2JWPA

Malectin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
GLADKVIWAVNAGGESHVDVHGIHYRKDPLEGRVGRASDYGMKLPILRSNPEDQVLYQTERYNEDSFGYDIPIKEEGEYVLVLKFAEVYFAQSQQKVFDVRVNGHTVVKDLDIFDRVGHSTAHDEIIPISIKKGKLSVQGEVSTFTGKLSVEFVKGYYDNPKVCALFIMKGTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malectin
publication title Malectin: A Novel Carbohydrate-binding Protein of the Endoplasmic Reticulum and a Candidate Player in the Early Steps of Protein N-Glycosylation
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Sugar binding protein
total genus 34
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2007-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11721 Malectin Malectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 2jwpA00
1W8WA 4BQ3A 2K46A 2LRPA 2Q1FA 1GWKA 4YWAA 1OH3A 1GWLA 3ORJA 1W8UA 4BQ2A 1WZXA 2LROA 5D21A 2VXJA 1W9FA 4AL9A 1W8ZA 4LKDA 1L7LA 1W90A 3F95A 3UT0A 1V0AA 2O14A 3ZYHA 3ZYBA 4CP9A 4LJHA 4LKFA 4LK6A 4CPBD 2C24A 4BQ5A 4CPBA 1WMXA 1GWMA 1W8TA 3ZYFA 4LKEA 4CP9B 1UOJA 4YW7A 1OKOA 2WYFA 1HN0A 2KR2A 4BQ4A 4LK7A 2JWPA 4YW6A 1WCUA 4A6SA
chains in the Genus database with same CATH superfamily
2NLRA 4P9WA 3POEA 1NCQC 4Y20A 1OLRA 4IEOA 3U11A 4UYBA 4JGZC 3UKNA 3JD73 4LE4A 2VZVA 1XRUA 4GMP0 3INAA 5C71A 4M01A 2VBDA 3EXUA 2R7EB 1W90A 5FY0A 1LU2A 3AX4A 1ND3A 1X9PA 5FCCA 1NKGA 2YBPA 2B7YA 3IIAA 4M3CF 3FLTA 1U5IA 4Q0QA 1SFPA 2AR6A 5C4WA 4AGGA 3WNXA 4YW4A 4LHNA 5H9RA 2EIDA 4LMFA 3LOIA 1SLCA 5F5CA 3PIGA 1X7NA 4HPKA 2WS93 1OF3A 4EV0A 4F8AA 1JZ7A 5F2WA 2ZOEB 1WLDA 2VBBA 4AVCA 1DHKB 5DMYA 3MIEA 5FZBA 2ZAHA 4XC9A 1HQWA 4XIKA 5E16A 3OG2A 4XJ8A 2PHWA 2XONA 1OOPC 1ZNPA 3AB0A 3UYJA 2ARBA 3N7LA 5BNNB 3ZN6B 4GWIA 1UKGA 3ILFA 1H2MA 2IXCA 2VXJA 3RZHA 1RUI2 3WNPA 4OHVA 2YC4A 5F9TA 1YWKA 2JG9C 5FXVA 1RC6A 3S57A 3M70A 1D4M1 1QHDA 3MUY1 4JAAA 1VPHA 4YRDA 1PX3A 1VBE1 3M2MA 1WMDA 4DEQA 1GQHA 3RWKX 1WLTA 4FT8A 4I30A 1YXWA 2HWF3 2RG4A 5C3RA 4E2QA 3GZEA 4FVVA 1SDWA 3ZMNA 5JSPA 4D7SA 3AVSA 5L7OC 4Q4V1 3TNPB 2ATFA 3NAPA 5A1FA 2YGLA 4FP2A 4QU2A 4XMAA 4YWAA 5FBZA 2ET7A 4LQRA 4W4ZA 3SLIA 5ERLA 5GM0A 4WVMB 2LM3A 5JPNB 1JYNA 1FOD3 4LNVA 3TOJA 1STMA 4SBVA 1HV1A 1TEIA 3CDZB 2P6CA 2A75A 1W28A 4NE9A 1MVEA 2HWB1 1HRV3 2OZJA 2RVAA 2W08A 3KVBA 2VOVA 3OYWA 4QT6A 1DGRA 3Q8CA 3J7LA 2WUHA 3ZX7A 4PLNA 2PAKA 2YPJA 3LDBA 3I3BA 4IGPA 4P5YA 5J3UA 1IS3A 5BXXA 1O6UA 1LOBA 2X05A 3IDAA 4BISA 3BODA 3VKOA 2BPA2 4TTGA 5LB6A 5JSOA 4YVWA 2F17A 1SFYA 2GZWA 2V09A 4Q4X1 5HXVA 1ENQA 2PHLA 4IQPA 2IXLA 2HWE2 2AZ5A 2Y26A 4DXTA 1BMV2 4TWTA 3R4UA 1NYWA 1BJQA 1QJU1 1XPWA 3I2GA 4MADA 2GNDA 2WS92 1VBC3 3SHRA 5FZ4A 5KHJA 3TN93 2R072 5D8AA 2VMIA 3LEKA 2X8KA 2WDBA 4JGYB 2ZXQA 2D97A 1F5FA 2VUCA 3W21A 3ZSLA 4KI5M 1C8M3 1XSQA 2VZSA 2VXRA 3PUSA 3N3HA 4GULA 3BTXA 2XQXA 3I3QA 2A73B 1YYNA 3J9SA 3VBSA 4EN7B 2W39A 5IATA 4QXCA 1S55A 1V00A 2WT1A 2KXLA 2WZR2 3O1TA 2HWF2 3T4HB 1RJ7A 1QJX3 1UZ0A 1OC1A 1V0AA 1R083 2WRAA 1Y4WA 5KHGA 4SLIA 1H8TB 4CP9B 3DEMA 4WM7B 2Q8EA 5LATA 4CCKA 3V0AB 2XQRA 4COWA 5FDBA 3ME2A 5KXBA 1BEV3 1FOD2 5HCFA 1V6NA 4FAHA 1DYKA 1JODA 4EQVA 5J09A 4BZ4A 3WNMA 1X82A 1UW8A 2JECA 2WNOA 1HRV2 2WZPP 1W6OA 4NHXA 1GWLA 1GICA 1X36A 3L9JT 4LUKA 3SMHA 2EXKA 4CP0A 1T6BX 4CCDA 2RS33 3WHTA 4XFCA 3LF7A 1I9RA 2NYYA 1OVPA 2Z79A 3D82A 5D1IA 5DAWA 3W5MA 2B42B 4NIDA 3ACHA 2E51A 3LPGA 4LUMA 4MV2A 2XLGA 5FR3A 4WZFA 2DBNA 4PBPA 2RS11 1Y7BA 1NCQA 4HSLA 3AM2A 4KWLA 1HXS3 5BNNC 3WD5A 5FXWA 4C90A 1FPN1 1S0GA 2H0VA 5K7PA 3WF4A 1CAUA 2VZOA 4IV1A 2IXHA 4Y5TA 1WMFA 1KEXA 2WT2A 2WIIB 3OPWA 5FP3A 2VZPA 5GZEA 1DYPA 2AH2A 3S7EA 4CVUA 2JIJA 3T0BA 4CEWA 4C0BA 1C4RA 5A70A 2TUNA 1ZZ7A 3AMPA 2AGSA 1HLCA 4DQAA 1AXZA 4TZDA 5F8PA 3RJ2X 1C8M2 3OBZA 1AR63 4JRLA 2GC0A 4MLOA 3BIWE 3BPZA 4Y22B 3VBUA 1RUNA 2YXSA 1XNKA 3FL7A 4LKSA 2YYOA 3ZPYA 2KR2A 4DY3A 3GF6A 4MGSA 4LO6B 4AXOA 3K77A 1RUG3 2FDFA 5J48A 3J8F2 3MIHA 2XJQA 2BGPA 4I09A 1LHWA 4FPEA 4AAPA 2JG9A 1POV0 2AREA 5DZEA 1LNSA 4FFGA 5FY7A 4LTAA 5FZ6A 5A6YA 4BQ2A 3IAPA 2XJRA 3L2YA 1FYUA 1RUJ1 3ECQA 5I8SA 1EAH3 1V6KA 1KD7A 2VVFA 3PTYA 5FYCA 4D94A 4Z2AA 4AL9A 2HKXA 2WNVB 3M3OA 3URFA 4CZSA 1MEC3 4YZ2A 1Q3EA 5T5PA 2ZX1A 3N7KA 2Y6JA 1DQ0A 2D5FA 3AKRA 1M4WA 1W0PA 5L7OA 1G9BA 1D0GA 2PHFA 4A7KA 3FMGA 5LK5A 2A6VA 5E6HA 4FBFA 1QJY2 1BCXA 4XAEA 5CFCB 3BN6A 3BIEA 4XILA 4AEDA 2DF7A 5JOYA 1K45A 2B5HA 4K8RB 4A3ZA 3IZOA 3I2JA 2JX9A 5BV6A 4JGYC 2E7AA 4YZ5A 4GQ7A 1BVP1 1YJLA 2WWJA 1UU4A 1W04A 2JDYA 1ASJ3 2DVBA 4B3NA 3WF3A 5CZKA 2XGXA 2IWGB 4AOCA 4GKXA 3NMBA 3ZMOA 1UMHA 1BXHA 1W2AX 1T6GC 4OMCA 2JB8A 1I5ZA 1NAEA 1O91A 3WNOA 2Y0OA 3IM0A 3UJQA 3RG0A 4XZUG 4XUTA 4UWDA 2PELA 3VBHB 3ZKUA 4XACA 3UGFA 4A7YA 3GHNA 4AI1A 1DBNA 5DUWA 3I59B 1H8TC 2FCUA 3I49A 4WM7C 2ZX0A 3FE5A 4W6WA 3SKVA 5A6ZA 1VRH2 1AR62 3POBA 5EYXA 1E5SA 2Q30A 2XHNA 4ARXA 5F6LB 1TMF1 4BLJA 2CV6A 2W92A 1J1LA 2WSUA 4XF1A 4QGMA 4XTMA 4FFHA 5DAPA 5I0TA 1CESA 3PUQA 4XCAA 3RPQA 4NIHA 1BBT2 1RUD3 2WN2A 3JQWA 2P3IA 4N43A 1WUVA 2ETEA 1DU3D 3FJSA 1EV13 2W46A 4AR2A 3AL5A 1TME1 2EXJA 5FMCA 5FPLA 4XQWA 5A7OA 3ZYFA 5J1XA 1K12A 3I2OA 4D0QA 2HWD1 2I2SA 1GFF2 1LKNA 1OSGA 2OX0A 5L9VA 3C7OA 1EAH2 2ARAA 2J1EA 5CU1A 1MS1A 2GMMA 2VD7A 4PCRA 5FZFA 4UW4A 4YZ3A 2QQJA 2CYFA 3ILRA 2HYKA 3ATGA 3ABZA 1S2EA 3K75B 4F7ZA 1POV3 2RM21 1PM7A 3AZXA 1N47A 3POGA 1DLLA 4XFHA 5DN2A 3POWA 1PVC1 1O8PA 2ZGNA 1DGRN 5ACA1 2B9UA 2ID4A 2GU9A 3R0RA 4RSUA 4UBHA 3ZIXA 2RS52 2D40A 1PO12 1CZTA 1OF4A 5JAXA 2PQSA 2ZZQA 1YUDA 2EVXA 2OUHA 2CGPA 5BNQA 5KXDA 1US2A 1ASJ2 5CB7A 1V6MA 2MEV1 2TEPA 1OQEA 4IGQA 4MGIE 3OY8B 1YCIA 2BDRA 3E1F1 4ITCA 4Q4V3 1XE0A 1QDCA 1LENA 1OLME 3WCSA 1RUI1 3PIJA 3SH4A 1VIWB 2K46A 4Y4YA 2DDUA 2HEYF 2CSGA 3VDCA 4BOWA 4J25A 2RDNA 4Y20B 2XLFA 5BNNA 1JI6A 1DLCA 3ZN6A 4Q1RA 1FI2A 2MNGA 1RUF3 1ZBA3 3MV11 1JOJA 2HWB3 3CJIA 3ALQA 1GP5A 3QOPA 5HV0A 1HV0A 3HN3A 1RVF3 4LHLA 5I8YA 4J1XA 1ND3B 2FQPA 2GMPA 1YFUA 4L9BA 4UF0B 2B4KA 1PGW1 2J1VA 1CZVA 1EPZA 2WZEA 3A7QA 5FMDA 5KHHA 4FAGA 1UOFA 2BYVE 2IFRA 2WNVC 1DGLA 3VZMA 4S2DA 3WG1A 4BMBA 5C4WB 4V2VA 3J7HA 1UPSA 3AXEA 4MHUA 1RUD2 1DZQA 4GWNA 5AFEA 2EIEA 2VW2A 4JQRA 4QXKA 2W95A 1YFXA 3RZMA 4HPKB 5CFCC 3O1UA 4PLMA 4WM8B 2A6YA 1ZX5A 3U14A 1G9FA 5T5JA 4MGYE 1UYPA 3E6BA 5GZFA 1WMEA 2ZX2A 3JD71 2G9GA 5FY9A 5T54A 2ZGMA 4BH9A 3QH6A 5EPAA 1CAXB 4NWWA 1ZA7A 1BVVA 1YLLA 2G1MA 1L7RA 1OPOA 1GP4A 2VO5A 3Q8EA 1RHI3 2HJIA 3CLPA 3N9OA 2B8MA 4LIUA 5A7WA 2VMEA 3USSA 5CG8A 3AMNA 3T2OA 1XYPA 1DIWA 4A6SA 1LOFC 4EJRA 1W2UA 1QGLA 5HCAA 2YV8A 1B35A 3VBHC 2WO3A 3M8LA 3GHMA 1RTVA 3MZHA 2WS91 3CMGA 1WD4A 2QNKA 4OHZA 5IVBA 5L73A 1CX4A 1VBE2 1X8MA 3NAPB 3FBMA 4S2HA 3UETA 3KLSA 3CZUA 2G4IA 1X50A 2ZEZA 1LR5A 1TQ5A 2BOIA 3NVCA 1QQP3 5C9AA 3DUIA 4Q4V2 4Q5OA 2YROA 1EUUA 4Q0UA 4KBZA 1J3QA 3OYWB 3FLRA 4CE8A 2W9XA 1NQDA 2A3YA 3RYPA 3FLPA 5LY1A 4XZPA 2PHTA 1RUF2 2WWUA 2D6NA 2HWF1 1W8WA 1JOPA 2HWB2 5APAA 5CFDB 3H7JA 4RHV3 4DUVA 2R0HA 3N36A 1MR5A 2VW1A 1IZ3A 1IQDC 2O8QA 2SBAA 3ZOIA 5C7GA 2UWAA 1DDLA 1ALYA 3IDEA 5F3EA 2E26A 5F5AA 2B9VA 3KF3A 4ES9A 1L7LA 1FOD1 1JW6A 2FDHA 2E32A 1LHUA 4Y1UA 3VD7A 4AHYA 2V4AA 1YFWA 3M1HA 2AENA 2X5IB 4XHXA 3V0AA 2R043 1HRV1 1XNDA 3KCXA 2Z42A 1F35A 5EHDA 2UURA 4IEZA 3DKQA 4YARA 1AX2A 1VRBA 3KB5A 5A6XA 1QNWA 1W9SA 4GJYA 4P9LA 1OD5A 1SEFA 4WBBA 4AGVA 3O0XA 4HG6B 3N4MA 1WBLA 3JZVA 3ZYJB 3ZPOA 1S2BA 3J4UH 5HV4A 5FZ0A 2K0GA 2J1UA 4W6YA 3WW3A 2W1WA 1WLCA 4AQ2A 3LOBA 1OD3A 4RS5B 2QQVA 1OA2A 2IVIB 5JMCA 4CA9A 4IV3A 4BMEA 1LRHA 2XVLA 2W1UA 1VBC1 1FATA 3N7JA 4Q27A 3TN91 2XXZA 3WEZA 2DCYA 3DN7A 1OMIA 1BYHA 2AUYA 2VMDA 2ZZJA 4ATEA 4UFLA 1ND3C 4CUCA 1C8M1 2XJUA 3A0KA 5EIYB 1ZZ8A 2Y6HA 3MW2A 2QQUA 3ZXLA 5IVEA 5IK7A 2FD8A 1CIYA 4CCLA 4ZKTB 4BM8A 2V5YA 1RUJ3 5A3TA 5C4WC 5LZ6A 4XXAA 5FBJA 2ARXA 2VW0A 1AYM3 1O59A 3GGLA 4XHBA 1VAKA 2PHDA 1W6OB 1SHWB 2JDHA 2DFBA 5FLHA 4XJWA 2JE9A 4AHWA 2PMWB 4LKDA 5A3PA 4YG6A 3SQOA 5M0TA 4Y22A 4WM8C 5T5OA 1UYZA 1WW7A 2Q1MA 4XF3A 4A3XA 2C24A 1QJX1 2OW4A 1OKQA 2IC1A 4AHZA 1ZRRA 1R081 2VVEA 3JU9A 3LB9A 4BU2A 2WFF3 4IE0A 3P5BA 5HXMA 2D3RA 4RR3B 5A80A 4PHZA 1HB2A 1WA6X 4HK9A 5HCBA 5GZCA 2WJSA 3AKQA 1AHSA 2V5DA 4PF1A 1CAUB 4IV1B 4TXWA 1SG3A 4JQTA 4GXLA 1BEV1 2RS12 2VQTA 3WF2A 5DABA 1CIWA 1NXMA 4QQHA 1DFQA 1FPN2 4W65A 3ZIWA 1UU6A 4NHMA 4LR4A 2XUEA 5DAQA 4CEWB 1XE8A 2NQYA 1H9PA 5FQ0A 4YW2A 2RS31 4BXSV 2W0XA 1S0FA 2W52A 3THPA 3NAPC 5FY8A 2I45A 4OZOA 3VZNA 5CFCA 1JYWA 4H55A 2ZHNA 5FYMA 3A0NA 5EYYA 1KQRA 2L9LA 1YI9A 3VBUB 3WNKA 4MX3A 1HXS1 5LK7B 3Q8BA 1RMU3 3ROUA 1OI6A 3T09A 4QAWA 4TLGA 4DUWA 4JVAA 2LRPA 4XMIA 1Q8OA 1UPIA 3HQXA 5FZDA 1BHGA 4L8QA 4Y3OA 3SH3A 