2JWSA

Solution nmr structures of two designed proteins with 88% sequence identity but different fold and function
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ga88
publication title NMR structures of two designed proteins with high sequence identity but different fold and function
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2jwsA00
2MH8A 1GJSA 2JWSA 1GJTA 2KDLA 1PRBA 2LHGA 2LHCA 2N35A 2FS1A 2VDBB 1TF0B 1GABA 2J5YA
chains in the Genus database with same CATH superfamily
1NJFA 2CHQA 4IBEA 4LF9M 4PDIA 1HNZM 1NHGC 3PXGA 2F5QA 4NRVA 4AKHA 2F4VM 4REZA 2L7IA 5IT9S 4RF1A 2JZ0A 2L7HA 2OQ4A 4DV7M 5EQTA 2C5RA 2DVWB 1OIPA 1XXHB 3AFHA 4HEOA 1E32A 3GRUA 1NV9A 2B3TA 2DHYA 4DV5M 5FTJA 2DXIA 4JI5M 2J5YA 1OTRA 5FTLA 2V6ZM 3K2LA 3W0FA 3B7ZA 1J09A 4DR3M 4R7GA 1E9SA 4QOZC 4AG5A 2MR9A 4CJ6A 1HR0M 5EXXA 4L78A 2KRKA 4GRIA 2YFQA 3AJIB 1QANA 4M0WA 2CUZA 4OW0A 1Z6TA 1C1KA 5EP1A 2UU9M 2W82A 3K8ZA 1IY2A 1GO5A 2EKKA 4MM3B 2CP8A 3DFZA 4EIWA 2JXNA 5C18A 3KFUG 2ZAMA 2R0IA 2R46A 4AW4A 3GLIA 1G3IA 4LJ5A 2KNAA 4OVZA 2FNAA 3A45A 3L2AA 5ITXE 4DUYM 2RRUA 3C3EA 1L2CA 3KSXA 3B89A 3E4RA 3HHWA 4KLNA 3RFWA 4D82A 3NBXX 3JR5A 1NY6A 4PD2A 1VEGA 2JUJA 4QNRA 1HQCA 1Q3CA 2XFSA 4LJ9A 3VK8A 3U6QA 4GKJM 1HQYE 2DI0A 3D8BA 3K92A 3AKZA 4Q7JA 1EFUB 2ZBKB 3ZH9B 4OVZB 3U6SA 1TGUA 3HJ8A 2DZNB 1L1TA 2LWXA 1XMQM 1IN4A 1MX0A 1TH4A 2CHGA 3J7BA 3GLFA 1OFHA 4JN6A 1G4AE 3FUUA 2XH9A 3MK6A 3WHLA 4JI6M 4DR7M 1XXHE 3OTOM 2QCUA 1T43A 1YLAA 3KP1E 3JR4A 1IBMM 4LF6M 2JY7A 1MU5A 2XZUA 3J80S 2X8AA 2C99A 2R44A 3FD9A 3CF6E 1TTEA 2NQ8C 2O5RA 1IXZA 2WZJA 4LZJA 1E94E 1WJ7A 4CHTB 1N75A 2V1CA 4FVMA 3KOXE 3JAMS 3GLFB 3GRVA 1QDTA 3MJ5A 4JI0M 2LNHC 1IXRC 1R4GA 3LQRA 4M9XA 3VDUA 3HHZA 3MHVC 2LXEA 4GHLA 2LVOC 5JI3E 4G4OA 2CHVA 3U6LA 2QBYB 2YQZA 2R6FA 1JR3D 3A98B 4RNAA 2DWLA 5LMUM 1Z5CA 4LJ8A 1F4IA 2XFTA 4XGIA 3LCUA 3DOAA 2G8LA 2N35A 3FYDA 4DV6M 4QHTA 1YUBA 3FTFA 1GKIA 4PCZA 1FJGM 1K3XA 4MGYE 1XMOM 1IY1A 3GLHA 4HL4A 4LG2A 3VDPA 1IXSA 2WSCF 3W68A 4KHPM 2ZAOA 4F1IA 5IREB 4NRWA 4D81A 3SAWA 4ANRA 3VFDA 2KDLA 2CRUA 4FWHA 1CUKA 4R3DA 3VKHA 