2JWKA

Solution structure of the periplasmic domain of tolr from haemophilus influenzae
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
GSVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKALNLLHLAGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Periplasmic Domain of TolR from Haemophilus influenzae Forms a Dimer with a Large Hydrophobic Groove: NMR Solution Structure and Comparison to SAXS Data.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein
molecule keywords Protein tolR
total genus 17
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.270 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2jwkA00
2JWKA 2JWLA 2PFUA
chains in the Genus database with same CATH superfamily
4DQQA 2UUAK 4MDAA 3OVNA 4DU4A 4N41A 3KK3A 3O4WA 4FJJA 4G9ZA 5FRMA 1ZBSA 4WQ4C 2W6LA 3QFPA 2O4GA 4CF2A 4DR1K 4H03B 2JWKA 4MO5A 3NGYA 2F7TA 4YY3K 2HNYA 3ZSXA 4KHPK 4MFBA 1U47A 4BRFA 4H5NA 4O4GA 3PSFA 1QZ5A 1BU6O 4FJIA 1Q9XA 1S5JA 3TARA 1WLJA 1CXUA 3NFAA 3P31A 5I42A 1R0AA 1N33K 2O8EA 3H3NO 5CHIA 2B6AA 2QWLA 5BREA 1RT4A 3ZYYX 4YFUA 3C0BA 1O1WA 3OYAA 4QS8A 2E8AA 4RW7A 3SI6A 4JKEA 4WQ5C 3RRGA 4RWTA 1IBMK 1NBWA 4CEZA 1VSKA 3I33A 2NRVA 4EZ6A 3CC4N 1TK0A 3VESA 1HQUA 2D0BA 3VPZA 4GVMA 2Q1NA 3DLRA 2ZGZA 3AO1A 5FPEA 2HSTA 1EQYA 3C7NB 4W5OA 2CH5A 3A5OC 1NNEA 2QKKA 4CGFA 3QNOA 3BY5A 2ZJPL 1L5UA 4KPYA 2OPQA 2YKNA 2OPPA 5HRNA 3CCMN 3O9QA 3GE1A 3EE8A 3QNNA 4W5RA 4LH4A 4CD1A 3MX5A 3ZX2A 1HRHA 3A5NC 3I0RA 5HRSA 4YORA 4KHSA 2YNGA 4CEFA 4CCHA 1FJGK 3H1QA 2E4LA 2UUBK 1IKYA 1JXBA 4M63C 4DV2K 2W41A 3QO9A 3KLFA 4DUZK 5FROA 3SPYA 3UKUB 3JS6A 5BR8K 5HRPA 5DK5A 1YVUA 3EZWA 3UKRA 4OJRA 4CJFA 4I7FA 3L6QA 4NLBA 4BDYA 4CERA 4F8RA 1T44A 3QEXA 3THVA 1GOAA 3DXMA 3Q7CA 3NCIA 5AQVA 3DLHA 3VEYA 4BVPA 5J2MA 2ITMA 4DHYA 1JLFA 2NZTA 3TU5A 3LP0A 1T7PA 3NF8A 4I6MA 3LZIA 4I9QA 3L0QA 4JKHA 4YDUC 4JHDB 5GINA 2OTJN 4DFJA 1H1VA 2KZMA 1RT2A 3DM2A 4H5WA 4CIFA 4FJ9A 1BDGA 1ASUA 1KVBA 4FK2A 3O3GA 1T8EA 2PZSA 1UWBA 5SZTA 3OA9A 3CC7N 4BY9C 3EEQA 2F8TA 1NGBA 4DFPA 3QMLA 3TANA 3PIOL 3K9KA 2CGKA 4AHTA 1QVFM 4GKKK 5JVHL 2HOEA 4BE1A 3DXMB 3EO3A 2P9IB 2YI1A 4M3XA 1HPZA 1MDUB 4I9LA 2YX6A 3K5LA 3ULEA 1K8KA 5T7BA 3R3LA 4YOWA 4IOCL 2E88A 1W2BM 3LAMA 4M3WA 1DTTA 1X9MA 3NGIA 3V6DA 1RT3A 4X65K 1W7AA 2E2PA 5FPMA 1TKDA 4V19S 3SMPA 5HLFA 4WYBA 1BIUA 3FFIA 4CZEA 1U04A 3CFOA 3NF6A 3ZSQA 4FLVA 1Q82O 1BWFO 4J8FA 1GLCG 1M1KO 3DYAA 1E4GT 4NXMK 2YHXA 4B9LA 5AQXA 4DTPA 2HHWA 4KV8A 1GLDG 2VWBA 5AJ3K 4BR4A 3M8QA 3EL2A 3WNEA 3WXIA 4CHQA 2O8CA 1WAFA 3HVRA 4X66K 5K14A 4LF9K 3L2VA 3OYGA 3L2QA 4JD2B 4N5SA 4FJ7A 1NGIA 1XHXA 3B8AX 1W97L 4IO9L 3C6AA 1BG3A 4W5QA 3P5JA 4IJAA 3TABA 4CHYA 2XY7A 3AVLA 3V81A 4AILC 5GADP 4JKGA 3KLHA 4FPAA 3QERA 4JKBA 2OCEA 5KPTA 4O5FA 1L3UA 1SS6A 2ZQBA 4CGIA 4JI3K 2PAVA 4FW1A 3NGZA 1RTHA 3UE5A 3AVJA 4CEQA 4XEIA 5TKYA 3QETA 4M3TA 1WBDA 3O08A 4H0VB 1P8ZA 2ZWHA 3JYTA 3FZFA 2P9NB 1EO1A 4X62K 5J2PA 5H1SQ 4BRHA 4B3MK 5CYMA 1REVA 4JI0K 3RMCA 1HYSA 4DFMA 1VSMA 5JLFA 2X74A 2O8DB 1J53A 1VSIA 3C94A 2FSJA 4YOYA 1OH7A 3VEZA 3SAFA 2P5GA 4F3TA 5KRSA 1BA0A 2P51A 4OKKA 4PWDA 3MECA 3OS1A 3BZKA 4DTOA 4JV5K 1JL1A 3VA0A 4BC2A 4CF9A 1T6CA 4BR2A 3R9PA 4CECA 2P9IA 4FJKA 1NU0A 3NDKA 2QK9A 4CK2A 1NJXA 5F0XA 2W42A 4JYAK 4I2QA 4DQSA 1W9HA 3KLEA 1LAWA 2VYPA 5C2FA 2IGIA 2GUPA 2HMPA 3B6PA 3MN5A 2GEMA 4BRPA 2G8IA 1KAZA 3OYFA 3M8PA 2P1JA 1Y97A 4DUYK 1KSPA 3P83D 4OGEA 4AHVA 5AZIB 4UQGA 1G15A 3TAEA 3O9RA 1TL1A 3AVAA 3M8RA 1XUPO 2CH6A 5AFUH 2HBJA 2KZZA 3IMXA 4LH5A 5C24A 1D8YA 2GV9A 1DGKN 1NWKA 3QBXA 1XNRK 3LDLA 4MLEA 4W5TA 4FPBA 2NUBA 4HWIA 2NRTA 4CIGA 3DLBA 1K6YA 2IIRA 4C23A 3OYDA 3PLAA 4CJPA 4BGAA 4DF8A 5AQIA 3CETA 3MWTA 3AVMA 4B08A 4CEBA 1RDWX 4M3ZA 4NYFA 4KREA 1RT7A 1N36K 3LDQA 5CYQA 3HM8A 1C0GA 3SAGA 4E1JA 1B9FA 2G8FA 3PIPL 1E4FT 1BGXT 1S6QA 2W6KA 2XRIA 3ENHA 3OTOK 1CLQA 3T1HK 3E01A 1HMVA 3ZSRA 1X9JA 1NJWA 3TAQA 4A62A 1JLCA 5LJVA 3TAFA 4Q0BA 4IG0A 4BGBA 5AQNA 1IH7A 5BRDA 1MWMA 2O8EB 1OVYA 1WSJA 4HUGA 4XH5A 3CJ9A 1A5VA 3CPWM 4FLZA 3K0SA 4CJUA 4YOTA 1N5YA 2ZGYA 4OX9K 2WBNA 3A5LC 1NGGA 3SJJA 3S3NA 2O8CB 3SBGA 3CCEN 2BH1A 3SUQA 3G71N 4QCLA 2XHBA 2D0OA 2NRRA 3GOIA 4Y1CA 1P90A 1HNXK 2Z1JA 2X78A 3CJCA 4OLBA 4Z0UA 1UA1A 3CERA 1HNZK 3U4LA 3LM2A 4HCBA 1VQ6N 1QE1A 2HHUA 1UA0A 3KKSA 3HSCA 5CE3A 2NRZA 3L2WA 3SQ1A 2KTQA 4BR5A 3KWIA 3AVGA 3D2FB 2QXFA 1QQMA 3ENOA 1IKWA 2ZD1A 3CYMA 3RMDA 4B9QA 1LCUA 3R6MA 1LWEA 3MX2A 4BE2A 4CF1A 4B1YB 3ULDA 2RPIA 3TR8A 3GG4A 1HQEA 2HHHK 2WUSA 3HXMA 2G8UA 1ZBFA 3CJ1A 4FJNA 1ZBLA 3AVHA 5IT9O 3FZLA 4RW8A 4DMNA 1NK5A 4BDZA 3MXJA 1HKBA 2E2OA 5TKWA 5KPZA 3F2KA 5M1KA 5ADXH 5GIOA 1EETA 5FPDA 3HBTA 3C6TA 1JCEA 5AQOA 3MN7A 1WUAA 3NF7A 1FK9A 4NB4A 4FM0A 4GKJK 4C8NA 5KQ8A 2E6LA 4IFVA 4JEPA 4PL8A 4DQ8A 4ICLA 1IG9A 2B5JA 2IDOA 3ID8A 3DRRA 3ZT1A 4NLCA 2GBZA 3HOSA 1I39A 2A40A 5EY4A 4KFBA 2RHKA 4KHNA 5AZJB 4DQRA 4CEEA 1GLAG 2X6SA 3C6HA 4OPHA 4J2EA 1ASWA 3O8MA 1SAZA 1RT5A 4GMJB 3T19A 4BC5A 1OH6A 4C8KA 3MWPA 4FWSA 4FL9A 3DXKB 3ZT3A 4Z4GA 2VG6A 1HNWK 3C6UA 4BRQA 4AM7A 1LWFA 1OKJA 3T1YK 4ELTA 3K5OA 4FZZA 3TAPA 3PV8A 1RDUA 3HSTB 5FPNA 3G10A 1KAYA 3I55N 4NYNA 3V1QA 5SWMA 3NMUA 3VQ5A 3K59A 4L8RB 3N4PA 1TAUA 3J7AP 2Q97A 4N47A 2PY5A 4BRDA 3KD5E 1GLBG 3CCLN 2ZM6K 3ZX3A 1YI2N 1I3AA 1RTIA 3HZ6A 3G25A 3D2EA 2I5JA 4A57A 2KKZA 3U6FA 5KPRA 3ALYA 4B3OA 4IEEA 4IFEA 1ATRA 3D2EB 3KD1E 4CF8A 4CHNA 1JCFA 4YDUA 1VQ9N 3DWLA 5AQLA 3WXJA 5C25A 4QS9A 3OYBA 3SZ2A 3L3UA 2A6AA 3VERA 3EN9A 1NGEA 2WONA 3RWUA 3MK6A 2JWLA 4CIEA 2V52B 5EOYA 3ULEB 2FBXA 4BG9A 3CM5A 2GWKA 1QQNA 3LANA 2HHXA 3FZMA 4F2RA 4BQZA 2YJFA 4DR5K 4EHUA 1VQMN 2W40A 3L3VA 2WC9A 3V9XA 1B9DA 2UYTA 4EP4A 4I2PA 4CBUA 4B1XB 3CIPA 3VGLA 4OKJA 1ZYQA 1X1PA 1VSDA 2PYJA 4IOAL 1VK0A 4H0YB 5J2NA 4FJMA 4IFYA 2DFEA 4C8MA 2QWNA 5J2QA 3OY9A 2HHQA 2AJQA 3R8EA 3CMAN 4B8AB 3GL1A 1WB9A 4DTJA 3KWGA 1YIJN 3SUNA 1SUQA 1TAQA 3ZSZA 1VSEA 1U48A 2ZF5O 4O55A 1KFSA 4DLGA 4Z94A 2HNZA 4CJTA 1GLEG 1OVQA 3BP8A 4AM6A 3NVKA 3WQUA 3HL8A 3LDNA 2HW3A 1YAGA 1HJRA 3NH1A 2HVIA 4ELUA 4WQ5A 3LWMA 2FSKA 3TAGA 4DTSA 4RW9A 4CZJA 1NGDA 5JICA 5D3GA 3FLCO 1J9AA 4FW2A 2BGGA 4CJWA 2P9KB 1Q18A 4LSLA 3SJHA 4CZGA 4KAZA 2OPRA 2XY8A 3NHGA 2R7YA 1JLGA 3VGKA 3VQBA 4CHOA 3MCPA 1BUPA 1XQSC 2FBTA 5EXWA 1RT6A 4GNIA 3A2FA 4LFAK 4FWPA 4E19A 4BR9A 3QEIA 4RG8A 5AQTA 1NK6A 4DU1A 4DTMA 4BR7A 4FWQA 3ATVA 2GUIA 3ZSVA 1ILYA 4UY8O 3THYA 2O8FA 3GBTA 2OZMA 2IS3A 1CZBA 1WNSA 1HKGA 4PA1A 4JD2A 4BR0A 5HROA 2QWQA 4CEOA 3MXMA 3NH0A 