2JWUA

Solution nmr structures of two designed proteins with 88% sequence identity but different fold and function
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAATAEKYFKLYANAKTVEGVWTYKDETKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gb88
publication title NMR structures of two designed proteins with high sequence identity but different fold and function
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 13
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jwuA00
1MI0A 5BMGA 2N9LA 1MHXA 4IKGA 5BMHA 1JMLA 1PGAA 2EELA 1K51A 2OEDA 2PLPA 2I2YA 2PW9A 2QSDA 2LGIA 4GLSC 1HEZE 5JXVA 4HJGE 5HI1A 2LUMA 2PTLA 2KWDA 4OZBA 2JSVX 3FILB 2JZPA 1P7FA 1D4BA 3FILA 1IBXB 1MVKA 1IBXA 3MP9A 5HHDG 4D2KA 4HKZE 4MACA 1K53A 1HZ6A 2JWUA 2JU6X 2KDMA 4IOIE 1K52A 1XF5L 2NMQA 2RPVA 1GB4A 2JXTA 1UWXA 2I38A 2ON8A 1IGDA 1FD6A 2KQ4X 1FCCC 4WH4A 1YNTE 1MPEA 2N9KA 2RMMA 2QMTA 1FCLA 4KGTA 1XCTL 2ONQA 2J53A 1IGCA 3GB1A 5HFYA 2J52A 4KGRA 2ZW0A 2IGDA 1GB1A 1P7EA 1MHHE 5HG2A 3V3XA 1EM7A 2IGGA 1F2RC 2KACA 2LHEA 5BMIA 1K50A 2IGHA 4KGSA 2ZW1A 4OZCA 2GB1A 1HZ5A 1XCQL 2LHDA 1Q10A 2K0PA 1PGBA 1YMHE 1ZXHA 2GI9A 1PGXA 3UI3A 1QKZA 2N7JA 1F2RI 2KN4A 4OZAA 1C9FA 1KH0A
chains in the Genus database with same CATH superfamily
1MI0A 3NRZA 5CHVC 4PYUA 2D11A 3VQIA 5LXHA 4MJSB 4NJCA 4JIOU 4KIKB 2PW9A 3QQ8B 2QC8A 3TEXA 1YQBA 2N7DA 2LGSA 1N6ZA 2NR2A 1T5XD 2CHWA 3PRZA 1J7AA 3AEDB 1MVKA 2K8HA 1RWSA 4G3XB 2PEAA 2N0SB 3ZDTA 5DPSA 1QT9A 3W5VB 1I4RA 2WP9B 4YTPB 2GBJA 2WXRA 4ICVA 3IHPC 5BO4B 4WJPA 5J17A 2FBWB 1I42A 1D6EC 1K52A 4JPSA 1TKGA 3KUDB 2RPVA 1C4CA 1RRBA 2N9PC 4E74A 2INCC 1QOFA 4HDOA 1MJDA 2N9KA 1H8CA 1EO6A 4LDTD 4N58A 2VZKB 3ZLZA 4HCNB 1OQYA 3DBLB 5MPOA 3ZXRA 3MTNB 2KQ7A 3TEWA 3N32A 4EEWA 3AE6B 2IO3B 4C56C 1X1MA 3ZJUA 3TJPA 2KACA 1TTNA 1Y56A 1ZDVA 3P63A 3VRBB 2WDVB 2I1JA 2JYEA 2MHJA 3HVDA 1PDXA 2KXJA 4A3OA 3AMZA 3QAQA 2XN9C 2MLBA 1Q10A 4A20A 4BBNC 2NBUA 3RNEC 3VTVA 4A3PA 2MEKA 1ZXIA 2WXFA 2WX0A 3ZRFA 4MDKE 2N7JA 3HRDD 1SSNA 2LVPA 2VRRB 3CSFA 2BYVE 2G3QB 3AH7A 1A70A 3PLVA 3FAHA 4LK0M 4A55A 5D7GA 2PMVA 3AN1A 3ZJTA 2DYOA 4ASWC 1KTKA 2I2YA 1IYFA 2YVCA 2OJWA 3NVWA 4W9IA 5HI1A 2BVCA 2KMCA 3PGEA 1VZ6A 1XD3B 1WX7A 3FILA 4PS3A 4J6IA 4C7YA 4DQOC 3URYA 4EUTA 3C0RB 3HM6X 2QCZA 4G50A 2LVQA 2DZMA 4YSYB 2JU6X 2D3CA 2KDMA 3DBHB 2IBIB 2W82A 3HK0A 4TMAB 4WJOA 1WIAA 4W9JA 3AU4A 4WH4A 1S1QB 2CHZA 3Q8CA 3I3TB 3WALA 1ZUD2 2J52A 2WNMA 1WJUA 4JWSC 2KT7A 3K9PB 3JVZX 1NVID 1MG8A 5HG2A 1SXTA 3CIRB 1SIFA 3Q3FA 4EZKA 2K6QA 2H89B 3NVYA 2WLBA 1ZGUB 2OJRA 3AM9A 3AE4B 3DHGC 1UELA 3ZYYX 5FR3A 1PGBA 2KX0A 4FJZA 1WYGA 1ESFA 4PS8A 3Q3JA 1N5WA 2WXLA 1TZOA 2E6XA 2LASA 4KSKC 4KKIA 3VRAB 3ZVVA 1NYQA 2JZ3B 2X38A 4ZRPA 3NJTA 4BKSD 2CHXA 2WXOA 1GC7A 3BK1A 2WXPA 2PTLA 1P98A 1TT5B 2Z59B 3RYTA 3ZTCA 3DDCB 4BOSC 3MP9A 4R3DA 4F7ZA 4YSXB 1CMXB 3X23A 3K9OB 1K53A 1BXTA 3PREA 3DCGA 2G9HD 1LXDA 4PT5A 5G2NA 3IFWB 1XXGA 2JXTA 1RYJA 2K6DB 3HM3A 4BKTA 5DPRA 2LXCA 4HROA 3P4RB 2LFIA 3W5UB 4I6LB 1WGKA 5AEKB 1KF6B 4RCOA 1V5OA 4IWQA 4LNKA 3SFEB 3VUYA 3C19A 2LRUA 2UYZB 4RF1A 3Q2AC 4FHKA 2HJ8A 3B1LX 2ZW0A 1GB1A 1GG3A 4JX1C 1UWMA 1UBIA 4DDGD 2RGFA 5BYSA 2N9XA 1F2RC 2KOXA 3Q8EA 3LXFA 1NYRA 1FNWA 1V9JA 1K50A 3AU5A 2KTRA 2GRIA 2KHWB 2M17A 2WXHA 2G1EA 4AQ7A 1HZ5A 3U7DA 2MJ3A 5J2RA 4OVUA 4JE3B 2DAFA 4OW0A 2KLCA 4ITKA 4NNJB 5DCNA 1WF9A 3JW0X 2LUEA 1JRPA 3ALBA 2QIEB 5DPTA 4C4VA 1E8XA 4REZA 4MH0E 4MH8A 2Y5PA 1I4PA 4LNIA 2KKCA 2FCQA 5G5HA 3HVZA 1N61A 2UWQA 1L0VB 2LMCA 1I7HA 3D32A 2PPHA 4RGOS 1P7FA 1UBQA 2KDIA 2KD0A 1E10A 2B3AA 3SFDB 3ZW3A 4EZJA 4URKA 1XO3A 4HKZE 2LEKA 1WYWB 3VH4B 3UF8A 3UIPB 2G4SA 2CU1A 5IOIA 5BYRA 1B9RA 1YX5B 2MX2A 4WWPA 4FHJA 4II2B 4ZHOA 3AEFB 3RFZB 1WMHB 3KQ4A 3LDZE 1WY8A 2KQ4X 4W9LA 3GE3C 2N9EB 2M4NA 1L6UA 2QMTA 3O65B 3V62A 4II3B 2ONQA 1HTOA 3NVVA 3PZDA 1YX6B 3MFGA 1FM0D 2O6VD 2L0FA 1L0XB 2IGDA 4MELA 1VLBA 1P7EA 4YXDB 5LXIB 1ET6A 3SEBA 5CHWA 4US8A 2KQSA 3I63C 1CQVA 4LDTB 3Q3MC 5D6JB 5IP4D 1TGZB 1LO5D 3KH0A 1WE6A 2LRWA 3TL5A 4DBGA 3EA6A 3ZRCA 3NY5A 2KZRA 4XWTA 5E6JA 5FK9C 5LLIA 2V1YA 2RR9A 4IC7B 1FXTB 2M0XA 2GLSA 4BOZB 2DBYA 1V5TA 3NUHB 4A6QA 2BS3B 1JMLA 4UDUC 3N1XC 4LLGM 2K1FA 4NY0A 1N63A 1AN8A 1KRHA 2LUMA 4HKQA 2ZCCA 4JGHB 1XLPA 2RDHA 3BK2A 1E7PB 1YJJA 4TQ0A 1L6VA 2EKEC 4MACA 2BYTA 1HZ6A 4RGNA 1RM6C 1ZE3D 4IG7B 1HTQA 1AARA 1FO4A 3IBEA 2BYEA 2ZEQA 2RSUA 5TSSA 1GOZA 1UWXA 2IO1B 1FD6A 2BW2A 2JY6A 3SHQA 3BY4B 3M63B 1AYFA 2NVUI 2X8XX 3DWMA 4AJWA 2REXA 1E8YA 1KJTA 4HCPB 4FJVB 1XLQA 3SDLC 2Z0DB 4YTMB 4C00A 2Y5BB 3TIXA 3AXCA 4A90A 1ZDXA 1UH6A 2LWPA 2PKOA 1ZOYB 4W9HA 3PVLA 2DNFA 3PRMB 1FFVA 3A1QA 1OTRB 1V2YA 1NEKB 2QJLA 3EFUA 2DYBA 1J19A 2RDGA 3PV1A 4W9GA 1TS4A 2NBVB 1TBEA 2W54A 3RNCC 2IYDB 1J8CA 1WFYA 2MBHA 3RZFA 2IZVB 2PIAA 2QDFA 4ZHPA 1V1PB 1LGRA 3DHIC 3BVMA 1WE7A 2JYTA 4E71A 2JT4B 4RM9A 4HRSA 3IAM1 4XC2A 3I9V1 4MJSA 5J18A 5L83A 