 B;  3UKR B;  4Z4F A;  2FC0 A;  1NK7 A;  4A2A A;  1XHZ A;  1VSE A;  4IEI A;  3ZEU A;  4IOA L;  1ZBU A;  4W5R A;  3O6W A;  4DTM A;  3HVR A;  3SK3 A;  1KLM A;  4FWK A;  3OYI A;  5C15 A;  2G8I A;  4A62 A;  4DWI A;  3F2K A;  3UKR A;  2QWR A;  2XHB A;  4CZF A;  4DTO A;  1DT9 A;  1D9D A;  1CZB A;  1RDW X;  1HNZ K;  3SJJ A;  2HBL A;  5JVH L;  1GLD G;  1S5J A;  2D5R A;  2HND A;  4CD1 A;  5J2P A;  2RF2 A;  2HBM A;  2O8C B;  4M3W A;  2Z1J A;  3OYH A;  4C8M A;  4A5A A;  4NO7 A;  3I33 A;  4A2B A;  2G8V A;  3PO5 A;  3WNF A;  2IVO A;  3AVA A;  4BGB A;  1NGH A;  2E2P A;  2HF4 A;  5KQ8 A;  2Y1I A;  1JJ2 M; 
#chains in the Genus database with same CATH homology
 1GLA G;  3CC2 N;  3TTC A;  3TSP A;  3PIO L;  4B1Z A;  2P9S A;  1G99 A;  4WQ4 A;  1VQ6 N;  4BRC A;  1M90 O;  3K9J A;  3VEX A;  3O9Q A;  5C0Y A;  2D0P A;  2ZGY A;  3ID8 A;  3O08 A;  2E2Q A;  1VQ5 N;  4ISG A;  3G25 A;  2A5X A;  3EN9 A;  4BQZ A;  1SZ2 A;  2P9N B;  3MN6 A;  1BU6 O;  1NGI A;  3VET A;  4C1N K;  1O13 A;  4H5V A;  5BR9 A;  1KXP A;  5M1Q A;  2UYT A;  3WUH A;  5BN9 A;  5B8H A;  4QS8 A;  5M1K A;  5H1S Q;  2CH6 A;  2E2O A;  4JKD A;  3I56 N;  3H45 C;  2CGK A;  1Z05 A;  4BR2 A;  3CC4 N;  3U9D A;  1Y64 A;  1GLL O;  5E26 A;  3SAF A;  3KK7 A;  2NRX A;  3O9T A;  3UKU A;  4YOV A;  3U9Z A;  4FWM A;  3CER A;  3GBT A;  3HI0 A;  3MCA B;  3WEE B;  5JMV A;  3CF5 L;  5GAH P;  4FWQ A;  2BH1 A;  2GUP A;  2NNW A;  2VWB A;  3FLC O;  2Q1N A;  4JK7 A;  4MLE A;  4BRN A;  1DKG D;  3ULE B;  4MDA A;  1S72 N;  1XUP O;  3I55 N;  5AFU H;  1NGA A;  1MWM A;  4XEI A;  2HOE A;  1K73 O;  1YJ9 N;  4FOI A;  3U4L A;  2VGM A;  3FE1 A;  3DLL L;  3VES A;  2W40 A;  4BRO A;  1RDU A;  2J4R A;  4IJA A;  5ELZ A;  4BGA A;  5BRD A;  2YHY A;  4CZE A;  3IKM A;  5DM7 L;  2P9I A;  4IO9 L;  4BRQ A;  4O8U A;  2F9T A;  4EHT A;  3WEE A;  3DAW A;  5F0X A;  5KPT A;  3HOT A;  1P90 A;  3CJB A;  4O8K A;  3WQU A;  2P9K B;  1VQP N;  1GLE G;  2ZWH A;  3ULE A;  2RHK A;  1BO5 O;  4GNI A;  1WOQ A;  2JWL A;  4M7Y A;  1NGC A;  4EHU A;  4DCH A;  5JIC A;  5EX5 A;  2F7T A;  4JHD B;  3N4P A;  3F5T A;  2NZT A;  3ENB A;  1IJJ A;  1T6D A;  3QDK A;  4R79 A;  5KPZ A;  1T3V A;  2JWK A;  4YDU A;  3KZB A;  4JKF A;  3DXK B;  3FZL A;  3NMU A;  1VQO N;  4A57 A;  4BR4 A;  4LC9 B;  1H1V A;  1NMD A;  5AQP A;  3WXI A;  1Q7Y O;  1NGF A;  3VF6 A;  4DKW A;  4BC3 A;  2P9P B;  5LY3 A;  3ENO A;  4PL8 A;  2QWN A;  3GDQ A;  5LJV A;  4Y0W A;  1SQK A;  5M1P