3ZT4A 4K8XA 3SQ4A 2I7PA 1KXPA 1ZBHA 1Q8IA 4KH4A 3HOTA 3V9UA 4CJRA 1VAZA 4E1MA 4JI1K 3M3ZA 4B9MA 4ILGB 1RTJA 1RGIA 3CJBA 5AZIA 4M42A 3VQEA 3QLHA 4KTWA 1I94K 3FGUA 3DLEA 1U45A 3CHWA 3P1GA 3VQPA 3DRSA 4ZHRA 1K9MO 4B1VA 4E3SA 3AVKA 3AVFA 1U2VB 4CVNE 1VRTA 2P9SA 1W0HA 1ZXOA 1TK8A 2DY4A 3IKMA 4B9VA 3OYEA 3FE1A 2VQEK 5CZ2A 4CJEA 4KKOA 4LY7A 2EHGA 3AA4A 3VQ9A 1EXQA 2IAJA 2J4RA 4FZXC 1CZAN 3HYFA 3O4NA 3ASMA 3VQCA 5B8HA 4FWMA 2D4WA 4K41A 2Q2RA 4JI7K 1Q7YO 5GAHP 4N76A 2HHVA 3SMSA 1YITN 3DLKA 3SUPA 4CFAA 5BPMA 1U4BA 4LFBK 2WOMA 1G99A 4H4OA 1B92A 4GV3A 2QWOA 3F5TA 3NE6A 1SKSA 2P9UB 1XHZA 2GWJA 3KK2A 1NGFA 3TAMA 3ZCMA 1BIZA 3KK1A 2QEXN 4ID1A 1X9SA 2FXUA 1KLMA 1BOTO 4N56A 3SV4A 2HHTA 3WUHA 2RE2A 3M8SA 3KK7A 1LV5A 1JXEA 2FBVA 3LZJA 4CJQA 4EIAA 1U2VA 2GELA 2FLOA 3MXIA 4BRIA 4WFNL 1LAVA 2QTDA 2A1RA 4AHSA 1VSHA 4KHUA 1L3VA 4H8KA 3L4QA 1ATNA 3O1BA 5AFUA 4LF6K 3EYZA 1C0FA 3VQ7A 4BRLA 2GX9A 2ZJRL 5DM7L 2CGJA 2F9TA 3IUCA 4CFCA 1NK7A 3EZ5A 3VF4A 4DCHA 4CJSA 4GV9A 4JI5K 5AQSA 2UXBK 5M1OA 1VHXA 2X6NA 4AHRA 2UXDK 1NGJA 3PO4A 2QA4N 3PY8A 4CK1A 4IO8A 2ZJQL 2D1KA 5KQDA 2D0CA 4KHYA 4OVLA 2E1YA 4YOVA 1FW6A 3J80O 4JHDA 1TKZA 3IDHA 2EWSA 2YJEA 3T7ZA 3WXLA 4JRQA 4A5BA 3ZT0A 4KHQA 2E2NA 3OYHA 1X3MA 1WN7A 4JRPA 3RVCA 5LMUK 4MLHA 3OYLA 1C6VA 1C1BA 3U9ZA 3ZSYA 1F21A 4LFCK 1S3XA 4LC9B 3EY1A 1S9GA 3V9ZA 2P9SB 3VQDA 2IVNA 1BCOA 4FXDA 1JL2A 4LF8K 4DB3A 3O1WA 4IDHA 3U3GA 2I7NA 3AO5A 4KH5A 5AQRA 4BC3A 2QWMA 3WEEA 1SZ2A 2P9LA 4BRKA 3LM9A 3CQYA 1VQ4N 3OHRA 1QS4A 3NH2A 3D7EO 2HBMA 1HKCA 4OPKA 3J8AA 1XC9A 3JXUA 3VQQA 1SQKA 2D5RA 3KHYA 2E2QA 1JKHA 2RN2A 2IOCA 1DLOA 2OA8A 4XH4A 2OYQA 1S1VA 3QEWA 4PKIA 3OS0A 3FFKB 3J81O 3HJFA 2FF3B 1QSLA 1XMQK 3N4QA 3AA3A 3AVNA 1S1UA 2G8WA 3OBYA 3IFRA 3I0SA 2B4JA 5AQMA 4Y1DA 4C8LA 3LP1A 3THWB 1NK8A 1NKBA 3FZKA 3ISNC 5AQFA 2NNWA 3VQ4A 3SLCA 3DLGA 3A0IX 4WFAL 4JN4A 5BN9A 1TVRA 4PY5A 2QWPA 1NGCA 4CF0A 3VF6A 5LL6Z 3CCUN 1TUUA 2XO7A 3T3FA 5CZ1A 1YTAA 3TWHA 4A2BA 3RMBA 4PQUA 2VWJA 4K0KK 4RW4A 3O4QA 4BACA 4NCBA 4M3RA 3O9SA 3AVIA 3VA3A 1YT3A 3TSQA 4GVEA 1WAJA 4WFBL 1KLNA 2KQ2A 1NK4A 2VGNA 1QHAA 4CZMA 2H3GX 2D0AA 4HUEA 1C1AA 2PYLA 1S9EA 3LPTA 5JVGL 2F9WA 3MEGA 3CFPA 3HO1A 4ISGA 3DOKA 2PFUA 2KFZA 3TSPA 5F1XA 5M1QA 4JI6K 4A61A 1NK0A 4CZKA 2A41A 4B3RK 4KI4A 1XNQK 2BANA 2P9UA 1JJ2M 3VEWA 3E9PA 3D0PA 4Z4CA 4IOXA 2HF3A 3PX0A 2OZSA 1Z25A 1JCGA 3TTCA 1RBUA 1IKVA 1BI4B 4ISFA 1NMDA 5BN8A 5BRFA 3OYNA 2YCHA 2Q3SA 5FDLA 3K58A 1J5OA 4A5AA 1S72N 3CQXA 4ELVA 3HPGA 1QTMA 4AQYK 3B6OA 2Q36A 3PX4A 1S6PA 3G4SN 1RTDA 4F9OA 4BREA 5C42A 3TI0A 3C65A 3P39A 3OJUA 5HBMA 2HB5A 2UUCK 1SV5A 1IBKK 3LL3A 1DTQA 3C95A 4E7LA 1YJ9N 3L2RA 5AQGA 4WF9L 3LDPA 4J2BA 5EVZA 2E1ZA 4CJVA 1T05A 4OGCA 1LW0A 1RBVA 3D2FA 3I8BA 1VQ5N 5HRRA 4ISEA 1HYZA 5E41A 4DV6K 3QEPA 1BCMA 3J7ZO 4JI4K 1VQON 4CI6A 1RT1A 3EKSA 2WTUA 4B3SK 4FVUA 3CCRN 3D6RA 4KB1A 2QM1A 1SKWA 1V4TA 4CZIA 2NLXA 3THWA 1NKEA 4RTFD 4CZFA 1TUYA 3TTFA 2OANA 3H1VX 4IG3A 3S3MA 3MN9A 2ASOA 3QIOA 1QQOA 4PL7A 4YOUA 1Z05A 3SPZA 4QS7A 2QXLA 3UB5A 4DR3K 5M1FA 3U3YA 5JS2A 1SKRA 1FKPA 3R1XA 3SUOA 4DV0K 1UOCA 3WXKA 3AY9A 3W0LA 3THYB 1U49A 4JKCA 3WEEB 4JKGB 2DFFA 1FXXA 3AVBA 4FCYA 1BA1A 4CGHA 3O6WA 4AHUA 4FJGA 1VSJA 2IVOA 3RR8A 4O5BA 3M6GA 3AVCA 1T03A 3CC2N 4IKFA 3F9KA 3H45C 1E3MA 1J54A 2RKIA 1J5EK 4BDPA 5JS1A 2VG5A 1VQLN 3V9WA 5M1PA 5ELZA 4WQ4A 4J2AA 1KQSM 4FJHA 2P9NA 3KLGA 3WNFA 4A59A 4A2AA 3LPUA 1YTUA 4DR4K 1S22A 3AA2A 3PSIA 3PX6A 4Z4HA 4CE9A 4DSKA 1V4SA 2HBKA 3QBWA 1YF5L 3RRHA 5J1EA 2E5LK 3K57A 1BI4A 4M3UA 2KFNA 1NJYA 4DWIA 4E7IA 1XI1A 4L3QA 4Z4FA 1GLLO 5BRHA 3CF5L 1VSLA 4OKEA 4GY2B 3SV3A 2YHYA 3MDQA 5FRNA 4B1UB 1NLVA 2HMIA 3RTVA 1MWKA 2Q0UA 2O8BA 4H5TA 2BDPA 4DQPA 3HRGA 1VQ7N 1K8KB 5AQQA 4DG1A 4B9NA 4FOEA 3QESA 4K8ZA 3CI5A 5AR0A 2VCPA 4LD0A 1WSHA 4FJ8A 4MDBA 3O9TA 4CZLA 2Y1IA 1HR0K 3O3FA 2ZE2A 4DSEA 3GDQA 4C1NK 1NJZA 4E7HA 1YJWN 3JAMO 4JS5A 1N8RO 3HPOA 3SCXA 3ZLJA 4NCAA 3SYZA 3HT3A 5GAEP 4B9UA 1JLEA 2YHBA 3MMVA 3O9UA 1RFQA 2YHAA 1A5XA 4PKGA 1FKOA 1JLAA 3OBWA 4M7XA 4DV4K 5EU7A 5AQHA 4ILJA 4BRCA 4DKWA 4E89A 2IC3A 1KVCA 3QINA 4DV1K 1QSSA 5CR4A 3MAQA 3VEOA 4CBWA 3KVGA 1Q86O 2HVHA 5IWAK 2Z1HA 1O13A 3M1FA 2YKMA 1GOBA 1LWCA 4KHWA 1RDDA 4DQIA 3VOVA 2VQFK 1K8AO 4FJ5A 2DFHA 1C1CA 4FWRA 3HTVA 4CEAA 4HVJA 4CJ4A 3Q7BA 1TK5A 1EKEA 1RDAA 3UKRB 1RBTA 1J6ZA 2KW4A 4U67L 1RDBA 3DJCA 4FLWA 4CFDA 3THXB 1L3SA 3CM6A 4LSNA 2HF4A 3DLLL 3OW2M 2F8SA 3U8XA 1KRPA 2G8KA 1UAXA 5BR9A 2YNIA 4OPAA 2ETJA 5C2DA 3DOLA 4E0DA 4FLXA 3JSMA 1BQMA 2F4VK 1WOQA 1ESVA 3EE9A 4B9SA 4H0XB 2A3ZA 3LDSA 2Z1IA 3OYJA 3VF2A 4WE1A 4JKFA 4CGGA 3L4IA 3W3DA 2P5OA 4IZ9A 1D9DA 1VRUA 4JI2K 2A1SA 2NRXA 3PUFA 3CJAA 3WNGA 3VENA 4FWKA 3BZCA 4DV5K 4ZTJA 4CJ3A 1LW2A 3MN6A 3VEVA 4BRAA 1BL3A 3ENBA 3I56N 1TKTA 3L2UA 1KFDA 2F96A 4BROA 4IJNA 4DSLA 2QI2A 4E7JA 4K43A 2FC0A 3VQ8A 1TKXA 4E1NA 1NKCA 4M3YA 3WT0A 3HM9A 2YNHA 3K9JA 4RW6A 4CFBA 3HPHA 2V7YA 4C8OA 4DSJA 3QICA 1NGAA 5M1NA 4NXNK 4FWLA 1KAXA 1U6ZA 3CFRA 1KD1O 4JNEA 4IEIA 1S1XA 2UU9K 4IDKA 5AZJA 1BHLA 3ZEUB 3E9LA 4YHHK 2KHOA 2KLAA 2Y1JA 4FWNA 1JLBA 1TYQA 3H6EA 3CQ8A 4KTZA 2E20A 4B9TA 3THXA 3IRXA 3H46O 3MCAB 4IXCA 1D5AA 4DLEA 3RR7A 1BISA 2P9KA 2O8DA 4HCCA 4O8UA 1BQNA 2XY5A 1LOTB 4PHTX 3H3OB 1MA9B 1DT9A 4DTXA 2YV0X 4KBOA 3SK3A 1VQKN 1KTQA 5GAGP 4MQ3A 3QEVA 3DRPA 2IVPA 2OTLN 2O4IA 4EP5A 4FSVA 4JK8A 3AGKA 1WSEA 3V1OA 3WNHA 3OYKA 4ZTFA 4CGDA 3HK2A 1DEJA 5AQPA 1Y64A 3DMJA 4BE0A 3UIQA 4LF5K 2BUPA 2WFBA 2GTDA 4H0PA 2LSNA 2NRWA 5C15A 3P4IA 4CJLA 3LP2A 4JAXA 3O3HA 5AQYA 3KJVA 5FLXO 4O0JA 4I6MB 3BDPA 1C0MA 4CBXA 4YNQA 4ILHA 3AAQA 3CXCM 3NBPA 3F73A 1N34K 4TSXA 4FOIA 1HX1A 5KRTA 3AO3A 1QZ6A 4F3OA 4AHCA 1X9WA 1QVGM 1YVNA 3SQ2A 4FM2A 2V51B 4BG8A 3IAYA 3FR0A 4CK3A 2G8VA 4RCHA 2NRHA 1CZ9A 3LAKA 3WXMB 4K25A 1HNVA 5DMRA 2Q31A 4O44A 4KB0A 3AGRA 2HBLA 4O8KA 2RF2A 1WSGA 5KGXA 4Y0WA 2YHWA 1RDCA 1EP4A 4KTQA 2QW9A 1Q9YA 3VTIA 2P9PA 1SL1A 4BRMA 4WCEL 5BPLA 3KLIA 2P9PB 1NM1A 2FF6A 3QFUA 3BF1A 4DU3A 4FVMA 4H0OA 4CJ7A 4B8CA 5HP1A 2ASPA 1NOYA 3T69A 2Q0RA 4R5PA 3AA5X 3HVTA 4JKDA 1WSFA 3LWLA 2JLEA 4Z4IA 4QAGA 1HUXA 2BE2A 4BWJA 3ZSOA 5I9EB 4XIUA 1CXQA 2VGMA 3HI0A 4IBNA 1YHQN 1X3NA 2JGUA 3KIOA 1KCFA 5AQKA 4FYDA 4DR6K 1IBLK 3DXKA 1OH5A 3H08A 3ZETB 3OYCA 3L8BA 3U9DA 5AQZA 2ASMA 1C0UA 1Z6RA 3FZHA 4OPJA 4FK0A 4B1WB 4R79A 1VQ8N 2D0PA 4FK4A 4F2SA 4F4KA 4Z4EA 4PKHA 4DSIA 4CJKA 4EAHD 3ZX0A 3IS9A 1HPMA 4FM1A 3K5NA 3LP3A 1M90O 4CHZA 5AQUA 1SL2A 5KTQA 1S1WA 2XY6A 3VEXA 2QKBA 1ATSA 