2MH7A 2BKRB 5JXVA 2KVZA 2L83A 3LYYA 3NOBA 2AQ3B 4OZBA 3Q69A 2XK5B 4ZYNA 2GBRA 2R2QA 2V3SA 1NI3A 1XEEA 2L7RA 3OG5A 2D07B 2D2QA 3A4RA 3BZDB 1ISNA 4MGZE 2KANA 2KN5A 1GAQB 2LGXA 2L32A 2MQJA 2I38A 4ANXA 2HTME 3MHSD 5JHBA 1ZP0B 3A9KA 5CHFA 2N7EA 3ZDMC 1FMAD 1C4PA 1F52A 4ICUA 2KTFA 3DVGY 3DWGC 1OQRA 2V3PA 4DHZE 1FRDA 1ZPSA 3QCAA 1UD7A 1E0ZA 5HFYA 3KLSX 2BKFA 5JZEB 2BS4B 2KYWA 1MHHE 2ZJDA 3GZNB 2IDYA 1E9MA 3RUIB 1JCKB 2DWQA 4S0RA 4WURA 2YEPB 4LCDE 1RLFA 2INPE 2LHDA 3TSSA 2V4IB 3NZ3A 3L08A 4WAFA 4WQOB 2JPHA 2FE8A 1F2RI 1YJ1A 2IY1B 1T0SC 2A5UA 1A5RA 3KWVA 1VDVA 1YN3A 4OVVA 3HHMA 3DQVA 1BT0A 2EMTA 2RDBC 3N20C 2AWTA 1D5ZC 4WJQA 3KWLA 3NVZA 2BB5A 2R2OA 4NZLB 3N3KB 1SBBB 1Q5WB 4M01A 3RD2A 1GUAB 1LQBA 2ZNVB 2WQYB 2HTHA 2V4LA 4FN2A 3Q8FA 4EZLA 2KMAA 3UINB 1FXIA 1TJEA 3MC9A 2K22A 3GE8C 1WX9A 1IP9A 2FAZA 2KC2A 4AWJA 3U30A 1XF5L 2RPQA 4DDID 3R7RA 2KJ6A 4B0MA 1GC6A 2Q5WD 3ZGZA 4TKNA 4TQ1A 2L1AA 1V81A 2EKIA 3AB5A 2KNBA 4IM0A 4OVZA 2V0GA 2ZVOA 2HE7A 4DXFA 3BINA 4GDLA 2WXIA 2KWCA 1D3ZA 2KWVB 2DZIA 3DHHC 2N1WA 4CQNA 2L3ZA 1Q1OA 3Q8BA 2KDFB 1C1YB 4CO7A 1JALA 2L8JA 3DBRB 5BMIA 4XX5A 3VUWA 1MG4A 2XBBC 1V86A 2K25A 5EDSA 2J42A 4KX6B 2ZW1A 2V3NA 2O2VB 4ANUA 5CX3A 3W1SC 3M95A 1LM8B 2WWZA 3MHZA 2FIFA 2O6VB 1ZXHA 1N62A 2UU7A 5IN7A 2WHIA 4GGQA 1JW9D 3W1SA 1WJ6A 1ROEA 1VJKA 4YSZB 4OZAA 2MBQA 4RMAA 5GXGB 1KH0A 3X0WA 2R61A 3PSEB 2K8CA 3PRPB 3KW5B 4GB9A 1T0YA 3BYYB 5D94A 1JRUA 4M0WB 4DWFA 2C7MB 3EHVA 3APFA 1OFFA 3NZUA 2LGYA 3VAWA 2JX5A 3VHTC 4S17A 4JQWC 4GLSC 3WAOA 3L10B 2BF8B 1WXQA 1WRDB 1PFDA 4W9FA 2Y5CA 4AP4C 1EWCA 1IBXB 1TZ1A 1R4MI 1TYGB 3VUXA 2JWUA 1FIQA 1JWSD 2XNAC 3M3JA 3T8MA 3APDA 2W3RA 3Q3NC 3Q6BA 1SJED 3T3OA 2WXJA 3QJZA 3R7QA 1V97A 2WDQB 1QILA 2WDRB 5G5GA 5TR5A 1FCCC 3VXWA 1WSPA 3QC8B 4ANVA 3O13A 4FADA 3BWUD 2MP2A 2M56B 2L52A 2J53A 2FNJB 4B9KA 2FCMA 3RMKC 3ENEA 1FFUA 1SIJA 2KDBA 1XQQA 1SEBD 4LNFA 2WXQA 3V61A 3RNGC 4CYEA 2WX1A 5EE0A 1BMLC 1IUEA 1P0RA 3UQAA 2IGHA 2MJEA 1HE8A 4JLCA 2ACZB 1KM7A 2GB1A 4TV3A 1JWUD 2BWFA 1EU3A 2K0PA 3M62B 2JF5A 2LGDA 4HK2A 3NG0A 1C79A 3V6EB 1P3QU 1WX8A 3UI3A 4IWOA 1FXAA 1V80A 3NZSA 1UF0A 2INNE 4K3BA 3TBLD 3AEAB 2N9LA 1WGYA 1UZXB 3VDZA 3AE3B 3VFKA 1PGAA 2JUOA 2TSSA 3NHEB 2OEDA 1SE9A 1J0GA 3N30A 3B08A 2LGIA 1UNSA 3RNBC 2KFKB 1L5PA 2BTEA 4L2YA 4P7IA 4IM3A 2KFJA 3AEBB 1E8WA 4ZRJA 1DGJA 4KZ0A 3P2BA 3IXSA 3N1ZC 4ARIA 2INDC 4D2KA 1Z5SB 5AZFA 5AUIA 5EE9A 4BKGA 2FCNA 2JQRB 3KYDD 4K7WA 5C3JB 3AE9B 4WWMA 3LB8C 3ZNHB 2AEHA 3DVGX 2KTRB 1ET9A 3P4SB 2JRHA 3ZIMA 2L05A 4NQKE 2LI5A 1XT9B 4LJOB 1U4AA 4WWNA 1DOYA 2EMSA 3BVGA 2NPTB 3V3XA 3S2AA 2IGGA 2C7NB 4KDLB 1WZ3A 3H7PB 1S3SG 4OZCA 4BBNF 2ASQA 3U7ZA 2C5LC 4FXCA 1WXAA 4AUQC 2BQQA 2PJHA 1QKZA 3IT4B 3TEZA 4W9CA 2C7HA 1F0ZA 1C76A 2KLGA 1SB3C 3ZJVA 4FJYA 3APCA 2GBMA 4NAWA 1VR9A 2MJDA 2CS4A 2JXXA 1HEZE 3MC8A 4P1CC 2L76A 1UGMA 3OLMD 4N59A 3PT2B 3WAPA 2NTTA 4GDKA 1GNUA 4K3CA 4XYCA 3CF6E 3Q14C 3NS1A 4IOIE 2OHFA 5C23A 1D5MC 1WRIA 2DYMA 5T8IA 2VH1A 2KX3A 3JSVB 1GPXA 2AYOB 2W3SA 1TKEA 2WXKA 1MPEA 3OJ3A 3FKYA 2QEJC 2PE9A 2QILA 1WZ0A 3JYUA 1XCTL 4ZYSA 4NJ7A 1YQ3B 4I6NB 3GB1A 1RFAA 2GMIC 3L17A 4WAAA 1WJ4A 1L4DB 4KVGB 4PS7A 4P1BC 2CKHB 3QX1A 3AI5A 4BFRA 3N9YC 2Z0EB 1FRRA 3IG3A 2MW5A 1ENFA 1TS2A 4AS1A 4YL8A 2K8BA 3SU8X 1C9FA 5IO9A 1EF5A 1KLGD 3MC0B 1F9JA 2JWZA 3OWEB 3A4SC 4CHKA 5AZHA 3GS2A 4MSMB 3HUIA 1KFYB 5BYQA 4I6PA 1YJIA 4M8MA 2LD9A 3PHXB 3AE8B 1R7SA 3QIJA 3QK0A 3RI7C 4MM3B 5JH5C 1I4HA 2J0MA 2KJRA 3IT6B 1QOBA 3KVFB 2K39A 4KIKA 4O1NA 4BKSA 3Q8AA 2NMQA 5GMVA 3VR9B 4DHJD 1IGDA 3A1QB 3R3MA 3V60A 1FCLA 3MJ5A 1F77A 2QHOA 3A9JB 1OEYA 4KGTA 1WGRA 1V1OA 5EE3A 3R66C 3RULA 2I1KA 1J7CA 4ANWA 2WS3B 4USAA 2PVGC 2HJ1A 1NI2A 3SD5A 1L7YA 2BYFA 5EE1A 3VTUA 1R4NI 2NCNA 4K7UA 4K81A 3B2FA 4XGAB 4F8CB 4KSLC 3FC4A 3TEYA 1XCQL 2K5PA 2ZVNA 1YN4A 3AE1B 4IDIA 3VH3B 4E3CA 1V49A 1NBFC 2W55A 2E3TA 2AX5A 2GI9A 3RPFC 2C9WB 3E9SA 2WXNA 3L54A 5AUKA 3ZKJC 1L4ZB 2DENB 4XE0A 2N1VA 2FUHB 3QWZB 1YN5A 1SF0A 1VCBA 3OAWA 1DOXA 2A4ZA 4IWPA 3UQBA 2BGFA 1BUIC 2ZNVC 3AE7B 3H8HA 4JWUC 5C1ZA 3A9KB 4B0EA 4Q2JA 2HDEA 2KC1A 3Q3OC 4DK5A 5HHDG 1L0YB 1E7UA 1TS3A 1VRAB 4JL9A 3AULA 2BB6A 2N4FA 1PQSA 2KWUB 3W9CB 2FIDA 4F1SA 1WR1A 5IA7A 2ZPYA 4ACFA 2W9NA 1I35A 1EUVB 2JVCA 1H4RA 1EF1A 3P42A 1YNTE 4RGMA 2HD5B 1P1AA 5AZGA 1SE4A 1VZ8A 2BPSA 4ZRIA 3ONSA 4BZAA 1T6BX 4G11A 3DOWA 4X57B 3AEGB 1B1ZA 1HA5A 5IAAC 3WAMA 2NBWB 4A9AA 2V9HA 2AL3A 3V05A 4WQMA 2DLBA 2WYQA 2D3GA 3C8YA 1E7VA 5D2MB 4KGSA 3HIZA 2BT6A 3ECIA 3PS6A 2O2VA 2G4DB 2LJIA 2O6VA 4YTNB 1M4VA 1KLUD 1QZEA 1YMHE 2PVOD 5H92C 4NAMA 1PYWD 4BVUC 2KAJA 4KV2A 1QOGA 5LNK1 4RH6A 1Q0WB 4GMVA 3GP7A 2J0KA 1K51A 2L0TA 4M0WA 1C78A 2PLPA 1C4AA 3R2TA 4YWGG 2QSDA 1WGHA 1YOVB 3P4PB 2MA9B 4ZOHC 2D10A 3H7SA 1XLNA 1CK1A 4HXDA 2KDEB 2KWDA 2JSVX 4IUMB 4FBJB 3FILB 3CWIA 2LVOA 1RAXA 2M8SA 3R8BA 2J0JA 3H1UA 1IBXA 4GDLB 4MT5A 4ZDVA 3BIID 2WXGA 1I4XA 