A;  4BRF A;  4H5N A;  2I7N A;  1X9J A;  4RTF D;  4YOR A;  4CZH A;  3VMF B;  4UY8 O;  1RGI A;  3J8A A;  4IOX A;  4JHD A;  4FWP A;  5AQW A;  3W3D A;  2YCH A;  3H6E A;  1W97 L;  4FWO A;  3HBT A;  4BRE A;  3M1F A;  1XC3 A;  3CET A;  3DXK A;  3C65 A;  3S41 A;  3FZH A;  4JKB A;  3G4S N;  1YJN N;  4H5W A;  4FWN A;  3MWT A;  1LCU A;  2QTD A;  4HTL A;  4CZL A;  2VYP A;  5AQO A;  4FWL A;  3WQT A;  3Q7C A;  2D1K A;  3G71 N;  2QEX N;  5AR0 A;  2GX9 A;  5GIP A;  3JS6 A;  4WQ5 C;  1VQN N;  3VTH A;  4B1Y B;  2P9S B;  2RE2 A;  3FR0 A;  4CI6 A;  4WCE L;  3LM9 A;  1QHA A;  5AQK A;  4IOC L;  3WXK A;  3CPW M;  1E4G T;  2Q0R A;  2E1Z A;  4K25 A;  2KKZ A;  1V4S A;  3MK6 A;  5AQN A;  2E2N A;  1W2B M;  2NRV A;  3P39 A;  4M63 C;  5M1O A;  5BRF A;  4U7B A;  4GV3 A;  2HF3 A;  1KAY A;  3KVG A;  3VEV A;  5C12 A;  5TKW A;  4A59 A;  4B1U B;  3SAH A;  2YJE A;  4BC5 A;  4EFH A;  2OAN A;  5LJW A;  3CCJ N;  3VTI A;  2P9L B;  1U2V A;  3CJA A;  2NRT A;  1KAX A;  2WBN A;  4H0Y B;  1T44 A;  4KH5 A;  2NRW A;  3J7Z O;  3MX5 A;  1VQ4 N;  4NLC A;  4FPA A;  3CCV N;  2QWL A;  4FWR A;  3OBW A;  3L4Q A;  1TYQ A;  2BUP A;  2ASM A;  2W41 A;  3CIP A;  3PLA A;  2ASO A;  3SLC A;  3HZ6 A;  1X3N A;  1P8Z A;  4BRL A;  1GLB G;  1VAZ A;  2QWM A;  3UKU B;  5C2F A;  4BR9 A;  1NJI O;  3VGM A;  3TSQ A;  4CZM A;  1J6Z A;  4XH1 A;  2FSJ A;  3GG4 A;  4XH4 A;  2Q36 A;  3CMA N;  4BVP A;  1BDG A;  1V4T A;  2P9L A;  4H0X B;  3CME N;  1RFQ A;  3K9K A;  3LL3 A;  4CZJ A;  4JKH A;  2H3G X;  3BP8 A;  4H5R A;  1VQ9 N;  3M6G A;  1ATN A;  2WFB A;  3O9U A;  2Q0U A;  4KH6 A;  2FLO A;  1ATR A;  3VEW A;  4OO1 J;  2QXL A;  3SAG A;  3H3N O;  4C1N I;  1ESV A;  3CCE N;  3VPZ A;  2P9I B;  5AQH A;  1MDU B;  1D4X A;  1GLC G;  3A8Y A;  3AGK A;  4DQ8 A;  3FZK A;  5AQQ A;  3PIP L;  3VEZ A;  1KQS M;  1HKB A;  1ZXO A;  4KH4 A;  4A5B A;  4U67 L;  3E66 A;  1MWK A;  3A5M C;  4JNE A;  3KHY A;  1Q81 O;  3M5R A;  1JCE A;  2CGL A;  5AQR A;  4CJ7 A;  1YIJ N;  4BR7 A;  3SBT A;  3NVM A;  1OKJ A;  2QM1 A;  3GL1 A;  3O9R A;  3ZET B;  2NRH A;  4JAX A;  1DEJ A;  5ADX H;  3LDN A;  5MLC Q;  2F9W A;  5GAD P;  4O5F A;  1HLU A;  5HL7 L;  1Q18 A;  5FPD A;  5JVG L;  2FXU A;  3LDQ A;  4IJN A;  3CJ9 A;  1Q86 O;  3HTV A;  2KHO A;  5AZI A;  5BPM A;  5KQD A;  1VQK N;  3AY9 A;  4MLH A;  3F9M A;  5TKY A;  2FF6 A;  2A41 A;  4IEE A;  4WYB A;  4BG8 A;  3MMV A;  3QBW A;  2IIR A;  3U8X A;  2EWS A;  3CQY A;  3W0L A;  2HST A;  2E8A A;  