3DZDA 3HHYA 1SXJA 5A2QS 1DGHB 3U6DA 3SHFA 4NL4H 1ORYB 3NWLA 4XBOA 4AKIA 2XSZA 3IHPA 1HT2E 3SMSA 2DNAA 1JB0F 3E21A 2BJWA 3FRIA 5ITQA 1EE8A 1PJSA 2Z3XA 4KO8A 2WSFF 1Z5AA 1WR1B 2YR0A 2VQEM 1YSYA 1QDRA 2I7NA 1N77A 3HGIA 5BR8M 5EXTA 1J7KA 1NY5A 3K9PA 4RF0A 3V76A 1L2BA 4I5SA 1IQPA 5DYIA 3TL4X 4PDGA 4AI6A 2D7HA 3GPYA 3U5ZA 1FNNA 1NSFA 1R2YA 3Q8GA 3GLGA 3VK7A 1ZMUA 4BBAA 4WW0A 1KFVA 1DO0A 4DR2M 3PNYA 1IY0A 2VDBB 3IG8A 2KA6B 3GQ5A 3FKEA 3FUXA 3A46A 3DA1A 3GLFE 4II7A 2LHCA 2VF7A 3RGPA 3SARA 1P3QQ 4FCWA 4IJFA 3U6EA 4LFBM 1GJSA 4JI3M 3U5ZB 3GPUA 2JNHA 3HKPA 5KPRA 3GLGB 1IFYA 4K0KM 4LFCM 4G4QA 4I8OA 4Z6YA 4GITA 1N36M 4YY3M 3MMPA 3F92A 4Z8XA 2EA0A 1Q3BA 2APLA 2KRUA 1VDDA 3R9XB 1VQ1A 3KOZE 2QHOB 4CIZA 5H37D 1LTMA 1Y8GA 3FE3A 1ZQ9A 2KZSA 2VF8A 1OFIA 2ZTCA 4JI2M 3FUVA 5E26A 1NV8A 3FUWA 4L15A 5ITRA 4X64M 4JI4M 2BJVA 2G5GX 4MGHA 3U6CA 1L8QA 2Z4RA 3C58A 4NOOB 1AUAA 3H4MA 3GRRA 1G8PA 2LTUA 3PVSA 4G3OA 4GKKM 4DR5M 3SYLA 3L26A 2JWSA 4FWGA 4IBDA 3THGA 4LRSA 2GQFA 4LF5M 1D2NA 1N34M 2OO9A 2R4EA 3KS4A 4LJ6A 2ZM6M 3GLHE 2EJSA 5E6JA 2ZANA 2L4EA 1MJGM 3M6AA 2LVAA 2ERCA 2XEPA 2JZ1A 3UGJA 4AQYM 4AKGA 5L8RF 1DO2A 1PM5A 4G4NA 3SATA 1SG9A 1SXJE 4IBKA 2C9CA 4GEWA 7CATA 2Z7JA 2CE7A 3QYEA 1XNQM 1MN3A 3C9PA 1Z5BA 1G59A 4MGIE 3WHKA 1VDLA 2XLJA 2CV0A 1R2ZA 1N78A 4GC5A 1EIJA 3UZUA 1HNXM 1WGNA 3BOSA 1IN6A 1NHWC 1RU3A 5IWAM 5DYGA 3A42A 2QBYA 4DR1M 4NSRA 3QYBA 2UUBM 4LY6A 2QPAA 4FW9A 4NXMM 1X37A 3FUTA 4OX9M 3GLGE 3EIEA 4RKUF 4AG6A 3U6OA 2FE8A 4CGYB 3HHXA 3U61B 4KT0F 3H4JA 1C7YA 2Y0QA 2RGHA 3I01M 3KDSE 1H6UA 1D0LA 4LZZA 2OOBA 4IBIA 3AL0C 1TH3A 4QOSA 1D0MA 1ZAEA 2K0BX 2R62A 3KW6A 2O25A 5IZ7D 4LF7M 1W5SA 2FFJA 3E9SA 2DZLA 1XHBA 4BLCA 1WXQA 4D80A 1PJIA 3TE6A 1ZMWA 2J7OA 2P5TA 4FD2A 4GHAA 4B3MM 1QQWA 2KNZA 4MGZE 2HCBA 3E46A 4FCVA 3L25A 1DGHA 3Q8XA 3L29A 4B3RM 2MGWA 1KSFX 3KSJA 1OAIA 4QHSA 5KQDA 1NNUC 1NJGA 4IBFA 3B7NA 4IJEA 3K1JA 3L28A 4R71A 3PFIA 1XNRM 3KXEC 4MGKE 3HY5A 4PT5A 4DV4M 3J27B 5EP3A 1JR3A 2OOAA 1QZEA 4FWDA 2Y0TA 4LCBA 4OU7A 4X66M 1DV0A 1I4WA 2DAIA 2HAKA 3FRHA 5EP2A 2R45A 1HT1E 4JYAM 1QUTA 1GVNA 2BWEA 