3AK0A 3ZXAC 2E9QA 3CQOA 5KWRA 4Q29A 3AC0A 1S0EA 5KXEA 5H9QA 1N1TA 5CFDC 3K4ZA 3RWNA 4LLFA 3PMSA 1OA3A 2J1SA 5CVRA 1UQXA 1AR61 1IOAA 1ULGA 3ETPA 2DUQA 4P14A 1UF2C 2ZGTA 4INDA 4QXHA 1RUJ2 2FHRA 4P9XA 5E1RA 1S0DA 3WR0A 4COUA 3H50A 4YM0A 4WVZA 4O61A 3RYKA 2VE1A 2ZGLA 5DQ0A 2ZGSA 4AEDB 4BJ0A 5IFPA 2X5IC 5CYYA 1RUG1 1Y43B 4RD7A 4GWJA 4AI9A 4Z2WA 1OH3A 4OHYA 2Y60A 4NRQA 1PGSA 4IEVA 5GJ6A 1NUKA 4OZXA 2A70A 4AEKA 5JOWA 1NG0A 2IVJA 2VMGA 5A3OA 2XH6A 1QF3A 2VU9A 1EAH1 5FLJA 4X8NA 2WAAA 4DY5A 1PK6A 4LKFA 4FFIA 5GLTA 1MEC1 3LEMA 4Y24A 5FV3A 5LBEA 1DYOA 3VKLA 2KM2A 3HWJA 1NLQA 4NMIA 2WZ8A 4UAPA 4JKMA 2JEMA 5F5IA 1H9WA 4ONUA 4LIVA 4ARYA 2G9FA 4RS5C 1HX6A 2Q4SA 4B1MA 5HBAA 1O5LA 1H2LA 2BZDA 5FPXA 3H3ZA 1JYIA 5FYYA 2XKPA 3AFKA 2ZGQA 4TSVA 4DEVA 1F4AA 5FZLA 4XFGA 2YG0A 1CAWB 1ZM1A 3TNQA 3ON7A 5E89A 1UO9A 2DCKA 4U2AA 4LXLA 1ASJ1 2XJVA 4ZHNA 1WZXA 3IMNA 3GM8A 2RJLA 4JDOA 2E7QA 4Z1VA 2D7FA 2EXIA 2O14A 2ZKLA 2P3KA 2Y6LA 3GDBA 2DBIA 1DG6A 1X9TA 3DYPA 4N43B 1TMF2 4DNYA 3E5UA 2PLV3 4YPJA 5FXZA 3OY8A 5C8CB 4DOUA 2P2KA 3QLQA 4E8DA 3GJBA 2RE9A 1G9CA 1TME2 5GALA 4FPOB 5F6KA 2W1SA 1HB4A 3AP9A 2ZACA 4XJUA 4I02A 4RR3C 3S0MA 1O5UA 2HWD2 1QOSA 1XYNA 1Y9QA 3OGRA 2C9AA 4IV1C 4QWNA 2OIIA 1S0JA 3H8OA 5H9SA 3VL9A 5A7NA 1JZ5A 2GP5A 1S0BA 4GH4B 4OCTA 1RUD1 4ET7A 4NJ4A 5FYUA 3ZO0B 1RL3A 4UF0A 3ACIA 3JBG3 2ENRA 3ST7A 2JKXA 1EV11 2RM22 4NHKA 4CEWC 4D69A 3PUHA 5C5UA 1PVC2 2A7AA 4LK7A 5JUVA 3E6CC 3HN1A 2UYAA 5ACA2 3POJA 1OFSA 2R1DA 1LGNA 2ZGKA 2RDQA 1AR73 3I4IA 2XBO3 4XFBA 4BHPA 4WM8A 1HN1A 4YFZA 1F2NA 1GNZA 4YGEA 3VBUC 3WUCA 5FAXA 3OUHA 3ENRA 2MEV2 4CUGA 2OA2A 5DUVA 3SEPA 1POV1 3ZSKA 1CAXA 2E63A 1Z7S3 3WP3A 3PVEA 2IUWA 4MYEA 2VZTA 2W68A 5AC93 1DGWX 3NV2A 4LO8A 4CDWB 3CJIB 4OLLA 3VKFC 4FQ4A 5DXDA 5LRRA 3H8RA 4PLOA 1QJFA 3DPRA 4AI8A 1REDA 5JIAA 2E7TA 1HB3A 2CL2A 1BZWA 1NZCA 2ZGPA 3ZN4A 5FZ8A 5A6QA 5C3QA 5FP7A 3KV4A 3C3VA 3AMQA 1SLAA 1YO8A 4FPCA 2P3JA 4OHXA 3MFAA 4BQ1A 1YQCA 1PGW2 2VUDA 1CX1A 1CQ9A 4QDQA 3PVBB 3KGLA 3SNMA 4L92A 4AEDC 5CNAA 4AFMA 2BUKA 1SLIA 3V65A 3R6SA 3RGBA 1RUF1 5DAVA 2ZEWA 3ES1A 1ZBA1 3LA3A 4B7KA 4CPBD 4FFFA 3X29B 3HR9A 4LT5A 4M00A 2BNNA 4ISRA 3LSEA 4A45A 5I8TA 3O1MA 1RVF1 3H9AA 1J3PA 4NHLA 4Z92B 3EHKA 3QH7A 3JD72 3KV5A 4D7YA 1F5JA 1NT0A 5CFDA 5A7WB 3VGIA 2W91A 3RI9A 3ELNA 1U0AA 3K4AA 4DUXA 1MVQA 4CUBA 3CHXA 1TNRA 3JBG2 1VBA3 3U75A 3LKJA 4CU9A 1JHJA 1B35B 1QWRA 4R9CA 4OQ8A 3O1SA 1PMJX 2ZABA 1SFNA 2Y6FA 4Y1XA 1ENRA 4N7IA 4M0NA 5FZOA 4NAOA 2VZ1A 1SCSA 1ZVFA 4MO3M 3PNAA 3SISA 2X5IA 5C9AB 4LHSA 5JZGA 4FSJA 2ADEA 3GBGA 2VNGA 2VCAA 3B9IA 3N7MA 3VZKA 4ASLA 3S30A 4L0PA 3LA2A 1IS6A 1Q8QA 3IDBB 5C3OA 1AYN3 2JWPA 3NJYA 1RHI1 2OYZA 1OHFA 2OZ6A 4BCUA 4N43C 4M3CE 3AMMA 4AHXA 1CD3G 4FPGA 3ZXGA 4HZFA 3U37A 4XYXA 4YGBA 1PZ7A 2V72A 3RNSA 4C8DA 4GJZA 2XKOA 4COYA 4F3JA 5C8CC 5C8WA 1QIQA 2BU9A 4JHTA 4XDOA 4MG2A 2YZ4A 3CO2A 3H1WA 1QKQA 2WO2A 4XE9A 2ZCWA 4AZZA 4RS5A 3VDAA 3B3QE 2VL4A 5FPBA 1RUE3 1QQP1 2ZMKA 3MHZA 4A7ZA 2LUWA 4ORFA 5A1LA 2JDAA 3WDYA 4B4PA 1MS0A 2E6VA 5CBLA 5ABJB 4GH4C 2QQWA 3O0WA 5GLZA 3VBFA 2OS2A 2IXKA 3B02A 4N90A 2JDMA 4P02B 4P00B 3WX5A 2YU1A 4WZCA 4DINB 5CADA 3WY6A 1N1SA 3O5SA 2VOXA 4RFT0 5FYIA 5I0DA 4RHV1 2LS6A 5IWFA 1W05A 5DUXA 3DXTA 2F4PA 1VJ2A 3O14A 3CBNA 1LTEA 1VALA 1ULFA 2YU2A 3AKPA 5F39A 2VG9A 3H1YA 3ZVXA 1XBFA 3HJRA 2VTXJ 1W0NA 4DRRA 1PM4A 1FMD3 1POQA 3N9QA 4HOOA 1CJPA 2Y33A 3TBDA 3MO4A 2R49A 3MLKA 2FZ2A 5FP9A 4CU6A 4IV3B 4RR3A 5EJZB 4AYUA 2Y8KA 4PJYA 3JUUA 4RQPA 3WW4A 5FZ3A 2R041 1URXA 5JVVA 1R093 4JDNA 1HW5A 3CJIC 4CDWC 5FLIA 5FPVA 3DKWA 5FWEA 1LJ7A 4QX1A 2QQPA 4QX8A 2XG3A 1GZCA 1VBC2 2BV4A 2V73A 4EE2A 4L2NA 3TN92 3RZKA 3IPVB 1AR93 1MS5A 4FOQA 3JQXA 2RDRA 2JE8A 3O12A 5FJHA 3TEYA 1W8ZA 1AYN2 3ZYHA 1JU4A 2DURA 3KT7A 3RVHA 4XW3A 5LY2A 5JR2A 5HPOA 1RB8G 4KG8A 4PQ9A 5CKMA 2EIGA 2VY0A 3OF1A 4BQ5A 2XPJA 1UZVA 1Q56A 1OQ1A 1UOJA 4LBQD 1I1EA 4CCCA 2GSYA 1H30A 1KDMA 1OUXA 3G6JB 3IN9A 5FXXA 5T50A 4IL7A 1ZBE3 4NO4A 4OULA 4QD2A 3T0DA 2VULA 3IKWA 3AZYA 1AX1A 1QJX2 1UMIA 3FHIB 1R082 4JCKA 3D0SA 3POYA 4UBGA 3VN4A 3HIFA 4YSFA 1Q8SA 5KHIA 3HD8B 1W8OA 3NNFA 4HETA 3AYCA 4MSVA 1AYM1 1GYKA 3KQ4B 5JPMB 1C8NA 2GDFA 3ZXFA 1BEV2 3N9LA 4HKLA 2GNBA 5FQ0B 2D93A 1B35C 3QBQA 1W2NA 1BK0A 4IXLA 3PU3A 2E53A 4AI0A 1VAMA 2A3XA 3SCHA 4E4DX 5JLVA 3EBRA 4LLOA 5BNPA 5FK8A 2TNFA 2G19A 2BGOA 4CP1A 1MS3A 1OA4A 3I3DA 4YM2A 4DPNA 2WFF1 2RS32 2ORXA 2Y38A 4EROA 3VUOA 3WDTA 5C9AC 4XVHA 5HI0A 2D5HA 2Z2SB 3TYJA 4D3WA 4F83A 1FNYA 2YHJA 1WCSA 4CCNA 4E4SA 3BYWA 3UESA 3ZXJA 3NKGA 1HXS2 4QKBA 1KFXL 3O7OA 2XJSA 3O1VA 1NCRA 4ZONA 1R1A3 5FKCA 3WQ1A 1AXYA 3HOBA 1R092 3RZJA 2JDUA 4YLZA 4C1WA 4BIFA 1H1MA 1PNGA 2VGDA 4FP3A 1MQTA 1H6YA 4QDSA 3KF5A 2BW8A 5FZ9A 1Z78A 5LEKA 5LBFA 1JS9A 4IETA 1RGSA 3C2UA 4EYUA 2WKKA 4ISQA 4XQDA 5EXOA 3TEZA 2C9KA 1IQAA 4FPYA 2R30A 5ABJC 1YHFA 1RMU1 1CAWA 3HT1A 3MV01 3R05A 2QDNA 3HNBM 1JYVA 2HBUA 3NNJA 4FI9A 1A8MA 3UGHA 2C5DA 3THTA 4C91A 3WW2A 1JBCA 4LO7A 1X33A 5LA2A 3NL1A 3OBRA 4Q4W3 1DCSA 2VUJA 3WSOA 1HQNA 1ZBE2 2QZ3A 4EZHA 1RUG2 1W6PA 1CGPA 1AJKA 4J6GA 5FMOL 1PK6B 5IJRA 2CWMA 3H8UA 3MLJA 4QXBA 1VB2A 3D3AA 4DXZA 4XF0A 1W06A 5C8CA 4FTBA 3AZWA 1RXFA 1NA1B 1V9U3 3DL3A 4ZY9A 2Q8CA 3S6PA 3W9AA 5FZHA 3DF0A 3ZXKA 2EIBA 2VTFA 5CKQA 4CYDA 3WQ0A 1MEC2 4XBLA 1G6NA 4IV3C 4BQWA 4XOGA 4S2FA 1EY2A 3T08A 2P1BA 4D8MA 4FOVA 1YQ8A 5FY1A 5A3NA 5KC6A 3CZJA 4XBNA 1AR81 1QNYA 1VBD3 2C0ZA 5IVYA 1UWWA 4IEXA 3NQHA 2BP6A 4GH4A 1YC61 4XIOA 4CP2A 2B46X 1EUTA 1MZ5A 1GQGA 3ZFEB 1COV3 1LULA 2BEOA 2R16A 1OUSA 2MHFA 1A78A 1W6QB 1C1FA 3MF9A 4B7EA 3FC0A 4IUGA 2VR4A 4QB6A 5AVPA 5FKBA 4D6RA 5C5TA 2DCJA 1AL0G 1EYBA 2GMEA 1W3XA 3BOPA 3L2HA 5IAVA 1XNTA 1QJEA 1P8JA 1RYYA 2Q1FA 3PL0A 5A32A 3MI8A 3WT3A 2OUJA 4XUOA 3TEWA 1D0HA 2ZS6B 4XFIA 2WN3A 4QGLA 3LCPA 3B01A 1KJLA 4FCAA 1GP6A 5LEJA 2ZHKA 4A6OA 1IG3A 2P17A 4FTEA 1XNCA 3BB6A 1US3A 4OUMA 4PF5A 4CDWA 4AEJA 3CNAA 4D7TA 3FX3A 1KS5A 2QQLA 2FCVA 3WVJA 2WA3A 1GZWA 2O8OA 2DU0A 4MVTA 3RMXA 5B4NA 4NUBA 4LBQB 1GKBA 3NW4A 2PLV1 2P34A 3I2FA 4JTOA 4XTPA 2HEVF 2PXJA 4Y4RA 5I0UA 4KNCA 4MH0E 4Q4W2 4IE4A 1W3VA 1Q43A 4B1LA 3SITA 1EV12 4Q0PA 4AQ6A 2JJ6A 3KM5A 3H1MA 3D5OA 2EICA 1F8VA 3VBOA 1SLBA 4PT6A 3O1OA 1REEA 2P3YA 3C7GA 1N1YA 1HIXA 2BFUL 1Q5OA 4ZS3A 4ZZ8A 4XDQA 1K5MA 4LA2A 3T2PA 3T3YA 4R9BA 1LODA 4ZXEA 3IDCB 1WW6A 4AK3A 2J42A 1APNA 1CONA 2BWCA 2DVGA 2YBKA 3POIA 3WUDA 3JBG1 1PVXA 3OGSA 2WL1A 1VMHA 2WLQA 1NE4A 3J7NA 1GANA 3AYDA 3DPRB 1RUC3 3EMRA 3VB9A 5C6CA 2J1AA 1LGBA 4K40A 5LA0A 1K42A 1FT9A 3UK9A 1WW4A 2CGOA 5LCWL 3SCFA 3T30A 3OB8A 1FNZA 1AR71 4WVWA 2XBO1 1COV2 3LZZA 2Y6GA 3OOXA 1N1VA 2OKXA 1UZWA 1DQ5A 1WWYA 1W9YA 1XSRA 2JDKA 1JZ4A 3C7FA 4E4HA 3F95A 2EAAA 4WVVA 3KSCA 5B4XA 5LW9A 3M3QA 1Z7S1 4CU8A 3KT1A 4BK4A 3HQUA 5FYZA 1W8TA 3SXWA 3LDRA 3DYMA 5AC91 1H2KA 3USUA 4E9KA 1E5HA 2ORZA 3F2ZA 2N7GA 3WDVA 1LGCA 5FREA 3NSTA 4KU8A 2DUPA 5KC5A 5SV8A 3VKMA 4XURA 2QVSB 2FCTA 1A8DA 1ZBA2 1PK6C 1I6XA 4OVEA 2YBSA 5A1AA 2WQZC 4U36A 1QEXA 2H0BA 1RVF2 4J1WA 1DQ4A 1NA1C 3T1MA 2JDZA 3WNLA 4E2SA 2BWAA 2WWSA 2BNMA 2OPWA 4Y5Z0 3ZFFA 4C1XA 1UNBA 3ZR6A 4K21A 2VUAA 5SV5A 3V56A 3KHCA 2ZJCA 1C5IA 1SBDA 3B69A 1V6JA 3DGTA 5FZOB 5T55A 1AZDA 5IVCA 4LO5B 2DU1A 5ABJA 5FO8B 2XL7A 4XQ4A 3LE0A 2F6BA 2LALA 1SLLA 3PMEA 2D6KA 1UN1A 1NY71 1VE0A 1CJDA 4MXVA 5JZGB 1UY2A 1HJGA 4BYYA 1O3QA 5JOXA 1ZREA 1VR3A 1IPSA 1N3QA 4N9IA 3K3NA 3ZFEC 4UFJA 1U12A 5IVVA 2P4EA 3ES4A 1LCLA 4W50A 4CDUA 4JTNA 4PIXA 1AL23 1LOGA 2JICA 2RR13 3ZSMA 3GZTB 3KV6A 4DS0A 1U5YA 3HT2A 4UFHA 1VBA1 1AXKA 2PHUA 1H4HA 1RHI2 3EJKA 1LEMA 4CDXA 1O3RA 1RUC2 3M7AA 3TB0A 3IIIA 2WQ4A 4QQ2A 4E8CA 4H2AA 1PGL2 1GNHA 3LDKA 4YZ1A 2WO7A 2ZPXA 2R063 2WYFA 4RFRB 3POSA 3SCGA 1UY3A 5EP9A 5C3SA 3BKZA 2H6BA 1KJRA 1ZZ9A 1QDOA 1YIFA 4K1ZA 2GC3A 1D2QA 2YC2A 4GWMA 3WP5A 1ZZ6A 3ZDSA 4AAXA 4L97A 5A3UA 1WCUA 3NKTA 5JDBA 1SQ4A 1WCKA 1QQP2 1AYN1 1YRZA 3AZZA 3VBFB 3VHNA 3OD4A 1VLNA 2Z69A 3I54A 4M3CA 2VCBA 4CXXA 5J98B 3O1RA 3IPVA 3WLUA 5I91A 3P3PA 4M4RA 3C8XA 1A6CA 4URTA 4FOYA 1V6OA 5FRAA 3E5XA 5I0RA 2BOJA 4JHZA 3V64A 1FV2A 2QDRA 2A1XA 2YDEA 3ZYRA 3U78A 1UU5A 2XR4A 4P08A 4RHV2 3VHOA 1IS4A 1RUE1 4JC1A 3LIHA 1K5JA 1O4YA 4QX5A 1VBB3 2VZUA 4R4ZA 4A2UA 4COZA 4Q1PA 5K4LA 1IG0A 3U4SA 4QPYA 4JKLA 4RQPB 1SPPB 5DUUA 3RQ0A 2ZMLA 5DDJ3 3MIGA 1RUH3 5EJ3A 3KWVA 4EZ4A 3RFRA 4XXPA 2XDVA 4MGZE 3ZSEA 5DG2A 4PQQA 3DPRC 4P9YA 1WA4A 4CDQA 2DVAA 2GN7A 2R042 4G3YC 2RMU3 2ZX3A 4GALA 2JENA 1V6LA 3GCXA 3APBA 3I2HA 4QHBA 2VM9A 1BLZA 4A4AA 1ULCA 4JRAA 4OI4A 2EXHA 3BU7A 5A7PA 1PGL1 1JH5A 4Q2FA 4CPBA 4MOAA 4UW5A 2R6QA 1ND2A 2RR12 1FMD1 