1YD8U 2CJOA 4B95A 2IY0B 3ABVB 4KZCA 3QARA 5KHQA 1D5XC 3BYTB 1Z2MA 1SE2A 1WJNA 3DBSA 4MEMA 4FULA 2WU2B 4WIPA 2ZCBA 4M02A 4OHJA 2K9XA 2WGSA 1G6JA 4G0NB 3AEEB 4RF0A 3AV8A 1FNVA 1L2NA 4GOCA 1HQRD 1GJZA 3TMPB 3TCAA 3ETRA 1EM7A 1C77A 2WU5B 1I4GA 2SAKA 5FKAC 3SR6A 1E90A 2L00B 1WH3A 2PE6B 1AWDA 2VH2A 4FLHA 1HXYD 3R2IA 3PO0A 1WWTA 5CTRC 3QHTA 4J3OD 2M0AA 4US9A 3VVWB 4L23A 3KUCB 3H6NA 3ML9A 5E6NA 4C80A 1WGGA 3ZUNA 4GIVA 4EOYA 2K3UA 4YT0B 3MJWA 3U8ZA 1ZKHA 2BWES 4K1RB 5BMGA 1T3QA 3J9CA 1ACCA 3PPAA 4W9KA 4C7ZA 2JZZA 3ZXVA 1K8RB 4W9EA 2KFKA 3RN9C 2DAJA 3V6CB 1JWAD 3VR8B 5KHOA 4MGYE 1T0QC 2CJNA 5E6OA 2NTSA 3NS8A 1DOIA 2JZPA 2MP2B 1D4BA 2LJ5A 4KDIC 3EECA 2VZKD 3P4QB 1E6EB 2MWSB 1R4NB 4DHZB 4K7SA 2YEPF 1JWMD 4EFOA 4NQLB 4HVBA 4EKUA 3T3NA 1OQQA 5L95C 2JRIB 1GB4A 5JHAA 1VD2A 2DZJA 2ON8A 4HPPA 1EWYC 4WJNA 4MGKE 2IO2B 1EU4A 1YIWA 2ZPNA 4N6EB 4M8NA 4BAXA 4NJ6A 4HPMB 3AE2B 1P9DU 4XWWA 2C60A 3TUOA 3U4EG 3E56A 4KGRA 2AQ2B 3BVZA 1M94A 2XEWA 3KYCD 2AL6A 3EFCA 2WDTB 2FCSA 3ZNZB 2NPTA 4DHJB 2D3BA 1WMHA 3DPDA 2LHEA 3EC8A 3QA8A 4QAYA 3IVFA 4HPLB 4XDDA 3H7PA 2J4XA 3UIOB 1FPYA 3T9LA 1CJEA 2RD0A 1E8ZA 5I4DA 3IAS1 3DVNV 4TUUA 3GZNI 1UGJA 3CSTA 2CU3A 3OJ4B 5HKHA 1TY0A 2KJHB 1JWBD 4AJYB 1SE3A 3DBLI 2BS2B 4C4VB 2GBKA 1MHXA 1J7BA 1NENB 4RGTA 4M00A 4A8XC 1KOTA 5BMHA 1JROA 2KMMA 3PLUA 3AE5B 4RNAA 3ZNGC 1WXSA 2KK8A 4PK1A 2ZZPB 1V8CA 4XDCA 3LJ3A 3GOEA 3AECB 3WCQA 1V6EA 3KUZA 4LTUA 1IPGA 2IJ0A 1T0RC 1WGDA 1AW7A 2GOWA 3P1MA 1TKYA 3PTFC 1VZ7A 3RCZA 4NPNA 3U52E 1QF6A 4MSQB 3RNFC 2BBCA 1WR6E 1NDDA 4HDQA 4W9DA 3A33B 4EE2A 4MGIE 3PZ7A 3WIMA 1RFKA 1WXVA 4DXGA 2WXMA 3W2DA 4HJKA 1QOAA 1ZW7A 3L4PA 2NS5A 3JSVA 1DYQA 4HWIB 1FNUA 2MBBB 1PUTA 5IKCM 2RMMA 1N60A 4ARCA 2B76B 2D5GA 2DZKA 4H2AA 2KVRA 1IGCA 2J7QB 3WA0A 3ML8A 1F1HA 3RT3B 2M19A 4XZ4A 2IO0B 3ZNID 1FEHA 3N1YC 5D3DA 2M1MA 1OGWA 4KKJA 4GU2A 1I4QA 3PZ8A 3CMMB 3H9DA 4AOFA 1SJHD 3B9JA 1TIFA 1Y8RC 3DBHI 4NAWB 4GN1A 2DX5B 4ZRKA 1STEA 1UUPA 2H88B 4GSWA 1WM2A 2MBEA 3DBRI 4ZRQA 2G45B 1TY2A 1WM3A 3WANA 4RM8A 2D3AA 4GDKB 2DHZA 1N5XA 4IKGA 1SGHA 4L1BA 3W1YA 1TS5A 2EELA 2Z8LA 3I5JC 1R4MB 3ZO5B 4HJGE 3VTWA 4WWOA 1WI0A 2ICIA 1OEYJ 1V1PA 4LNOA 2FUG1 1MFWA 3ZTDA 3B0AA 3ZQ4A 4FA6A 2SEBD 3RZWC 4MM3A 1E5WA 2YLMA 2LZ6A 4HEA1 1C3TA 5D3IB 2GBNA 2OOBB 2MRPA 4B6WA 4TSSA 2Y3AA 3RNAC 2AQ1B 2XK5A 3L13A 4PYZA 3I57A 4LJPB 3A9JA 1JQ4A 5E6PA 1XLOA 2LXAA 1CZPA 3EGRA 2CR5A 3U2SC 1YQ4B 2MBOA 4HLEA 5H8YE 4LNNA 3PHWB 3B2GA 1QQRA 4IM2A 4DXAB 3L0WB 1KLVA 2IPKD 5C2TB 1QLBB 2KO3A 2MSED 1WXMA 5DPWA 3DVNU 4IW0A 1LFDA 3EUB2 3UGBB 4GXBA 1PGXA 4RFBA 2MCNB 5G55A 4N9F4 2KN4A 5FR6A 4P16A 3L16A 4P6VF
chains in the Genus database with same CATH topology
1MI0A 3NRZA 3AEAB 2N9LA 3NUHB 3AE3B 4A6QA 2BS3B 1JMLA 1PGAA 3GP7A 2TSSA 1K51A 3VQIA 2OEDA 4M0WA 4NJCA 4UDUC 1C78A 2PLPA 1C4AA 3R2TA 4YWGG 2PW9A 2QSDA 2LGIA 1UNSA 4LLGM 3TEXA 3P4PB 1L5PA 4ZOHC 1N63A 1AN8A 1XLNA 1KRHA 2BTEA 1CK1A 2LUMA 4L2YA 2KWDA 4HKQA 3AEBB 2JSVX 1T5XD 1J7AA 3AEDB 3CWIA 1XLPA 2RDHA 3BK2A 3FILB 1DGJA 1MVKA 3R8BA 3IXSA 1RWSA 1IBXA 1E7PB 1YJJA 4TQ0A 4ARIA 1L6VA 4GDLB 4MT5A 2N0SB 4D2KA 4MACA 2BYTA 1HZ6A 2WXGA 3BIID 1QT9A 1I4XA 3W5VB 1I4RA 5AUIA 2WP9B 5EE9A 4YTPB 4RGNA 2WXRA 1RM6C 2CJOA 1ZE3D 2JQRB 2FBWB 1D6EC 5C3JB 1FO4A 1K52A 3AE9B 3ABVB 4JPSA 1TKGA 4WWMA 2RPVA 1C4CA 1D5XC 3LB8C 3BYTB 5TSSA 1GOZA 1SE2A 1UWXA 1FD6A 2BW2A 1QOFA 1ET9A 3P4SB 2WU2B 4WIPA 2N9KA 4OHJA 4N58A 2K9XA 1AYFA 3DWMA 3AEEB 2VZKB 4RF0A 3AV8A 1XLQA 1FNVA 5MPOA 4YTMB 3TEWA 1HQRD 4A90A 1ZDXA 3AE6B 3ETRA 1DOYA 3BVGA 3V3XA 1EM7A 2IGGA 4C56C 1C77A 2WU5B 2PKOA 1I4GA 1ZOYB 2SAKA 3ZJUA 2KACA 1Y56A 1ZDVA 5FKAC 1FFVA 3SR6A 3P63A 3VRBB 2WDVB 1NEKB 2QJLA 2JYEA 3HVDA 1AWDA 1HXYD 1PDXA 3R2IA 3PO0A 1WWTA 4OZCA 4J3OD 2RDGA 3AMZA 2M0AA 3U7ZA 2XN9C 4US9A 1TS4A 1Q10A 2W54A 4L23A 4FXCA 2MEKA 1ZXIA 4C80A 2WXFA 2PIAA 1QKZA 2N7JA 3IT4B 3TEZA 2K3UA 3HRDD 1SSNA 1V1PB 4YT0B 4ZHPA 1F0ZA 1C76A 3AH7A 5BMGA 1A70A 3BVMA 1SB3C 3FAHA 4LK0M 2JYTA 1T3QA 4A55A 3J9CA 5D7GA 2PMVA 3ZJVA 1ACCA 4HRSA 3AN1A 3ZJTA 1VR9A 3IAM1 2DYOA 3I9V1 1KTKA 4C7ZA 2I2YA 2MJDA 2MH7A 3NVWA 1HEZE 5JXVA 5HI1A 2L83A 1JWAD 3LYYA 3VR8B 2AQ3B 4N59A 1VZ6A 3Q69A 4OZBA 2CJNA 2NTSA 1DOIA 2JZPA 1D4BA 3FILA 1NI3A 2NTTA 1XEEA 4C7YA 4DQOC 3URYA 2VZKD 3P4QB 1E6EB 3BZDB 4YSYB 2JU6X 2KDMA 2YEPF 1JWMD 2W82A 3NS1A 4IOIE 4TMAB 2OHFA 1GAQB 3T3NA 1D5MC 1OQQA 1WRIA 1GB4A 2L32A 2I38A 2DYMA 2ON8A 5T8IA 1EWYC 2HTME 1GPXA 2W3SA 1TKEA 1ZP0B 4WH4A 1FMAD 2WXKA 1EU4A 1MPEA 2QEJC 1C4PA 2QILA 4N6EB 3DWGC 1XCTL 3Q8CA 1OQRA 2V3PA 4ZYSA 1FRDA 1YQ3B 1ZPSA 3AE2B 3GB1A 4XWWA 1E0ZA 5HFYA 1ZUD2 3KLSX 2BS4B 2J52A 2WNMA 3TUOA 3U4EG 3E56A 4KGRA 4JWSC 2AQ2B 3BVZA 1L4DB 1NVID 1MHHE 5HG2A 1SXTA 3CIRB 2IDYA 2LHEA 1E9MA 1JCKB 2DWQA 4WURA 2H89B 2YEPB 3NVYA 4XDDA 2WLBA 2J4XA 2INPE 3AM9A 3N9YC 3AE4B 3ZYYX 1CJEA 5I4DA 3IAS1 1FRRA 2LHDA 5FR3A 3TSSA 2V4IB 1UGJA 1PGBA 