2BWBA 4LRTA 2FOIC 3KOWE 2ZTDA 3AOEC 4A3VB 1IN8A 3GPPA 2QENA 3L27A 2XF3A 3TWMA 2F5SA 1YE9A 2RKOA 3SYKA 1TH2A 3BXWA 3LVVA 1PJJA 1QAOA 2HWJA 2L4FA 2XZFA 4X62M 3IECA 1QAMA 4DUZM 2LBCA 4M0DA 1IBKM 4G6ZA 3KVWA 3CF0A 1UFZA 5KQ8A 4B08A 1PJQA 3KS8A 3T38A 3CF2A 4QNMA 1Z59A 3TQSA 4B7GA 5KO3A 3IG5A 2C96A 2FS1A 4TUWA 2M5ZA 1G41A 3U6MA 3SAVA 1N32M 4DR6M 3UJNA 2JY6B 2K6BA 4B7HA 1L2DA 4B3TM 2UXBM 2K47A 4LJ4A 4JV5M 2CV2A 1GLNA 2VQFM 4LF8M 4JXJA 3HU2A 4UN2B 2CV1A 1PRBA 3U60B 3B9PA 2DWZB 3J7AS 2F5OA 1NNJA 3GPXA 1XWIA 3FTDA 4M9ZA 4NSOB 3SC3A 4XK8F 4DV2M 2V1UA 2KZUA 2R4JA 8CATA 1WHCA 2JY5A 3BBZA 5FTKA 4BB9A 3SASA 1N33M 3ILKA 4I81A 3KOYE 1K82A 2DZOB 3ZQJA 5EXSA 3FTEA 2D7EA 3HWSA 1IM2A 3LQQA 2DAEA 2M60A 3GQ4A 1XB2B 2L09A 4L6V6 3VKGA 4DV0M 2EO2A 2Z4SA 4G4RA 3KP0E 4S12A 3PNVA 4GH9A 5JI2E 3I4VA 3CTWB 1WIVA 4LJ7A 4L16A 4IBJA 2QQ8A 1E9RA 2DAMA 2HKJA 3B7QA 2LHGA 3SMPA 3HU3A 2R18A 5DNYA 1ZV1A 1ZMVA 1BVSA 3GO8A 3GP1A 2E5LM 4MB7A 4IBBA 1JQJC 2UUAM 1T3TA 3W0LB 3LMMA 1Q02A 2H1RA 5GKNA 1JR3E 5ITYA 3HU1A 1V33A 1WGLA 5FTNA 3VLFB 1T6OA 2GNOA 1GABA 1TDHA 1I94M 1TR8A 5BPVA 3U61A 3SFZA 4B3SM 1HNWM 4HLQA 1R5LA 1VEKA 2C98A 2A5YB 2CWBA 4L4UA 1TF0B 2D7GA 3FYCA 5FLXS 5LMNM 2YNMD 1R6BX 2LVNC 4CISA 2DAKA 1PGYA 2KXEA 3AOGA 3CGWA 2LVQD 1V92A 3AV0A 3I04M 3M7GA 4Y28F 3D8LA 2QSFX 3HJSA 5EXPA 1OIZA 4DR4M 5F3WA 4ITQA 1D0KA 2JA2A 5DFLA 3T15A 3LW5F 1OQYA 3SHGB 4I4LA 3K9OA 4NC6A 4JI7M 4JI8M 3M0EA 2QZ4A 4GC9A 1A5TA 3GLIB 4L8RC 1IN5A 1G71A 1QYRA 2R65A 4LJAA 2G3QA 2JP7A 2H5XA 2C9OA 3I4YA 3ZC7B 5ITUA 2J7NA 4LF4M 2Z8YM 1OJLA 3FTCA 3ZCBB 5FTMA 1GJTA 2UUCM 2DENA 2DWMA 2L6OA 4LGMA 2L2DA 2DKLA 2KW0A 1J5EM 1AIPC 3HJQA 2LH0A 2EKFA 2I7PA 1TDZA 5EP4A 3T1HM 4P17A 4JI1M 2MH8A 2O01F 1OAOC 5KPZA 2HL7A 1Q39A 3UK6A 2UXCM 3RGSA 4NXNM 2RGOA 4ZPXA 4KODA 3J2PB 3LVWA 4IIWA 4DV1M 1XC8A 2HHHM 2WSEF 3RE8A 4DBGB 3EIHA 3TPZA 4IBGA 5ITXA 1SXJD 1PJTA 2QNJA 4F2LA 2F5NA 2KEBA 1VEJA 2XSZD 1SXJC 1LV7A 1NO1A 1R7RA 3I51A 1KYIA 1OKSA 1GL7A 2DAGA 3LCVB 3TWKA 3T1YM 1UM8A 2QP9X 2UXDM 4YHHM 2VIIA 2F5PA 1QUSA 2CEAA 1HJPA 1QZMA 2LVPC 3B74A 3GQ3A 3SBJA 4DV3M 3AOEA 