2PTMA 1LESA 4I3PA 3POFA 1I5PA 2RHPA 4QPIA 2FMDA 4RA0A 4A42A 4KWUA 3KV9A 5FWJA 5ANNA 4IW3A 3LSDA 1NZIA 2QQKA 4HL0A 4YM3A 3U1XA 2QFEA 1XE7A 3GBFA 1LOAA 2VCCA 5FUPA 1TG7A 1DQ2A 2YFZA 3GYDA 3GALA 1R091 4V1PA 4HFSA 1XJAA 3P3NA 2A71A 4TN7A 4K6BA 4YW3A 4B8EA 2FDGA 4NVPA 4FPHA 1OURA 4AVTA 2YY1A 1JYTA 3K48A 3QACA 4QX0A 1MZEA 2IXJA 1H8VA 1CR7A 1O7FA 4NWVA 4UFIA 4XEZA 1DP0A 1NLRA 1AR91 1RINA 2D6OX 3JB8A 3OEBA 3UT0A 3WZ1A 3WG2A 2DCZA 4RL7A 2ET1A 2P5BA 1TNFA 4TLFA 2R32A 4BQYA 1G86A 1OT5A 2DWRA 3HBZA 1DQ1A 1GBGA 1IGOA 1WW5A 4RYDA 5FZMA 4CCEA 5B2GB 5FMBA 1JYCA 1LOCA 3FBYA 2XL9A 4HN0A 1AYM2 1G8WA 1JU3A 2HBTA 4LULA 4LE3A 5BNPB 2CWSA 2AYHA 1C57A 1IKQA 2PAEA 2JXAA 2WR9A 4K20A 1TZOA 4K8FA 2YUEA 1ZBE1 3JXSA 4R52A 3VD5A 4E4ZA 5JZGC 4N53B 4YFWA 3O1PA 1AVBA 1J1TA 4W6XA 2VCMA 1AR83 2C4XA 2PA7A 4AVSA 2WFPA 2CTVA 2XJPA 1GR3A 2A6ZA 1TVGA 2GP3A 2WFF2 1VBB2 3TRSB 3MW4A 3PURA 4M0HA 2F4LA 5IAXA 3VHRA 1L7QA 1WKYA 1NCRB 3CKHA 4YNIA 3RZGA 4FXGB 5CAZA 2WA4A 5DDJ2 3RSJA 1S2KA 1YFYA 2GNMA 4CSWA 1YJKA 3LD8A 3S7IA 3GXUA 5FUNA 2O1QA 2TBVA 5BYNA 1NA1A 1O4ZA 3CEWA 1MQTB 4IESA 4L11A 5IYYA 3IAQA 3ZFGB 5FZIA 5IVFA 2RMU2 1HKDA 1LOEA 2BGCA 1ULEA 1FXZA 3R4DB 4GZ9A 5CISA 2KD7A 4NIAA 2VQUA 2W94A 3EYPA 3MW3A 4JX0A 1AUYA 5KHKA 3RJRA 1UKRA 4XDPA 4QQOA 3WDWA 2LROA 3WF1A 2JE7A 3VBFC 1W0OA 3NV4A 3RS6A 2FDKA 3I8TA 3ZFEA 1L3JA 4NIGA 2VECA 4QPGB 1RMU2 1R1A1 2W3JA 4D6QA 3E97A 1W6QA 4OI2A 3DCQA 3VDBA 2HWC3 4GA9A 1LU1A 1W6PB 3FHQA 2H6CA 4Y1YA 4HSJA 4IEUA 1W6NB 2C6SA 5FYHA 2OT7A 5FYSA 3ZYPA 4LBKA 4FOWA 4CCMA 1DZTA 2HH9A 1HRI3 4H14A 3AKTA 2J1TA 3W59A 1RJ8A 3T2TA 2CDPA 2ZAAA 3FWEA 3UJOA 1W8UA 2NMOA 4LITA 3NJZA 4RQPC 2A6WA 1JN2P 2BJSA 3PVNA 1RITA 1QMJA 1X8EA 4FO9A 4BPZA 1ENXA 2WNEA 2WNUB 2XJTA 4EN0A 2CDOA 4Q4W1 1WD3A 3M4FA 2BTVC 4MZUA 4LBQA 4HONA 4P9JA 1AR82 3AZVA 1MACA 3K46A 1HJFA 3VZOA 3ZYGA 1J58A 3N9PA 1XOYA 2ZKNA 4GIQA 3MPPG 1V9U1 4O9EA 4CXYA 4S2GA 4MUVA 1UY1A 3MYXA 2DTYA 4YG3A 4AE2A 5A32B 1U5ZA 5FZCA 4I0AA 4OI1A 1WBFA 3H3UA 1ST8A 2VJXA 4RGKA 4EWEA 4Q8LA 5I93A 4O7XA 1QJZA 2PQQA 4LEJA 5C3PA 3MGUA 1VBD1 3T0AA 4QKDA 1Y3TA 5JXJA 4QQLA 1ACCA 4LBMA 4BIOA 3RI8A 1DQ6A 2HWE3 4PDWA 3T4VA 4BB3A 4IERA 1UXXX 4CCJA 1COV1 4PI0A 1W03A 2VZRA 1GZWB 4XFFA 4Y1ZA 4DMIA 4JZRA 4XCBA 2WINB 1UMZA 2OQ6A 4K1YA 3HQRA 2R073 3KCCA 3M3IA 4KH9A 5FYTA 1UXZA 2RDSA 3FHAA 4GKYA 2UY9A 1OLMA 1PZ8A 2VTXA 2HWC2 1BKZA 2XHKA 1W99A 5BNPC 3RYRA 3WQ7A 2PLV2 1D2SA 4LBLA 4XFAA 1S4CA 5LBCA 2WQ8A 3I2IA 3VBOB 3OUJA 1XXNA 4N53C 3BVCA 4CUAA 2ZTNA 4YVSA 1HRI2 4LK6A 3OEAA 5JI9A 4B4RA 4UW3A 4LPLA 1Y9GA 1CZSA 1K5MB 3NNMA 5GKAC 4AW7A 1GLHA 4Q8KA 1U5XA 2WZR3 5BNOA 4KWJA 4LORA 2QQNA 5IW0A 1NCRC 1W39A 1CN1A 1REFA 2JD9A 1J83A 5ANQA 1SACA 2BERA 4FQZA 4QMAA 2I74A 1C5HA 4IDZA 1LAJA 5G04L 4Y5SA 5J36A 1MQTC 4G4FA 3KQRA 1O3TA 3A21A 3P1IA 3ZFGC 3U10A 4AWDA 5A3MA 4Z8BA 5IT6A 4JDMA 5T5LA 4XUNA 1GZ9A 4ZU4A 1BQPA 1GOFA 2BFUS 5F7UA 3TWIA 4H7MA 3SKJE 3BTYA 2J22A 1W8HA 3S5AA 3M3EA 1QXJA 4PBOA 2PHXA 2QKDA 5DZFA 5EV7A 1AR72 2AEYA 2XBO2 4Y26A 3VDDA 1JHNA 1H2NA 5JI7A 2ZMNA 3N9NA 3HNYM 4Q4Y3 3OPTA 2QE3A 3MIDA 5FZAA 4FPJA 4HKOA 4NRMA 3USUB 1UIJA 4QPGC 5JCTA 4ASMB 2BBAA 2PFWA 1Z7S2 3AL6A 1RUC1 1MS8A 1NLSA 5AC92 4UXAA 3BI3A 5DG1A 3VL8A 1W9TA 4DIQA 2QTWB 4AEMA 1UOBA 2D44A 2VPVA 4GMP3 5A33A 4KBBA 5F1RA 4N9HA 4R4XA 1XU2A 1YQ6A 4QX3A 3R4SA 3ZFFB 1OLQA 4BXFA 2XVKA 3D6EA 1GSLA 2DYCA 2X53S 4V2WA 4ZPIA 3J7MA 4UW6A 1UD1A 1GWMA 1NX9A 2FDJA 2D6PA 5IK8A 3BPSA 1D7PM 4BQ4A 2D6LX 4DO0A 2WNUC 1KDKA 3IBMA 1A3KA 2I07B 1PMIA 2IXIA 3EO6A 5F2SA 1K3IA 4CRQA 3AP6A 1ODNA 4E27A 4N8MA 4I0BA 5FP4A 2VMCA 4XJAA 3BTZA 4AVBA 4CDUB 1NY72 1BK1A 4AQTA 4CU7A 4AFBA 5L19A 3J8F3 1CVNA 1W9FA 5FY5A 5K0UA 4BLIA 2RV9A 3ZR5A 1QXRA 4I01A 4OUSA 2VOTA 2D6MA 5D2AA 3OSDA 4NPLA 3H42B 2C1FA 5FYBA 3T2QA 4CDXB 3FUOA 5JWPA 2NP0A 4CCOA 3ACGA 1SDDB 2QQIA 1VBA2 2NN8A 2UWBA 2VNVA 2VC9A 3LQCA 1UYYA 1SPPA 3PU8A 3MBWA 2WT0A 3SEEA 2BRTA 1GUIA 3KMHA 4YW6A 4B29A 3HBKA 5J96B 3FN9A 2AC1A 4R9AA 1QJY3 2ZHMA 3VD3A 5KR7A 1RUOA 4NPRA 1OQDA 2GC1A 4ATFA 4K7JA 1ZZBA 4M3CB 1AL21 2CY6A 2RR11 4AGRA 4Q4Y2 1N3PA 1UX7A 2UYBA 1MS4A 1H1AA 4G9SB 5L36A 2ZEXA 3KD4A 2YFUA 4QU1A 1F9KA 4XBQA 1S0CA 3NV1A 1PZ9A 4LBJA 5LA1A 1GV9A 3D4KA 4JGZA 4OMDA 3D8CA 5FPAA 1AX0A 1VMJA 1HN0A 2UU8A 4RN5A 3VBOC 3WP4A 4Q0VA 2R061 2Q8OA 1GZTA 1PO23 3VV1A 3WINE 3MFCA 1K5MC 3E6DA 2QQOA 2CGNA 4K3UA 4BA6A 2B45X 2C26A 4EN6B 1YQ2A 1RUE2 3PDQA 1PIV3 1S0IA 3RDIA 4AFDA 3UNPA 4Y1VA 1QU0A 1XU1A 3B5LB 1LECA 4LA3A 3VZJA 2WBKA 3WG3A 1ZRFA 4ZS2A 4CDQB 1VRH3 2YPDA 2EF6A 1D4VB 3ZN5A 4GD4A 1AJOA 2LTNA 4AFAA 1ZRCA 3GNEA 2LW8A 3LGRA 4HVOA 3V0BA 1BBT3 2QZ2A 1W6MA 2A3WA 1OOPA 4QKNA 1W2OA 3B94A 1ND2B 4YGDA 4QPIB 5T52A 3B7MA 2VOKA 3C7HA 1VBB1 2RJKA 1DZRA 3DECA 3AP5A 4N53A 4TYSA 3WNNA 1MS9A 2DFCA 2OQ7A 2NM1A 4BK5A 5F5QA 3THDA 3RZZA 1VAVA 4HVRA 5DDJ1 1RUH1 4Q0SA 1FMD2 2VMHA 5TSWA 1MPXA 2CU5A 1KITA 3MDPA 4Y33A 1ULOA 4ZXKA 5FOBB 3W5NA 4CEYB 3FFQA 1UZZA 1PNFA 3CF6E 2FZ1A 5IK4A 3PUIA 4LOSA 2RMU1 2CHHA 2X29A 2DV9A 2DTWA 4MXWA 3WP6A 1VP6A 1OPMA 3OTFA 4QDRA 1UIKA 3ZXDA 3C7EA 3IB3A 5F3GA 1F4HA 4L99A 3ZFGA 1GOGA 3N35A 3HNMA 2EA7A 3OBAA 3NJXA 3ZFFC 5FYVA 1V6IA 2E31A 1AR92 2RS53 3WG4A 2Y64A 1ULPA 1PO13 3HVDA 2HLEA 1KGYA 4OYUA 5JSRA 4GB33 4AG4A 2YC0A 2J1RA 2KA3A 3SH5A 1SBFA 2VZQA 3M3CA 4QGNA 2GH2A 2YMZA 5H9PA 2XLAA 3T1LA 3ZLIA 4IEQA 4IGOA 3LFIA 4QB1A 2DVDA 4QPGA 2AACA 3UV9A 3U4XA 1WCDJ 1PO22 4HT1T 4HXCA 2VH9A 4CDUC 2PHRA 3BGAA 4XPVA 4LKEA 3I3MA 3ZDVA 4KMQA 1W6NA 3I7DA 1LHNA 4OHWA 5FY4A 4CXWA 1O4TA 4PIZA 1HQLA 2XMLA 1N3OA 1PIV2 3OBTA 4XF9A 1HDKA 1QXPA 5A7SA 1Z0HA 4CDXC 4LOTA 1CPNA 1QH7A 3KT4A 4WV8A 3ZXEA 2WAOA 3AP4A 4IE7A 5EFUA 1EP0A 2JDPA 1DF0A 4NOTA 2Y34A 2YB7A 2WC2A 4LBOA 1CAVA 3D0JA 3LEGA 3Q9OA 4EN9B 2WNUA 3AXDA 3K3OA 5D21A 3WCRA 3AYAA 3AJZA 1H4GA 1YIPA 3K4DA 5L9RA 3ILNA 4XETA 2VAUA 1ZRDA 3AJYA 1J84A 3ETQA 4I3GA 1B09A 3CIHA 3CU7A 3RMYA 4FPLA 1A34A 3E5QA 3OUIA 5T3NA 4DZGA 5FZ1A 1CPMA 1QOTA 1XB9A 5AFBA 1F31A 3UKVA 4CTEA 1G9DA 1WCQA 3IMMA 2BNOA 3PUAA 3A4UA 4OUEA 4BQ3A 1QOOA 1R1A2 3NNLA 3HAGA 3QD6A 2ES3A 1O8SA 4IEYA 3WW1A 2JG8B 3VBRB 4NPMA 1TE1B 3KCYA 5KXCA 5IVJA 5FPUA 4H3WA 3Q8FA 2BVVA 5DAXA 3VD9A 2CAVA 3OGGA 1D4M3 1KFUL 4LJHA 3OD0A 3OGVA 1VBE3 2Z5WA 1QY4A 4FPKA 5ISLA 4X6RB 2W5FA 4GB32 5F32A 1UAIA 1PMHX 2JIGA 4CDQC 4O9GA 2HWC1 1JZ3A 3I97A 4KU7A 5A3LA 1KXGA 3JB4C 1VMFA 4UOJA 3GZAA 5FUIA 2PN5A 4RGGA 5JIUA 4ZU5A 3AVRA 1HRI1 5FO7B 3U07A 4URAA 2W1QA 5K8SA 3CJXA 4KG0A 4MHRA 1ND2C 3TEXA 4QPIC 1JXNA 1JYXA 3MIFA 4AFCA 2CNAA 1JTZX 1JUHA 4AVAA 1ZYBA 3LEIA 3BTAA 1HB1A 1C1LA 1V9U2 4K9SA 3K2OA 3GJAA 3H7YA 1OFNA 5CG9A 2BVBA 5JXHA 2NMNA 4CEYC 2EAKA 4FPFA 5E8AA 5BPXA 2SLIA 4PDWB 2QUOA 1GOHA 4HKWA 1UY0A 4I2OA 2VZ3A 3BOWA 1VBD2 4N7UA 2PAMA 3KVAA 2Q8DA 4Q4X3 3H8XA 3IT8A 4LHKA 2GH8A 1XQNA 3GCWA 3EB7A 4UT5A 3VZLA 4AI2A 2Y6KA 4JKKA 4OQ9A 4X8PA 4WVMA 2BQPA 3UKTA 1IS5A 2R1BA 4NN0A 2D3PA 2GAUA 3LA7A 4QM8A 4YG0A 3G7DA 1QJU3 4HK8A 5AVAA 1H1IA 1IKPA 2A6XA 1DGWA 2GNTA 2MPFA 5J37A 1QH6A 1WGPA 5HCHA 3UL2A 3KHBA 1VB4A 5FP8A 2ZHLA 2OXBA 1LHVA 4YVSB 1OKOA 2K2SA 4LO4B 2HWE1 3TAYA 1W8NA 3GBWA 3NO8A 5BNOB 5JXGA 2VNOA 1BMV1 5C70A 4QPWA 3U0ZA 5EQUA 4NIIA 2UWCA 1D4M2 1S1AA 1W9WA 4ASKA 2W2IA 2NZ9A 2J7MA 2R071 3LIGA 3FFZA 2P6HA 4KL1A 4BQXA 3B93A 1OBNA 1PX4A 3VD4A 3AFGA 2WABA 4XUPA 1I3HA 4MGKE 3AYEA 5I0SA 5FZ7A 4AF9A 5KBFA 1UZYA 4JGYA 3AP7A 5EZWA 4EN8B 1YNAA 5FOJB 4NAMA 1ZZCA 1SLTA 1FX5A 4P9IA 4XJZA 1OH4A 4YGCA 3VDDB 4M4PA 2WZR1 1ZRIA 2WLPA 4COVA 4HVQA 2JDNA 3J26N 3RRDA 4C0HA 3ZSJA 4HN1A 5JR7B 2E33A 1O3SA 3N9MA 1CWPA 4XABA 2X09A 4NROA 4A44A 1C28A 3MEPA 5JXIA 5J7MA 4YVWB 5FIXA 3UGGA 1ODMA 4AQSA 3CL1A 4HBNA 1R64A 3LFMA 4UFMA 1SZBA 1GMMA 1ONAA 3MF6A 1JUIA 5FJKA 3WQBA 1Q8PA 2UY8A 3OCPA 4EWAA 2RS13 2EALA 1H8TA 1RXGA 4KWKA 4CP9A 4WM7A 5A33B 1G7YA 3MPBA 4Q4X2 2HYXA 1OXCA 5CEHA 1YEWA 4QX2A 4GAZA 1FPN3 1NOVA 5C33A 5LWBA 2JG8C 1E5IA 3VBRC 5FO9B 5D8AB 4D6SA 2Z4FA 3IWZA 3PLQA 3Q8AA 1FAYA 3S5QA 1QJU2 1EPWA 3LWCA 4W8JA 5IK5A 4X6QB 5EWSA 4Q4Y1 2AEZA 4R9DA 1UX6A 4IE5A 5BY5A 5G05L 4FTSA 5GLVA 5IHRA 4DXRA 1WLWA 3JCIA 4IEPA 1PHMA 2NPIA 3VBSB 2ZEYA 2CAUA 2W87A 3NRUA 4QB2A 3WOGA 4IEWA 4LBNA 5GZGA 1KRIA 3ZM8A 1KS4A 4XUQA 5LRSA 1GNYA 3HEIA 4GMP1 4XF4A 4NR1A 2BBVA 3PHMA 4HLTA 3MIBA 5K0UB 4IE6A 5K9YA 1LHOA 4MGQA 2JD4A 3P6BA 3I2KA 4QKFA 4YW5A 5CA6A 1F15A 1J3RA 1MZFA 1JZ2A 3GZUC 5LA9A 1AF9A 2VBPA 2YGMA 3WDXA 2D98A 4ZZ5A 2ZA9A 2ADDA 1J59A 4PDWC 2Q1ZB 4B4QA 4E2GA 1LEDA 4O65A 1JMUB 5BUVA 3VHPA 2VQAA 1YI7A 4DXSA 2DUOA 2GALA 5CIRA 1MZ6A 3J8F1 5GZDA 2A5ZA 2QQMA 2QCSB 2ZGRA 3DV8A 4PIYA 1NCQB 2DVFA 