1ENFA 3NZ3A 1TS2A 2CU3A 1WYGA 4AS1A 1ESFA 4WAFA 1TY0A 2FE8A 1F2RI 1N5WA 2WXLA 1JWBD 1TZOA 1C9FA 2E6XA 1KLGD 1SE3A 2BS2B 3KWVA 1VDVA 1MHXA 1YN3A 1J7BA 1NENB 4KKIA 4RGTA 3VRAB 4A8XC 3MC0B 5BMHA 1JROA 2KMMA 4RNAA 3AE5B 1NYQA 2X38A 1D5ZC 1V8CA 3KWLA 4XDCA 4ZRPA 3NVZA 3AECB 3OWEB 2BB5A 3WCQA 4LTUA 2WXOA 4NZLB 1SBBB 2IJ0A 3BK1A 1AW7A 3GS2A 2WXPA 2PTLA 3HUIA 3P1MA 1KFYB 1TKYA 5BYQA 1VZ7A 1YJIA 3U52E 1QF6A 3MP9A 2WQYB 4R3DA 4YSXB 3AE8B 1R7SA 2BBCA 3Q8FA 1K53A 1BXTA 4MM3B 1I4HA 1FXIA 3IT6B 1TJEA 4EE2A 1QOBA 2K22A 3PZ7A 4O1NA 2G9HD 1RFKA 4DXGA 4PT5A 3Q8AA 2WXMA 1XF5L 2NMQA 3W2DA 3VR9B 1XXGA 2JXTA 1RYJA 1IGDA 4B0MA 1QOAA 2Q5WD 3L4PA 3ZGZA 1DYQA 4HROA 1FNUA 4TQ1A 2L1AA 3P4RB 1PUTA 2EKIA 2LFIA 3AB5A 3W5UB 4OVZA 2RMMA 2V0GA 1N60A 1F77A 1WGKA 3MJ5A 2B76B 2D5GA 4ARCA 4DXFA 1FCLA 4KGTA 4H2AA 1KF6B 4RCOA 1V1OA 5EE3A 2WXIA 3SFEB 1IGCA 1J7CA 4RF1A 2M19A 2WS3B 4USAA 2PVGC 2ZW0A 1GB1A 4CQNA 1FEHA 1UWMA 4JX1C 3Q8BA 5D3DA 4KKJA 5BYSA 1I4QA 1JALA 1F2RC 3PZ8A 3Q8EA 5EE1A 3LXFA 1NYRA 5BMIA 1FNWA 1SJHD 3B9JA 1K50A 2GRIA 3B2FA 4NAWB 2J42A 4KX6B 2ZW1A 2V3NA 3FC4A 2WXHA 3TEYA 2G1EA 4AQ7A 1HZ5A 1STEA 1XCQL 1UUPA 2K5PA 2H88B 2MJ3A 3MHZA 1YN4A 4ZRQA 3AE1B 4JE3B 4IDIA 4OW0A 1TY2A 2W55A 1ZXHA 1N62A 2AX5A 2GI9A 2E3TA 3E9SA 4ITKA 3RPFC 2WXNA 1JW9D 5AUKA 3W1SA 1L4ZB 1ROEA 1VJKA 4YSZB 4XE0A 4OZAA 5GXGB 1JRPA 1KH0A 2R61A 4GDKB 2QIEB 1N5XA 1YN5A 1SF0A 4IKGA 4L1BA 3BYYB 4REZA 1TS5A 2EELA 1DOXA 4MH8A 2Y5PA 1OFFA 2Z8LA 2JX5A 1I4PA 4GLSC 5G5HA 4HJGE 3HVZA 1BUIC 1N61A 4JWUC 3AE7B 3H8HA 1L0VB 2LMCA 1WXQA 1I7HA 4B0EA 1PFDA 2HDEA 2ICIA 1P7FA 4Q2JA 2Y5CA 1V1PA 4RGOS 1EWCA 1IBXB 2FUG1 1E10A 3SFDB 1TYGB 5HHDG 1XO3A 1L0YB 3ZQ4A 4HKZE 2LEKA 2SEBD 1TS3A 1VRAB 2JWUA 1FIQA 1JWSD 2BB6A 2XNAC 5BYRA 4HEA1 2W3RA 3W9CB 1B9RA 4ZHOA 5D3IB 1SJED 3AEFB 3RFZB 3T3OA 3KQ4A 4TSSA 2Y3AA 2WXJA 2AQ1B 2KQ4X 1V97A 2WDQB 3P42A 1QILA 2WDRB 5G5GA 1FCCC 1WSPA 1YNTE 4RGMA 3O13A 3I57A 3BWUD 2M56B 1L6UA 2QMTA 2L52A 2ONQA 3NVVA 1SE4A 1VZ8A 2J53A 1JQ4A 2DBYA 1XLOA 1CZPA 1FFUA 1SIJA 3MFGA 3EGRA 1FM0D 1SEBD 1T6BX 3U2SC 1YQ4B 3AEGB 1L0XB 1B1ZA 2IGDA 2WXQA 1VLBA 1HA5A 5H8YE 1P7EA 4YXDB 1ET6A 5EE0A 3SEBA 3B2GA 4A9AA 1BMLC 4US8A 1IUEA 1QQRA 3V05A 4WQMA 2DLBA 2IGHA 1CQVA 2MJEA 3C8YA 2IPKD 5C2TB 1QLBB 4KGSA 2ACZB 2BT6A 2GB1A 1LO5D 1JWUD 1EU3A 3EA6A 2K0PA 2LJIA 4YTNB 1M4VA 3EUB2 1KLUD 1YMHE 2PVOD 5H92C 4XWTA 1PGXA 4RFBA 5E6JA 5FK9C 4NAMA 1C79A 1PYWD 2KAJA 3UI3A 1FXAA 1QOGA 2KN4A 5LNK1 4P16A 4RH6A 2INNE 4P6VF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MI0 A;  5BMG A;  2N9L A;  1MHX A;  4IKG A;  5BMH A;  1JML A;  1PGA A;  2EEL A;  1K51 A;  2OED A;  2PLP A;  2I2Y A;  2PW9 A;  2QSD A;  2LGI A;  4GLS C;  1HEZ E;  5JXV A;  4HJG E;  5HI1 A;  2LUM A;  2PTL A;  2KWD A;  4OZB A;  2JSV X;  3FIL B;  2JZP A;  1P7F A;  1D4B A;  3FIL A;  1IBX B;  1MVK A;  1IBX A;  3MP9 A;  5HHD G;  4D2K A;  4HKZ E;  4MAC A;  1K53 A;  1HZ6 A;  2JWU A;  2JU6 X;  2KDM A;  4IOI E;  1K52 A;  1XF5 L;  2NMQ A;  2RPV A;  1GB4 A;  2JXT A;  1UWX A;  2I38 A;  2ON8 A;  1IGD A;  1FD6 A;  2KQ4 X;  1FCC C;  4WH4 A;  1YNT E;  1MPE A;  2N9K A;  2RMM A;  2QMT A;  1FCL A;  4KGT A;  1XCT L;  2ONQ A;  2J53 A;  1IGC A;  3GB1 A;  5HFY A;  2J52 A;  4KGR A;  2ZW0 A;  2IGD A;  1GB1 A;  1P7E A;  1MHH E;  5HG2 A;  3V3X A;  1EM7 A;  2IGG A;  1F2R C;  2KAC A;  2LHE A;  5BMI A;  1K50 A;  2IGH A;  4KGS A;  2ZW1 A;  4OZC A;  2GB1 A;  1HZ5 A;  1XCQ L;  2LHD A;  1Q10 A;  2K0P A;  1PGB A;  1YMH E;  1ZXH A;  2GI9 A;  1PGX A;  3UI3 A;  1QKZ A;  2N7J A;  1F2R I;  2KN4 A;  4OZA A;  1C9F A;  1KH0 A; 
#chains in the Genus database with same CATH topology
 1MI0 A;  3NRZ A;  5CHV C;  4PYU A;  2D11 A;  3VQI A;  5LXH A;  4MJS B;  4NJC A;  4JIO U;  4KIK B;  2PW9 A;  3QQ8 B;  2QC8 A;  3TEX A;  1YQB A;  2N7D A;  2LGS A;  1N6Z A;  2NR2 A;  1T5X D;  2CHW A;  3PRZ A;  1J7A A;  3AED B;  1MVK A;  2K8H A;  1RWS A;  4G3X B;  2PEA A;  2N0S B;  3ZDT A;  5DPS A;  1QT9 A;  3W5V B;  1I4R A;  2WP9 B;  4YTP B;  2GBJ A;  2WXR A;  4ICV A;  3IHP C;  5BO4 B;  4WJP A;  5J17 A;  2FBW B;  1I42 A;  1D6E C;  1K52 A;  4JPS A;  1TKG A;  3KUD B;  2RPV A;  1C4C A;  1RRB A;  2N9P C;  4E74 A;  2INC C;  1QOF A;  4HDO A;  1MJD A;  2N9K A;  1H8C A;  1EO6 A;  4LDT D;  4N58 A;  2VZK B;  3ZLZ A;  4HCN B;  1OQY A;  3DBL B;  5MPO A;  3ZXR A;  3MTN B;  2KQ7 A;  3TEW A;  3N32 A;  4EEW A;  3AE6 B;  2IO3 B;  4C56 C;  1X1M A;  3ZJU A;  3TJP A;  2KAC A;  1TTN A;  1Y56 A;  1ZDV A;  3P63 A;  3VRB B;  2WDV B;  2I1J A;  2JYE A;  2MHJ A;  3HVD A;  1PDX A;  2KXJ A;  4A3O A;  3AMZ A;  3QAQ A;  2XN9 C;  2MLB A;  1Q10 A;  4A20 A;  4BBN C;  2NBU A;  3RNE C;  3VTV A;  4A3P A;  2MEK A;  1ZXI A;  2WXF A;  2WX0 A;  3ZRF A;  4MDK E;  2N7J A;  3HRD D;  1SSN A;  2LVP A;  2VRR B;  3CSF A;  2BYV E;  2G3Q B;  3AH7 A;  1A70 A;  3PLV A;  3FAH A;  4LK0 M;  4A55 A;  