3U60A 4M9SA 4MH0E 2FH0A 2KHHA 2AHMA 1V34A 2X4AA 4X65M 4GMQA 2Y20A 2Q2EB 3HX3A 3HZJA 4LFAM 2OPFA 4WP2A 4IBCA 2CFOA 3W67A 3U6PA 3TWLA 5KPTA 5FSWA 1QAQA 1DGBA 5C1BA 1K3WA 2DWNA 5ITTA 1W5TA 3GLIE 1NVMA 1DGGA 4WURA 1IBLM 4P16A 4GIPA 2JY8A 1S3SA 2MROB 3GLHB 4FCTA 3T6PA 2K9DA 1IXSB 5EJCA 3UMMA 2KNVA 2EUCA 1XXHA 1QVRA 3C3DA 3R8FA 4B7FA 3SAUA 2X49A 3QAUA 4W5WA 2XGNA 1IN7A 3J81S 2DHRA 4LGYA 1SXJB 1DGFA 1VG5A 2BNKA 2Y21A 3QWLA 1L1ZA 1GL6A 3GRYA 2MJ5B 3NBIA 4AZFA
chains in the Genus database with same CATH topology
2MH8A 1GJSA 2JWSA 1GJTA 2KDLA 1PRBA 2LHGA 2LHCA 2N35A 2FS1A 2VDBB 1TF0B 1GABA 2J5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MH8 A;  1GJS A;  2JWS A;  1GJT A;  2KDL A;  1PRB A;  2LHG A;  2LHC A;  2N35 A;  2FS1 A;  2VDB B;  1TF0 B;  1GAB A;  2J5Y A; 
#chains in the Genus database with same CATH topology
 1NJF A;  2CHQ A;  4IBE A;  4LF9 M;  4PDI A;  1HNZ M;  1NHG C;  3PXG A;  2F5Q A;  4NRV A;  4AKH A;  2F4V M;  4REZ A;  2L7I A;  5IT9 S;  4RF1 A;  2JZ0 A;  2L7H A;  2OQ4 A;  4DV7 M;  5EQT A;  2C5R A;  2DVW B;  1OIP A;  1XXH B;  3AFH A;  4HEO A;  1E32 A;  3GRU A;  1NV9 A;  2B3T A;  2DHY A;  4DV5 M;  5FTJ A;  2DXI A;  4JI5 M;  2J5Y A;  1OTR A;  5FTL A;  2V6Z M;  3K2L A;  3W0F A;  3B7Z A;  1J09 A;  4DR3 M;  4R7G A;  1E9S A;  4QOZ C;  4AG5 A;  2MR9 A;  4CJ6 A;  1HR0 M;  5EXX A;  4L78 A;  2KRK A;  4GRI A;  2YFQ A;  3AJI B;  1QAN A;  4M0W A;  2CUZ A;  4OW0 A;  1Z6T A;  1C1K A;  5EP1 A;  2UU9 M;  2W82 A;  3K8Z A;  1IY2 A;  1GO5 A;  2EKK A;  4MM3 B;  2CP8 A;  3DFZ A;  4EIW A;  2JXN A;  5C18 A;  3KFU G;  2ZAM A;  2R0I A;  2R46 A;  4AW4 A;  3GLI A;  1G3I A;  4LJ5 A;  2KNA A;  4OVZ A;  2FNA A;  3A45 A;  3L2A A;  5ITX E;  4DUY M;  2RRU A;  3C3E A;  1L2C A;  3KSX A;  3B89 A;  3E4R A;  3HHW A;  4KLN A;  3RFW A;  4D82 A;  3NBX X;  3JR5 A;  1NY6 A;  4PD2 A;  1VEG A;  2JUJ A;  4QNR A;  1HQC A;  1Q3C A;  2XFS A;  4LJ9 A;  3VK8 A;  3U6Q A;  4GKJ M;  1HQY E;  2DI0 A;  3D8B A;  3K92 A;  3AKZ A;  4Q7J A;  1EFU B;  2ZBK B;  3ZH9 B;  4OVZ B;  3U6S A;  1TGU A;  3HJ8 A;  2DZN B;  1L1T