3J7YP 3QDKA 4LF7K 1JLQA 4NO7A 4CHPA 4O0IA 3VN5A 4DTNA 1RNHA 3NVMA 4B1ZA 1IV0A 3C7NA 1Z26A 1GLFO 4AF1A 3ZSWA 2DPNA 4B3TK 4FJLA 1XWLA 2A42A 3V1RA 4C1NI 3PO5A 2HNDA 3BEXA 1IG8A 1RBSA 1NMNA 4KI6A 4KRFA 4JK9A 4Q5VA 3A5MC 3MEEA 4JKAA 4LF4K 3EKUA 3K2PA 3ZEUA 4CZHA 2YNFA 1TYQB 5HOOA 1VSFA 3VQAA 4DTUA 4DR7K 4J2DA 4KH6A 3ITHA 4HHTA 1MU2A 1HLUA 4CGJA 3V9SA 3A8YA 1NJIO 5AQJA 3NF9A 2G8HA 1R59O 1Q81O 4JLHA 3TPQA 3I8DA 1NG9A 3KZBA 5JLHA 2EX3A 1IO2A 5CY4A 4NCGA 4AH9A 3VQ6A 4U7BA 3S41A 3SAHA 2Z1GA 2FSNA 4OLAA 3CPEA 4JK7A 5HL7L 3OYIA 1L3TA 1VQNN 3F9MA 3KTQA 3T1AA 1N6QA 5BPNA 4EFHA 4H5VA 5F2RA 2QWRA 4DSFA 2V7ZA 3CD6N 4XH1A 4BWMA 4HTUA 4QOZB 4ID5A 4HTLA 1A5WA 3OS2A 1GOCA 3MEDA 4M41A 1D9FA 1BO5O 3E1YA 3E9OA 3O80A 5E26A 1YJNN 5E84A 1S1TA 1YUWA 3M5RA 4GW6A 4W5NA 1N32K 4DS5A 3ZETA 4YOXA 4GV6A 4EHTA 3LALA 2ATQA 4BRGA 3CCVN 3ATUA 1DKGD 4HUFA 1NK9A 2E6MA 3CCSN 1EWRA 4FLUA 1XC3A 3CJ7A 1EX4A 1TGOA 4EZ9A 3AARA 3VGMA 3OYMA 4BVOA 3VETA 5KGWA 1T3VA 3AO4A 3AV9A 3QB0A 5LJWA 3NAEA 2DTUA 3S3OA 3BGRA 3RMAA 2CGLA 3TTDA 4FLTA 5KI6A 1WSIA 2FBYA 3HP6A 1IJJA 5MLCQ 3CCQN 3CMEN 4IWVA 1RCHA 3KKRA 3O5BA 4CD3A 3G6EN 3VMFB 2OPSA 2ITGA 3SBTA 4K42A 3AAPA 1VQPN 2A5XA 2O8BB 2BTFA 4H5RA 3RSEA 1RILA 1TV6A 1ZC6A 1ZBIA 4DTRA 3BF3A 1D4XA 4DV7K 4OO1J 2VG7A 2UXCK 3V4IA 5C0YA 3DAWA 1TL3A 4KO0A 1GLJO 5DM6L 1HYVA 1QQCA 1EWQA 5C12A 4FLYA 1WBBA 3SQ0A 1NGHA 1HJOA 3VTHA 1OH8A 1C0TA 2VWKA 3ID6A 5AQWA 3AO2A 1QSYA 1NOZA 4CW7B 2AA4A 1RBRA 3DI6A 4BRNA 5JMVA 1K73O 4FJXA 3S9HA 1ZBUA 4X64K 1KC8O 4DV3K 4JI8K 4JS4A 4DFKA 4H0TB 3UKUA 3SNNA 4G1QA 3LDOA 2O8FB 2AP1A 3HP9A 4BQLA 5A2QO 4DF4A 3E66A 1SL0A 4M7YA 4MO4A 4M45A 4CJ5A 4FO0A 4PUOA 1QHTA 4CESA 5LY3A 2P9LB 5EX5A 5ADXA 4CEDA 3D45A 4FWOA 4FZYA 5I3UA 4H4MA 1T6DA 3WQTA 2PBDA 1ITGA 5C10A 3BUZB 5GIPA 3G0ZA 3QIPA 4DR2K 3OJSA 1XMOK 2HHSA 3ZT2A 1KVAA 1ASVA 1HNIA 3K5MA 4BC4A 3TSUA 3RSEB 3CCJN 4E7KA 3P38A 1YXQA 1IKXA 3IG1A 5LMNK 4DS4A 3CG7A
chains in the Genus database with same CATH topology
2YJEA 4MDAA 3T7ZA 3WXLA 3MN6A 3O4WA 3VEVA 4BRAA 2D0OA 3ENBA 4A5BA 3I56N 4G9ZA 2NRRA 3GOIA 4BROA 2E2NA 4IJNA 1P90A 1ZBSA 4WQ4C 1X3MA 2QI2A 3QFPA 4K43A 3RVCA 3CJCA 3WT0A 4H03B 4MLHA 3K9JA 2JWKA 4MO5A 3CERA 2F7TA 2V7YA 3LM2A 3U4LA 1VQ6N 3U9ZA 3QICA 1NGAA 1S3XA 3HSCA 4LC9B 4BRFA 4H5NA 2P9SB 5M1NA 1QZ5A 1BU6O 5CE3A 2NRZA 2IVNA 4BR5A 3P31A 4FWLA 1KAXA 3KWIA 4DB3A 1U6ZA 3D2FB 3O1WA 4IDHA 4JNEA 1KD1O 1QQMA 3H3NO 4IEIA 2I7NA 3ENOA 5AZJA 4KH5A 5AQRA 3ZEUB 4BC3A 5CHIA 2QWMA 2QWLA 3E9LA 1LCUA 1SZ2A 2KHOA 2P9LA 3R6MA 4FWKA 3MX2A 3WEEA 4B9QA 4BRKA 5BREA 3LM9A 3CQYA 3ZYYX 1VQ4N 3OHRA 4B1YB 3D7EO 2KLAA 3C0BA 3GG4A 4FWNA 1TYQA 2HBMA 1HKCA 2E8AA 3H6EA 2WUSA 2E20A 3J8AA 4QS8A 3JXUA 3CJ1A 4JKEA 1SQKA 3H46O 3MCAB 4IXCA 4WQ5C 4RWTA 2P9KA 1NBWA 3FZLA 3KHYA 2E2QA 3I33A 4O8UA 2NRVA 1LOTB 4PHTX 3CC4N 4XH4A 3H3OB 1MA9B 3VESA 1DT9A 4PKIA 1HKBA 2E2OA 3FFKB 4KBOA 5TKWA 3SK3A 5KPZA 1VQKN 3VPZA 3F2KA 5M1KA 5ADXH 5GAGP 2Q1NA 2FF3B 5GIOA 2ZGZA 3N4QA 5FPDA 3HBTA 5FPEA 2HSTA 1EQYA 2IVPA 3C7NB 2CH5A 2OTLN 3OBYA 3IFRA 4FSVA 4JK8A 3A5OC 3AGKA 5AQMA 1JCEA 5AQOA 3MN7A 2ZJPL 1WUAA 4NB4A 1DEJA 3FZKA 5AQPA 5KQ8A 1Y64A 5AQFA 4JEPA 2NNWA 3CCMN 3O9QA 4PL8A 3SLCA 4DQ8A 3GE1A 3A0IX 3EE8A 2BUPA 2WFBA 3ID8A 2GTDA 4WFAL 4JN4A 4H0PA 4NLCA 5BN9A 3MX5A 4CD1A 2QWPA 2NRWA 5C15A 3ZX2A 1NGCA 3HOSA 2A40A 5EY4A 3A5NC 3P4IA 4YORA 2RHKA 3VF6A 4JAXA 3CCUN 5AQYA 3H1QA 5AZJB 1TUUA 4M63C 4I6MB 2W41A 1GLAG 4OPHA 3C6HA 4A2BA 3O8MA 1SAZA 4CBXA 4BC5A 3MWPA 4ILHA 3AAQA 4FWSA 3JS6A 3UKUB 3CXCM 3O9SA 4FL9A 3DXKB 3EZWA 4FOIA 3UKRA 3TSQA 4AM7A 4BRQA 3L6QA 1HX1A 4GVEA 4NLBA 4WFBL 1QZ6A 1OKJA 1T44A 1QVGM 2VGNA 1QHAA 1YVNA 1RDUA 3DXMA 3Q7CA 5AQVA 2H3GX 5FPNA 3VEYA 4BVPA 4CZMA 1KAYA 2V51B 3I55N 4BG8A 5JVGL 2F9WA 3FR0A 2ITMA 3NMUA 4RCHA 2NRHA 3N4PA 4DHYA 4ISGA 2NZTA 2Q97A 3TU5A 3WXMB 4K25A 2PFUA 4BRDA 1GLBG 4I6MA 3CCLN 2Q31A 3TSPA 5M1QA 5F1XA 4A61A 3AGRA 2HBLA 3ZX3A 3L0QA 4JKHA 4O8KA 4YDUC 4JHDB 4CZKA 2A41A 5GINA 1YI2N 3HZ6A 2OTJN 3G25A 4Y0WA 1H1VA 3D2EA 2YHWA 2P9UA 1JJ2M 3VEWA 3E9PA 2QW9A 4H5WA 4IOXA 4A57A 2KKZA 1BDGA 2P9PA 3VTIA 4BRMA 5KPRA 2HF3A 4IEEA 4IFEA 1ATRA 3D2EB 4WCEL 5BPLA 1JCFA 4YDUA 1VQ9N 1JCGA 3DWLA 5AQLA 3TTCA 3WXJA 4QS9A 4ISFA 2P9PB 1NM1A 2FF6A 2A6AA 3QFUA 3VERA 1NMDA 5BN8A 3BF1A 3EN9A 3OA9A 1NGEA 5BRFA 3CC7N 4BY9C 2YCHA 4H0OA 4CJ7A 4A5AA 1S72N 3CQXA 3MK6A 1NGBA 2JWLA 2ASPA 2V52B 3QMLA 5EOYA 3PIOL 3K9KA 2CGKA 3T69A 3ULEB 2Q0RA 4BG9A 2GWKA 2Q36A 1QVFM 1QQNA 4JKDA 3G4SN 4F9OA 4BREA 5JVHL 3FZMA 4BQZA 2YJFA 1HUXA 3C65A 3P39A 5I9EB 2HOEA 3DXMB 4EHUA 3EO3A 2P9IB 2YI1A 3LL3A 2W40A 1VQMN 1MDUB 2WC9A 2VGMA 1YJ9N 2UYTA 3HI0A 1YHQN 1X3NA 2YX6A 5AQKA 4CBUA 4B1XB 5AQGA 1K8KA 3CIPA 3ULEA 3VGLA 3DXKA 4WF9L 3LDPA 3R3LA 3ZETB 5EVZA 2E1ZA 4YOWA 2E88A 3U9DA 4IOCL 5AQZA 2ASMA 1W2BM 4IOAL 4H0YB 1Z6RA 3FZHA 4B1WB 4R79A 1VQ8N 3D2FA 2D0PA 3I8BA 1VQ5N 4ISEA 4PKHA 2QWNA 4EAHD 2E2PA 3R8EA 3ZX0A 3CMAN 5FPMA 3GL1A 1HPMA 3J7ZO 1VQON 4CI6A 3SMPA 3KWGA 4WYBA 1YIJN 4CZEA 3EKSA 1M90O 4FVUA 3CCRN 3D6RA 1Q82O 1BWFO 5AQUA 2ZF5O 4J8FA 2QM1A 4Z94A 1GLCG 3VEXA 1V4TA 1M1KO 1ATSA 1GLEG 4CZIA 1E4GT 2NLXA 3QDKA 2YHXA 5AQXA 4NO7A 4RTFD 3BP8A 4AM6A 4CZFA 3WQUA 1TUYA 3TTFA 2OANA 3NVKA 1GLDG 3LDNA 3H1VX 3NVMA 1YAGA 3MN9A 2VWBA 4B1ZA 3C7NA 2ASOA 1QQOA 4PL7A 4YOUA 1GLFO 1Z05A 4BR4A 4AF1A 3EL2A 3WXIA 2DPNA 4QS7A 4WQ5A 2QXLA 3UB5A 5M1FA 2A42A 4C1NI 2FSKA 4JD2B 3BEXA 3R1XA 4CZJA 1NGIA 1IG8A 1NGDA 5JICA 3FLCO 3B8AX 1W97L 4JK9A 3AY9A 3W0LA 3A5MC 3WXKA 2P9KB 3C6AA 4JKCA 1BG3A 1Q18A 4JKGB 3SJHA 4JKAA 3WEEB 4CZGA 3EKUA 3ZEUA 4IJAA 3VGKA 4CZHA 4IO9L 1BA1A 1TYQB 5HOOA 3O6WA 3MCPA 1BUPA 1XQSC 5EXWA 5GADP 4KH6A 4GNIA 4JKGA 2IVOA 4FPAA 4FWPA 4BR9A 3M6GA 4JKBA 1HLUA 5AQTA 3CC2N 5KPTA 3A8YA 4O5FA 1NJIO 3H45C 5AQJA 4BR7A 1R59O 1SS6A 4FWQA 3ATVA 1Q81O 1ILYA 3TPQA 1VQLN 4UY8O 3KZBA 5JLHA 3GBTA 2PAVA 3UE5A 1HKGA 5ELZA 4WQ4A 5M1PA 4JD2A 4XEIA 4U7BA 5TKYA 3S41A 3SAHA 1KQSM 2FSNA 2P9NA 3CPEA 4JK7A 4BR0A 2QWQA 4A59A 4A2AA 3O08A 5HL7L 4H0VB 1VQNN 1S22A 3F9MA 2I7PA 1P8ZA 2ZWHA 1KXPA 3FZFA 2P9NB 4EFHA 5BPNA 1V4SA 4H5VA 1EO1A 5F2RA 2HBKA 2QWRA 5H1SQ 3QBWA 1YF5L 2V7ZA 4BRHA 3CD6N 4XH1A 5JLFA 4KH4A 4L3QA 1GLLO 5BRHA 4HTLA 3HOTA 3CF5L 1VAZA 2FSJA 3M3ZA 4YOYA 4GY2B 3VEZA 2YHYA 3SAFA 1BO5O 3E1YA 3E9OA 3MDQA 3O80A 5E26A 4B1UB 1YJNN 4ILGB 5E84A 1RGIA 1NLVA 1YUWA 3M5RA 3CJBA 1BA0A 1MWKA 2Q0UA 3ZETA 4YOXA 5AZIA 4H5TA 4GV6A 4EHTA 3HRGA 1VQ7N 1K8KB 5AQQA 4BRGA 3FGUA 3CCVN 3ATUA 3CHWA 4FOEA 