3MUZ1 2P37A 3PJQA 1ZA4A 1AL22 2WSVA 4QQPA 3W20A 3BALA 3THCA 4JGZB 4NHYA 2R0FA 1LB2A 1UCXA 5JMOA 2QJVA 2WYSA 3B00A 4YM1A 1UYXA 3DXUA 3ACLA 3BU0A 2O0OA 4AVVA 1XC6A 2ZGOA 3KZ4C 4YVSC 4BE3A 1JZ8A 5F37A 4OFGA 4UI9L 3LPFA 4YW1A 5BNOC 2VNRA 2QBXA 1QJY1 3ORJA 4HMZA 5FFOC 2W47A 2WNVA 4CEYA 1GU3A 5FZEA 4AI3A 2VVDA 3DYOA 2R062 3ACFA 1R1ZA 3PVOA 2V4VA 2JKBA 2XVGA 1M06G 5F3CA 3KGZA 2RJ2A 3AMHA 3NV3A 5FK7A 5DPNA 2XB6C 1ULDA 3FZ3A 3NJVA 5E88A 2WO1A 1UY4A 1OVSA 3OGJA 3V0BB 4P5HA 1W6MB 3KS7A 1OOPB 3I3EA 2ILMA 3LAGA 2OPKA 1TMF3 1SBEA 3WXPA 1IPKA 1Y9MA 1GWKA 1PO21 3MICA 2X10A 3HPNA 4H7LA 5IUQA 2ERFA 1JZ6A 2D43A 2JG9B 1IPJA 3VDDC 5FTTC 2G9ZA 3HMYA 3WV6A 4QM9A 1XYOA 4MGTA 3OPZA 1PIV1 4DB5A 3A22A 1TME3 2XWJB 3ITQA 2XUMA 4BWOA 3ZYBA 1LOFA 4Q26A 2FMYA 4YVWC 4QHZA 3VBHA 5LASA 1VRH1 2HWD3 2Q0AA 3A23A 1W8FA 5L7OB 1RUH2 2B39A 3PJYA 1G9AA 5IFTA 4MXWB 2Q5TA 3I59A 3OJBA 2HEWF 2DCTA 1BBT1 2GC2A 4QX7A 3SC7X 4OI0A 2RM23 1E5RA 3H0OA 5D8AC 5DZGA 4Z07A 3B9CA 3VKNA 2XOMA 3RZLA 1PVC3 3O0VA 3BUCA 4XAAA 2ARCA 2K9ZA 3NWKA 4RGAA 4XJ9A 3H3LA 1T2XA 5ACA3 4FXKB 2OVUA 2IFWA 1JOBA 4UFKA 2IZWA 2ZBJA 3ASIA 4Z82A 1RIRA 5EJ1B 5F3IA 5A7QA 1UOGA 5A3WA 5FPZA 4BDVB 3K51A 3VBSC 1C3HA 3WDUA 3AKSA 1WMXA 1SMVA 2ZGUA 1ENSA 2MEV3 3MLLA 3NNGA 3WHUA 3ZYIB 4DRVA 1SCRA 2PYTA 2VOWA 3FUQA 1UL9A 1RUI3 5GLWA 1E57A 4YYOA 4QHOA 5K0UC 1H6XA 5JOZA 1YQ5A 1W2TA 2RS51 3VLBB 3PTRB 4HANA 1NE6A 4JV4A 1PO11 1XNAA 4R8HA 3QCWA 5FZKA 4ZU7A 5FZGA 4PI2A 4KQ7A 1NXD1 1XNBA 5LBBA 3BCWA 2JG8A 3VBRA 4YZ4A 1Q8VA 2D3SA 2VMFA 4GB31 1NQJA 4ES8A 1GQPA 4KGQA 3I2DA 2ZX4A 1IHMA 1H0BA 2GN3A 4NRPA 2Y0IA 4P9GA 3W58A 3WF0A 1CAVB 2JB4A 2VQ0A 3ZKYA 1FV3A 2FBEA 2XWBB 5L9BA 2FDIA 4KGGA 4YW7A 5FMOS 4EWDA 4A41A 5GLUA 5CKNA 3EQEA 4I0WB 4META 1V70A 4DFSA
chains in the Genus database with same CATH topology
1W8WA 4BQ3A 2K46A 2LRPA 2Q1FA 1GWKA 4YWAA 1OH3A 1GWLA 3ORJA 1W8UA 4BQ2A 1WZXA 2LROA 5D21A 2VXJA 1W9FA 4AL9A 1W8ZA 4LKDA 1L7LA 1W90A 3F95A 3UT0A 1V0AA 2O14A 3ZYHA 3ZYBA 4CP9A 4LJHA 4LKFA 4LK6A 4CPBD 2C24A 4BQ5A 4CPBA 1WMXA 1GWMA 1W8TA 3ZYFA 4LKEA 4CP9B 1UOJA 4YW7A 1OKOA 2WYFA 1HN0A 2KR2A 4BQ4A 4LK7A 2JWPA 4YW6A 1WCUA 4A6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8W A;  4BQ3 A;  2K46 A;  2LRP A;  2Q1F A;  1GWK A;  4YWA A;  1OH3 A;  1GWL A;  3ORJ A;  1W8U A;  4BQ2 A;  1WZX A;  2LRO A;  5D21 A;  2VXJ A;  1W9F A;  4AL9 A;  1W8Z A;  4LKD A;  1L7L A;  1W90 A;  3F95 A;  3UT0 A;  1V0A A;  2O14 A;  3ZYH A;  3ZYB A;  4CP9 A;  4LJH A;  4LKF A;  4LK6 A;  4CPB D;  2C24 A;  4BQ5 A;  4CPB A;  1WMX A;  1GWM A;  1W8T A;  3ZYF A;  4LKE A;  4CP9 B;  1UOJ A;  4YW7 A;  1OKO A;  2WYF A;  1HN0 A;  2KR2 A;  4BQ4 A;  4LK7 A;  2JWP A;  4YW6 A;  1WCU A;  4A6S A; 
#chains in the Genus database with same CATH topology
 2NLR A;  4P9W A;  3POE A;  1NCQ C;  4Y20 A;  1OLR A;  4IEO A;  3U11 A;  4UYB A;  4JGZ C;  3UKN A;  3JD7 3;  4LE4 A;  2VZV A;  1XRU A;  4GMP 0;  3INA A;  5C71 A;  4M01 A;  2VBD A;  3EXU A;  2R7E B;  1W90 A;  5FY0 A;  1LU2 A;  3AX4 A;  1ND3 A;  1X9P A;  5FCC A;  1NKG A;  2YBP A;  2B7Y A;  3IIA A;  4M3C F;  3FLT A;  1U5I A;  4Q0Q A;  1SFP A;  2AR6 A;  5C4W A;  4AGG A;  3WNX A;  4YW4 A;  4LHN A;  5H9R A;  2EID A;  4LMF A;  3LOI A;  1SLC A;  5F5C A;  3PIG A;  1X7N A;  4HPK A;  2WS9 3;  1OF3 A;  4EV0 A;  4F8A A;  1JZ7 A;  5F2W A;  2ZOE B;  1WLD A;  2VBB A;  4AVC A;  1DHK B;  5DMY A;  3MIE A;  5FZB A;  2ZAH A;  4XC9 A;  1HQW A;  4XIK A;  5E16 A;  3OG2 A;  4XJ8 A;  2PHW A;  2XON A;  1OOP C;  1ZNP A;  3AB0 A;  3UYJ A;  2ARB A;  3N7L A;  5BNN B;  3ZN6 B;  4GWI A;  1UKG A;  3ILF A;  1H2M A;  2IXC A;  2VXJ A;  3RZH A;  1RUI 2;  3WNP A;  4OHV A;  2YC4 A;  5F9T A;  1YWK A;  2JG9 C;  5FXV A;  1RC6 A;  3S57 A;  3M70 A;  1D4M 1;  1QHD A;  3MUY 1;  4JAA A;  1VPH A;  4YRD A;  1PX3 A;  1VBE 1;  3M2M A;  1WMD A;  4DEQ A;  1GQH A;  3RWK X;  1WLT A;  4FT8 A;  4I30 A;  1YXW A;  2HWF 3;  2RG4 A;  5C3R A;  4E2Q A;  3GZE A;  4FVV A;  1SDW A;  3ZMN A;  5JSP A;  4D7S A;  3AVS A;  5L7O C;  4Q4V 1;  3TNP B;  2ATF A;  3NAP A;  5A1F A;  2YGL A;  4FP2 A;  4QU2 A;  4XMA A;  4YWA A;  5FBZ A;  2ET7 A;  4LQR A;  4W4Z A;  3SLI A;  5ERL A;  5GM0 A;  4WVM B;  2LM3 A;  5JPN B;  1JYN A;  1FOD 3;  4LNV A;  3TOJ A;  1STM A;  4SBV A;  1HV1 A;  1TEI A;  3CDZ B;  2P6C A;  2A75 A;  1W28 A;  4NE9 A;  1MVE A;  2HWB 1;  1HRV 3;  2OZJ A;  2RVA A;  2W08 A;  3KVB A;  2VOV A;  3OYW A;  4QT6 A;  1DGR A;  3Q8C A;  3J7L A;  2WUH A;  3ZX7 A;  4PLN A;  2PAK A;  2YPJ A;  3LDB A;  3I3B A;  4IGP A;  4P5Y A;  5J3U A;  1IS3 A;  5BXX A;  1O6U A;  1LOB A;  2X05 A;  3IDA A;  4BIS A;  3BOD A;  3VKO A;  2BPA 2;  4TTG A;  5LB6 A;  5JSO A;  4YVW A;  2F17 A;  1SFY A;  2GZW A;  2V09 A;  4Q4X 1;  5HXV A;  1ENQ A;  2PHL A;  4IQP A;  2IXL A;  2HWE 2;  2AZ5 A;  2Y26 A;  4DXT A;  1BMV 2;  4TWT A;  3R4U A;  1NYW A;  1BJQ A;  1QJU 1;  1XPW A;  3I2G A;  4MAD A;  2GND A;  2WS9 2;  1VBC 3;  3SHR A;  5FZ4 A;  5KHJ A;  3TN9 3;  2R07 2;  5D8A A;  2VMI A;  3LEK A;  2X8K A;  2WDB A;  4JGY B;  2ZXQ A;  2D97 A;  1F5F A;  2VUC A;  3W21 A;  3ZSL A;  4KI5 M;  1C8M 3;  1XSQ A;  2VZS A;  2VXR A;  3PUS A;  3N3H A;  4GUL A;  3BTX A;  2XQX A;  3I3Q A;  2A73 B;  1YYN A;  3J9S A;  3VBS A;  4EN7 B;  2W39 A;  5IAT A;  4QXC A;  1S55 A;  1V00 A;  2WT1 A;  2KXL A;  2WZR 2;  3O1T A;  2HWF 2;  3T4H B;  1RJ7 A;  1QJX 3;  1UZ0 A;  1OC1 A;  1V0A A;  1R08 3;  2WRA A;  1Y4W A;  5KHG A;  4SLI A;  1H8T B;  4CP9 B;  3DEM A;  4WM7 B;  2Q8E A;  5LAT A;  4CCK A;  3V0A B;  2XQR A;  4COW A;  5FDB A;  3ME2 A;  5KXB A;  1BEV 3;  1FOD 2;  5HCF A;  1V6N A;  4FAH A;  1DYK A;  1JOD A;  4EQV A;  5J09 A;  4BZ4 A;  3WNM A;  1X82 A;  1UW8 A;  2JEC A;  2WNO A;  1HRV 2;  2WZP P;  1W6O A;  4NHX A;  1GWL A;  1GIC A;  1X36 A;  3L9J T;  4LUK A;  3SMH A;  2EXK A;  4CP0 A;  1T6B X;  4CCD A;  2RS3 3;  3WHT A;  4XFC A;  3LF7 A;  1I9R A;  2NYY A;  1OVP A;  2Z79 A;  3D82 A;  5D1I A;  5DAW A;  3W5M A;  2B42 B;  4NID A;  3ACH A;  2E51 A;  3LPG A;  4LUM A;  4MV2 A;  2XLG A;  5FR3 A;  4WZF A;  2DBN A;  4PBP A;  2RS1 1;  1Y7B A;  1NCQ A;  4HSL A;  3AM2 A;  4KWL A;  1HXS 3;  5BNN C;  3WD5 A;  5FXW A;  4C90 A;  1FPN 1;  1S0G A;  2H0V A;  5K7P A;  3WF4 A;  1CAU A;  2VZO A;  4IV1 A;  2IXH A;  4Y5T A;  1WMF A;  1KEX A;  2WT2 A;  2WII B;  3OPW A;  5FP3 A;  2VZP A;  5GZE A;  1DYP A;  2AH2 A;  3S7E A;  4CVU A;  2JIJ A;  3T0B A;  4CEW A;  4C0B A;  1C4R A;  5A70 A;  2TUN A;  1ZZ7 A;  3AMP A;  2AGS A;  1HLC A;  4DQA A;  1AXZ A;  4TZD A;  5F8P A;  3RJ2 X;  1C8M 2;  3OBZ A;  1AR6 3;  4JRL A;  2GC0 A;  4MLO A;  3BIW E;  3BPZ A;  4Y22 B;  3VBU A;  1RUN A;  2YXS A;  1XNK A;  3FL7 A;  4LKS A;  2YYO A;  3ZPY A;  2KR2 A;  4DY3 A;  3GF6 A;  4MGS A;  4LO6 B;  4AXO A;  3K77 A;  1RUG 3;  2FDF A;  5J48 A;  3J8F 2;  3MIH A;  2XJQ A;  2BGP A;  4I09 A;  1LHW A;  4FPE A;  4AAP A;  2JG9 A;  1POV 0;  2ARE A;  5DZE A;  1LNS A;  4FFG A;  5FY7 A;  4LTA A;  5FZ6 A;  5A6Y A;  4BQ2 A;  3IAP A;  2XJR A;  3L2Y A;  1FYU A;  1RUJ 1;  3ECQ A;  5I8S A;  1EAH 3;  1V6K A;  1KD7 A;  2VVF A;  3PTY A;  5FYC A;  4D94 A;  4Z2A A;  4AL9 A;  2HKX A;  2WNV B;  3M3O A;  3URF A;  4CZS A;  1MEC 3;  4YZ2 A;  1Q3E A;  5T5P A;  2ZX1 A;  3N7K A;  2Y6J A;  1DQ0 A;  2D5F A;  3AKR A;  1M4W A;  1W0P A;  5L7O A;  1G9B A;  1D0G A;  2PHF A;  4A7K A;  3FMG A;  5LK5 A;  2A6V A;  5E6H A;  4FBF A;  1QJY 2;  1BCX A;  4XAE A;  5CFC B;  3BN6 A;  3BIE A;  4XIL A;  4AED A;  2DF7 A;  5JOY A;  1K45 A;  2B5H A;  4K8R B;  4A3Z A;  3IZO A;  3I2J A;  2JX9 A;  5BV6 A;  4JGY C;  2E7A A;  4YZ5 A;  4GQ7 A;  1BVP 1;  1YJL A;  2WWJ A;  1UU4 A;  1W04 A;  2JDY A;  1ASJ 3;  2DVB A;  4B3N A;  3WF3 A;  5CZK A;  2XGX A;  2IWG B;  4AOC A;  4GKX A;  3NMB A;  3ZMO A;  1UMH A;  1BXH A;  1W2A X;  1T6G C;  4OMC A;  2JB8 A;  1I5Z A;  1NAE A;  1O91 A;  3WNO A;  2Y0O A;  3IM0 A;  3UJQ A;  3RG0 A;  4XZU G;  4XUT A;  4UWD A;  2PEL A;  3VBH B;  3ZKU A;  4XAC A;  3UGF A;  4A7Y A;  3GHN A;  4AI1 A;  1DBN A;  5DUW A;  3I59 B;  1H8T C;  2FCU A;  3I49 A;  4WM7 C;  2ZX0 A;  3FE5 A;  4W6W A;  3SKV A;  5A6Z A;  1VRH 2;  1AR6 2;  3POB A;  5EYX A;  1E5S A;  2Q30 A;  2XHN A;  4ARX A;  5F6L B;  1TMF 1;  4BLJ A;  2CV6 A;  2W92 A;  1J1L A;  2WSU A;  4XF1 A;  4QGM A;  4XTM A;  4FFH A;  5DAP A;  5I0T A;  1CES A;  3PUQ A;  4XCA A;  3RPQ A;  4NIH A;  1BBT 2;  1RUD 3;  2WN2 A;  3JQW A;  2P3I A;  4N43 A;  1WUV A;  2ETE A;  1DU3 D;  3FJS A;  1EV1 3;  2W46 A;  4AR2 A;  3AL5 A;  1TME 1;  2EXJ A;  5FMC A;  5FPL A;  4XQW