5D7G A;  2PMV A;  3AN1 A;  3ZJT A;  2DYO A;  4ASW C;  1KTK A;  2I2Y A;  1IYF A;  2YVC A;  2OJW A;  3NVW A;  4W9I A;  5HI1 A;  2BVC A;  2KMC A;  3PGE A;  1VZ6 A;  1XD3 B;  1WX7 A;  3FIL A;  4PS3 A;  4J6I A;  4C7Y A;  4DQO C;  3URY A;  4EUT A;  3C0R B;  3HM6 X;  2QCZ A;  4G50 A;  2LVQ A;  2DZM A;  4YSY B;  2JU6 X;  2D3C A;  2KDM A;  3DBH B;  2IBI B;  2W82 A;  3HK0 A;  4TMA B;  4WJO A;  1WIA A;  4W9J A;  3AU4 A;  4WH4 A;  1S1Q B;  2CHZ A;  3Q8C A;  3I3T B;  3WAL A;  1ZUD 2;  2J52 A;  2WNM A;  1WJU A;  4JWS C;  2KT7 A;  3K9P B;  3JVZ X;  1NVI D;  1MG8 A;  5HG2 A;  1SXT A;  3CIR B;  1SIF A;  3Q3F A;  4EZK A;  2K6Q A;  2H89 B;  3NVY A;  2WLB A;  1ZGU B;  2OJR A;  3AM9 A;  3AE4 B;  3DHG C;  1UEL A;  3ZYY X;  5FR3 A;  1PGB A;  2KX0 A;  4FJZ A;  1WYG A;  1ESF A;  4PS8 A;  3Q3J A;  1N5W A;  2WXL A;  1TZO A;  2E6X A;  2LAS A;  4KSK C;  4KKI A;  3VRA B;  3ZVV A;  1NYQ A;  2JZ3 B;  2X38 A;  4ZRP A;  3NJT A;  4BKS D;  2CHX A;  2WXO A;  1GC7 A;  3BK1 A;  2WXP A;  2PTL A;  1P98 A;  1TT5 B;  2Z59 B;  3RYT A;  3ZTC A;  3DDC B;  4BOS C;  3MP9 A;  4R3D A;  4F7Z A;  4YSX B;  1CMX B;  3X23 A;  3K9O B;  1K53 A;  1BXT A;  3PRE A;  3DCG A;  2G9H D;  1LXD A;  4PT5 A;  5G2N A;  3IFW B;  1XXG A;  2JXT A;  1RYJ A;  2K6D B;  3HM3 A;  4BKT A;  5DPR A;  2LXC A;  4HRO A;  3P4R B;  2LFI A;  3W5U B;  4I6L B;  1WGK A;  5AEK B;  1KF6 B;  4RCO A;  1V5O A;  4IWQ A;  4LNK A;  3SFE B;  3VUY A;  3C19 A;  2LRU A;  2UYZ B;  4RF1 A;  3Q2A C;  4FHK A;  2HJ8 A;  3B1L X;  2ZW0 A;  1GB1 A;  1GG3 A;  4JX1 C;  1UWM A;  1UBI A;  4DDG D;  2RGF A;  5BYS A;  2N9X A;  1F2R C;  2KOX A;  3Q8E A;  3LXF A;  1NYR A;  1FNW A;  1V9J A;  1K50 A;  3AU5 A;  2KTR A;  2GRI A;  2KHW B;  2M17 A;  2WXH A;  2G1E A;  4AQ7 A;  1HZ5 A;  3U7D A;  2MJ3 A;  5J2R A;  4OVU A;  4JE3 B;  2DAF A;  4OW0 A;  2KLC A;  4ITK A;  4NNJ B;  5DCN A;  1WF9 A;  3JW0 X;  2LUE A;  1JRP A;  3ALB A;  2QIE B;  5DPT A;  4C4V A;  1E8X A;  4REZ A;  4MH0 E;  4MH8 A;  2Y5P A;  1I4P A;  4LNI A;  2KKC A;  2FCQ A;  5G5H A;  3HVZ A;  1N61 A;  2UWQ A;  1L0V B;  2LMC A;  1I7H A;  3D32 A;  2PPH A;  4RGO S;  1P7F A;  1UBQ A;  2KDI A;  2KD0 A;  1E10 A;  2B3A A;  3SFD B;  3ZW3 A;  4EZJ A;  4URK A;  1XO3 A;  4HKZ E;  2LEK A;  1WYW B;  3VH4 B;  3UF8 A;  3UIP B;  2G4S A;  2CU1 A;  5IOI A;  5BYR A;  1B9R A;  1YX5 B;  2MX2 A;  4WWP A;  4FHJ A;  4II2 B;  4ZHO A;  3AEF B;  3RFZ B;  1WMH B;  3KQ4 A;  3LDZ E;  1WY8 A;  2KQ4 X;  4W9L A;  3GE3 C;  2N9E B;  2M4N A;  1L6U A;  2QMT A;  3O65 B;  3V62 A;  4II3 B;  2ONQ A;  1HTO A;  3NVV A;  3PZD A;  1YX6 B;  3MFG A;  1FM0 D;  2O6V D;  2L0F A;  1L0X B;  2IGD A;  4MEL A;  1VLB A;  1P7E A;  4YXD B;  5LXI B;  1ET6 A;  3SEB A;  5CHW A;  4US8 A;  2KQS A;  3I63 C;  1CQV A;  4LDT B;  3Q3M C;  5D6J B;  5IP4 D;  1TGZ B;  1LO5 D;  3KH0 A;  1WE6 A;  2LRW A;  3TL5 A;  4DBG A;  3EA6 A;  3ZRC A;  3NY5 A;  2KZR A;  4XWT A;  5E6J A;  5FK9 C;  5LLI A;  2V1Y A;  2RR9 A;  4IC7 B;  1FXT B;  2M0X A;  2GLS A;  4BOZ B;  2DBY A;  1V5T A;  3NUH B;  4A6Q A;  2BS3 B;  1JML A;  4UDU C;  3N1X C;  4LLG M;  2K1F A;  4NY0 A;  1N63 A;  1AN8 A;  1KRH A;  2LUM A;  4HKQ A;  2ZCC A;  4JGH B;  1XLP A;  2RDH A;  3BK2 A;  1E7P B;  1YJJ A;  4TQ0 A;  1L6V A;  2EKE C;  4MAC A;  2BYT A;  1HZ6 A;  4RGN A;  1RM6 C;  1ZE3 D;  4IG7 B;  1HTQ A;  1AAR A;  1FO4 A;  3IBE A;  2BYE A;  2ZEQ A;  2RSU A;  5TSS A;  1GOZ A;  1UWX A;  2IO1 B;  1FD6 A;  2BW2 A;  2JY6 A;  3SHQ A;  3BY4 B;  3M63 B;  1AYF A;  2NVU I;  2X8X X;  3DWM A;  4AJW A;  2REX A;  1E8Y A;  1KJT A;  4HCP B;  4FJV B;  1XLQ A;  3SDL C;  2Z0D B;  4YTM B;  4C00 A;  2Y5B B;  3TIX A;  3AXC A;  4A90 A;  1ZDX A;  1UH6 A;  2LWP A;  2PKO A;  1ZOY B;  4W9H A;  3PVL A;  2DNF A;  3PRM B;  1FFV A;  3A1Q A;  1OTR B;  1V2Y A;  1NEK B;  2QJL A;  3EFU A;  2DYB A;  1J19 A;  2RDG A;  3PV1 A;  4W9G A;  1TS4 A;  2NBV B;  1TBE A;  2W54 A;  3RNC C;  2IYD B;  1J8C A;  1WFY A;  2MBH A;  3RZF A;  2IZV B;  2PIA A;  2QDF A;  4ZHP A;  1V1P B;  1LGR A;  3DHI C;  3BVM A;  1WE7 A;  2JYT A;  4E71 A;  2JT4 B;  4RM9 A;  4HRS A;  3IAM 1;  4XC2 A;  3I9V 1;  4MJS A;  5J18 A;  5L83 A;  2MH7 A;  2BKR B;  5JXV A;  2KVZ A;  2L83 A;  3LYY A;  3NOB A;  2AQ3 B;  4OZB A;  3Q69 A;  2XK5 B;  4ZYN A;  2GBR A;  2R2Q A;  2V3S A;  1NI3 A;  1XEE A;  2L7R A;  3OG5 A;  2D07 B;  2D2Q A;  3A4R A;  3BZD B;  1ISN A;  4MGZ E;  2KAN A;  2KN5 A;  1GAQ B;  2LGX A;  2L32 A;  2MQJ A;  2I38 A;  4ANX A;  2HTM E;  3MHS D;  5JHB A;  1ZP0 B;  3A9K A;  5CHF A;  2N7E A;  3ZDM C;  1FMA D;  1C4P A;  1F52 A;  4ICU A;  2KTF A;  3DVG Y;  3DWG C;  1OQR A;  2V3P A;  4DHZ E;  1FRD A;  1ZPS A;  3QCA A;  1UD7 A;  1E0Z A;  5HFY A;  3KLS X;  2BKF A;  5JZE B;  2BS4 B;  2KYW A;  1MHH E;  2ZJD A;  3GZN B;  2IDY A;  1E9M A;  3RUI B;  1JCK B;  2DWQ A;  4S0R A;  4WUR A;  2YEP B;  4LCD E;  