4BC2A 1T6CA 4BR2A 3R9PA 1DKGD 2P9IA 3CI5A 1K9MO 4B1VA 3CCSN 5AR0A 1U2VB 2VCPA 2P9SA 5F0XA 4MDBA 1ZXOA 3O9TA 1XC3A 3CJ7A 4CZLA 3AARA 3IKMA 3VGMA 4BVOA 3FE1A 3VETA 2VYPA 3GDQA 5C2FA 2GUPA 2HMPA 1T3VA 3QB0A 5LJWA 4C1NK 3MN5A 2GEMA 4BRPA 2CGLA 1YJWN 1N8RO 3TTDA 1KAZA 2J4RA 1IJJA 1CZAN 5MLCQ 3CCQN 3CMEN 4IWVA 3O5BA 4CD3A 5GAEP 5B8HA 3G6EN 4FWMA 2D4WA 5AZIB 3VMFB 3SBTA 4K41A 4K42A 3MMVA 3O9UA 1RFQA 3AAPA 1VQPN 2A5XA 3O9RA 2BTFA 2Q2RA 4H5RA 4PKGA 1XUPO 3RSEA 2CH6A 3OBWA 4M7XA 1Q7YO 5GAHP 1ZC6A 5AFUH 2HBJA 5AQHA 4ILJA 3SMSA 4BRCA 4DKWA 1YITN 3VENA 3IMXA 3BF3A 1D4XA 5CR4A 4OO1J 3VEOA 5BPMA 1DGKN 1NWKA 3QBXA 4CBWA 3LDLA 4MLEA 3KVGA 4FPBA 1Q86O 1G99A 5C0YA 3DAWA 1GLJO 5DM6L 1O13A 3M1FA 4HWIA 2NRTA 4GV3A 2QWOA 5C12A 3F5TA 1NGHA 1HJOA 2P9UB 3VTHA 2GWJA 3VOVA 2IIRA 1K8AO 1NGFA 4C23A 3PLAA 2QEXN 3ID6A 2FXUA 5AQWA 4FWRA 4BGAA 1BOTO 3HTVA 5AQIA 2AA4A 3WUHA 2RE2A 3CETA 3MWTA 4BRNA 5JMVA 3KK7A 1K73O 1RDWX 1KC8O 3Q7BA 3UKRB 3LDQA 4EIAA 3HM8A 1U2VA 4H0TB 1J6ZA 1C0GA 2FLOA 2GELA 3UKUA 4E1JA 4U67L 3DJCA 3LDOA 4BRIA 2AP1A 2QTDA 3SAGA 4WFNL 3PIPL 1E4FT 4BQLA 3E66A 3L4QA 1ATNA 3O1BA 5AFUA 4M7YA 4MO4A 3DLLL 2HF4A 3ENHA 4FO0A 3OW2M 3U8XA 1C0FA 1X9JA 4BRLA 5LY3A 2GX9A 2P9LB 5EX5A 5BR9A 2ZJRL 5DM7L 2CGJA 2F9TA 4OPAA 4A62A 5ADXA 5C2DA 3IUCA 5LJVA 4FWOA 3VF4A 4DCHA 4BGBA 4GV9A 5AQNA 5AQSA 5BRDA 1MWMA 5M1OA 1T6DA 1WOQA 1ESVA 3EE9A 1OVYA 2PBDA 3WQTA 5C10A 3BUZB 4H0XB 5GIPA 2A3ZA 3CJ9A 4XH5A 3CPWM 1NGJA 4YOTA 3VF2A 4JKFA 2QA4N 3L4IA 3W3DA 4IZ9A 4BC4A 4IO8A 3TSUA 2D1KA 2ZGYA 3RSEB 2WBNA 5KQDA 3A5LC 1NGGA 2ZJQL 3CCJN 3P38A 2NRXA 1YXQA 2E1YA 4YOVA 3CJAA 3SBGA 3CCEN 4JHDA 2BH1A 3IDHA 3G71N 2EWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWK A;  2JWL A;  2PFU A; 
#chains in the Genus database with same CATH topology
 4DQQ A;  2UUA K;  4MDA A;  3OVN A;  4DU4 A;  4N41 A;  3KK3 A;  3O4W A;  4FJJ A;  4G9Z A;  5FRM A;  1ZBS A;  4WQ4 C;  2W6L A;  3QFP A;  2O4G A;  4CF2 A;  4DR1 K;  4H03 B;  2JWK A;  4MO5 A;  3NGY A;  2F7T A;  4YY3 K;  2HNY A;  3ZSX A;  4KHP K;  4MFB A;  1U47 A;  4BRF A;  4H5N A;  4O4G A;  3PSF A;  1QZ5 A;  1BU6 O;  4FJI A;  1Q9X A;  1S5J A;  3TAR A;  1WLJ A;  1CXU A;  3NFA A;  3P31 A;  5I42 A;  1R0A A;  1N33 K;  2O8E A;  3H3N O;  5CHI A;  2B6A A;  2QWL A;  5BRE A;  1RT4 A;  3ZYY X;  4YFU A;  3C0B A;  1O1W A;  3OYA A;  4QS8 A;  2E8A A;  4RW7 A;  3SI6 A;  4JKE A;  4WQ5 C;  3RRG A;  4RWT A;  1IBM K;  1NBW A;  4CEZ A;  1VSK A;  3I33 A;  2NRV A;  4EZ6 A;  3CC4 N;  1TK0 A;  3VES A;  1HQU A;  2D0B A;  3VPZ A;  4GVM A;  2Q1N A;  3DLR A;  2ZGZ A;  3AO1 A;  5FPE A;  2HST A;  1EQY A;  3C7N B;  4W5O A;  2CH5 A;  3A5O C;  1NNE A;  2QKK A;  4CGF A;  3QNO A;  3BY5 A;  2ZJP L;  1L5U A;  4KPY A;  2OPQ A;  2YKN A;  2OPP A;  5HRN A;  3CCM N;  3O9Q A;  3GE1 A;  3EE8 A;  3QNN A;  4W5R A;  4LH4 A;  4CD1 A;  3MX5 A;  3ZX2 A;  1HRH A;  3A5N C;  3I0R A;  5HRS A;  4YOR A;  4KHS A;  2YNG A;  4CEF A;  4CCH A;  1FJG K;  3H1Q A;  2E4L A;  2UUB K;  1IKY A;  1JXB A;  4M63 C;  4DV2 K;  2W41 A;  3QO9 A;  3KLF A;  4DUZ K;  5FRO A;  3SPY A;  3UKU B;  3JS6 A;  5BR8 K;  5HRP A;  5DK5 A;  1YVU A;  3EZW A;  3UKR A;  4OJR A;  4CJF A;  4I7F A;  3L6Q A;  4NLB A;  4BDY A;  4CER A;  4F8R A;  1T44 A;  3QEX A;  3THV A;  1GOA A;  3DXM A;  3Q7C A;  3NCI A;  5AQV A;  3DLH A;  3VEY A;  4BVP A;  5J2M A;  2ITM A;  4DHY A;  1JLF A;  2NZT A;  3TU5 A;  3LP0 A;  1T7P A;  3NF8 A;  4I6M A;  3LZI A;  4I9Q A;  3L0Q A;  4JKH A;  4YDU C;  4JHD B;  5GIN A;  2OTJ N;  4DFJ A;  1H1V A;  2KZM A;  1RT2 A;  3DM2 A;  4H5W A;  4CIF A;  4FJ9 A;  1BDG A;  1ASU A;  1KVB A;  4FK2 A;  3O3G A;  1T8E A;  2PZS A;  1UWB A;  5SZT A;  3OA9 A;  3CC7 N;  4BY9 C;  3EEQ A;  2F8T A;  1NGB A;  4DFP A;  3QML A;  3TAN A;  3PIO L;  3K9K A;  2CGK A;  4AHT A;  1QVF M;  4GKK K;  5JVH L;  2HOE A;  4BE1 A;  3DXM B;  3EO3 A;  2P9I B;  2YI1 A;  4M3X A;  1HPZ A;  1MDU B;  4I9L A;  2YX6 A;  3K5L A;  3ULE A;  1K8K A;  5T7B A;  3R3L A;  4YOW A;  4IOC L;  2E88 A;  1W2B M;  3LAM A;  4M3W A;  1DTT A;  1X9M A;  3NGI A;  3V6D A;  1RT3 A;  4X65 K;  1W7A A;  2E2P A;  5FPM A;  1TKD A;  4V19 S;  3SMP A;  5HLF A;  4WYB A;  1BIU A;  3FFI A;  4CZE A;  1U04 A;  3CFO A;  3NF6 A;  3ZSQ A;  4FLV A;  1Q82 O;  1BWF O;  4J8F A;  1GLC G;  1M1K O;  3DYA A;  1E4G T;  4NXM K;  2YHX A;  4B9L A;  5AQX A;  4DTP A;  2HHW A;  4KV8 A;  1GLD G;  2VWB A;  5AJ3 K;  4BR4 A;  3M8Q A;  3EL2 A;  3WNE A;  3WXI A;  4CHQ A;  2O8C A;  1WAF A;  3HVR A;  4X66 K;  5K14 A;  4LF9 K;  3L2V A;  3OYG A;  3L2Q A;  4JD2 B;  4N5S A;  4FJ7 A;  1NGI A;  1XHX A;  3B8A X;  1W97 L;  4IO9 L;  3C6A A;  1BG3 A;  4W5Q A;  3P5J A;  4IJA A;  3TAB A;  4CHY A;  2XY7 A;  3AVL A;  3V81 A;  4AIL C;  5GAD P;  4JKG A;  3KLH A;  4FPA A;  3QER A;  4JKB A;  2OCE A;  5KPT A;  4O5F A;  1L3U A;  1SS6 A;  2ZQB A;  4CGI A;  4JI3 K;  2PAV A;  4FW1 A;  3NGZ A;  1RTH A;  3UE5 A;  3AVJ A;  4CEQ A;  4XEI A;  5TKY A;  3QET A;  4M3T A;  1WBD A;  3O08 A;  4H0V B;  1P8Z A;  2ZWH A;  3JYT A;  3FZF A;  2P9N B;  1EO1 A;  4X62 K;  5J2P A;  5H1S Q;  4BRH A;  4B3M K;  5CYM A;  1REV A;  4JI0 K;  3RMC A;  1HYS A;  4DFM A;  1VSM A;  5JLF A;  2X74 A;  2O8D B;  1J53 A;  1VSI A;  3C94 A;  2FSJ A;  4YOY A;  1OH7 A;  3VEZ A;  3SAF A;  2P5G A;  4F3T A;  5KRS A;  1BA0 A;  2P51 A;  4OKK A;  4PWD A;  3MEC A;  3OS1 A;  3BZK A;  4DTO A;  4JV5 K;  1JL1 A;  3VA0 A;  4BC2 A;  4CF9 A;  1T6C A;  4BR2 A;  3R9P A;  4CEC A;  2P9I A;  4FJK A;  1NU0 A;  3NDK A;  2QK9 A;  4CK2 A;  1NJX A;  5F0X A;  2W42 A;  4JYA K;  4I2Q A;  4DQS A;  1W9H A;  3KLE A;  1LAW A;  2VYP A;  5C2F A;  2IGI A;  2GUP A;  2HMP A;  3B6P A;  3MN5 A;  2GEM A;  4BRP A;  2G8I A;  1KAZ A;  3OYF A;  3M8P A;  2P1J A;  1Y97 A;  4DUY K;  1KSP A;  3P83 D;  4OGE A;  4AHV A;  5AZI B;  4UQG A;  1G15 A;  3TAE A;  3O9R A;  1TL1 A;  3AVA A;  3M8R A;  1XUP O;  2CH6 A;  5AFU H;  2HBJ A;  2KZZ A;  3IMX A;  4LH5 A;  5C24 A;  1D8Y A;  2GV9 A;  1DGK N;  1NWK A;  3QBX A;  1XNR K;  3LDL A;  4MLE A;  4W5T A;  4FPB A;  2NUB A;  4HWI A;  2NRT A;  4CIG A;  3DLB A;  1K6Y A;  2IIR A;  4C23 A;  3OYD A;  3PLA A;  4CJP A;  4BGA A;  4DF8 A;  5AQI A;  3CET A;  3MWT A;  3AVM A;  4B08 A;  4CEB A;  1RDW X;  4M3Z A;  4NYF A;  4KRE A;  1RT7 A;  1N36 K;  3LDQ A;  5CYQ A;  3HM8 A;  1C0G A;  3SAG A;  4E1J A;  1B9F A;  2G8F A;  3PIP L;  1E4F T;  1BGX T;  1S6Q A;  2W6K A;  2XRI A;  3ENH A;  3OTO K;  