A;  5A7O A;  3ZYF A;  5J1X A;  1K12 A;  3I2O A;  4D0Q A;  2HWD 1;  2I2S A;  1GFF 2;  1LKN A;  1OSG A;  2OX0 A;  5L9V A;  3C7O A;  1EAH 2;  2ARA A;  2J1E A;  5CU1 A;  1MS1 A;  2GMM A;  2VD7 A;  4PCR A;  5FZF A;  4UW4 A;  4YZ3 A;  2QQJ A;  2CYF A;  3ILR A;  2HYK A;  3ATG A;  3ABZ A;  1S2E A;  3K75 B;  4F7Z A;  1POV 3;  2RM2 1;  1PM7 A;  3AZX A;  1N47 A;  3POG A;  1DLL A;  4XFH A;  5DN2 A;  3POW A;  1PVC 1;  1O8P A;  2ZGN A;  1DGR N;  5ACA 1;  2B9U A;  2ID4 A;  2GU9 A;  3R0R A;  4RSU A;  4UBH A;  3ZIX A;  2RS5 2;  2D40 A;  1PO1 2;  1CZT A;  1OF4 A;  5JAX A;  2PQS A;  2ZZQ A;  1YUD A;  2EVX A;  2OUH A;  2CGP A;  5BNQ A;  5KXD A;  1US2 A;  1ASJ 2;  5CB7 A;  1V6M A;  2MEV 1;  2TEP A;  1OQE A;  4IGQ A;  4MGI E;  3OY8 B;  1YCI A;  2BDR A;  3E1F 1;  4ITC A;  4Q4V 3;  1XE0 A;  1QDC A;  1LEN A;  1OLM E;  3WCS A;  1RUI 1;  3PIJ A;  3SH4 A;  1VIW B;  2K46 A;  4Y4Y A;  2DDU A;  2HEY F;  2CSG A;  3VDC A;  4BOW A;  4J25 A;  2RDN A;  4Y20 B;  2XLF A;  5BNN A;  1JI6 A;  1DLC A;  3ZN6 A;  4Q1R A;  1FI2 A;  2MNG A;  1RUF 3;  1ZBA 3;  3MV1 1;  1JOJ A;  2HWB 3;  3CJI A;  3ALQ A;  1GP5 A;  3QOP A;  5HV0 A;  1HV0 A;  3HN3 A;  1RVF 3;  4LHL A;  5I8Y A;  4J1X A;  1ND3 B;  2FQP A;  2GMP A;  1YFU A;  4L9B A;  4UF0 B;  2B4K A;  1PGW 1;  2J1V A;  1CZV A;  1EPZ A;  2WZE A;  3A7Q A;  5FMD A;  5KHH A;  4FAG A;  1UOF A;  2BYV E;  2IFR A;  2WNV C;  1DGL A;  3VZM A;  4S2D A;  3WG1 A;  4BMB A;  5C4W B;  4V2V A;  3J7H A;  1UPS A;  3AXE A;  4MHU A;  1RUD 2;  1DZQ A;  4GWN A;  5AFE A;  2EIE A;  2VW2 A;  4JQR A;  4QXK A;  2W95 A;  1YFX A;  3RZM A;  4HPK B;  5CFC C;  3O1U A;  4PLM A;  4WM8 B;  2A6Y A;  1ZX5 A;  3U14 A;  1G9F A;  5T5J A;  4MGY E;  1UYP A;  3E6B A;  5GZF A;  1WME A;  2ZX2 A;  3JD7 1;  2G9G A;  5FY9 A;  5T54 A;  2ZGM A;  4BH9 A;  3QH6 A;  5EPA A;  1CAX B;  4NWW A;  1ZA7 A;  1BVV A;  1YLL A;  2G1M A;  1L7R A;  1OPO A;  1GP4 A;  2VO5 A;  3Q8E A;  1RHI 3;  2HJI A;  3CLP A;  3N9O A;  2B8M A;  4LIU A;  5A7W A;  2VME A;  3USS A;  5CG8 A;  3AMN A;  3T2O A;  1XYP A;  1DIW A;  4A6S A;  1LOF C;  4EJR A;  1W2U A;  1QGL A;  5HCA A;  2YV8 A;  1B35 A;  3VBH C;  2WO3 A;  3M8L A;  3GHM A;  1RTV A;  3MZH A;  2WS9 1;  3CMG A;  1WD4 A;  2QNK A;  4OHZ A;  5IVB A;  5L73 A;  1CX4 A;  1VBE 2;  1X8M A;  3NAP B;  3FBM A;  4S2H A;  3UET A;  3KLS A;  3CZU A;  2G4I A;  1X50 A;  2ZEZ A;  1LR5 A;  1TQ5 A;  2BOI A;  3NVC A;  1QQP 3;  5C9A A;  3DUI A;  4Q4V 2;  4Q5O A;  2YRO A;  1EUU A;  4Q0U A;  4KBZ A;  1J3Q A;  3OYW B;  3FLR A;  4CE8 A;  2W9X A;  1NQD A;  2A3Y A;  3RYP A;  3FLP A;  5LY1 A;  4XZP A;  2PHT A;  1RUF 2;  2WWU A;  2D6N A;  2HWF 1;  1W8W A;  1JOP A;  2HWB 2;  5APA A;  5CFD B;  3H7J A;  4RHV 3;  4DUV A;  2R0H A;  3N36 A;  1MR5 A;  2VW1 A;  1IZ3 A;  1IQD C;  2O8Q A;  2SBA A;  3ZOI A;  5C7G A;  2UWA A;  1DDL A;  1ALY A;  3IDE A;  5F3E A;  2E26 A;  5F5A A;  2B9V A;  3KF3 A;  4ES9 A;  1L7L A;  1FOD 1;  1JW6 A;  2FDH A;  2E32 A;  1LHU A;  4Y1U A;  3VD7 A;  4AHY A;  2V4A A;  1YFW A;  3M1H A;  2AEN A;  2X5I B;  4XHX A;  3V0A A;  2R04 3;  1HRV 1;  1XND A;  3KCX A;  2Z42 A;  1F35 A;  5EHD A;  2UUR A;  4IEZ A;  3DKQ A;  4YAR A;  1AX2 A;  1VRB A;  3KB5 A;  5A6X A;  1QNW A;  1W9S A;  4GJY A;  4P9L A;  1OD5 A;  1SEF A;  4WBB A;  4AGV A;  3O0X A;  4HG6 B;  3N4M A;  1WBL A;  3JZV A;  3ZYJ B;  3ZPO A;  1S2B A;  3J4U H;  5HV4 A;  5FZ0 A;  2K0G A;  2J1U A;  4W6Y A;  3WW3 A;  2W1W A;  1WLC A;  4AQ2 A;  3LOB A;  1OD3 A;  4RS5 B;  2QQV A;  1OA2 A;  2IVI B;  5JMC A;  4CA9 A;  4IV3 A;  4BME A;  1LRH A;  2XVL A;  2W1U A;  1VBC 1;  1FAT A;  3N7J A;  4Q27 A;  3TN9 1;  2XXZ A;  3WEZ A;  2DCY A;  3DN7 A;  1OMI A;  1BYH A;  2AUY A;  2VMD A;  2ZZJ A;  4ATE A;  4UFL A;  1ND3 C;  4CUC A;  1C8M 1;  2XJU A;  3A0K A;  5EIY B;  1ZZ8 A;  2Y6H A;  3MW2 A;  2QQU A;  3ZXL A;  5IVE A;  5IK7 A;  2FD8 A;  1CIY A;  4CCL A;  4ZKT B;  4BM8 A;  2V5Y A;  1RUJ 3;  5A3T A;  5C4W C;  5LZ6 A;  4XXA A;  5FBJ A;  2ARX A;  2VW0 A;  1AYM 3;  1O59 A;  3GGL A;  4XHB A;  1VAK A;  2PHD A;  1W6O B;  1SHW B;  2JDH A;  2DFB A;  5FLH A;  4XJW A;  2JE9 A;  4AHW A;  2PMW B;  4LKD A;  5A3P A;  4YG6 A;  3SQO A;  5M0T A;  4Y22 A;  4WM8 C;  5T5O A;  1UYZ A;  1WW7 A;  2Q1M A;  4XF3 A;  4A3X A;  2C24 A;  1QJX 1;  2OW4 A;  1OKQ A;  2IC1 A;  4AHZ A;  1ZRR A;  1R08 1;  2VVE A;  3JU9 A;  3LB9 A;  4BU2 A;  2WFF 3;  4IE0 A;  3P5B A;  5HXM A;  2D3R A;  4RR3 B;  5A80 A;  4PHZ A;  1HB2 A;  1WA6 X;  4HK9 A;  5HCB A;  5GZC A;  2WJS A;  3AKQ A;  1AHS A;  2V5D A;  4PF1 A;  1CAU B;  4IV1 B;  4TXW A;  1SG3 A;  4JQT A;  4GXL A;  1BEV 1;  2RS1 2;  2VQT A;  3WF2 A;  5DAB A;  1CIW A;  1NXM A;  4QQH A;  1DFQ A;  1FPN 2;  4W65 A;  3ZIW A;  1UU6 A;  4NHM A;  4LR4 A;  2XUE A;  5DAQ A;  4CEW B;  1XE8 A;  2NQY A;  1H9P A;  5FQ0 A;  4YW2 A;  2RS3 1;  4BXS V;  2W0X A;  1S0F A;  2W52 A;  3THP A;  3NAP C;  5FY8 A;  2I45 A;  4OZO A;  3VZN A;  5CFC A;  1JYW A;  4H55 A;  2ZHN A;  5FYM A;  3A0N A;  5EYY A;  1KQR A;  2L9L A;  1YI9 A;  3VBU B;  3WNK A;  4MX3 A;  1HXS 1;  5LK7 B;  3Q8B A;  1RMU 3;  3ROU A;  1OI6 A;  3T09 A;  4QAW A;  4TLG A;  4DUW A;  4JVA A;  2LRP A;  4XMI A;  1Q8O A;  1UPI A;  3HQX A;  5FZD A;  1BHG A;  4L8Q A;  4Y3O A;  3SH3 A;  3AK0 A;  3ZXA C;  2E9Q A;  3CQO A;  5KWR A;  4Q29 A;  3AC0 A;  1S0E A;  5KXE A;  5H9Q A;  1N1T A;  5CFD C;  3K4Z A;  3RWN A;  4LLF A;  3PMS A;  1OA3 A;  2J1S A;  5CVR A;  1UQX A;  1AR6 1;  1IOA A;  1ULG A;  3ETP A;  2DUQ A;  4P14 A;  1UF2 C;  2ZGT A;  4IND A;  4QXH A;  1RUJ 2;  2FHR A;  4P9X A;  5E1R A;  1S0D A;  3WR0 A;  4COU A;  3H50 A;  4YM0 A;  4WVZ A;  4O61 A;  3RYK A;  2VE1 A;  2ZGL A;  5DQ0 A;  2ZGS A;  4AED B;  4BJ0 A;  5IFP A;  2X5I C;  5CYY A;  1RUG 1;  1Y43 B;  4RD7 A;  4GWJ A;  4AI9 A;  4Z2W A;  1OH3 A;  4OHY A;  2Y60 A;  4NRQ A;  1PGS A;  4IEV A;  5GJ6 A;  1NUK A;  4OZX A;  2A70 A;  4AEK A;  5JOW A;  1NG0 A;  2IVJ A;  2VMG A;  5A3O A;  2XH6 A;  1QF3 A;  2VU9 A;  1EAH 1;  5FLJ A;  4X8N A;  2WAA A;  4DY5 A;  1PK6 A;  4LKF A;  4FFI A;  5GLT A;  1MEC 1;  3LEM A;  4Y24 A;  5FV3 A;  5LBE A;  1DYO A;  3VKL A;  2KM2 A;  3HWJ A;  1NLQ A;  4NMI A;  2WZ8 A;  4UAP A;  4JKM A;  2JEM A;  5F5I A;  1H9W A;  4ONU A;  4LIV A;  4ARY A;  2G9F A;  4RS5 C;  1HX6 A;  2Q4S A;  4B1M A;  5HBA A;  1O5L A;  1H2L A;  2BZD A;  5FPX A;  3H3Z A;  1JYI A;  5FYY A;  2XKP A;  3AFK A;  2ZGQ A;  4TSV A;  4DEV A;  1F4A A;  5FZL A;  4XFG A;  2YG0 A;  1CAW B;  1ZM1 A;  3TNQ A;  3ON7 A;  5E89 A;  1UO9 A;  2DCK A;  4U2A A;  4LXL A;  1ASJ 1;  2XJV A;  4ZHN A;  1WZX A;  3IMN A;  3GM8 A;  2RJL A;  4JDO A;  2E7Q A;  4Z1V A;  2D7F A;  2EXI A;  2O14 A;  2ZKL A;  2P3K A;  2Y6L A;  3GDB A;  2DBI A;  1DG6 A;  1X9T A;  3DYP A;  4N43 B;  1TMF 2;  4DNY A;  3E5U A;  2PLV 3;  4YPJ A;  5FXZ A;  3OY8 A;  5C8C B;  4DOU A;  2P2K A;  3QLQ A;  4E8D A;  3GJB A;  2RE9 A;  1G9C A;  1TME 2;  5GAL A;  4FPO B;  5F6K A;  2W1S A;  1HB4 A;  3AP9 A;  2ZAC A;  4XJU A;  4I02 A;  4RR3 C;  3S0M A;  1O5U A;  2HWD 2;  1QOS A;  1XYN A;  1Y9Q A;  3OGR A;  2C9A A;  4IV1 C;  4QWN A;  2OII A;  1S0J A;  3H8O A;  5H9S A;  3VL9 A;  5A7N A;  1JZ5 A;  2GP5 A;  1S0B A;  4GH4 B;  4OCT A;  1RUD 1;  4ET7 A;  4NJ4 A;  5FYU A;  3ZO0 B;  1RL3 A;  4UF0 A;  3ACI A;  3JBG 3;  2ENR A;  3ST7 A;  2JKX A;  1EV1 1;  2RM2 2;  4NHK A;  4CEW C;  4D69 A;  3PUH A;  5C5U A;  1PVC 2;  2A7A A;  4LK7 A;  5JUV A;  3E6C C;  3HN1 A;  2UYA A;  5ACA 2;  3POJ A;  1OFS A;  2R1D A;  1LGN A;  2ZGK A;  2RDQ A;  1AR7 3;  3I4I A;  2XBO 3;  4XFB A;  4BHP A;  4WM8 A;  1HN1 A;  4YFZ A;  1F2N A;  1GNZ A;  4YGE A;  3VBU C;  3WUC A;  5FAX A;  3OUH A;  3ENR A;  2MEV 2;  4CUG A;  2OA2 A;  5DUV A;  3SEP A;  1POV 1;  3ZSK A;  1CAX A;  2E63 A;  1Z7S 3;  3WP3 A;  3PVE A;  2IUW A;  4MYE A;  2VZT A;  2W68 A;  5AC9 3;  1DGW X;  3NV2 A;  4LO8 A;  4CDW B;  3CJI B;  4OLL A;  3VKF C;  4FQ4 A;  5DXD A;  5LRR A;  3H8R A;  4PLO A;  1QJF A;  3DPR A;  4AI8 A;  1RED A;  5JIA A;  2E7T A;  1HB3 A;  2CL2 A;  1BZW A;  1NZC A;  2ZGP A;  3ZN4 A;  5FZ8 A;  5A6Q A;  5C3Q A;  5FP7 A;  3KV4 A;  3C3V A;  3AMQ A;  1SLA A;  1YO8 A;  4FPC A;  2P3J A;  4OHX A;  3MFA A;  4BQ1 A;  1YQC A;  1PGW 2;  2VUD A;  1CX1 A;  1CQ9 A;  4QDQ A;  3PVB B;  3KGL A;  3SNM A;  4L92 A;  4AED C;  5CNA A;  4AFM A;  2BUK A;  1SLI A;  3V65 A;  3R6S A;  3RGB A;  1RUF 1;  5DAV A;  2ZEW A;  3ES1 A;  1ZBA 1;  3LA3 A;  4B7K A;  4CPB D;  4FFF A;  3X29 B;  3HR9 A;  4LT5 A;  4M00 A;  2BNN A;  4ISR A;  3LSE A;  4A45 A;  5I8T