1RLF A;  2INP E;  2LHD A;  3TSS A;  2V4I B;  3NZ3 A;  3L08 A;  4WAF A;  4WQO B;  2JPH A;  2FE8 A;  1F2R I;  1YJ1 A;  2IY1 B;  1T0S C;  2A5U A;  1A5R A;  3KWV A;  1VDV A;  1YN3 A;  4OVV A;  3HHM A;  3DQV A;  1BT0 A;  2EMT A;  2RDB C;  3N20 C;  2AWT A;  1D5Z C;  4WJQ A;  3KWL A;  3NVZ A;  2BB5 A;  2R2O A;  4NZL B;  3N3K B;  1SBB B;  1Q5W B;  4M01 A;  3RD2 A;  1GUA B;  1LQB A;  2ZNV B;  2WQY B;  2HTH A;  2V4L A;  4FN2 A;  3Q8F A;  4EZL A;  2KMA A;  3UIN B;  1FXI A;  1TJE A;  3MC9 A;  2K22 A;  3GE8 C;  1WX9 A;  1IP9 A;  2FAZ A;  2KC2 A;  4AWJ A;  3U30 A;  1XF5 L;  2RPQ A;  4DDI D;  3R7R A;  2KJ6 A;  4B0M A;  1GC6 A;  2Q5W D;  3ZGZ A;  4TKN A;  4TQ1 A;  2L1A A;  1V81 A;  2EKI A;  3AB5 A;  2KNB A;  4IM0 A;  4OVZ A;  2V0G A;  2ZVO A;  2HE7 A;  4DXF A;  3BIN A;  4GDL A;  2WXI A;  2KWC A;  1D3Z A;  2KWV B;  2DZI A;  3DHH C;  2N1W A;  4CQN A;  2L3Z A;  1Q1O A;  3Q8B A;  2KDF B;  1C1Y B;  4CO7 A;  1JAL A;  2L8J A;  3DBR B;  5BMI A;  4XX5 A;  3VUW A;  1MG4 A;  2XBB C;  1V86 A;  2K25 A;  5EDS A;  2J42 A;  4KX6 B;  2ZW1 A;  2V3N A;  2O2V B;  4ANU A;  5CX3 A;  3W1S C;  3M95 A;  1LM8 B;  2WWZ A;  3MHZ A;  2FIF A;  2O6V B;  1ZXH A;  1N62 A;  2UU7 A;  5IN7 A;  2WHI A;  4GGQ A;  1JW9 D;  3W1S A;  1WJ6 A;  1ROE A;  1VJK A;  4YSZ B;  4OZA A;  2MBQ A;  4RMA A;  5GXG B;  1KH0 A;  3X0W A;  2R61 A;  3PSE B;  2K8C A;  3PRP B;  3KW5 B;  4GB9 A;  1T0Y A;  3BYY B;  5D94 A;  1JRU A;  4M0W B;  4DWF A;  2C7M B;  3EHV A;  3APF A;  1OFF A;  3NZU A;  2LGY A;  3VAW A;  2JX5 A;  3VHT C;  4S17 A;  4JQW C;  4GLS C;  3WAO A;  3L10 B;  2BF8 B;  1WXQ A;  1WRD B;  1PFD A;  4W9F A;  2Y5C A;  4AP4 C;  1EWC A;  1IBX B;  1TZ1 A;  1R4M I;  1TYG B;  3VUX A;  2JWU A;  1FIQ A;  1JWS D;  2XNA C;  3M3J A;  3T8M A;  3APD A;  2W3R A;  3Q3N C;  3Q6B A;  1SJE D;  3T3O A;  2WXJ A;  3QJZ A;  3R7Q A;  1V97 A;  2WDQ B;  1QIL A;  2WDR B;  5G5G A;  5TR5 A;  1FCC C;  3VXW A;  1WSP A;  3QC8 B;  4ANV A;  3O13 A;  4FAD A;  3BWU D;  2MP2 A;  2M56 B;  2L52 A;  2J53 A;  2FNJ B;  4B9K A;  2FCM A;  3RMK C;  3ENE A;  1FFU A;  1SIJ A;  2KDB A;  1XQQ A;  1SEB D;  4LNF A;  2WXQ A;  3V61 A;  3RNG C;  4CYE A;  2WX1 A;  5EE0 A;  1BML C;  1IUE A;  1P0R A;  3UQA A;  2IGH A;  2MJE A;  1HE8 A;  4JLC A;  2ACZ B;  1KM7 A;  2GB1 A;  4TV3 A;  1JWU D;  2BWF A;  1EU3 A;  2K0P A;  3M62 B;  2JF5 A;  2LGD A;  4HK2 A;  3NG0 A;  1C79 A;  3V6E B;  1P3Q U;  1WX8 A;  3UI3 A;  4IWO A;  1FXA A;  1V80 A;  3NZS A;  1UF0 A;  2INN E;  4K3B A;  3TBL D;  3AEA B;  2N9L A;  1WGY A;  1UZX B;  3VDZ A;  3AE3 B;  3VFK A;  1PGA A;  2JUO A;  2TSS A;  3NHE B;  2OED A;  1SE9 A;  1J0G A;  3N30 A;  3B08 A;  2LGI A;  1UNS A;  3RNB C;  2KFK B;  1L5P A;  2BTE A;  4L2Y A;  4P7I A;  4IM3 A;  2KFJ A;  3AEB B;  1E8W A;  4ZRJ A;  1DGJ A;  4KZ0 A;  3P2B A;  3IXS A;  3N1Z C;  4ARI A;  2IND C;  4D2K A;  1Z5S B;  5AZF A;  5AUI A;  5EE9 A;  4BKG A;  2FCN A;  2JQR B;  3KYD D;  4K7W A;  5C3J B;  3AE9 B;  4WWM A;  3LB8 C;  3ZNH B;  2AEH A;  3DVG X;  2KTR B;  1ET9 A;  3P4S B;  2JRH A;  3ZIM A;  2L05 A;  4NQK E;  2LI5 A;  1XT9 B;  4LJO B;  1U4A A;  4WWN A;  1DOY A;  2EMS A;  3BVG A;  2NPT B;  3V3X A;  3S2A A;  2IGG A;  2C7N B;  4KDL B;  1WZ3 A;  3H7P B;  1S3S G;  4OZC A;  4BBN F;  2ASQ A;  3U7Z A;  2C5L C;  4FXC A;  1WXA A;  4AUQ C;  2BQQ A;  2PJH A;  1QKZ A;  3IT4 B;  3TEZ A;  4W9C A;  2C7H A;  1F0Z A;  1C76 A;  2KLG A;  1SB3 C;  3ZJV A;  4FJY A;  3APC A;  2GBM A;  4NAW A;  1VR9 A;  2MJD A;  2CS4 A;  2JXX A;  1HEZ E;  3MC8 A;  4P1C C;  2L76 A;  1UGM A;  3OLM D;  4N59 A;  3PT2 B;  3WAP A;  2NTT A;  4GDK A;  1GNU A;  4K3C A;  4XYC A;  3CF6 E;  3Q14 C;  3NS1 A;  4IOI E;  2OHF A;  5C23 A;  1D5M C;  1WRI A;  2DYM A;  5T8I A;  2VH1 A;  2KX3 A;  3JSV B;  1GPX A;  2AYO B;  2W3S A;  1TKE A;  2WXK A;  1MPE A;  3OJ3 A;  3FKY A;  2QEJ C;  2PE9 A;  2QIL A;  1WZ0 A;  3JYU A;  1XCT L;  4ZYS A;  4NJ7 A;  1YQ3 B;  4I6N B;  3GB1 A;  1RFA A;  2GMI C;  3L17 A;  4WAA A;  1WJ4 A;  1L4D B;  4KVG B;  4PS7 A;  4P1B C;  2CKH B;  3QX1 A;  3AI5 A;  4BFR A;  3N9Y C;  2Z0E B;  1FRR A;  3IG3 A;  2MW5 A;  1ENF A;  1TS2 A;  4AS1 A;  4YL8 A;  2K8B A;  3SU8 X;  1C9F A;  5IO9 A;  1EF5 A;  1KLG D;  3MC0 B;  1F9J A;  2JWZ A;  3OWE B;  3A4S C;  4CHK A;  5AZH A;  3GS2 A;  4MSM B;  3HUI A;  1KFY B;  5BYQ A;  4I6P A;  1YJI A;  4M8M A;  2LD9 A;  3PHX B;  3AE8 B;  1R7S A;  3QIJ A;  3QK0 A;  3RI7 C;  4MM3 B;  5JH5 C;  1I4H A;  2J0M A;  2KJR A;  3IT6 B;  1QOB A;  3KVF B;  2K39 A;  4KIK A;  4O1N A;  4BKS A;  3Q8A A;  2NMQ A;  5GMV A;  3VR9 B;  4DHJ D;  1IGD A;  3A1Q B;  3R3M A;  3V60 A;  1FCL A;  3MJ5 A;  1F77 A;  2QHO A;  3A9J B;  1OEY A;  4KGT A;  1WGR A;  1V1O A;  5EE3 A;  3R66 C;  3RUL A;  2I1K A;  1J7C A;  4ANW A;  2WS3 B;  4USA A;  2PVG C;  2HJ1 A;  1NI2 A;  3SD5 A;  1L7Y A;  2BYF A;  5EE1 A;  3VTU A;  1R4N