5AZJ A;  1CZA N;  5BN8 A;  3AAR A;  2Q2R A;  4FPB A;  4BRH A;  4CBU A;  3QML A;  3ZET A;  3EL2 A;  1DGK N;  3N4Q A;  5EVZ A;  4K42 A;  1NWK A;  2E88 A;  3VER A;  2QWP A;  2GEL A;  1JJ2 M;  1QVF M;  1R59 O;  1YVN A;  5AQL A;  5E84 A;  4CZI A;  5AQZ A;  4CZG A;  2ZF5 O;  4K41 A;  1JCF A;  2OTL N;  4WF9 L;  3BUZ B;  2AP1 A;  3EE9 A;  4GY2 B;  1NM1 A;  3RVC A;  4BRP A;  3EZW A;  3A5L C;  1C0F A;  2QWQ A;  1VQM N;  1NLV A;  1QZ5 A;  1HPM A;  5EY4 A;  4FOE A;  3QFU A;  3CJ7 A;  1SS6 A;  4DHY A;  2DPN A;  2HMP A;  3MWP A;  5CR4 A;  4BY9 C;  2YX6 A;  3EO3 A;  3IFR A;  4MDB A;  4BRA A;  4MO5 A;  4A61 A;  3AAQ A;  3AGR A;  3SJH A;  1E4F T;  4M7X A;  2IVN A;  4EIA A;  4H03 B;  1BUP A;  4WQ4 C;  2HBK A;  2V51 B;  3VOV A;  3TTF A;  2V7Y A;  1NGJ A;  1HX1 A;  2GEM A;  3CI5 A;  2ZJQ L;  4G9Z A;  1S22 A;  4JKA A;  3O5B A;  4JKC A;  3R8E A;  2NLX A;  1ATS A;  1ZC6 A;  4JKE A;  1U2V B;  4BR5 A;  5FPN A;  1QVG M;  1KC8 O;  1YI2 N;  3A5N C;  4RWT A;  3OA9 A;  5AFU A;  3FZF A;  3HOS A;  3E1Y A;  3L0Q A;  3E9O A;  3MCP A;  4NLB A;  4IO8 A;  2P9U B;  4PKH A;  1TYQ B;  3QBX A;  3C7N A;  4IXC A;  1YJW N;  4RCH A;  5AQU A;  1GLJ O;  3O4W A;  3T7Z A;  1HUX A;  4GV9 A;  4JEP A;  3D2F B;  3C0B A;  3LDP A;  1EQY A;  1BWF O;  3VEY A;  1Z6R A;  2A3Z A;  5BRH A;  3IMX A;  3KWG A;  4B1W B;  4OPH A;  4B9Q A;  4NB4 A;  3T69 A;  3ATV A;  1U6Z A;  2AA4 A;  3O1B A;  2YJF A;  3O8M A;  3RSE A;  4AF1 A;  4BQL A;  4JD2 B;  3OW2 M;  1TUY A;  4BRI A;  4J8F A;  1HJO A;  5DM6 L;  2ZJP L;  5GIO A;  5M1F A;  3HSC A;  1JCG A;  4EAH D;  4QS9 A;  2P9U A;  4CZK A;  1ZBS A;  3IDH A;  3Q7B A;  5M1N A;  3ENH A;  3NVK A;  2I7P A;  1YUW A;  1XQS C;  1NGE A;  4YOX A;  3MDQ A;  4BRD A;  4FL9 A;  4CBW A;  4WFB L;  3D2F A;  1GLF O;  2E20 A;  4JKG B;  4ILH A;  1NGD A;  2GWK A;  3TU5 A;  3GOI A;  3VGK A;  2FSK A;  3EKS A;  3O80 A;  5AQI A;  3P38 A;  2YI1 A;  4BRK A;  4JD2 A;  3ATU A;  3TTD A;  2D0O A;  4PKG A;  4BC2 A;  4BRM A;  4FWS A;  5AQS A;  3EKU A;  1M1K O;  1Q82 O;  1YIT N;  4IFE A;  1VQL N;  4WFN L;  4I6M B;  3D2E B;  3CCM N;  2BTF A;  2GWJ A;  3G6E N;  1KD1 O;  4JK9 A;  3R9P A;  1HKC A;  3FGU A;  3E9L A;  2KLA A;  5F1X A;  3WXM B;  4JKG A;  3VF2 A;  1YF5 L;  4MO4 A;  5FPE A;  3CXC M;  5JLF A;  1IG8 A;  1VQ7 N;  3DXM B;  2A40 A;  4YDU C;  5AZI B;  5HOO A;  5AQG A;  5BRE A;  1HKG A;  4WQ5 A;  5GAE P;  3DWL A;  3HRG A;  1ILY A;  3H1Q A;  2QI2 A;  4YOY A;  3TSU A;  