A;  2LWX A;  1XMQ M;  1IN4 A;  1MX0 A;  1TH4 A;  2CHG A;  3J7B A;  3GLF A;  1OFH A;  4JN6 A;  1G4A E;  3FUU A;  2XH9 A;  3MK6 A;  3WHL A;  4JI6 M;  4DR7 M;  1XXH E;  3OTO M;  2QCU A;  1T43 A;  1YLA A;  3KP1 E;  3JR4 A;  1IBM M;  4LF6 M;  2JY7 A;  1MU5 A;  2XZU A;  3J80 S;  2X8A A;  2C99 A;  2R44 A;  3FD9 A;  3CF6 E;  1TTE A;  2NQ8 C;  2O5R A;  1IXZ A;  2WZJ A;  4LZJ A;  1E94 E;  1WJ7 A;  4CHT B;  1N75 A;  2V1C A;  4FVM A;  3KOX E;  3JAM S;  3GLF B;  3GRV A;  1QDT A;  3MJ5 A;  4JI0 M;  2LNH C;  1IXR C;  1R4G A;  3LQR A;  4M9X A;  3VDU A;  3HHZ A;  3MHV C;  2LXE A;  4GHL A;  2LVO C;  5JI3 E;  4G4O A;  2CHV A;  3U6L A;  2QBY B;  2YQZ A;  2R6F A;  1JR3 D;  3A98 B;  4RNA A;  2DWL A;  5LMU M;  1Z5C A;  4LJ8 A;  1F4I A;  2XFT A;  4XGI A;  3LCU A;  3DOA A;  2G8L A;  2N35 A;  3FYD A;  4DV6 M;  4QHT A;  1YUB A;  3FTF A;  1GKI A;  4PCZ A;  1FJG M;  1K3X A;  4MGY E;  1XMO M;  1IY1 A;  3GLH A;  4HL4 A;  4LG2 A;  3VDP A;  1IXS A;  2WSC F;  3W68 A;  4KHP M;  2ZAO A;  4F1I A;  5IRE B;  4NRW A;  4D81 A;  3SAW A;  4ANR A;  3VFD A;  2KDL A;  2CRU A;  4FWH A;  1CUK A;  4R3D A;  3VKH A;  3DZD A;  3HHY A;  1SXJ A;  5A2Q S;  1DGH B;  3U6D A;  3SHF A;  4NL4 H;  1ORY B;  3NWL A;  4XBO A;  4AKI A;  2XSZ A;  3IHP A;  1HT2 E;  3SMS A;  2DNA A;  1JB0 F;  3E21 A;  2BJW A;  3FRI A;  5ITQ A;  1EE8 A;  1PJS A;  2Z3X A;  4KO8 A;  2WSF F;  1Z5A A;  1WR1 B;  2YR0 A;  2VQE M;  1YSY A;  1QDR A;  2I7N A;  1N77 A;  3HGI A;  5BR8 M;  5EXT A;  1J7K A;  1NY5 A;  3K9P A;  4RF0 A;  3V76 A;  1L2B A;  4I5S A;  1IQP A;  5DYI A;  3TL4 X;  4PDG A;  4AI6 A;  2D7H A;  3GPY A;  3U5Z A;  1FNN A;  1NSF A;  1R2Y A;  3Q8G A;  3GLG A;  3VK7 A;  1ZMU A;  4BBA A;  4WW0 A;  1KFV A;  1DO0 A;  4DR2 M;  3PNY A;  1IY0 A;  2VDB B;  3IG8 A;  2KA6 B;  3GQ5 A;  3FKE A;  3FUX A;  3A46 A;  3DA1 A;  3GLF E;  4II7 A;  2LHC A;  2VF7 A;  3RGP A;  3SAR A;  1P3Q Q;  4FCW A;  4IJF A;  3U6E A;  4LFB M;  1GJS A;  4JI3 M;  3U5Z B;  3GPU A;  2JNH A;  3HKP A;  5KPR A;  3GLG B;  1IFY A;  4K0K M;  4LFC M;  4G4Q A;  4I8O A;  4Z6Y A;  4GIT A;  1N36 