I;  2NCN A;  4K7U A;  4K81 A;  3B2F A;  4XGA B;  4F8C B;  4KSL C;  3FC4 A;  3TEY A;  1XCQ L;  2K5P A;  2ZVN A;  1YN4 A;  3AE1 B;  4IDI A;  3VH3 B;  4E3C A;  1V49 A;  1NBF C;  2W55 A;  2E3T A;  2AX5 A;  2GI9 A;  3RPF C;  2C9W B;  3E9S A;  2WXN A;  3L54 A;  5AUK A;  3ZKJ C;  1L4Z B;  2DEN B;  4XE0 A;  2N1V A;  2FUH B;  3QWZ B;  1YN5 A;  1SF0 A;  1VCB A;  3OAW A;  1DOX A;  2A4Z A;  4IWP A;  3UQB A;  2BGF A;  1BUI C;  2ZNV C;  3AE7 B;  3H8H A;  4JWU C;  5C1Z A;  3A9K B;  4B0E A;  4Q2J A;  2HDE A;  2KC1 A;  3Q3O C;  4DK5 A;  5HHD G;  1L0Y B;  1E7U A;  1TS3 A;  1VRA B;  4JL9 A;  3AUL A;  2BB6 A;  2N4F A;  1PQS A;  2KWU B;  3W9C B;  2FID A;  4F1S A;  1WR1 A;  5IA7 A;  2ZPY A;  4ACF A;  2W9N A;  1I35 A;  1EUV B;  2JVC A;  1H4R A;  1EF1 A;  3P42 A;  1YNT E;  4RGM A;  2HD5 B;  1P1A A;  5AZG A;  1SE4 A;  1VZ8 A;  2BPS A;  4ZRI A;  3ONS A;  4BZA A;  1T6B X;  4G11 A;  3DOW A;  4X57 B;  3AEG B;  1B1Z A;  1HA5 A;  5IAA C;  3WAM A;  2NBW B;  4A9A A;  2V9H A;  2AL3 A;  3V05 A;  4WQM A;  2DLB A;  2WYQ A;  2D3G A;  3C8Y A;  1E7V A;  5D2M B;  4KGS A;  3HIZ A;  2BT6 A;  3ECI A;  3PS6 A;  2O2V A;  2G4D B;  2LJI A;  2O6V A;  4YTN B;  1M4V A;  1KLU D;  1QZE A;  1YMH E;  2PVO D;  5H92 C;  4NAM A;  1PYW D;  4BVU C;  2KAJ A;  4KV2 A;  1QOG A;  5LNK 1;  4RH6 A;  1Q0W B;  4GMV A;  3GP7 A;  2J0K A;  1K51 A;  2L0T A;  4M0W A;  1C78 A;  2PLP A;  1C4A A;  3R2T A;  4YWG G;  2QSD A;  1WGH A;  1YOV B;  3P4P B;  2MA9 B;  4ZOH C;  2D10 A;  3H7S A;  1XLN A;  1CK1 A;  4HXD A;  2KDE B;  2KWD A;  2JSV X;  4IUM B;  4FBJ B;  3FIL B;  3CWI A;  2LVO A;  1RAX A;  2M8S A;  3R8B A;  2J0J A;  3H1U A;  1IBX A;  4GDL B;  4MT5 A;  4ZDV A;  3BII D;  2WXG A;  1I4X A;  1YD8 U;  2CJO A;  4B95 A;  2IY0 B;  3ABV B;  4KZC A;  3QAR A;  5KHQ A;  1D5X C;  3BYT B;  1Z2M A;  1SE2 A;  1WJN A;  3DBS A;  4MEM A;  4FUL A;  2WU2 B;  4WIP A;  2ZCB A;  4M02 A;  4OHJ A;  2K9X A;  2WGS A;  1G6J A;  4G0N B;  3AEE B;  4RF0 A;  3AV8 A;  1FNV A;  1L2N A;  4GOC A;  1HQR D;  1GJZ A;  3TMP B;  3TCA A;  3ETR A;  1EM7 A;  1C77 A;  2WU5 B;  1I4G A;  2SAK A;  5FKA C;  3SR6 A;  1E90 A;  2L00 B;  1WH3 A;  2PE6 B;  1AWD A;  2VH2 A;  4FLH A;  1HXY D;  3R2I A;  3PO0 A;  1WWT A;  5CTR C;  3QHT A;  4J3O D;  2M0A A;  4US9 A;  3VVW B;  4L23 A;  3KUC B;  3H6N A;  3ML9 A;  5E6N A;  4C80 A;  1WGG A;  3ZUN A;  4GIV A;  4EOY A;  2K3U A;  4YT0 B;  3MJW A;  3U8Z A;  1ZKH A;  2BWE S;  4K1R B;  5BMG A;  1T3Q A;  3J9C A;  1ACC A;  3PPA A;  4W9K A;  4C7Z A;  2JZZ A;  3ZXV A;  1K8R B;  4W9E A;  2KFK A;  3RN9 C;  2DAJ A;  3V6C B;  1JWA D;  3VR8 B;  5KHO A;  4MGY E;  1T0Q C;  2CJN A;  5E6O A;  2NTS A;  3NS8 A;  1DOI A;  2JZP A;  2MP2 B;  1D4B A;  2LJ5 A;  4KDI C;  3EEC A;  2VZK D;  3P4Q B;  1E6E B;  2MWS B;  1R4N B;  4DHZ B;  4K7S A;  2YEP F;  1JWM D;  4EFO A;  4NQL B;  4HVB A;  4EKU A;  3T3N A;  1OQQ A;  5L95 C;  2JRI B;  1GB4 A;  5JHA A;  1VD2 A;  2DZJ A;  2ON8 A;  4HPP A;  1EWY C;  4WJN A;  4MGK E;  2IO2 B;  1EU4 A;  1YIW A;  2ZPN A;  4N6E B;  4M8N A;  4BAX A;  4NJ6 A;  4HPM B;  3AE2 B;  1P9D U;  4XWW A;  2C60 A;  3TUO A;  3U4E G;  3E56 A;  4KGR A;  2AQ2 B;  3BVZ A;  1M94 A;  2XEW A;  3KYC D;  2AL6 A;  3EFC A;  2WDT B;  2FCS A;  3ZNZ B;  2NPT A;  4DHJ B;  2D3B A;  1WMH A;  3DPD A;  2LHE A;  3EC8 A;  3QA8 A;  4QAY A;  3IVF A;  4HPL B;  4XDD A;  3H7P A;  2J4X A;  3UIO B;  1FPY A;  3T9L A;  1CJE A;  2RD0 A;  1E8Z A;  5I4D A;  3IAS 1;  3DVN V;  4TUU A;  3GZN I;  1UGJ A;  3CST A;  2CU3 A;  3OJ4 B;  5HKH A;  1TY0 A;  2KJH B;  1JWB D;  4AJY B;  1SE3 A;  3DBL I;  2BS2 B;  4C4V B;  2GBK A;  1MHX A;  1J7B A;  1NEN B;  4RGT A;  4M00 A;  4A8X C;  1KOT A;  5BMH A;  1JRO A;  2KMM A;  3PLU A;  3AE5 B;  4RNA A;  3ZNG C;  1WXS A;  2KK8 A;  4PK1 A;  2ZZP B;  1V8C A;  4XDC A;  3LJ3 A;  3GOE A;  3AEC B;  3WCQ A;  1V6E A;  3KUZ A;  4LTU A;  1IPG A;  2IJ0 A;  1T0R C;  1WGD A;  1AW7 A;  2GOW A;  3P1M A;  1TKY A;  3PTF C;  1VZ7 A;  3RCZ A;  4NPN A;  3U52 E;  1QF6 A;  4MSQ B;  3RNF C;  2BBC A;  1WR6 E;  1NDD A;  4HDQ A;  4W9D A;  3A33 B;  4EE2 A;  4MGI E;  3PZ7 A;  3WIM A;  1RFK A;  1WXV A;  4DXG A;  2WXM A;  3W2D A;  4HJK A;  1QOA A;  1ZW7 A;  3L4P A;  2NS5 A;  3JSV A;  1DYQ A;  4HWI B;  1FNU A;  2MBB B;  1PUT A;  5IKC M;  2RMM A;  1N60 A;  4ARC A;  2B76 B;  2D5G A;  2DZK A;  4H2A A;  2KVR A;  1IGC A;  2J7Q B;  3WA0 A;  3ML8 A;  1F1H A;  3RT3 B;  2M19 A;  4XZ4 A;  2IO0 B;  3ZNI D;  1FEH A;  3N1Y C;  5D3D A;  2M1M A;  1OGW A;  4KKJ A;  4GU2 A;  1I4Q A;  3PZ8 A;  3CMM B;  3H9D A;  4AOF A;  1SJH D;  3B9J A;  1TIF A;  1Y8R C;  3DBH I;  4NAW B;  4GN1 A;  2DX5 B;  4ZRK A;  1STE A;  1UUP A;  2H88 B;  4GSW A;  1WM2 A;  2MBE A;  3DBR I;  4ZRQ A;  2G45 B;  1TY2 A;  1WM3 A;  3WAN A;  4RM8 A;  2D3A A;  4GDK B;  2DHZ A;  1N5X A;  4IKG A;  1SGH A;  4L1B A;  3W1Y A;  1TS5 A;  