1CLQ A;  3T1H K;  3E01 A;  1HMV A;  3ZSR A;  1X9J A;  1NJW A;  3TAQ A;  4A62 A;  1JLC A;  5LJV A;  3TAF A;  4Q0B A;  4IG0 A;  4BGB A;  5AQN A;  1IH7 A;  5BRD A;  1MWM A;  2O8E B;  1OVY A;  1WSJ A;  4HUG A;  4XH5 A;  3CJ9 A;  1A5V A;  3CPW M;  4FLZ A;  3K0S A;  4CJU A;  4YOT A;  1N5Y A;  2ZGY A;  4OX9 K;  2WBN A;  3A5L C;  1NGG A;  3SJJ A;  3S3N A;  2O8C B;  3SBG A;  3CCE N;  2BH1 A;  3SUQ A;  3G71 N;  4QCL A;  2XHB A;  2D0O A;  2NRR A;  3GOI A;  4Y1C A;  1P90 A;  1HNX K;  2Z1J A;  2X78 A;  3CJC A;  4OLB A;  4Z0U A;  1UA1 A;  3CER A;  1HNZ K;  3U4L A;  3LM2 A;  4HCB A;  1VQ6 N;  1QE1 A;  2HHU A;  1UA0 A;  3KKS A;  3HSC A;  5CE3 A;  2NRZ A;  3L2W A;  3SQ1 A;  2KTQ A;  4BR5 A;  3KWI A;  3AVG A;  3D2F B;  2QXF A;  1QQM A;  3ENO A;  1IKW A;  2ZD1 A;  3CYM A;  3RMD A;  4B9Q A;  1LCU A;  3R6M A;  1LWE A;  3MX2 A;  4BE2 A;  4CF1 A;  4B1Y B;  3ULD A;  2RPI A;  3TR8 A;  3GG4 A;  1HQE A;  2HHH K;  2WUS A;  3HXM A;  2G8U A;  1ZBF A;  3CJ1 A;  4FJN A;  1ZBL A;  3AVH A;  5IT9 O;  3FZL A;  4RW8 A;  4DMN A;  1NK5 A;  4BDZ A;  3MXJ A;  1HKB A;  2E2O A;  5TKW A;  5KPZ A;  3F2K A;  5M1K A;  5ADX H;  5GIO A;  1EET A;  5FPD A;  3HBT A;  3C6T A;  1JCE A;  5AQO A;  3MN7 A;  1WUA A;  3NF7 A;  1FK9 A;  4NB4 A;  4FM0 A;  4GKJ K;  4C8N A;  5KQ8 A;  2E6L A;  4IFV A;  4JEP A;  4PL8 A;  4DQ8 A;  4ICL A;  1IG9 A;  2B5J A;  2IDO A;  3ID8 A;  3DRR A;  3ZT1 A;  4NLC A;  2GBZ A;  3HOS A;  1I39 A;  2A40 A;  5EY4 A;  4KFB A;  2RHK A;  4KHN A;  5AZJ B;  4DQR A;  4CEE A;  1GLA G;  2X6S A;  3C6H A;  4OPH A;  4J2E A;  1ASW A;  3O8M A;  1SAZ A;  1RT5 A;  4GMJ B;  3T19 A;  4BC5 A;  1OH6 A;  4C8K A;  3MWP A;  4FWS A;  4FL9 A;  3DXK B;  3ZT3 A;  4Z4G A;  2VG6 A;  1HNW K;  3C6U A;  4BRQ A;  4AM7 A;  1LWF A;  1OKJ A;  3T1Y K;  4ELT A;  3K5O A;  4FZZ A;  3TAP A;  3PV8 A;  1RDU A;  3HST B;  5FPN A;  3G10 A;  1KAY A;  3I55 N;  4NYN A;  3V1Q A;  5SWM A;  3NMU A;  3VQ5 A;  3K59 A;  4L8R B;  3N4P A;  1TAU A;  3J7A P;  2Q97 A;  4N47 A;  2PY5 A;  4BRD A;  3KD5 E;  1GLB G;  3CCL N;  2ZM6 K;  3ZX3 A;  1YI2 N;  1I3A A;  1RTI A;  3HZ6 A;  3G25 A;  3D2E A;  2I5J A;  4A57 A;  2KKZ A;  3U6F A;  5KPR A;  3ALY A;  4B3O A;  4IEE A;  4IFE A;  1ATR A;  3D2E B;  3KD1 E;  4CF8 A;  4CHN A;  1JCF A;  4YDU A;  1VQ9 N;  3DWL A;  5AQL A;  3WXJ A;  5C25 A;  4QS9 A;  3OYB A;  3SZ2 A;  3L3U A;  2A6A A;  3VER A;  3EN9 A;  1NGE A;  2WON A;  3RWU A;  3MK6 A;  2JWL A;  4CIE A;  2V52 B;  5EOY A;  3ULE B;  2FBX A;  4BG9 A;  3CM5 A;  2GWK A;  1QQN A;  3LAN A;  2HHX A;  3FZM A;  4F2R A;  4BQZ A;  2YJF A;  4DR5 K;  4EHU A;  1VQM N;  2W40 A;  3L3V A;  2WC9 A;  3V9X A;  1B9D A;  2UYT A;  4EP4 A;  4I2P A;  4CBU A;  4B1X B;  3CIP A;  3VGL A;  4OKJ A;  1ZYQ A;  1X1P A;  1VSD A;  2PYJ A;  4IOA L;  1VK0 A;  4H0Y B;  5J2N A;  4FJM A;  4IFY A;  2DFE A;  4C8M A;  2QWN A;  5J2Q A;  3OY9 A;  2HHQ A;  2AJQ A;  3R8E A;  3CMA N;  4B8A B;  3GL1 A;  1WB9 A;  4DTJ A;  3KWG A;  1YIJ N;  3SUN A;  1SUQ A;  1TAQ A;  3ZSZ A;  1VSE A;  1U48 A;  2ZF5 O;  4O55 A;  1KFS A;  4DLG A;  4Z94 A;  2HNZ A;  4CJT A;  1GLE G;  1OVQ A;  3BP8 A;  4AM6 A;  3NVK A;  3WQU A;  3HL8 A;  3LDN A;  2HW3 A;  1YAG A;  1HJR A;  3NH1 A;  2HVI A;  4ELU A;  4WQ5 A;  3LWM A;  2FSK A;  3TAG A;  4DTS A;  4RW9 A;  4CZJ A;  1NGD A;  5JIC A;  5D3G A;  3FLC O;  1J9A A;  4FW2 A;  2BGG A;  4CJW A;  2P9K B;  1Q18 A;  4LSL A;  3SJH A;  4CZG A;  4KAZ A;  2OPR A;  2XY8 A;  3NHG A;  2R7Y A;  1JLG A;  3VGK A;  3VQB A;  4CHO A;  3MCP A;  1BUP A;  1XQS C;  2FBT A;  5EXW A;  1RT6 A;  4GNI A;  3A2F A;  4LFA K;  4FWP A;  4E19 A;  4BR9 A;  3QEI A;  4RG8 A;  5AQT A;  1NK6 A;  4DU1 A;  4DTM A;  4BR7 A;  4FWQ A;  3ATV A;  2GUI A;  3ZSV A;  1ILY A;  4UY8 O;  3THY A;  2O8F A;  3GBT A;  2OZM A;  2IS3 A;  1CZB A;  1WNS A;  1HKG A;  4PA1 A;  4JD2 A;  4BR0 A;  5HRO A;  2QWQ A;  4CEO A;  3MXM A;  3NH0 A;  3ZT4 A;  4K8X A;  3SQ4 A;  2I7P A;  1KXP A;  1ZBH A;  1Q8I A;  4KH4 A;  3HOT A;  3V9U A;  4CJR A;  1VAZ A;  4E1M A;  4JI1 K;  3M3Z A;  4B9M A;  4ILG B;  1RTJ A;  1RGI A;  3CJB A;  5AZI A;  4M42 A;  3VQE A;  3QLH A;  4KTW A;  1I94 K;  3FGU A;  3DLE A;  1U45 A;  3CHW A;  3P1G A;  3VQP A;  3DRS A;  4ZHR A;  1K9M O;  4B1V A;  4E3S A;  3AVK A;  3AVF A;  1U2V B;  4CVN E;  1VRT A;  2P9S A;  1W0H A;  1ZXO A;  1TK8 A;  2DY4 A;  3IKM A;  4B9V A;  3OYE A;  3FE1 A;  2VQE K;  5CZ2 A;  4CJE A;  4KKO A;  4LY7 A;  2EHG A;  3AA4 A;  3VQ9 A;  1EXQ A;  2IAJ A;  2J4R A;  4FZX C;  1CZA N;  3HYF A;  3O4N A;  3ASM A;  3VQC A;  5B8H A;  4FWM A;  2D4W A;  4K41 A;  2Q2R A;  4JI7 K;  1Q7Y O;  5GAH P;  4N76 A;  2HHV A;  3SMS A;  1YIT N;  3DLK A;  3SUP A;  4CFA A;  5BPM A;  1U4B A;  4LFB K;  2WOM A;  1G99 A;  4H4O A;  1B92 A;  4GV3 A;  2QWO A;  3F5T A;  3NE6 A;  1SKS A;  2P9U B;  1XHZ A;  2GWJ A;  3KK2 A;  1NGF A;  3TAM A;  3ZCM A;  1BIZ A;  3KK1 A;  2QEX N;  4ID1 A;  1X9S A;  2FXU A;  1KLM A;  1BOT O;  4N56 A;  3SV4 A;  2HHT A;  3WUH A;  2RE2 A;  3M8S A;  3KK7 A;  1LV5 A;  1JXE A;  2FBV A;  3LZJ A;  4CJQ A;  4EIA A;  1U2V A;  2GEL A;  2FLO A;  3MXI A;  4BRI A;  4WFN L;  1LAV A;  2QTD A;  2A1R A;  4AHS A;  1VSH A;  4KHU A;  1L3V A;  4H8K A;  3L4Q A;  1ATN A;  3O1B A;  5AFU A;  4LF6 K;  3EYZ A;  1C0F A;  3VQ7 A;  4BRL A;  2GX9 A;  2ZJR L;  5DM7 L;  2CGJ A;  2F9T A;  3IUC A;  4CFC A;  1NK7 A;  3EZ5 A;  3VF4 A;  4DCH A;  4CJS A;  4GV9 A;  4JI5 K;  5AQS A;  2UXB K;  5M1O A;  1VHX A;  2X6N A;  4AHR A;  2UXD K;  1NGJ A;  3PO4 A;  2QA4 N;  3PY8 A;  4CK1 A;  4IO8 A;  2ZJQ L;  2D1K A;  5KQD A;  2D0C A;  4KHY A;  4OVL A;  2E1Y A;  4YOV A;  1FW6 A;  3J80 O;  4JHD A;  1TKZ A;  3IDH A;  2EWS A;  2YJE A;  3T7Z A;  3WXL A;  4JRQ A;  4A5B A;  3ZT0 A;  4KHQ A;  2E2N A;  3OYH A;  1X3M A;  1WN7 A;  4JRP A;  3RVC A;  5LMU K;  4MLH A;  3OYL A;  1C6V A;  1C1B A;  3U9Z A;  3ZSY A;  1F21 A;  4LFC K;  1S3X A;  4LC9 B;  3EY1 A;  1S9G A;  3V9Z A;  2P9S B;  3VQD A;  2IVN A;  1BCO A;  4FXD A;  1JL2 A;  4LF8 K;  4DB3 A;  3O1W A;  4IDH A;  3U3G A;  2I7N A;  3AO5 A;  4KH5 A;  5AQR A;  4BC3 A;  2QWM A;  3WEE A;  1SZ2 A;  2P9L A;  4BRK A;  3LM9 A;  3CQY A;  1VQ4 N;  3OHR A;  1QS4 A;  3NH2 A;  3D7E O;  2HBM A;  1HKC A;  4OPK A;  3J8A A;  1XC9 A;  3JXU A;  3VQQ A;  1SQK A;  2D5R A;  3KHY A;  2E2Q A;  1JKH A;  2RN2 A;  2IOC A;  1DLO A;  2OA8 A;  4XH4 A;  2OYQ A;  1S1V A;  3QEW A;  4PKI A;  3OS0 A;  3FFK B;  3J81 O;  3HJF