M;  4YY3 M;  3MMP A;  3F92 A;  4Z8X A;  2EA0 A;  1Q3B A;  2APL A;  2KRU A;  1VDD A;  3R9X B;  1VQ1 A;  3KOZ E;  2QHO B;  4CIZ A;  5H37 D;  1LTM A;  1Y8G A;  3FE3 A;  1ZQ9 A;  2KZS A;  2VF8 A;  1OFI A;  2ZTC A;  4JI2 M;  3FUV A;  5E26 A;  1NV8 A;  3FUW A;  4L15 A;  5ITR A;  4X64 M;  4JI4 M;  2BJV A;  2G5G X;  4MGH A;  3U6C A;  1L8Q A;  2Z4R A;  3C58 A;  4NOO B;  1AUA A;  3H4M A;  3GRR A;  1G8P A;  2LTU A;  3PVS A;  4G3O A;  4GKK M;  4DR5 M;  3SYL A;  3L26 A;  2JWS A;  4FWG A;  4IBD A;  3THG A;  4LRS A;  2GQF A;  4LF5 M;  1D2N A;  1N34 M;  2OO9 A;  2R4E A;  3KS4 A;  4LJ6 A;  2ZM6 M;  3GLH E;  2EJS A;  5E6J A;  2ZAN A;  2L4E A;  1MJG M;  3M6A A;  2LVA A;  2ERC A;  2XEP A;  2JZ1 A;  3UGJ A;  4AQY M;  4AKG A;  5L8R F;  1DO2 A;  1PM5 A;  4G4N A;  3SAT A;  1SG9 A;  1SXJ E;  4IBK A;  2C9C A;  4GEW A;  7CAT A;  2Z7J A;  2CE7 A;  3QYE A;  1XNQ M;  1MN3 A;  3C9P A;  1Z5B A;  1G59 A;  4MGI E;  3WHK A;  1VDL A;  2XLJ A;  2CV0 A;  1R2Z A;  1N78 A;  4GC5 A;  1EIJ A;  3UZU A;  1HNX M;  1WGN A;  3BOS A;  1IN6 A;  1NHW C;  1RU3 A;  5IWA M;  5DYG A;  3A42 A;  2QBY A;  4DR1 M;  4NSR A;  3QYB A;  2UUB M;  4LY6 A;  2QPA A;  4FW9 A;  4NXM M;  1X37 A;  3FUT A;  4OX9 M;  3GLG E;  3EIE A;  4RKU F;  4AG6 A;  3U6O A;  2FE8 A;  4CGY B;  3HHX A;  3U61 B;  4KT0 F;  3H4J A;  1C7Y A;  2Y0Q A;  2RGH A;  3I01 M;  3KDS E;  1H6U A;  1D0L A;  4LZZ A;  2OOB A;  4IBI A;  3AL0 C;  1TH3 A;  4QOS A;  1D0M A;  1ZAE A;  2K0B X;  2R62 A;  3KW6 A;  2O25 A;  5IZ7 D;  4LF7 M;  1W5S A;  2FFJ A;  3E9S A;  2DZL A;  1XHB A;  4BLC A;  1WXQ A;  4D80 A;  1PJI A;  3TE6 A;  1ZMW A;  2J7O A;  2P5T A;  4FD2 A;  4GHA A;  4B3M M;  1QQW A;  2KNZ A;  4MGZ E;  2HCB A;  3E46 A;  4FCV A;  3L25 A;  1DGH A;  3Q8X A;  3L29 A;  4B3R M;  2MGW A;  1KSF X;  3KSJ A;  1OAI A;  4QHS A;  5KQD A;  1NNU C;  1NJG A;  4IBF A;  3B7N A;  4IJE A;  3K1J A;  3L28 A;  4R71 A;  3PFI A;  1XNR M;  3KXE C;  4MGK E;  3HY5 A;  4PT5 A;  4DV4 M;  3J27 B;  5EP3 A;  1JR3 A;  2OOA A;  1QZE A;  4FWD A;  2Y0T A;  4LCB A;  4OU7 A;  4X66 M;  1DV0 A;  1I4W A;  2DAI