5AZJ B;  1BG3 A;  4BRG A;  5I9E B;  3KWI A;  4I6M A;  3D2E A;  2E1Y A;  4BR0 A;  2D4W A;  2ZGZ A;  3H1V X;  3LDO A;  1QQN A;  5AQT A;  3BEX A;  3CJC A;  3EE8 A;  3OBY A;  3VGL A;  4DB3 A;  4YOT A;  2Q97 A;  3A5O C;  1K8K B;  2FF3 B;  5AQJ A;  3JXU A;  4BC4 A;  3BF3 A;  3DXM A;  1MA9 B;  2P9N A;  3C6H A;  4E1J A;  2CGJ A;  4XH5 A;  1OVY A;  3O9S A;  5AQY A;  4IWV A;  4IZ9 A;  4PHT X;  1QZ6 A;  3R3L A;  1NBW A;  3QIC A;  4IDH A;  4L3Q A;  3WT0 A;  3WXJ A;  3VEO A;  3LDL A;  2Q31 A;  2QWO A;  3ZYY X;  3CJ1 A;  2HBJ A;  2ASP A;  3AAP A;  3SMP A;  5C10 A;  2PFU A;  1BOT O;  3C6A A;  1X3M A;  3CCU N;  4YOW A;  4H0P A;  2YHW A;  3CC7 N;  1VQ8 N;  2PAV A;  4B1V A;  4Z94 A;  1K8K A;  4KBO A;  1BA1 A;  4JN4 A;  3GE1 A;  4OPA A;  2PBD A;  5AQX A;  2ITM A;  1K9M O;  2VCP A;  5BPN A;  3ZX0 A;  4FSV A;  1EO1 A;  4HWI A;  4BVO A;  2A42 A;  3QFP A;  1QQO A;  3CCQ N;  3ZEU B;  3CD6 N;  3MN7 A;  1K8A O;  3IUC A;  3LM2 A;  3R6M A;  3CCL N;  3D6R A;  4YOU A;  4QS7 A;  2VGN A;  4ISE A;  4JK8 A;  1WUA A;  3C7N B;  3MN5 A;  1T6C A;  3CQX A;  4H0O A;  4PL7 A;  3H46 O;  2FSN A;  4AM6 A;  4ILJ A;  3B8A X;  3H3O B;  5GAG P;  5F2R A;  1YAG A;  2OTJ N;  3UB5 A;  2V52 B;  3UKR B;  4FVU A;  2GTD A;  2P9K A;  3WXL A;  3OHR A;  3RSE B;  3R1X A;  4A2A A;  3E9P A;  1S3X A;  4IEI A;  2NRZ A;  4B1X B;  5BPL A;  1N8R O;  3ID6 A;  2QA4 N;  3D7E O;  3ZEU A;  4IOA L;  5EXW A;  4ILG B;  1C0G A;  4BG9 A;  5CE3 A;  3BF1 A;  5KPR A;  3HM8 A;  3MX2 A;  4K43 A;  3O6W A;  1BA0 A;  2CH5 A;  5FPM A;  3CPE A;  1NGG A;  3QB0 A;  3SK3 A;  5AQM A;  3FZM A;  5ADX A;  3P4I A;  3I8B A;  4FWK A;  4C23 A;  5AQF A;  3CCS N;  2A6A A;  5C15 A;  4A62 A;  5CHI A;  3F2K A;  3P31 A;  3SMS A;  5EOY A;  4H0T B;  1NGB A;  3M3Z A;  4AM7 A;  5C2D A;  3UKR A;  4H0V B;  2QWR A;  4GV6 A;  4F9O A;  4CZF A;  3VEN A;  1DT9 A;  3CCR N;  1RDW X;  2P9P A;  2IVP A;  3SBG A;  2WC9 A;  2HBL A;  3FFK B;  4ISF A;  1LOT B;  5JVH L;  1GLD G;  1SAZ A;  4CD1 A;  2ZJR L;  4CD3 A;  1QQM A;  3L4I A;  3CHW A;  5GIN A;  3ZX2 A;  2HBM A;  4GVE A;  4A5A A;  3A0I X;  1TUU A;  2NRR A;  3UE5 A;  2YHX A;  4NO7 A;  3I33 A;  4A2B A;  3MN9 A;  2V7Z A;  2IVO A;  4CBX A;  4BGB A;  1KAZ A;  1NGH A;  1YHQ N;  3VF4 A;  4WFA L;  3DJC A;  4H5T A;  3TPQ A;  2E2P A;  5AQV A;  5JLH A;  3O1W A;  2HF4 A;  4PKI A;  3ZX3 A;  2WUS A;  2QW9 A;  5KQ8 A;  3L6Q A;  4FO0 A;  1YXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...