A;  2FF3 B;  1QSL A;  1XMQ K;  3N4Q A;  3AA3 A;  3AVN A;  1S1U A;  2G8W A;  3OBY A;  3IFR A;  3I0S A;  2B4J A;  5AQM A;  4Y1D A;  4C8L A;  3LP1 A;  3THW B;  1NK8 A;  1NKB A;  3FZK A;  3ISN C;  5AQF A;  2NNW A;  3VQ4 A;  3SLC A;  3DLG A;  3A0I X;  4WFA L;  4JN4 A;  5BN9 A;  1TVR A;  4PY5 A;  2QWP A;  1NGC A;  4CF0 A;  3VF6 A;  5LL6 Z;  3CCU N;  1TUU A;  2XO7 A;  3T3F A;  5CZ1 A;  1YTA A;  3TWH A;  4A2B A;  3RMB A;  4PQU A;  2VWJ A;  4K0K K;  4RW4 A;  3O4Q A;  4BAC A;  4NCB A;  4M3R A;  3O9S A;  3AVI A;  3VA3 A;  1YT3 A;  3TSQ A;  4GVE A;  1WAJ A;  4WFB L;  1KLN A;  2KQ2 A;  1NK4 A;  2VGN A;  1QHA A;  4CZM A;  2H3G X;  2D0A A;  4HUE A;  1C1A A;  2PYL A;  1S9E A;  3LPT A;  5JVG L;  2F9W A;  3MEG A;  3CFP A;  3HO1 A;  4ISG A;  3DOK A;  2PFU A;  2KFZ A;  3TSP A;  5F1X A;  5M1Q A;  4JI6 K;  4A61 A;  1NK0 A;  4CZK A;  2A41 A;  4B3R K;  4KI4 A;  1XNQ K;  2BAN A;  2P9U A;  1JJ2 M;  3VEW A;  3E9P A;  3D0P A;  4Z4C A;  4IOX A;  2HF3 A;  3PX0 A;  2OZS A;  1Z25 A;  1JCG A;  3TTC A;  1RBU A;  1IKV A;  1BI4 B;  4ISF A;  1NMD A;  5BN8 A;  5BRF A;  3OYN A;  2YCH A;  2Q3S A;  5FDL A;  3K58 A;  1J5O A;  4A5A A;  1S72 N;  3CQX A;  4ELV A;  3HPG A;  1QTM A;  4AQY K;  3B6O A;  2Q36 A;  3PX4 A;  1S6P A;  3G4S N;  1RTD A;  4F9O A;  4BRE A;  5C42 A;  3TI0 A;  3C65 A;  3P39 A;  3OJU A;  5HBM A;  2HB5 A;  2UUC K;  1SV5 A;  1IBK K;  3LL3 A;  1DTQ A;  3C95 A;  4E7L A;  1YJ9 N;  3L2R A;  5AQG A;  4WF9 L;  3LDP A;  4J2B A;  5EVZ A;  2E1Z A;  4CJV A;  1T05 A;  4OGC A;  1LW0 A;  1RBV A;  3D2F A;  3I8B A;  1VQ5 N;  5HRR A;  4ISE A;  1HYZ A;  5E41 A;  4DV6 K;  3QEP A;  1BCM A;  3J7Z O;  4JI4 K;  1VQO N;  4CI6 A;  1RT1 A;  3EKS A;  2WTU A;  4B3S K;  4FVU A;  3CCR N;  3D6R A;  4KB1 A;  2QM1 A;  1SKW A;  1V4T A;  4CZI A;  2NLX A;  3THW A;  1NKE A;  4RTF D;  4CZF A;  1TUY A;  3TTF A;  2OAN A;  3H1V X;  4IG3 A;  3S3M A;  3MN9 A;  2ASO A;  3QIO A;  1QQO A;  4PL7 A;  4YOU A;  1Z05 A;  3SPZ A;  4QS7 A;  2QXL A;  3UB5 A;  4DR3 K;  5M1F A;  3U3Y A;  5JS2 A;  1SKR A;  1FKP A;  3R1X A;  3SUO A;  4DV0 K;  1UOC A;  3WXK A;  3AY9 A;  3W0L A;  3THY B;  1U49 A;  4JKC A;  3WEE B;  4JKG B;  2DFF A;  1FXX A;  3AVB A;  4FCY A;  1BA1 A;  4CGH A;  3O6W A;  4AHU A;  4FJG A;  1VSJ A;  2IVO A;  3RR8 A;  4O5B A;  3M6G A;  3AVC A;  1T03 A;  3CC2 N;  4IKF A;  3F9K A;  3H45 C;  1E3M A;  1J54 A;  2RKI A;  1J5E K;  4BDP A;  5JS1 A;  2VG5 A;  1VQL N;  3V9W A;  5M1P A;  5ELZ A;  4WQ4 A;  4J2A A;  1KQS M;  4FJH A;  2P9N A;  3KLG A;  3WNF A;  4A59 A;  4A2A A;  3LPU A;  1YTU A;  4DR4 K;  1S22 A;  3AA2 A;  3PSI A;  3PX6 A;  4Z4H A;  4CE9 A;  4DSK A;  1V4S A;  2HBK A;  3QBW A;  1YF5 L;  3RRH A;  5J1E A;  2E5L K;  3K57 A;  1BI4 A;  4M3U A;  2KFN A;  1NJY A;  4DWI A;  4E7I A;  1XI1 A;  4L3Q A;  4Z4F A;  1GLL O;  5BRH A;  3CF5 L;  1VSL A;  4OKE A;  4GY2 B;  3SV3 A;  2YHY A;  3MDQ A;  5FRN A;  4B1U B;  1NLV A;  2HMI A;  3RTV A;  1MWK A;  2Q0U A;  2O8B A;  4H5T A;  2BDP A;  4DQP A;  3HRG A;  1VQ7 N;  1K8K B;  5AQQ A;  4DG1 A;  4B9N A;  4FOE A;  3QES A;  4K8Z A;  3CI5 A;  5AR0 A;  2VCP A;  4LD0 A;  1WSH A;  4FJ8 A;  4MDB A;  3O9T A;  4CZL A;  2Y1I A;  1HR0 K;  3O3F A;  2ZE2 A;  4DSE A;  3GDQ A;  4C1N K;  1NJZ A;  4E7H A;  1YJW N;  3JAM O;  4JS5 A;  1N8R O;  3HPO A;  3SCX A;  3ZLJ A;  4NCA A;  3SYZ A;  3HT3 A;  5GAE P;  4B9U A;  1JLE A;  2YHB A;  3MMV A;  3O9U A;  1RFQ A;  2YHA A;  1A5X A;  4PKG A;  1FKO A;  1JLA A;  3OBW A;  4M7X A;  4DV4 K;  5EU7 A;  5AQH A;  4ILJ A;  4BRC A;  4DKW A;  4E89 A;  2IC3 A;  1KVC A;  3QIN A;  4DV1 K;  1QSS A;  5CR4 A;  3MAQ A;  3VEO A;  4CBW A;  3KVG A;  1Q86 O;  2HVH A;  5IWA K;  2Z1H A;  1O13 A;  3M1F A;  2YKM A;  1GOB A;  1LWC A;  4KHW A;  1RDD A;  4DQI A;  3VOV A;  2VQF K;  1K8A O;  4FJ5 A;  2DFH A;  1C1C A;  4FWR A;  3HTV A;  4CEA A;  4HVJ A;  4CJ4 A;  3Q7B A;  1TK5 A;  1EKE A;  1RDA A;  3UKR B;  1RBT A;  1J6Z A;  2KW4 A;  4U67 L;  1RDB A;  3DJC A;  4FLW A;  4CFD A;  3THX B;  1L3S A;  3CM6 A;  4LSN A;  2HF4 A;  3DLL L;  3OW2 M;  2F8S A;  3U8X A;  1KRP A;  2G8K A;  1UAX A;  5BR9 A;  2YNI A;  4OPA A;  2ETJ A;  5C2D A;  3DOL A;  4E0D A;  4FLX A;  3JSM A;  1BQM A;  2F4V K;  1WOQ A;  1ESV A;  3EE9 A;  4B9S A;  4H0X B;  2A3Z A;  3LDS A;  2Z1I A;  3OYJ A;  3VF2 A;  4WE1 A;  4JKF A;  4CGG A;  3L4I A;  3W3D A;  2P5O A;  4IZ9 A;  1D9D A;  1VRU A;  4JI2 K;  2A1S A;  2NRX A;  3PUF A;  3CJA A;  3WNG A;  3VEN A;  4FWK A;  3BZC A;  4DV5 K;  4ZTJ A;  4CJ3 A;  1LW2 A;  3MN6 A;  3VEV A;  4BRA A;  1BL3 A;  3ENB A;  3I56 N;  1TKT A;  3L2U A;  1KFD A;  2F96 A;  4BRO A;  4IJN A;  4DSL A;  2QI2 A;  4E7J A;  4K43 A;  2FC0 A;  3VQ8 A;  1TKX A;  4E1N A;  1NKC A;  4M3Y A;  3WT0 A;  3HM9 A;  2YNH A;  3K9J A;  4RW6 A;  4CFB A;  3HPH A;  2V7Y A;  4C8O A;  4DSJ A;  3QIC A;  1NGA A;  5M1N A;  4NXN K;  4FWL A;  1KAX A;  1U6Z A;  3CFR A;  1KD1 O;  4JNE A;  4IEI A;  1S1X A;  2UU9 K;  4IDK A;  5AZJ A;  1BHL A;  3ZEU B;  3E9L A;  4YHH K;  2KHO A;  2KLA A;  2Y1J A;  4FWN A;  1JLB A;  1TYQ A;  3H6E A;  3CQ8 A;  4KTZ A;  2E20 A;  4B9T A;  3THX A;  3IRX A;  3H46 O;  3MCA B;  4IXC A;  1D5A A;  4DLE A;  3RR7 A;  1BIS A;  2P9K A;  2O8D A;  4HCC A;  4O8U A;  1BQN A;  2XY5 A;  1LOT B;  4PHT X;  3H3O B;  1MA9 B;  1DT9 A;  4DTX A;  2YV0 X;  4KBO A;  3SK3 A;  1VQK N;  1KTQ A;  5GAG P;  4MQ3 A;  3QEV A;  3DRP A;  2IVP A;  2OTL N;  2O4I A;  4EP5 A;  4FSV A;  4JK8 A;  3AGK A;  1WSE A;  3V1O A;  3WNH A;  3OYK A;  4ZTF A;  4CGD A;  3HK2 A;  1DEJ A;  5AQP A;  1Y64 A;  3DMJ A;  4BE0 A;  3UIQ A;  4LF5 K;  2BUP A;  2WFB A;  2GTD A;  4H0P A;  2LSN A;  2NRW A;  5C15 A;  3P4I A;  4CJL A;  3LP2 A;  4JAX A;  3O3H A;  5AQY A;  3KJV A;  5FLX O;  4O0J A;  4I6M B;  3BDP A;  1C0M A;  4CBX A;  4YNQ A;  4ILH A;  3AAQ A;  3CXC M;  3NBP A;  3F73 A;  1N34 K;  4TSX A;  4FOI A;  1HX1 A;  5KRT A;  3AO3 A;  1QZ6 A;  4F3O A;  4AHC A;  1X9W A;  1QVG M;  1YVN A;  3SQ2 A;  4FM2 A;  2V51 B;  4BG8 A;  3IAY A;  3FR0 A;  4CK3 A;  2G8V A;  4RCH A;  2NRH A;  1CZ9 A;  3LAK A;  3WXM B;  4K25 A;  1HNV A;  5DMR A;  2Q31 A;  4O44 A;  4KB0 A;  3AGR A;  2HBL A;  4O8K A;  2RF2 A;  1WSG A;  5KGX A;  4Y0W A;  2YHW A;  1RDC A;  1EP4 A;  4KTQ A;  2QW9 A;  1Q9Y A;  3VTI A;  2P9P A;  1SL1 A;  4BRM A;  4WCE L;  5BPL A;  3KLI A;  2P9P B;  1NM1 A;  2FF6 A;  3QFU A;  3BF1 A;  4DU3 A;  4FVM A;  4H0O A;  4CJ7 A;  4B8C A;  5HP1 A;  2ASP A;  1NOY