A;  2HAK A;  3FRH A;  5EP2 A;  2R45 A;  1HT1 E;  4JYA M;  1QUT A;  1GVN A;  2BWE A;  2BWB A;  4LRT A;  2FOI C;  3KOW E;  2ZTD A;  3AOE C;  4A3V B;  1IN8 A;  3GPP A;  2QEN A;  3L27 A;  2XF3 A;  3TWM A;  2F5S A;  1YE9 A;  2RKO A;  3SYK A;  1TH2 A;  3BXW A;  3LVV A;  1PJJ A;  1QAO A;  2HWJ A;  2L4F A;  2XZF A;  4X62 M;  3IEC A;  1QAM A;  4DUZ M;  2LBC A;  4M0D A;  1IBK M;  4G6Z A;  3KVW A;  3CF0 A;  1UFZ A;  5KQ8 A;  4B08 A;  1PJQ A;  3KS8 A;  3T38 A;  3CF2 A;  4QNM A;  1Z59 A;  3TQS A;  4B7G A;  5KO3 A;  3IG5 A;  2C96 A;  2FS1 A;  4TUW A;  2M5Z A;  1G41 A;  3U6M A;  3SAV A;  1N32 M;  4DR6 M;  3UJN A;  2JY6 B;  2K6B A;  4B7H A;  1L2D A;  4B3T M;  2UXB M;  2K47 A;  4LJ4 A;  4JV5 M;  2CV2 A;  1GLN A;  2VQF M;  4LF8 M;  4JXJ A;  3HU2 A;  4UN2 B;  2CV1 A;  1PRB A;  3U60 B;  3B9P A;  2DWZ B;  3J7A S;  2F5O A;  1NNJ A;  3GPX A;  1XWI A;  3FTD A;  4M9Z A;  4NSO B;  3SC3 A;  4XK8 F;  4DV2 M;  2V1U A;  2KZU A;  2R4J A;  8CAT A;  1WHC A;  2JY5 A;  3BBZ A;  5FTK A;  4BB9 A;  3SAS A;  1N33 M;  3ILK A;  4I81 A;  3KOY E;  1K82 A;  2DZO B;  3ZQJ A;  5EXS A;  3FTE A;  2D7E A;  3HWS A;  1IM2 A;  3LQQ A;  2DAE A;  2M60 A;  3GQ4 A;  1XB2 B;  2L09 A;  4L6V 6;  3VKG A;  4DV0 M;  2EO2 A;  2Z4S A;  4G4R A;  3KP0 E;  4S12 A;  3PNV A;  4GH9 A;  5JI2 E;  3I4V A;  3CTW B;  1WIV A;  4LJ7 A;  4L16 A;  4IBJ A;  2QQ8 A;  1E9R A;  2DAM A;  2HKJ A;  3B7Q A;  2LHG A;  3SMP A;  3HU3 A;  2R18 A;  5DNY A;  1ZV1 A;  1ZMV A;  1BVS A;  3GO8 A;  3GP1 A;  2E5L M;  4MB7 A;  4IBB A;  1JQJ C;  2UUA M;  1T3T A;  3W0L B;  3LMM A;  1Q02 A;  2H1R A;  5GKN A;  1JR3 E;  5ITY A;  3HU1 A;  1V33 A;  1WGL A;  5FTN A;  3VLF B;  1T6O A;  2GNO A;  1GAB A;  1TDH A;  1I94 M;  1TR8 A;  5BPV A;  3U61 A;  3SFZ A;  4B3S M;  1HNW M;  4HLQ A;  1R5L A;  1VEK A;  2C98 A;  2A5Y B;  2CWB A;  4L4U A;  1TF0 B;  2D7G A;  3FYC A;  5FLX S;  5LMN M;  2YNM D;  1R6B X;  2LVN C;  4CIS A;  2DAK A;  1PGY A;  2KXE A;  3AOG A;  3CGW A;  2LVQ D;  1V92 A;  3AV0 A;  3I04 M;  3M7G A;  4Y28 F;  3D8L A;  2QSF X;  3HJS A;  5EXP A;  1OIZ A;  4DR4 M;  5F3W