A;  3O1M A;  1RVF 1;  3H9A A;  1J3P A;  4NHL A;  4Z92 B;  3EHK A;  3QH7 A;  3JD7 2;  3KV5 A;  4D7Y A;  1F5J A;  1NT0 A;  5CFD A;  5A7W B;  3VGI A;  2W91 A;  3RI9 A;  3ELN A;  1U0A A;  3K4A A;  4DUX A;  1MVQ A;  4CUB A;  3CHX A;  1TNR A;  3JBG 2;  1VBA 3;  3U75 A;  3LKJ A;  4CU9 A;  1JHJ A;  1B35 B;  1QWR A;  4R9C A;  4OQ8 A;  3O1S A;  1PMJ X;  2ZAB A;  1SFN A;  2Y6F A;  4Y1X A;  1ENR A;  4N7I A;  4M0N A;  5FZO A;  4NAO A;  2VZ1 A;  1SCS A;  1ZVF A;  4MO3 M;  3PNA A;  3SIS A;  2X5I A;  5C9A B;  4LHS A;  5JZG A;  4FSJ A;  2ADE A;  3GBG A;  2VNG A;  2VCA A;  3B9I A;  3N7M A;  3VZK A;  4ASL A;  3S30 A;  4L0P A;  3LA2 A;  1IS6 A;  1Q8Q A;  3IDB B;  5C3O A;  1AYN 3;  2JWP A;  3NJY A;  1RHI 1;  2OYZ A;  1OHF A;  2OZ6 A;  4BCU A;  4N43 C;  4M3C E;  3AMM A;  4AHX A;  1CD3 G;  4FPG A;  3ZXG A;  4HZF A;  3U37 A;  4XYX A;  4YGB A;  1PZ7 A;  2V72 A;  3RNS A;  4C8D A;  4GJZ A;  2XKO A;  4COY A;  4F3J A;  5C8C C;  5C8W A;  1QIQ A;  2BU9 A;  4JHT A;  4XDO A;  4MG2 A;  2YZ4 A;  3CO2 A;  3H1W A;  1QKQ A;  2WO2 A;  4XE9 A;  2ZCW A;  4AZZ A;  4RS5 A;  3VDA A;  3B3Q E;  2VL4 A;  5FPB A;  1RUE 3;  1QQP 1;  2ZMK A;  3MHZ A;  4A7Z A;  2LUW A;  4ORF A;  5A1L A;  2JDA A;  3WDY A;  4B4P A;  1MS0 A;  2E6V A;  5CBL A;  5ABJ B;  4GH4 C;  2QQW A;  3O0W A;  5GLZ A;  3VBF A;  2OS2 A;  2IXK A;  3B02 A;  4N90 A;  2JDM A;  4P02 B;  4P00 B;  3WX5 A;  2YU1 A;  4WZC A;  4DIN B;  5CAD A;  3WY6 A;  1N1S A;  3O5S A;  2VOX A;  4RFT 0;  5FYI A;  5I0D A;  4RHV 1;  2LS6 A;  5IWF A;  1W05 A;  5DUX A;  3DXT A;  2F4P A;  1VJ2 A;  3O14 A;  3CBN A;  1LTE A;  1VAL A;  1ULF A;  2YU2 A;  3AKP A;  5F39 A;  2VG9 A;  3H1Y A;  3ZVX A;  1XBF A;  3HJR A;  2VTX J;  1W0N A;  4DRR A;  1PM4 A;  1FMD 3;  1POQ A;  3N9Q A;  4HOO A;  1CJP A;  2Y33 A;  3TBD A;  3MO4 A;  2R49 A;  3MLK A;  2FZ2 A;  5FP9 A;  4CU6 A;  4IV3 B;  4RR3 A;  5EJZ B;  4AYU A;  2Y8K A;  4PJY A;  3JUU A;  4RQP A;  3WW4 A;  5FZ3 A;  2R04 1;  1URX A;  5JVV A;  1R09 3;  4JDN A;  1HW5 A;  3CJI C;  4CDW C;  5FLI A;  5FPV A;  3DKW A;  5FWE A;  1LJ7 A;  4QX1 A;  2QQP A;  4QX8 A;  2XG3 A;  1GZC A;  1VBC 2;  2BV4 A;  2V73 A;  4EE2 A;  4L2N A;  3TN9 2;  3RZK A;  3IPV B;  1AR9 3;  1MS5 A;  4FOQ A;  3JQX A;  2RDR A;  2JE8 A;  3O12 A;  5FJH A;  3TEY A;  1W8Z A;  1AYN 2;  3ZYH A;  1JU4 A;  2DUR A;  3KT7 A;  3RVH A;  4XW3 A;  5LY2 A;  5JR2 A;  5HPO A;  1RB8 G;  4KG8 A;  4PQ9 A;  5CKM A;  2EIG A;  2VY0 A;  3OF1 A;  4BQ5 A;  2XPJ A;  1UZV A;  1Q56 A;  1OQ1 A;  1UOJ A;  4LBQ D;  1I1E A;  4CCC A;  2GSY A;  1H30 A;  1KDM A;  1OUX A;  3G6J B;  3IN9 A;  5FXX A;  5T50 A;  4IL7 A;  1ZBE 3;  4NO4 A;  4OUL A;  4QD2 A;  3T0D A;  2VUL A;  3IKW A;  3AZY A;  1AX1 A;  1QJX 2;  1UMI A;  3FHI B;  1R08 2;  4JCK A;  3D0S A;  3POY A;  4UBG A;  3VN4 A;  3HIF A;  4YSF A;  1Q8S A;  5KHI A;  3HD8 B;  1W8O A;  3NNF A;  4HET A;  3AYC A;  4MSV A;  1AYM 1;  1GYK A;  3KQ4 B;  5JPM B;  1C8N A;  2GDF A;  3ZXF A;  1BEV 2;  3N9L A;  4HKL A;  2GNB A;  5FQ0 B;  2D93 A;  1B35 C;  3QBQ A;  1W2N A;  1BK0 A;  4IXL A;  3PU3 A;  2E53 A;  4AI0 A;  1VAM A;  2A3X A;  3SCH A;  4E4D X;  5JLV A;  3EBR A;  4LLO A;  5BNP A;  5FK8 A;  2TNF A;  2G19 A;  2BGO A;  4CP1 A;  1MS3 A;  1OA4 A;  3I3D A;  4YM2 A;  4DPN A;  2WFF 1;  2RS3 2;  2ORX A;  2Y38 A;  4ERO A;  3VUO A;  3WDT A;  5C9A C;  4XVH A;  5HI0 A;  2D5H A;  2Z2S B;  3TYJ A;  4D3W A;  4F83 A;  1FNY A;  2YHJ A;  1WCS A;  4CCN A;  4E4S A;  3BYW A;  3UES A;  3ZXJ A;  3NKG A;  1HXS 2;  4QKB A;  1KFX L;  3O7O A;  2XJS A;  3O1V A;  1NCR A;  4ZON A;  1R1A 3;  5FKC A;  3WQ1 A;  1AXY A;  3HOB A;  1R09 2;  3RZJ A;  2JDU A;  4YLZ A;  4C1W A;  4BIF A;  1H1M A;  1PNG A;  2VGD A;  4FP3 A;  1MQT A;  1H6Y A;  4QDS A;  3KF5 A;  2BW8 A;  5FZ9 A;  1Z78 A;  5LEK A;  5LBF A;  1JS9 A;  4IET A;  1RGS A;  3C2U A;  4EYU A;  2WKK A;  4ISQ A;  4XQD A;  5EXO A;  3TEZ A;  2C9K A;  1IQA A;  4FPY A;  2R30 A;  5ABJ C;  1YHF A;  1RMU 1;  1CAW A;  3HT1 A;  3MV0 1;  3R05 A;  2QDN A;  3HNB M;  1JYV A;  2HBU A;  3NNJ A;  4FI9 A;  1A8M A;  3UGH A;  2C5D A;  3THT A;  4C91 A;  3WW2 A;  1JBC A;  4LO7 A;  1X33 A;  5LA2 A;  3NL1 A;  3OBR A;  4Q4W 3;  1DCS A;  2VUJ A;  3WSO A;  1HQN A;  1ZBE 2;  2QZ3 A;  4EZH A;  1RUG 2;  1W6P A;  1CGP A;  1AJK A;  4J6G A;  5FMO L;  1PK6 B;  5IJR A;  2CWM A;  3H8U A;  3MLJ A;  4QXB A;  1VB2 A;  3D3A A;  4DXZ A;  4XF0 A;  1W06 A;  5C8C A;  4FTB A;  3AZW A;  1RXF A;  1NA1 B;  1V9U 3;  3DL3 A;  4ZY9 A;  2Q8C A;  3S6P A;  3W9A A;  5FZH A;  3DF0 A;  3ZXK A;  2EIB A;  2VTF A;  5CKQ A;  4CYD A;  3WQ0 A;  1MEC 2;  4XBL A;  1G6N A;  4IV3 C;  4BQW A;  4XOG A;  4S2F A;  1EY2 A;  3T08 A;  2P1B A;  4D8M A;  4FOV A;  1YQ8 A;  5FY1 A;  5A3N A;  5KC6 A;  3CZJ A;  4XBN A;  1AR8 1;  1QNY A;  1VBD 3;  2C0Z A;  5IVY A;  1UWW A;  4IEX A;  3NQH A;  2BP6 A;  4GH4 A;  1YC6 1;  4XIO A;  4CP2 A;  2B46 X;  1EUT A;  1MZ5 A;  1GQG A;  3ZFE B;  1COV 3;  1LUL A;  2BEO A;  2R16 A;  1OUS A;  2MHF A;  1A78 A;  1W6Q B;  1C1F A;  3MF9 A;  4B7E A;  3FC0 A;  4IUG A;  2VR4 A;  4QB6 A;  5AVP A;  5FKB A;  4D6R A;  5C5T A;  2DCJ A;  1AL0 G;  1EYB A;  2GME A;  1W3X A;  3BOP A;  3L2H A;  5IAV A;  1XNT A;  1QJE A;  1P8J A;  1RYY A;  2Q1F A;  3PL0 A;  5A32 A;  3MI8 A;  3WT3 A;  2OUJ A;  4XUO A;  3TEW A;  1D0H A;  2ZS6 B;  4XFI A;  2WN3 A;  4QGL A;  3LCP A;  3B01 A;  1KJL A;  4FCA A;  1GP6 A;  5LEJ A;  2ZHK A;  4A6O A;  1IG3 A;  2P17 A;  4FTE A;  1XNC A;  3BB6 A;  1US3 A;  4OUM A;  4PF5 A;  4CDW A;  4AEJ A;  3CNA A;  4D7T A;  3FX3 A;  1KS5 A;  2QQL A;  2FCV A;  3WVJ A;  2WA3 A;  1GZW A;  2O8O A;  2DU0 A;  4MVT A;  3RMX A;  5B4N A;  4NUB A;  4LBQ B;  1GKB A;  3NW4 A;  2PLV 1;  2P34 A;  3I2F A;  4JTO A;  4XTP A;  2HEV F;  2PXJ A;  4Y4R A;  5I0U A;  4KNC A;  4MH0 E;  4Q4W 2;  4IE4 A;  1W3V A;  1Q43 A;  4B1L A;  3SIT A;  1EV1 2;  4Q0P A;  4AQ6 A;  2JJ6 A;  3KM5 A;  3H1M A;  3D5O A;  2EIC A;  1F8V A;  3VBO A;  1SLB A;  4PT6 A;  3O1O A;  1REE A;  2P3Y A;  3C7G A;  1N1Y A;  1HIX A;  2BFU L;  1Q5O A;  4ZS3 A;  4ZZ8 A;  4XDQ A;  1K5M A;  4LA2 A;  3T2P A;  3T3Y A;  4R9B A;  1LOD A;  4ZXE A;  3IDC B;  1WW6 A;  4AK3 A;  2J42 A;  1APN A;  1CON A;  2BWC A;  2DVG A;  2YBK A;  3POI A;  3WUD A;  3JBG 1;  1PVX A;  3OGS A;  2WL1 A;  1VMH A;  2WLQ A;  1NE4 A;  3J7N A;  1GAN A;  3AYD A;  3DPR B;  1RUC 3;  3EMR A;  3VB9 A;  5C6C A;  2J1A A;  1LGB A;  4K40 A;  5LA0 A;  1K42 A;  1FT9 A;  3UK9 A;  1WW4 A;  2CGO A;  5LCW L;  3SCF A;  3T30 A;  3OB8 A;  1FNZ A;  1AR7 1;  4WVW A;  2XBO 1;  1COV 2;  3LZZ A;  2Y6G A;  3OOX A;  1N1V A;  2OKX A;  1UZW A;  1DQ5 A;  1WWY A;  1W9Y A;  1XSR A;  2JDK A;  1JZ4 A;  3C7F A;  4E4H A;  3F95 A;  2EAA A;  4WVV A;  3KSC A;  5B4X A;  5LW9 A;  3M3Q A;  1Z7S 1;  4CU8 A;  3KT1 A;  4BK4 A;  3HQU A;  5FYZ A;  1W8T A;  3SXW A;  3LDR A;  3DYM A;  5AC9 1;  1H2K A;  3USU A;  4E9K A;  1E5H A;  2ORZ A;  3F2Z A;  2N7G A;  3WDV A;  1LGC A;  5FRE A;  3NST A;  4KU8 A;  2DUP A;  5KC5 A;  5SV8 A;  3VKM A;  4XUR A;  2QVS B;  2FCT A;  1A8D A;  1ZBA 2;  1PK6 C;  1I6X A;  4OVE A;  2YBS A;  5A1A A;  2WQZ C;  4U36 A;  1QEX A;  2H0B A;  1RVF 2;  4J1W A;  1DQ4 A;  1NA1 C;  3T1M A;  2JDZ A;  3WNL A;  4E2S A;  2BWA A;  2WWS A;  2BNM A;  2OPW A;  4Y5Z 0;  3ZFF A;  4C1X A;  1UNB A;  3ZR6 A;  4K21 A;  2VUA A;  5SV5 A;  3V56 A;  3KHC A;  2ZJC A;  1C5I A;  1SBD A;  3B69 A;  1V6J A;  3DGT A;  5FZO B;  5T55 A;  1AZD A;  5IVC A;  4LO5 B;  2DU1 A;  5ABJ A;  5FO8 B;  2XL7 A;  4XQ4 A;  3LE0 A;  2F6B A;  2LAL A;  1SLL A;  3PME A;  2D6K A;  1UN1 A;  1NY7 1;  1VE0 A;  1CJD A;  4MXV A;  5JZG B;  1UY2 A;  1HJG A;  4BYY A;  1O3Q A;  5JOX A;  1ZRE A;  1VR3 A;  1IPS A;  1N3Q A;  4N9I A;  3K3N A;  3ZFE C;  4UFJ A;  1U12 A;  5IVV A;  2P4E A;  3ES4 A;  1LCL A;  4W50 A;  4CDU A;  4JTN A;  4PIX A;  1AL2 3;  1LOG A;  2JIC A;  2RR1 3;  3ZSM A;  3GZT B;  3KV6 A;  4DS0 A;  1U5Y A;  3HT2 A;  4UFH A;  1VBA 1;  1AXK A;  2PHU A;  1H4H A;  1RHI 2;  3EJK A;  1LEM A;  4CDX A;  1O3R A;  1RUC 2;  3M7A A;  3TB0 A;  3III A;  2WQ4 A;  4QQ2 A;  4E8C A;  4H2A A;  1PGL 2;  1GNH A;  3LDK A;  4YZ1 A;  2WO7 A;  2ZPX A;  2R06 3;  2WYF A;  4RFR B;  3POS A;  3SCG A;  1UY3 A;  5EP9 A;  5C3S A;  3BKZ A;  2H6B A;  1KJR A;  1ZZ9 A;  1QDO A;  1YIF A;  4K1Z A;  2GC3 A;  1D2Q A;  2YC2 A;  4GWM A;  3WP5 A;  1ZZ6 A;  3ZDS A;  4AAX A;  4L97 A;  5A3U A;  1WCU A;  3NKT A;  5JDB A;  1SQ4 A;  1WCK A;  1QQP 2;  1AYN 1;  1YRZ A;  3AZZ A;  3VBF B;  3VHN A;  3OD4 A;  1VLN A;  2Z69 A;  