A;  3T69 A;  2Q0R A;  4R5P A;  3AA5 X;  3HVT A;  4JKD A;  1WSF A;  3LWL A;  2JLE A;  4Z4I A;  4QAG A;  1HUX A;  2BE2 A;  4BWJ A;  3ZSO A;  5I9E B;  4XIU A;  1CXQ A;  2VGM A;  3HI0 A;  4IBN A;  1YHQ N;  1X3N A;  2JGU A;  3KIO A;  1KCF A;  5AQK A;  4FYD A;  4DR6 K;  1IBL K;  3DXK A;  1OH5 A;  3H08 A;  3ZET B;  3OYC A;  3L8B A;  3U9D A;  5AQZ A;  2ASM A;  1C0U A;  1Z6R A;  3FZH A;  4OPJ A;  4FK0 A;  4B1W B;  4R79 A;  1VQ8 N;  2D0P A;  4FK4 A;  4F2S A;  4F4K A;  4Z4E A;  4PKH A;  4DSI A;  4CJK A;  4EAH D;  3ZX0 A;  3IS9 A;  1HPM A;  4FM1 A;  3K5N A;  3LP3 A;  1M90 O;  4CHZ A;  5AQU A;  1SL2 A;  5KTQ A;  1S1W A;  2XY6 A;  3VEX A;  2QKB A;  1ATS A;  3J7Y P;  3QDK A;  4LF7 K;  1JLQ A;  4NO7 A;  4CHP A;  4O0I A;  3VN5 A;  4DTN A;  1RNH A;  3NVM A;  4B1Z A;  1IV0 A;  3C7N A;  1Z26 A;  1GLF O;  4AF1 A;  3ZSW A;  2DPN A;  4B3T K;  4FJL A;  1XWL A;  2A42 A;  3V1R A;  4C1N I;  3PO5 A;  2HND A;  3BEX A;  1IG8 A;  1RBS A;  1NMN A;  4KI6 A;  4KRF A;  4JK9 A;  4Q5V A;  3A5M C;  3MEE A;  4JKA A;  4LF4 K;  3EKU A;  3K2P A;  3ZEU A;  4CZH A;  2YNF A;  1TYQ B;  5HOO A;  1VSF A;  3VQA A;  4DTU A;  4DR7 K;  4J2D A;  4KH6 A;  3ITH A;  4HHT A;  1MU2 A;  1HLU A;  4CGJ A;  3V9S A;  3A8Y A;  1NJI O;  5AQJ A;  3NF9 A;  2G8H A;  1R59 O;  1Q81 O;  4JLH A;  3TPQ A;  3I8D A;  1NG9 A;  3KZB A;  5JLH A;  2EX3 A;  1IO2 A;  5CY4 A;  4NCG A;  4AH9 A;  3VQ6 A;  4U7B A;  3S41 A;  3SAH A;  2Z1G A;  2FSN A;  4OLA A;  3CPE A;  4JK7 A;  5HL7 L;  3OYI A;  1L3T A;  1VQN N;  3F9M A;  3KTQ A;  3T1A A;  1N6Q A;  5BPN A;  4EFH A;  4H5V A;  5F2R A;  2QWR A;  4DSF A;  2V7Z A;  3CD6 N;  4XH1 A;  4BWM A;  4HTU A;  4QOZ B;  4ID5 A;  4HTL A;  1A5W A;  3OS2 A;  1GOC A;  3MED A;  4M41 A;  1D9F A;  1BO5 O;  3E1Y A;  3E9O A;  3O80 A;  5E26 A;  1YJN N;  5E84 A;  1S1T A;  1YUW A;  3M5R A;  4GW6 A;  4W5N A;  1N32 K;  4DS5 A;  3ZET A;  4YOX A;  4GV6 A;  4EHT A;  3LAL A;  2ATQ A;  4BRG A;  3CCV N;  3ATU A;  1DKG D;  4HUF A;  1NK9 A;  2E6M A;  3CCS N;  1EWR A;  4FLU A;  1XC3 A;  3CJ7 A;  1EX4 A;  1TGO A;  4EZ9 A;  3AAR A;  3VGM A;  3OYM A;  4BVO A;  3VET A;  5KGW A;  1T3V A;  3AO4 A;  3AV9 A;  3QB0 A;  5LJW A;  3NAE A;  2DTU A;  3S3O A;  3BGR A;  3RMA A;  2CGL A;  3TTD A;  4FLT A;  5KI6 A;  1WSI A;  2FBY A;  3HP6 A;  1IJJ A;  5MLC Q;  3CCQ N;  3CME N;  4IWV A;  1RCH A;  3KKR A;  3O5B A;  4CD3 A;  3G6E N;  3VMF B;  2OPS A;  2ITG A;  3SBT A;  4K42 A;  3AAP A;  1VQP N;  2A5X A;  2O8B B;  2BTF A;  4H5R A;  3RSE A;  1RIL A;  1TV6 A;  1ZC6 A;  1ZBI A;  4DTR A;  3BF3 A;  1D4X A;  4DV7 K;  4OO1 J;  2VG7 A;  2UXC K;  3V4I A;  5C0Y A;  3DAW A;  1TL3 A;  4KO0 A;  1GLJ O;  5DM6 L;  1HYV A;  1QQC A;  1EWQ A;  5C12 A;  4FLY A;  1WBB A;  3SQ0 A;  1NGH A;  1HJO A;  3VTH A;  1OH8 A;  1C0T A;  2VWK A;  3ID6 A;  5AQW A;  3AO2 A;  1QSY A;  1NOZ A;  4CW7 B;  2AA4 A;  1RBR A;  3DI6 A;  4BRN A;  5JMV A;  1K73 O;  4FJX A;  3S9H A;  1ZBU A;  4X64 K;  1KC8 O;  4DV3 K;  4JI8 K;  4JS4 A;  4DFK A;  4H0T B;  3UKU A;  3SNN A;  4G1Q A;  3LDO A;  2O8F B;  2AP1 A;  3HP9 A;  4BQL A;  5A2Q O;  4DF4 A;  3E66 A;  1SL0 A;  4M7Y A;  4MO4 A;  4M45 A;  4CJ5 A;  4FO0 A;  4PUO A;  1QHT A;  4CES A;  5LY3 A;  2P9L B;  5EX5 A;  5ADX A;  4CED A;  3D45 A;  4FWO A;  4FZY A;  5I3U A;  4H4M A;  1T6D A;  3WQT A;  2PBD A;  1ITG A;  5C10 A;  3BUZ B;  5GIP A;  3G0Z A;  3QIP A;  4DR2 K;  3OJS A;  1XMO K;  2HHS A;  3ZT2 A;  1KVA A;  1ASV A;  1HNI A;  3K5M A;  4BC4 A;  3TSU A;  3RSE B;  3CCJ N;  4E7K A;  3P38 A;  1YXQ A;  1IKX A;  3IG1 A;  5LMN K;  4DS4 A;  3CG7 A; 
#chains in the Genus database with same CATH homology
 2YJE A;  4MDA A;  3T7Z A;  3WXL A;  3MN6 A;  3O4W A;  3VEV A;  4BRA A;  2D0O A;  3ENB A;  4A5B A;  3I56 N;  4G9Z A;  2NRR A;  3GOI A;  4BRO A;  2E2N A;  4IJN A;  1P90 A;  1ZBS A;  4WQ4 C;  1X3M A;  2QI2 A;  3QFP A;  4K43 A;  3RVC A;  3CJC A;  3WT0 A;  4H03 B;  4MLH A;  3K9J A;  2JWK A;  4MO5 A;  3CER A;  2F7T A;  2V7Y A;  3LM2 A;  3U4L A;  1VQ6 N;  3U9Z A;  3QIC A;  1NGA A;  1S3X A;  3HSC A;  4LC9 B;  4BRF A;  4H5N A;  2P9S B;  5M1N A;  1QZ5 A;  1BU6 O;  5CE3 A;  2NRZ A;  2IVN A;  4BR5 A;  3P31 A;  4FWL A;  1KAX A;  3KWI A;  4DB3 A;  1U6Z A;  3D2F B;  3O1W A;  4IDH A;  4JNE A;  1KD1 O;  1QQM A;  3H3N O;  4IEI A;  2I7N A;  3ENO A;  5AZJ A;  4KH5 A;  5AQR A;  3ZEU B;  4BC3 A;  5CHI A;  2QWM A;  2QWL A;  3E9L A;  1LCU A;  1SZ2 A;  2KHO A;  2P9L A;  3R6M A;  4FWK A;  3MX2 A;  3WEE A;  4B9Q A;  4BRK A;  5BRE A;  3LM9 A;  3CQY A;  3ZYY X;  1VQ4 N;  3OHR A;  4B1Y B;  3D7E O;  2KLA A;  3C0B A;  3GG4 A;  4FWN A;  1TYQ A;  2HBM A;  1HKC A;  2E8A A;  3H6E A;  2WUS A;  2E20 A;  3J8A A;  4QS8 A;  3JXU A;  3CJ1 A;  4JKE A;  1SQK A;  3H46 O;  3MCA B;  4IXC A;  4WQ5 C;  4RWT A;  2P9K A;  1NBW A;  3FZL A;  3KHY A;  2E2Q A;  3I33 A;  4O8U A;  2NRV A;  1LOT B;  4PHT X;  3CC4 N;  4XH4 A;  3H3O B;  1MA9 B;  3VES A;  1DT9 A;  4PKI A;  1HKB A;  2E2O A;  3FFK B;  4KBO A;  5TKW A;  3SK3 A;  5KPZ A;  1VQK N;  3VPZ A;  3F2K A;  5M1K A;  5ADX H;  5GAG P;  2Q1N A;  2FF3 B;  5GIO A;  2ZGZ A;  3N4Q A;  5FPD A;  3HBT A;  5FPE A;  2HST A;  1EQY A;  2IVP A;  3C7N B;  2CH5 A;  2OTL N;  3OBY A;  3IFR A;  4FSV A;  4JK8 A;  3A5O C;  3AGK A;  5AQM A;  1JCE A;  5AQO A;  3MN7 A;  2ZJP L;  1WUA A;  4NB4 A;  1DEJ A;  3FZK A;  5AQP A;  5KQ8 A;  1Y64 A;  5AQF A;  4JEP A;  2NNW A;  3CCM N;  3O9Q A;  4PL8 A;  3SLC A;  4DQ8 A;  3GE1 A;  3A0I X;  3EE8 A;  2BUP A;  2WFB A;  3ID8 A;  2GTD A;  4WFA L;  4JN4 A;  4H0P A;  4NLC A;  5BN9 A;  3MX5 A;  4CD1 A;  2QWP A;  2NRW A;  5C15 A;  3ZX2 A;  1NGC A;  3HOS A;  2A40 A;  5EY4 A;  3A5N C;  3P4I A;  4YOR A;  2RHK A;  3VF6 A;  4JAX A;  3CCU N;  5AQY A;  3H1Q A;  5AZJ B;  1TUU A;  4M63 C;  4I6M B;  2W41 A;  1GLA G;  4OPH A;  3C6H A;  4A2B A;  3O8M A;  1SAZ A;  4CBX A;  4BC5 A;  3MWP A;  4ILH A;  3AAQ A;  4FWS A;  3JS6 A;  3UKU B;  3CXC M;  3O9S A;  4FL9 A;  3DXK B;  3EZW A;  4FOI A;  3UKR A;  3TSQ A;  4AM7 A;  4BRQ A;  3L6Q A;  1HX1 A;  4GVE A;  4NLB A;  4WFB L;  1QZ6 A;  1OKJ A;  1T44 A;  1QVG M;  2VGN A;  1QHA A;  1YVN A;  1RDU A;  3DXM A;  3Q7C A;  5AQV A;  2H3G X;  5FPN A;  3VEY A;  4BVP A;  4CZM A;  1KAY A;  2V51 B;  3I55 N;  4BG8 A;  5JVG L;  2F9W A;  3FR0 A;  2ITM A;  3NMU A;  4RCH A;  2NRH A;  3N4P A;  4DHY A;  4ISG A;  2NZT A;  2Q97 A;  3TU5 A;  3WXM B;  4K25 A;  2PFU A;  4BRD A;  1GLB G;  4I6M A;  