A;  4ITQ A;  1D0K A;  2JA2 A;  5DFL A;  3T15 A;  3LW5 F;  1OQY A;  3SHG B;  4I4L A;  3K9O A;  4NC6 A;  4JI7 M;  4JI8 M;  3M0E A;  2QZ4 A;  4GC9 A;  1A5T A;  3GLI B;  4L8R C;  1IN5 A;  1G71 A;  1QYR A;  2R65 A;  4LJA A;  2G3Q A;  2JP7 A;  2H5X A;  2C9O A;  3I4Y A;  3ZC7 B;  5ITU A;  2J7N A;  4LF4 M;  2Z8Y M;  1OJL A;  3FTC A;  3ZCB B;  5FTM A;  1GJT A;  2UUC M;  2DEN A;  2DWM A;  2L6O A;  4LGM A;  2L2D A;  2DKL A;  2KW0 A;  1J5E M;  1AIP C;  3HJQ A;  2LH0 A;  2EKF A;  2I7P A;  1TDZ A;  5EP4 A;  3T1H M;  4P17 A;  4JI1 M;  2MH8 A;  2O01 F;  1OAO C;  5KPZ A;  2HL7 A;  1Q39 A;  3UK6 A;  2UXC M;  3RGS A;  4NXN M;  2RGO A;  4ZPX A;  4KOD A;  3J2P B;  3LVW A;  4IIW A;  4DV1 M;  1XC8 A;  2HHH M;  2WSE F;  3RE8 A;  4DBG B;  3EIH A;  3TPZ A;  4IBG A;  5ITX A;  1SXJ D;  1PJT A;  2QNJ A;  4F2L A;  2F5N A;  2KEB A;  1VEJ A;  2XSZ D;  1SXJ C;  1LV7 A;  1NO1 A;  1R7R A;  3I51 A;  1KYI A;  1OKS A;  1GL7 A;  2DAG A;  3LCV B;  3TWK A;  3T1Y M;  1UM8 A;  2QP9 X;  2UXD M;  4YHH M;  2VII A;  2F5P A;  1QUS A;  2CEA A;  1HJP A;  1QZM A;  2LVP C;  3B74 A;  3GQ3 A;  3SBJ A;  4DV3 M;  3AOE A;  3U60 A;  4M9S A;  4MH0 E;  2FH0 A;  2KHH A;  2AHM A;  1V34 A;  2X4A A;  4X65 M;  4GMQ A;  2Y20 A;  2Q2E B;  3HX3 A;  3HZJ A;  4LFA M;  2OPF A;  4WP2 A;  4IBC A;  2CFO A;  3W67 A;  3U6P A;  3TWL A;  5KPT A;  5FSW A;  1QAQ A;  1DGB A;  5C1B A;  1K3W A;  2DWN A;  5ITT A;  1W5T A;  3GLI E;  1NVM A;  1DGG A;  4WUR A;  1IBL M;  4P16 A;  4GIP A;  2JY8 A;  1S3S A;  2MRO B;  3GLH B;  4FCT A;  3T6P A;  2K9D A;  1IXS B;  5EJC A;  3UMM A;  2KNV A;  2EUC A;  1XXH A;  1QVR A;  3C3D A;  3R8F A;  4B7F A;  3SAU A;  2X49 A;  3QAU A;  4W5W A;  2XGN A;  1IN7 A;  3J81 S;  2DHR A;  4LGY A;  1SXJ B;  1DGF A;  1VG5 A;  2BNK A;  2Y21 A;  3QWL A;  1L1Z A;  1GL6 A;  3GRY A;  2MJ5 B;  3NBI A;  4AZF A; 
#chains in the Genus database with same CATH homology
 2MH8 A;  1GJS A;  2JWS A;  1GJT A;  2KDL A;  1PRB A;  2LHG A;  2LHC A;  2N35 A;  2FS1 A;  2VDB B;  1TF0 B;  1GAB A;  2J5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...