3I54 A;  4M3C A;  2VCB A;  4CXX A;  5J98 B;  3O1R A;  3IPV A;  3WLU A;  5I91 A;  3P3P A;  4M4R A;  3C8X A;  1A6C A;  4URT A;  4FOY A;  1V6O A;  5FRA A;  3E5X A;  5I0R A;  2BOJ A;  4JHZ A;  3V64 A;  1FV2 A;  2QDR A;  2A1X A;  2YDE A;  3ZYR A;  3U78 A;  1UU5 A;  2XR4 A;  4P08 A;  4RHV 2;  3VHO A;  1IS4 A;  1RUE 1;  4JC1 A;  3LIH A;  1K5J A;  1O4Y A;  4QX5 A;  1VBB 3;  2VZU A;  4R4Z A;  4A2U A;  4COZ A;  4Q1P A;  5K4L A;  1IG0 A;  3U4S A;  4QPY A;  4JKL A;  4RQP B;  1SPP B;  5DUU A;  3RQ0 A;  2ZML A;  5DDJ 3;  3MIG A;  1RUH 3;  5EJ3 A;  3KWV A;  4EZ4 A;  3RFR A;  4XXP A;  2XDV A;  4MGZ E;  3ZSE A;  5DG2 A;  4PQQ A;  3DPR C;  4P9Y A;  1WA4 A;  4CDQ A;  2DVA A;  2GN7 A;  2R04 2;  4G3Y C;  2RMU 3;  2ZX3 A;  4GAL A;  2JEN A;  1V6L A;  3GCX A;  3APB A;  3I2H A;  4QHB A;  2VM9 A;  1BLZ A;  4A4A A;  1ULC A;  4JRA A;  4OI4 A;  2EXH A;  3BU7 A;  5A7P A;  1PGL 1;  1JH5 A;  4Q2F A;  4CPB A;  4MOA A;  4UW5 A;  2R6Q A;  1ND2 A;  2RR1 2;  1FMD 1;  2PTM A;  1LES A;  4I3P A;  3POF A;  1I5P A;  2RHP A;  4QPI A;  2FMD A;  4RA0 A;  4A42 A;  4KWU A;  3KV9 A;  5FWJ A;  5ANN A;  4IW3 A;  3LSD A;  1NZI A;  2QQK A;  4HL0 A;  4YM3 A;  3U1X A;  2QFE A;  1XE7 A;  3GBF A;  1LOA A;  2VCC A;  5FUP A;  1TG7 A;  1DQ2 A;  2YFZ A;  3GYD A;  3GAL A;  1R09 1;  4V1P A;  4HFS A;  1XJA A;  3P3N A;  2A71 A;  4TN7 A;  4K6B A;  4YW3 A;  4B8E A;  2FDG A;  4NVP A;  4FPH A;  1OUR A;  4AVT A;  2YY1 A;  1JYT A;  3K48 A;  3QAC A;  4QX0 A;  1MZE A;  2IXJ A;  1H8V A;  1CR7 A;  1O7F A;  4NWV A;  4UFI A;  4XEZ A;  1DP0 A;  1NLR A;  1AR9 1;  1RIN A;  2D6O X;  3JB8 A;  3OEB A;  3UT0 A;  3WZ1 A;  3WG2 A;  2DCZ A;  4RL7 A;  2ET1 A;  2P5B A;  1TNF A;  4TLF A;  2R32 A;  4BQY A;  1G86 A;  1OT5 A;  2DWR A;  3HBZ A;  1DQ1 A;  1GBG A;  1IGO A;  1WW5 A;  4RYD A;  5FZM A;  4CCE A;  5B2G B;  5FMB A;  1JYC A;  1LOC A;  3FBY A;  2XL9 A;  4HN0 A;  1AYM 2;  1G8W A;  1JU3 A;  2HBT A;  4LUL A;  4LE3 A;  5BNP B;  2CWS A;  2AYH A;  1C57 A;  1IKQ A;  2PAE A;  2JXA A;  2WR9 A;  4K20 A;  1TZO A;  4K8F A;  2YUE A;  1ZBE 1;  3JXS A;  4R52 A;  3VD5 A;  4E4Z A;  5JZG C;  4N53 B;  4YFW A;  3O1P A;  1AVB A;  1J1T A;  4W6X A;  2VCM A;  1AR8 3;  2C4X A;  2PA7 A;  4AVS A;  2WFP A;  2CTV A;  2XJP A;  1GR3 A;  2A6Z A;  1TVG A;  2GP3 A;  2WFF 2;  1VBB 2;  3TRS B;  3MW4 A;  3PUR A;  4M0H A;  2F4L A;  5IAX A;  3VHR A;  1L7Q A;  1WKY A;  1NCR B;  3CKH A;  4YNI A;  3RZG A;  4FXG B;  5CAZ A;  2WA4 A;  5DDJ 2;  3RSJ A;  1S2K A;  1YFY A;  2GNM A;  4CSW A;  1YJK A;  3LD8 A;  3S7I A;  3GXU A;  5FUN A;  2O1Q A;  2TBV A;  5BYN A;  1NA1 A;  1O4Z A;  3CEW A;  1MQT B;  4IES A;  4L11 A;  5IYY A;  3IAQ A;  3ZFG B;  5FZI A;  5IVF A;  2RMU 2;  1HKD A;  1LOE A;  2BGC A;  1ULE A;  1FXZ A;  3R4D B;  4GZ9 A;  5CIS A;  2KD7 A;  4NIA A;  2VQU A;  2W94 A;  3EYP A;  3MW3 A;  4JX0 A;  1AUY A;  5KHK A;  3RJR A;  1UKR A;  4XDP A;  4QQO A;  3WDW A;  2LRO A;  3WF1 A;  2JE7 A;  3VBF C;  1W0O A;  3NV4 A;  3RS6 A;  2FDK A;  3I8T A;  3ZFE A;  1L3J A;  4NIG A;  2VEC A;  4QPG B;  1RMU 2;  1R1A 1;  2W3J A;  4D6Q A;  3E97 A;  1W6Q A;  4OI2 A;  3DCQ A;  3VDB A;  2HWC 3;  4GA9 A;  1LU1 A;  1W6P B;  3FHQ A;  2H6C A;  4Y1Y A;  4HSJ A;  4IEU A;  1W6N B;  2C6S A;  5FYH A;  2OT7 A;  5FYS A;  3ZYP A;  4LBK A;  4FOW A;  4CCM A;  1DZT A;  2HH9 A;  1HRI 3;  4H14 A;  3AKT A;  2J1T A;  3W59 A;  1RJ8 A;  3T2T A;  2CDP A;  2ZAA A;  3FWE A;  3UJO A;  1W8U A;  2NMO A;  4LIT A;  3NJZ A;  4RQP C;  2A6W A;  1JN2 P;  2BJS A;  3PVN A;  1RIT A;  1QMJ A;  1X8E A;  4FO9 A;  4BPZ A;  1ENX A;  2WNE A;  2WNU B;  2XJT A;  4EN0 A;  2CDO A;  4Q4W 1;  1WD3 A;  3M4F A;  2BTV C;  4MZU A;  4LBQ A;  4HON A;  4P9J A;  1AR8 2;  3AZV A;  1MAC A;  3K46 A;  1HJF A;  3VZO A;  3ZYG A;  1J58 A;  3N9P A;  1XOY A;  2ZKN A;  4GIQ A;  3MPP G;  1V9U 1;  4O9E A;  4CXY A;  4S2G A;  4MUV A;  1UY1 A;  3MYX A;  2DTY A;  4YG3 A;  4AE2 A;  5A32 B;  1U5Z A;  5FZC A;  4I0A A;  4OI1 A;  1WBF A;  3H3U A;  1ST8 A;  2VJX A;  4RGK A;  4EWE A;  4Q8L A;  5I93 A;  4O7X A;  1QJZ A;  2PQQ A;  4LEJ A;  5C3P A;  3MGU A;  1VBD 1;  3T0A A;  4QKD A;  1Y3T A;  5JXJ A;  4QQL A;  1ACC A;  4LBM A;  4BIO A;  3RI8 A;  1DQ6 A;  2HWE 3;  4PDW A;  3T4V A;  4BB3 A;  4IER A;  1UXX X;  4CCJ A;  1COV 1;  4PI0 A;  1W03 A;  2VZR A;  1GZW B;  4XFF A;  4Y1Z A;  4DMI A;  4JZR A;  4XCB A;  2WIN B;  1UMZ A;  2OQ6 A;  4K1Y A;  3HQR A;  2R07 3;  3KCC A;  3M3I A;  4KH9 A;  5FYT A;  1UXZ A;  2RDS A;  3FHA A;  4GKY A;  2UY9 A;  1OLM A;  1PZ8 A;  2VTX A;  2HWC 2;  1BKZ A;  2XHK A;  1W99 A;  5BNP C;  3RYR A;  3WQ7 A;  2PLV 2;  1D2S A;  4LBL A;  4XFA A;  1S4C A;  5LBC A;  2WQ8 A;  3I2I A;  3VBO B;  3OUJ A;  1XXN A;  4N53 C;  3BVC A;  4CUA A;  2ZTN A;  4YVS A;  1HRI 2;  4LK6 A;  3OEA A;  5JI9 A;  4B4R A;  4UW3 A;  4LPL A;  1Y9G A;  1CZS A;  1K5M B;  3NNM A;  5GKA C;  4AW7 A;  1GLH A;  4Q8K A;  1U5X A;  2WZR 3;  5BNO A;  4KWJ A;  4LOR A;  2QQN A;  5IW0 A;  1NCR C;  1W39 A;  1CN1 A;  1REF A;  2JD9 A;  1J83 A;  5ANQ A;  1SAC A;  2BER A;  4FQZ A;  4QMA A;  2I74 A;  1C5H A;  4IDZ A;  1LAJ A;  5G04 L;  4Y5S A;  5J36 A;  1MQT C;  4G4F A;  3KQR A;  1O3T A;  3A21 A;  3P1I A;  3ZFG C;  3U10 A;  4AWD A;  5A3M A;  4Z8B A;  5IT6 A;  4JDM A;  5T5L A;  4XUN A;  1GZ9 A;  4ZU4 A;  1BQP A;  1GOF A;  2BFU S;  5F7U A;  3TWI A;  4H7M A;  3SKJ E;  3BTY A;  2J22 A;  1W8H A;  3S5A A;  3M3E A;  1QXJ A;  4PBO A;  2PHX A;  2QKD A;  5DZF A;  5EV7 A;  1AR7 2;  2AEY A;  2XBO 2;  4Y26 A;  3VDD A;  1JHN A;  1H2N A;  5JI7 A;  2ZMN A;  3N9N A;  3HNY M;  4Q4Y 3;  3OPT A;  2QE3 A;  3MID A;  5FZA A;  4FPJ A;  4HKO A;  4NRM A;  3USU B;  1UIJ A;  4QPG C;  5JCT A;  4ASM B;  2BBA A;  2PFW A;  1Z7S 2;  3AL6 A;  1RUC 1;  1MS8 A;  1NLS A;  5AC9 2;  4UXA A;  3BI3 A;  5DG1 A;  3VL8 A;  1W9T A;  4DIQ A;  2QTW B;  4AEM A;  1UOB A;  2D44 A;  2VPV A;  4GMP 3;  5A33 A;  4KBB A;  5F1R A;  4N9H A;  4R4X A;  1XU2 A;  1YQ6 A;  4QX3 A;  3R4S A;  3ZFF B;  1OLQ A;  4BXF A;  2XVK A;  3D6E A;  1GSL A;  2DYC A;  2X53 S;  4V2W A;  4ZPI A;  3J7M A;  4UW6 A;  1UD1 A;  1GWM A;  1NX9 A;  2FDJ A;  2D6P A;  5IK8 A;  3BPS A;  1D7P M;  4BQ4 A;  2D6L X;  4DO0 A;  2WNU C;  1KDK A;  3IBM A;  1A3K A;  2I07 B;  1PMI A;  2IXI A;  3EO6 A;  5F2S A;  1K3I A;  4CRQ A;  3AP6 A;  1ODN A;  4E27 A;  4N8M A;  4I0B A;  5FP4 A;  2VMC A;  4XJA A;  3BTZ A;  4AVB A;  4CDU B;  1NY7 2;  1BK1 A;  4AQT A;  4CU7 A;  4AFB A;  5L19 A;  3J8F 3;  1CVN A;  1W9F A;  5FY5 A;  5K0U A;  4BLI A;  2RV9 A;  3ZR5 A;  1QXR A;  4I01 A;  4OUS A;  2VOT A;  2D6M A;  5D2A A;  3OSD A;  4NPL A;  3H42 B;  2C1F A;  5FYB A;  3T2Q A;  4CDX B;  3FUO A;  5JWP A;  2NP0 A;  4CCO A;  3ACG A;  1SDD B;  2QQI A;  1VBA 2;  2NN8 A;  2UWB A;  2VNV A;  2VC9 A;  3LQC A;  1UYY A;  1SPP A;  3PU8 A;  3MBW A;  2WT0 A;  3SEE A;  2BRT A;  1GUI A;  3KMH A;  4YW6 A;  4B29 A;  3HBK A;  5J96 B;  3FN9 A;  2AC1 A;  4R9A A;  1QJY 3;  2ZHM A;  3VD3 A;  5KR7 A;  1RUO A;  4NPR A;  1OQD A;  2GC1 A;  4ATF A;  4K7J A;  1ZZB A;  4M3C B;  1AL2 1;  2CY6 A;  2RR1 1;  4AGR A;  4Q4Y 2;  1N3P A;  1UX7 A;  2UYB A;  1MS4 A;  1H1A A;  4G9S B;  5L36 A;  2ZEX A;  3KD4 A;  2YFU A;  4QU1 A;  1F9K A;  4XBQ A;  1S0C A;  3NV1 A;  1PZ9 A;  4LBJ A;  5LA1 A;  1GV9 A;  3D4K A;  4JGZ A;  4OMD A;  3D8C A;  5FPA A;  1AX0 A;  1VMJ A;  1HN0 A;  2UU8 A;  4RN5 A;  3VBO C;  3WP4 A;  4Q0V A;  2R06 1;  2Q8O A;  1GZT A;  1PO2 3;  3VV1 A;  3WIN E;  3MFC A;  1K5M C;  3E6D A;  2QQO A;  2CGN A;  4K3U A;  4BA6 A;  2B45 X;  2C26 A;  4EN6 B;  1YQ2 A;  1RUE 2;  3PDQ A;  1PIV 3;  1S0I A;  3RDI A;  4AFD A;  3UNP A;  4Y1V A;  1QU0 A;  1XU1 A;  3B5L B;  1LEC A;  4LA3 A;  3VZJ A;  2WBK A;  3WG3 A;  1ZRF A;  4ZS2 A;  4CDQ B;  1VRH 3;  2YPD A;  2EF6 A;  1D4V B;  3ZN5 A;  4GD4 A;  1AJO A;  2LTN A;  4AFA A;  1ZRC A;  3GNE A;  2LW8 A;  3LGR A;  4HVO A;  3V0B A;  1BBT 3;  2QZ2 A;  1W6M A;  2A3W A;  1OOP A;  4QKN A;  1W2O A;  3B94 A;  1ND2 B;  4YGD A;  4QPI B;  5T52 A;  3B7M A;  2VOK A;  3C7H A;  1VBB 1;  2RJK A;  1DZR A;  3DEC A;  3AP5 A;  4N53 A;  4TYS A;  3WNN A;  1MS9 A;  2DFC A;  2OQ7 A;  2NM1 A;  4BK5 A;  5F5Q A;  3THD A;  3RZZ A;  1VAV A;  4HVR A;  5DDJ 1;  1RUH 1;  4Q0S A;  1FMD 2;  2VMH A;  5TSW A;  1MPX A;  2CU5 A;  1KIT A;  3MDP A;  4Y33 A;  1ULO A;  4ZXK A;  5FOB B;  3W5N A;  4CEY B;  3FFQ A;  1UZZ A;  1PNF A;  3CF6 E;  2FZ1 A;  5IK4 A;  3PUI A;  4LOS A;  2RMU 1;  2CHH A;  2X29 A;  2DV9 A;  2DTW A;  4MXW A;  3WP6 A;  1VP6 A;  1OPM A;  3OTF A;  4QDR A;  