3CCL N;  2Q31 A;  3TSP A;  5M1Q A;  5F1X A;  4A61 A;  3AGR A;  2HBL A;  3ZX3 A;  3L0Q A;  4JKH A;  4O8K A;  4YDU C;  4JHD B;  4CZK A;  2A41 A;  5GIN A;  1YI2 N;  3HZ6 A;  2OTJ N;  3G25 A;  4Y0W A;  1H1V A;  3D2E A;  2YHW A;  2P9U A;  1JJ2 M;  3VEW A;  3E9P A;  2QW9 A;  4H5W A;  4IOX A;  4A57 A;  2KKZ A;  1BDG A;  2P9P A;  3VTI A;  4BRM A;  5KPR A;  2HF3 A;  4IEE A;  4IFE A;  1ATR A;  3D2E B;  4WCE L;  5BPL A;  1JCF A;  4YDU A;  1VQ9 N;  1JCG A;  3DWL A;  5AQL A;  3TTC A;  3WXJ A;  4QS9 A;  4ISF A;  2P9P B;  1NM1 A;  2FF6 A;  2A6A A;  3QFU A;  3VER A;  1NMD A;  5BN8 A;  3BF1 A;  3EN9 A;  3OA9 A;  1NGE A;  5BRF A;  3CC7 N;  4BY9 C;  2YCH A;  4H0O A;  4CJ7 A;  4A5A A;  1S72 N;  3CQX A;  3MK6 A;  1NGB A;  2JWL A;  2ASP A;  2V52 B;  3QML A;  5EOY A;  3PIO L;  3K9K A;  2CGK A;  3T69 A;  3ULE B;  2Q0R A;  4BG9 A;  2GWK A;  2Q36 A;  1QVF M;  1QQN A;  4JKD A;  3G4S N;  4F9O A;  4BRE A;  5JVH L;  3FZM A;  4BQZ A;  2YJF A;  1HUX A;  3C65 A;  3P39 A;  5I9E B;  2HOE A;  3DXM B;  4EHU A;  3EO3 A;  2P9I B;  2YI1 A;  3LL3 A;  2W40 A;  1VQM N;  1MDU B;  2WC9 A;  2VGM A;  1YJ9 N;  2UYT A;  3HI0 A;  1YHQ N;  1X3N A;  2YX6 A;  5AQK A;  4CBU A;  4B1X B;  5AQG A;  1K8K A;  3CIP A;  3ULE A;  3VGL A;  3DXK A;  4WF9 L;  3LDP A;  3R3L A;  3ZET B;  5EVZ A;  2E1Z A;  4YOW A;  2E88 A;  3U9D A;  4IOC L;  5AQZ A;  2ASM A;  1W2B M;  4IOA L;  4H0Y B;  1Z6R A;  3FZH A;  4B1W B;  4R79 A;  1VQ8 N;  3D2F A;  2D0P A;  3I8B A;  1VQ5 N;  4ISE A;  4PKH A;  2QWN A;  4EAH D;  2E2P A;  3R8E A;  3ZX0 A;  3CMA N;  5FPM A;  3GL1 A;  1HPM A;  3J7Z O;  1VQO N;  4CI6 A;  3SMP A;  3KWG A;  4WYB A;  1YIJ N;  4CZE A;  3EKS A;  1M90 O;  4FVU A;  3CCR N;  3D6R A;  1Q82 O;  1BWF O;  5AQU A;  2ZF5 O;  4J8F A;  2QM1 A;  4Z94 A;  1GLC G;  3VEX A;  1V4T A;  1M1K O;  1ATS A;  1GLE G;  4CZI A;  1E4G T;  2NLX A;  3QDK A;  2YHX A;  5AQX A;  4NO7 A;  4RTF D;  3BP8 A;  4AM6 A;  4CZF A;  3WQU A;  1TUY A;  3TTF A;  2OAN A;  3NVK A;  1GLD G;  3LDN A;  3H1V X;  3NVM A;  1YAG A;  3MN9 A;  2VWB A;  4B1Z A;  3C7N A;  2ASO A;  1QQO A;  4PL7 A;  4YOU A;  1GLF O;  1Z05 A;  4BR4 A;  4AF1 A;  3EL2 A;  3WXI A;  2DPN A;  4QS7 A;  4WQ5 A;  2QXL A;  3UB5 A;  5M1F A;  2A42 A;  4C1N I;  2FSK A;  4JD2 B;  3BEX A;  3R1X A;  4CZJ A;  1NGI A;  1IG8 A;  1NGD A;  5JIC A;  3FLC O;  3B8A X;  1W97 L;  4JK9 A;  3AY9 A;  3W0L A;  3A5M C;  3WXK A;  2P9K B;  3C6A A;  4JKC A;  1BG3 A;  1Q18 A;  4JKG B;  3SJH A;  4JKA A;  3WEE B;  4CZG A;  3EKU A;  3ZEU A;  4IJA A;  3VGK A;  4CZH A;  4IO9 L;  1BA1 A;  1TYQ B;  5HOO A;  3O6W A;  3MCP A;  1BUP A;  1XQS C;  5EXW A;  5GAD P;  4KH6 A;  4GNI A;  4JKG A;  2IVO A;  4FPA A;  4FWP A;  4BR9 A;  3M6G A;  4JKB A;  1HLU A;  5AQT A;  3CC2 N;  5KPT A;  3A8Y A;  4O5F A;  1NJI O;  3H45 C;  5AQJ A;  4BR7 A;  1R59 O;  1SS6 A;  4FWQ A;  3ATV A;  1Q81 O;  1ILY A;  3TPQ A;  1VQL N;  4UY8 O;  3KZB A;  5JLH A;  3GBT A;  2PAV A;  3UE5 A;  1HKG A;  5ELZ A;  4WQ4 A;  5M1P A;  4JD2 A;  4XEI A;  4U7B A;  5TKY A;  3S41 A;  3SAH A;  1KQS M;  2FSN A;  2P9N A;  3CPE A;  4JK7 A;  4BR0 A;  2QWQ A;  4A59 A;  4A2A A;  3O08 A;  5HL7 L;  4H0V B;  1VQN N;  1S22 A;  3F9M A;  2I7P A;  1P8Z A;  2ZWH A;  1KXP A;  3FZF A;  2P9N B;  4EFH A;  5BPN A;  1V4S A;  4H5V A;  1EO1 A;  5F2R A;  2HBK A;  2QWR A;  5H1S Q;  3QBW A;  1YF5 L;  2V7Z A;  4BRH A;  3CD6 N;  4XH1 A;  5JLF A;  4KH4 A;  4L3Q A;  1GLL O;  5BRH A;  4HTL A;  3HOT A;  3CF5 L;  1VAZ A;  2FSJ A;  3M3Z A;  4YOY A;  4GY2 B;  3VEZ A;  2YHY A;  3SAF A;  1BO5 O;  3E1Y A;  3E9O A;  3MDQ A;  3O80 A;  5E26 A;  4B1U B;  1YJN N;  4ILG B;  5E84 A;  1RGI A;  1NLV A;  1YUW A;  3M5R A;  3CJB A;  1BA0 A;  1MWK A;  2Q0U A;  3ZET A;  4YOX A;  5AZI A;  4H5T A;  4GV6 A;  4EHT A;  3HRG A;  1VQ7 N;  1K8K B;  5AQQ A;  4BRG A;  3FGU A;  3CCV N;  3ATU A;  3CHW A;  4FOE A;  4BC2 A;  1T6C A;  4BR2 A;  3R9P A;  1DKG D;  2P9I A;  3CI5 A;  1K9M O;  4B1V A;  3CCS N;  5AR0 A;  1U2V B;  2VCP A;  2P9S A;  5F0X A;  4MDB A;  1ZXO A;  3O9T A;  1XC3 A;  3CJ7 A;  4CZL A;  3AAR A;  3IKM A;  3VGM A;  4BVO A;  3FE1 A;  3VET A;  2VYP A;  3GDQ A;  5C2F A;  2GUP A;  2HMP A;  1T3V A;  3QB0 A;  5LJW A;  4C1N K;  3MN5 A;  2GEM A;  4BRP A;  2CGL A;  1YJW N;  1N8R O;  3TTD A;  1KAZ A;  2J4R A;  1IJJ A;  1CZA N;  5MLC Q;  3CCQ N;  3CME N;  4IWV A;  3O5B A;  4CD3 A;  5GAE P;  5B8H A;  3G6E N;  4FWM A;  2D4W A;  5AZI B;  3VMF B;  3SBT A;  4K41 A;  4K42 A;  3MMV A;  3O9U A;  1RFQ A;  3AAP A;  1VQP N;  2A5X A;  3O9R A;  2BTF A;  2Q2R A;  4H5R A;  4PKG A;  1XUP O;  3RSE A;  2CH6 A;  3OBW A;  4M7X A;  1Q7Y O;  5GAH P;  1ZC6 A;  5AFU H;  2HBJ A;  5AQH A;  4ILJ A;  3SMS A;  4BRC A;  4DKW A;  1YIT N;  3VEN A;  3IMX A;  3BF3 A;  1D4X A;  5CR4 A;  4OO1 J;  3VEO A;  5BPM A;  1DGK N;  1NWK A;  3QBX A;  4CBW A;  3LDL A;  4MLE A;  3KVG A;  4FPB A;  1Q86 O;  1G99 A;  5C0Y A;  3DAW A;  1GLJ O;  5DM6 L;  1O13 A;  3M1F A;  4HWI A;  2NRT A;  4GV3 A;  2QWO A;  5C12 A;  3F5T A;  1NGH A;  1HJO A;  2P9U B;  3VTH A;  2GWJ A;  3VOV A;  2IIR A;  1K8A O;  1NGF A;  4C23 A;  3PLA A;  2QEX N;  3ID6 A;  2FXU A;  5AQW A;  4FWR A;  4BGA A;  1BOT O;  3HTV A;  5AQI A;  2AA4 A;  3WUH A;  2RE2 A;  3CET A;  3MWT A;  4BRN A;  5JMV A;  3KK7 A;  1K73 O;  1RDW X;  1KC8 O;  3Q7B A;  3UKR B;  3LDQ A;  4EIA A;  3HM8 A;  1U2V A;  4H0T B;  1J6Z A;  1C0G A;  2FLO A;  2GEL A;  3UKU A;  4E1J A;  4U67 L;  3DJC A;  3LDO A;  4BRI A;  2AP1 A;  2QTD A;  3SAG A;  4WFN L;  3PIP L;  1E4F T;  4BQL A;  3E66 A;  3L4Q A;  1ATN A;  3O1B A;  5AFU A;  4M7Y A;  4MO4 A;  3DLL L;  2HF4 A;  3ENH A;  4FO0 A;  3OW2 M;  3U8X A;  1C0F A;  1X9J A;  4BRL A;  5LY3 A;  2GX9 A;  2P9L B;  5EX5 A;  5BR9 A;  2ZJR L;  5DM7 L;  2CGJ A;  2F9T A;  4OPA A;  4A62 A;  5ADX A;  5C2D A;  3IUC A;  5LJV A;  4FWO A;  3VF4 A;  4DCH A;  4BGB A;  4GV9 A;  5AQN A;  5AQS A;  5BRD A;  1MWM A;  5M1O A;  1T6D A;  1WOQ A;  1ESV A;  3EE9 A;  1OVY A;  2PBD A;  3WQT A;  5C10 A;  3BUZ B;  4H0X B;  5GIP A;  2A3Z A;  3CJ9 A;  4XH5 A;  3CPW M;  1NGJ A;  4YOT A;  3VF2 A;  4JKF A;  2QA4 N;  3L4I A;  3W3D A;  4IZ9 A;  4BC4 A;  4IO8 A;  3TSU A;  2D1K A;  2ZGY A;  3RSE B;  2WBN A;  5KQD A;  3A5L C;  1NGG A;  2ZJQ L;  3CCJ N;  3P38 A;  2NRX A;  1YXQ A;  2E1Y A;  4YOV A;  3CJA A;  3SBG A;  3CCE N;  4JHD A;  2BH1 A;  3IDH A;  3G71 N;  2EWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...