1UIK A;  3ZXD A;  3C7E A;  3IB3 A;  5F3G A;  1F4H A;  4L99 A;  3ZFG A;  1GOG A;  3N35 A;  3HNM A;  2EA7 A;  3OBA A;  3NJX A;  3ZFF C;  5FYV A;  1V6I A;  2E31 A;  1AR9 2;  2RS5 3;  3WG4 A;  2Y64 A;  1ULP A;  1PO1 3;  3HVD A;  2HLE A;  1KGY A;  4OYU A;  5JSR A;  4GB3 3;  4AG4 A;  2YC0 A;  2J1R A;  2KA3 A;  3SH5 A;  1SBF A;  2VZQ A;  3M3C A;  4QGN A;  2GH2 A;  2YMZ A;  5H9P A;  2XLA A;  3T1L A;  3ZLI A;  4IEQ A;  4IGO A;  3LFI A;  4QB1 A;  2DVD A;  4QPG A;  2AAC A;  3UV9 A;  3U4X A;  1WCD J;  1PO2 2;  4HT1 T;  4HXC A;  2VH9 A;  4CDU C;  2PHR A;  3BGA A;  4XPV A;  4LKE A;  3I3M A;  3ZDV A;  4KMQ A;  1W6N A;  3I7D A;  1LHN A;  4OHW A;  5FY4 A;  4CXW A;  1O4T A;  4PIZ A;  1HQL A;  2XML A;  1N3O A;  1PIV 2;  3OBT A;  4XF9 A;  1HDK A;  1QXP A;  5A7S A;  1Z0H A;  4CDX C;  4LOT A;  1CPN A;  1QH7 A;  3KT4 A;  4WV8 A;  3ZXE A;  2WAO A;  3AP4 A;  4IE7 A;  5EFU A;  1EP0 A;  2JDP A;  1DF0 A;  4NOT A;  2Y34 A;  2YB7 A;  2WC2 A;  4LBO A;  1CAV A;  3D0J A;  3LEG A;  3Q9O A;  4EN9 B;  2WNU A;  3AXD A;  3K3O A;  5D21 A;  3WCR A;  3AYA A;  3AJZ A;  1H4G A;  1YIP A;  3K4D A;  5L9R A;  3ILN A;  4XET A;  2VAU A;  1ZRD A;  3AJY A;  1J84 A;  3ETQ A;  4I3G A;  1B09 A;  3CIH A;  3CU7 A;  3RMY A;  4FPL A;  1A34 A;  3E5Q A;  3OUI A;  5T3N A;  4DZG A;  5FZ1 A;  1CPM A;  1QOT A;  1XB9 A;  5AFB A;  1F31 A;  3UKV A;  4CTE A;  1G9D A;  1WCQ A;  3IMM A;  2BNO A;  3PUA A;  3A4U A;  4OUE A;  4BQ3 A;  1QOO A;  1R1A 2;  3NNL A;  3HAG A;  3QD6 A;  2ES3 A;  1O8S A;  4IEY A;  3WW1 A;  2JG8 B;  3VBR B;  4NPM A;  1TE1 B;  3KCY A;  5KXC A;  5IVJ A;  5FPU A;  4H3W A;  3Q8F A;  2BVV A;  5DAX A;  3VD9 A;  2CAV A;  3OGG A;  1D4M 3;  1KFU L;  4LJH A;  3OD0 A;  3OGV A;  1VBE 3;  2Z5W A;  1QY4 A;  4FPK A;  5ISL A;  4X6R B;  2W5F A;  4GB3 2;  5F32 A;  1UAI A;  1PMH X;  2JIG A;  4CDQ C;  4O9G A;  2HWC 1;  1JZ3 A;  3I97 A;  4KU7 A;  5A3L A;  1KXG A;  3JB4 C;  1VMF A;  4UOJ A;  3GZA A;  5FUI A;  2PN5 A;  4RGG A;  5JIU A;  4ZU5 A;  3AVR A;  1HRI 1;  5FO7 B;  3U07 A;  4URA A;  2W1Q A;  5K8S A;  3CJX A;  4KG0 A;  4MHR A;  1ND2 C;  3TEX A;  4QPI C;  1JXN A;  1JYX A;  3MIF A;  4AFC A;  2CNA A;  1JTZ X;  1JUH A;  4AVA A;  1ZYB A;  3LEI A;  3BTA A;  1HB1 A;  1C1L A;  1V9U 2;  4K9S A;  3K2O A;  3GJA A;  3H7Y A;  1OFN A;  5CG9 A;  2BVB A;  5JXH A;  2NMN A;  4CEY C;  2EAK A;  4FPF A;  5E8A A;  5BPX A;  2SLI A;  4PDW B;  2QUO A;  1GOH A;  4HKW A;  1UY0 A;  4I2O A;  2VZ3 A;  3BOW A;  1VBD 2;  4N7U A;  2PAM A;  3KVA A;  2Q8D A;  4Q4X 3;  3H8X A;  3IT8 A;  4LHK A;  2GH8 A;  1XQN A;  3GCW A;  3EB7 A;  4UT5 A;  3VZL A;  4AI2 A;  2Y6K A;  4JKK A;  4OQ9 A;  4X8P A;  4WVM A;  2BQP A;  3UKT A;  1IS5 A;  2R1B A;  4NN0 A;  2D3P A;  2GAU A;  3LA7 A;  4QM8 A;  4YG0 A;  3G7D A;  1QJU 3;  4HK8 A;  5AVA A;  1H1I A;  1IKP A;  2A6X A;  1DGW A;  2GNT A;  2MPF A;  5J37 A;  1QH6 A;  1WGP A;  5HCH A;  3UL2 A;  3KHB A;  1VB4 A;  5FP8 A;  2ZHL A;  2OXB A;  1LHV A;  4YVS B;  1OKO A;  2K2S A;  4LO4 B;  2HWE 1;  3TAY A;  1W8N A;  3GBW A;  3NO8 A;  5BNO B;  5JXG A;  2VNO A;  1BMV 1;  5C70 A;  4QPW A;  3U0Z A;  5EQU A;  4NII A;  2UWC A;  1D4M 2;  1S1A A;  1W9W A;  4ASK A;  2W2I A;  2NZ9 A;  2J7M A;  2R07 1;  3LIG A;  3FFZ A;  2P6H A;  4KL1 A;  4BQX A;  3B93 A;  1OBN A;  1PX4 A;  3VD4 A;  3AFG A;  2WAB A;  4XUP A;  1I3H A;  4MGK E;  3AYE A;  5I0S A;  5FZ7 A;  4AF9 A;  5KBF A;  1UZY A;  4JGY A;  3AP7 A;  5EZW A;  4EN8 B;  1YNA A;  5FOJ B;  4NAM A;  1ZZC A;  1SLT A;  1FX5 A;  4P9I A;  4XJZ A;  1OH4 A;  4YGC A;  3VDD B;  4M4P A;  2WZR 1;  1ZRI A;  2WLP A;  4COV A;  4HVQ A;  2JDN A;  3J26 N;  3RRD A;  4C0H A;  3ZSJ A;  4HN1 A;  5JR7 B;  2E33 A;  1O3S A;  3N9M A;  1CWP A;  4XAB A;  2X09 A;  4NRO A;  4A44 A;  1C28 A;  3MEP A;  5JXI A;  5J7M A;  4YVW B;  5FIX A;  3UGG A;  1ODM A;  4AQS A;  3CL1 A;  4HBN A;  1R64 A;  3LFM A;  4UFM A;  1SZB A;  1GMM A;  1ONA A;  3MF6 A;  1JUI A;  5FJK A;  3WQB A;  1Q8P A;  2UY8 A;  3OCP A;  4EWA A;  2RS1 3;  2EAL A;  1H8T A;  1RXG A;  4KWK A;  4CP9 A;  4WM7 A;  5A33 B;  1G7Y A;  3MPB A;  4Q4X 2;  2HYX A;  1OXC A;  5CEH A;  1YEW A;  4QX2 A;  4GAZ A;  1FPN 3;  1NOV A;  5C33 A;  5LWB A;  2JG8 C;  1E5I A;  3VBR C;  5FO9 B;  5D8A B;  4D6S A;  2Z4F A;  3IWZ A;  3PLQ A;  3Q8A A;  1FAY A;  3S5Q A;  1QJU 2;  1EPW A;  3LWC A;  4W8J A;  5IK5 A;  4X6Q B;  5EWS A;  4Q4Y 1;  2AEZ A;  4R9D A;  1UX6 A;  4IE5 A;  5BY5 A;  5G05 L;  4FTS A;  5GLV A;  5IHR A;  4DXR A;  1WLW A;  3JCI A;  4IEP A;  1PHM A;  2NPI A;  3VBS B;  2ZEY A;  2CAU A;  2W87 A;  3NRU A;  4QB2 A;  3WOG A;  4IEW A;  4LBN A;  5GZG A;  1KRI A;  3ZM8 A;  1KS4 A;  4XUQ A;  5LRS A;  1GNY A;  3HEI A;  4GMP 1;  4XF4 A;  4NR1 A;  2BBV A;  3PHM A;  4HLT A;  3MIB A;  5K0U B;  4IE6 A;  5K9Y A;  1LHO A;  4MGQ A;  2JD4 A;  3P6B A;  3I2K A;  4QKF A;  4YW5 A;  5CA6 A;  1F15 A;  1J3R A;  1MZF A;  1JZ2 A;  3GZU C;  5LA9 A;  1AF9 A;  2VBP A;  2YGM A;  3WDX A;  2D98 A;  4ZZ5 A;  2ZA9 A;  2ADD A;  1J59 A;  4PDW C;  2Q1Z B;  4B4Q A;  4E2G A;  1LED A;  4O65 A;  1JMU B;  5BUV A;  3VHP A;  2VQA A;  1YI7 A;  4DXS A;  2DUO A;  2GAL A;  5CIR A;  1MZ6 A;  3J8F 1;  5GZD A;  2A5Z A;  2QQM A;  2QCS B;  2ZGR A;  3DV8 A;  4PIY A;  1NCQ B;  2DVF A;  3MUZ 1;  2P37 A;  3PJQ A;  1ZA4 A;  1AL2 2;  2WSV A;  4QQP A;  3W20 A;  3BAL A;  3THC A;  4JGZ B;  4NHY A;  2R0F A;  1LB2 A;  1UCX A;  5JMO A;  2QJV A;  2WYS A;  3B00 A;  4YM1 A;  1UYX A;  3DXU A;  3ACL A;  3BU0 A;  2O0O A;  4AVV A;  1XC6 A;  2ZGO A;  3KZ4 C;  4YVS C;  4BE3 A;  1JZ8 A;  5F37 A;  4OFG A;  4UI9 L;  3LPF A;  4YW1 A;  5BNO C;  2VNR A;  2QBX A;  1QJY 1;  3ORJ A;  4HMZ A;  5FFO C;  2W47 A;  2WNV A;  4CEY A;  1GU3 A;  5FZE A;  4AI3 A;  2VVD A;  3DYO A;  2R06 2;  3ACF A;  1R1Z A;  3PVO A;  2V4V A;  2JKB A;  2XVG A;  1M06 G;  5F3C A;  3KGZ A;  2RJ2 A;  3AMH A;  3NV3 A;  5FK7 A;  5DPN A;  2XB6 C;  1ULD A;  3FZ3 A;  3NJV A;  5E88 A;  2WO1 A;  1UY4 A;  1OVS A;  3OGJ A;  3V0B B;  4P5H A;  1W6M B;  3KS7 A;  1OOP B;  3I3E A;  2ILM A;  3LAG A;  2OPK A;  1TMF 3;  1SBE A;  3WXP A;  1IPK A;  1Y9M A;  1GWK A;  1PO2 1;  3MIC A;  2X10 A;  3HPN A;  4H7L A;  5IUQ A;  2ERF A;  1JZ6 A;  2D43 A;  2JG9 B;  1IPJ A;  3VDD C;  5FTT C;  2G9Z A;  3HMY A;  3WV6 A;  4QM9 A;  1XYO A;  4MGT A;  3OPZ A;  1PIV 1;  4DB5 A;  3A22 A;  1TME 3;  2XWJ B;  3ITQ A;  2XUM A;  4BWO A;  3ZYB A;  1LOF A;  4Q26 A;  2FMY A;  4YVW C;  4QHZ A;  3VBH A;  5LAS A;  1VRH 1;  2HWD 3;  2Q0A A;  3A23 A;  1W8F A;  5L7O B;  1RUH 2;  2B39 A;  3PJY A;  1G9A A;  5IFT A;  4MXW B;  2Q5T A;  3I59 A;  3OJB A;  2HEW F;  2DCT A;  1BBT 1;  2GC2 A;  4QX7 A;  3SC7 X;  4OI0 A;  2RM2 3;  1E5R A;  3H0O A;  5D8A C;  5DZG A;  4Z07 A;  3B9C A;  3VKN A;  2XOM A;  3RZL A;  1PVC 3;  3O0V A;  3BUC A;  4XAA A;  2ARC A;  2K9Z A;  3NWK A;  4RGA A;  4XJ9 A;  3H3L A;  1T2X A;  5ACA 3;  4FXK B;  2OVU A;  2IFW A;  1JOB A;  4UFK A;  2IZW A;  2ZBJ A;  3ASI A;  4Z82 A;  1RIR A;  5EJ1 B;  5F3I A;  5A7Q A;  1UOG A;  5A3W A;  5FPZ A;  4BDV B;  3K51 A;  3VBS C;  1C3H A;  3WDU A;  3AKS A;  1WMX A;  1SMV A;  2ZGU A;  1ENS A;  2MEV 3;  3MLL A;  3NNG A;  3WHU A;  3ZYI B;  4DRV A;  1SCR A;  2PYT A;  2VOW A;  3FUQ A;  1UL9 A;  1RUI 3;  5GLW A;  1E57 A;  4YYO A;  4QHO A;  5K0U C;  1H6X A;  5JOZ A;  1YQ5 A;  1W2T A;  2RS5 1;  3VLB B;  3PTR B;  4HAN A;  1NE6 A;  4JV4 A;  1PO1 1;  1XNA A;  4R8H A;  3QCW A;  5FZK A;  4ZU7 A;  5FZG A;  4PI2 A;  4KQ7 A;  1NXD 1;  1XNB A;  5LBB A;  3BCW A;  2JG8 A;  3VBR A;  4YZ4 A;  1Q8V A;  2D3S A;  2VMF A;  4GB3 1;  1NQJ A;  4ES8 A;  1GQP A;  4KGQ A;  3I2D A;  2ZX4 A;  1IHM A;  1H0B A;  2GN3 A;  4NRP A;  2Y0I A;  4P9G A;  3W58 A;  3WF0 A;  1CAV B;  2JB4 A;  2VQ0 A;  3ZKY A;  1FV3 A;  2FBE A;  2XWB B;  5L9B A;  2FDI A;  4KGG A;  4YW7 A;  5FMO S;  4EWD A;  4A41 A;  5GLU A;  5CKN A;  3EQE A;  4I0W B;  4MET A;  1V70 A;  4DFS A; 
#chains in the Genus database with same CATH homology
 1W8W A;  4BQ3 A;  2K46 A;  2LRP A;  2Q1F A;  1GWK A;  4YWA A;  1OH3 A;  1GWL A;  3ORJ A;  1W8U A;  4BQ2 A;  1WZX A;  2LRO A;  5D21 A;  2VXJ A;  1W9F A;  4AL9 A;  1W8Z A;  4LKD A;  1L7L A;  1W90 A;  3F95 A;  3UT0 A;  1V0A A;  2O14 A;  3ZYH A;  3ZYB A;  4CP9 A;  4LJH A;  4LKF A;  4LK6 A;  4CPB D;  2C24 A;  4BQ5 A;  4CPB A;  1WMX A;  1GWM A;  1W8T A;  3ZYF A;  4LKE A;  4CP9 B;  1UOJ A;  4YW7 A;  1OKO A;  2WYF A;  1HN0 A;  2KR2 A;  4BQ4 A;  4LK7 A;  2JWP A;  4YW6 A;  1WCU A;  4A6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...