2EEL A;  2Z8L A;  3I5J C;  1R4M B;  3ZO5 B;  4HJG E;  3VTW A;  4WWO A;  1WI0 A;  2ICI A;  1OEY J;  1V1P A;  4LNO A;  2FUG 1;  1MFW A;  3ZTD A;  3B0A A;  3ZQ4 A;  4FA6 A;  2SEB D;  3RZW C;  4MM3 A;  1E5W A;  2YLM A;  2LZ6 A;  4HEA 1;  1C3T A;  5D3I B;  2GBN A;  2OOB B;  2MRP A;  4B6W A;  4TSS A;  2Y3A A;  3RNA C;  2AQ1 B;  2XK5 A;  3L13 A;  4PYZ A;  3I57 A;  4LJP B;  3A9J A;  1JQ4 A;  5E6P A;  1XLO A;  2LXA A;  1CZP A;  3EGR A;  2CR5 A;  3U2S C;  1YQ4 B;  2MBO A;  4HLE A;  5H8Y E;  4LNN A;  3PHW B;  3B2G A;  1QQR A;  4IM2 A;  4DXA B;  3L0W B;  1KLV A;  2IPK D;  5C2T B;  1QLB B;  2KO3 A;  2MSE D;  1WXM A;  5DPW A;  3DVN U;  4IW0 A;  1LFD A;  3EUB 2;  3UGB B;  4GXB A;  1PGX A;  4RFB A;  2MCN B;  5G55 A;  4N9F 4;  2KN4 A;  5FR6 A;  4P16 A;  3L16 A;  4P6V F; 
#chains in the Genus database with same CATH homology
 1MI0 A;  3NRZ A;  3AEA B;  2N9L A;  3NUH B;  3AE3 B;  4A6Q A;  2BS3 B;  1JML A;  1PGA A;  3GP7 A;  2TSS A;  1K51 A;  3VQI A;  2OED A;  4M0W A;  4NJC A;  4UDU C;  1C78 A;  2PLP A;  1C4A A;  3R2T A;  4YWG G;  2PW9 A;  2QSD A;  2LGI A;  1UNS A;  4LLG M;  3TEX A;  3P4P B;  1L5P A;  4ZOH C;  1N63 A;  1AN8 A;  1XLN A;  1KRH A;  2BTE A;  1CK1 A;  2LUM A;  4L2Y A;  2KWD A;  4HKQ A;  3AEB B;  2JSV X;  1T5X D;  1J7A A;  3AED B;  3CWI A;  1XLP A;  2RDH A;  3BK2 A;  3FIL B;  1DGJ A;  1MVK A;  3R8B A;  3IXS A;  1RWS A;  1IBX A;  1E7P B;  1YJJ A;  4TQ0 A;  4ARI A;  1L6V A;  4GDL B;  4MT5 A;  2N0S B;  4D2K A;  4MAC A;  2BYT A;  1HZ6 A;  2WXG A;  3BII D;  1QT9 A;  1I4X A;  3W5V B;  1I4R A;  5AUI A;  2WP9 B;  5EE9 A;  4YTP B;  4RGN A;  2WXR A;  1RM6 C;  2CJO A;  1ZE3 D;  2JQR B;  2FBW B;  1D6E C;  5C3J B;  1FO4 A;  1K52 A;  3AE9 B;  3ABV B;  4JPS A;  1TKG A;  4WWM A;  2RPV A;  1C4C A;  1D5X C;  3LB8 C;  3BYT B;  5TSS A;  1GOZ A;  1SE2 A;  1UWX A;  1FD6 A;  2BW2 A;  1QOF A;  1ET9 A;  3P4S B;  2WU2 B;  4WIP A;  2N9K A;  4OHJ A;  4N58 A;  2K9X A;  1AYF A;  3DWM A;  3AEE B;  2VZK B;  4RF0 A;  3AV8 A;  1XLQ A;  1FNV A;  5MPO A;  4YTM B;  3TEW A;  1HQR D;  4A90 A;  1ZDX A;  3AE6 B;  3ETR A;  1DOY A;  3BVG A;  3V3X A;  1EM7 A;  2IGG A;  4C56 C;  1C77 A;  2WU5 B;  2PKO A;  1I4G A;  1ZOY B;  2SAK A;  3ZJU A;  2KAC A;  1Y56 A;  1ZDV A;  5FKA C;  1FFV A;  3SR6 A;  3P63 A;  3VRB B;  2WDV B;  1NEK B;  2QJL A;  2JYE A;  3HVD A;  1AWD A;  1HXY D;  1PDX A;  3R2I A;  3PO0 A;  1WWT A;  4OZC A;  4J3O D;  2RDG A;  3AMZ A;  2M0A A;  3U7Z A;  2XN9 C;  4US9 A;  1TS4 A;  1Q10 A;  2W54 A;  4L23 A;  4FXC A;  2MEK A;  1ZXI A;  4C80 A;  2WXF A;  2PIA A;  1QKZ A;  2N7J A;  3IT4 B;  3TEZ A;  2K3U A;  3HRD D;  1SSN A;  1V1P B;  4YT0 B;  4ZHP A;  1F0Z A;  1C76 A;  3AH7 A;  5BMG A;  1A70 A;  3BVM A;  1SB3 C;  3FAH A;  4LK0 M;  2JYT A;  1T3Q A;  4A55 A;  3J9C A;  5D7G A;  2PMV A;  3ZJV A;  1ACC A;  4HRS A;  3AN1 A;  3ZJT A;  1VR9 A;  3IAM 1;  2DYO A;  3I9V 1;  1KTK A;  4C7Z A;  2I2Y A;  2MJD A;  2MH7 A;  3NVW A;  1HEZ E;  5JXV A;  5HI1 A;  2L83 A;  1JWA D;  3LYY A;  3VR8 B;  2AQ3 B;  4N59 A;  1VZ6 A;  3Q69 A;  4OZB A;  2CJN A;  2NTS A;  1DOI A;  2JZP A;  1D4B A;  3FIL A;  1NI3 A;  2NTT A;  1XEE A;  4C7Y A;  4DQO C;  3URY A;  2VZK D;  3P4Q B;  1E6E B;  3BZD B;  4YSY B;  2JU6 X;  2KDM A;  2YEP F;  1JWM D;  2W82 A;  3NS1 A;  4IOI E;  4TMA B;  2OHF A;  1GAQ B;  3T3N A;  1D5M C;  1OQQ A;  1WRI A;  1GB4 A;  2L32 A;  2I38 A;  2DYM A;  2ON8 A;  5T8I A;  1EWY C;  2HTM E;  1GPX A;  2W3S A;  1TKE A;  1ZP0 B;  4WH4 A;  1FMA D;  2WXK A;  1EU4 A;  1MPE A;  2QEJ C;  1C4P A;  2QIL A;  4N6E B;  3DWG C;  1XCT L;  3Q8C A;  1OQR A;  2V3P A;  4ZYS A;  1FRD A;  1YQ3 B;  1ZPS A;  3AE2 B;  3GB1 A;  4XWW A;  1E0Z A;  5HFY A;  1ZUD 2;  3KLS X;  2BS4 B;  2J52 A;  2WNM A;  3TUO A;  3U4E G;  3E56 A;  4KGR A;  4JWS C;  2AQ2 B;  3BVZ A;  1L4D B;  1NVI D;  1MHH E;  5HG2 A;  1SXT A;  3CIR B;  2IDY A;  2LHE A;  1E9M A;  1JCK B;  2DWQ A;  4WUR A;  2H89 B;  2YEP B;  3NVY A;  4XDD A;  2WLB A;  2J4X A;  2INP E;  3AM9 A;  3N9Y C;  3AE4 B;  3ZYY X;  1CJE A;  5I4D A;  3IAS 1;  1FRR A;  2LHD A;  5FR3 A;  3TSS A;  2V4I B;  1UGJ A;  1PGB A;  1ENF A;  3NZ3 A;  1TS2 A;  2CU3 A;  1WYG A;  4AS1 A;  1ESF A;  4WAF A;  1TY0 A;  2FE8 A;  1F2R I;  1N5W A;  2WXL A;  1JWB D;  1TZO A;  1C9F A;  2E6X A;  1KLG D;  1SE3 A;  2BS2 B;  3KWV A;  1VDV A;  1MHX A;  1YN3 A;  1J7B A;  1NEN B;  4KKI A;  4RGT A;  3VRA B;  4A8X C;  3MC0 B;  5BMH A;  1JRO A;  2KMM A;  4RNA A;  3AE5 B;  1NYQ A;  2X38 A;  1D5Z C;  1V8C A;  3KWL A;  4XDC A;  4ZRP A;  3NVZ A;  3AEC B;  3OWE B;  2BB5 A;  3WCQ A;  4LTU A;  2WXO A;  4NZL B;  1SBB B;  2IJ0 A;  3BK1 A;  1AW7 A;  3GS2 A;  2WXP A;  2PTL A;  3HUI A;  3P1M A;  1KFY B;  1TKY A;  5BYQ A;  1VZ7 A;  1YJI A;  3U52 E;  1QF6 A;  3MP9 A;  2WQY B;  4R3D A;  4YSX B;  3AE8 B;  1R7S A;  2BBC A;  3Q8F A;  1K53 A;  1BXT A;  4MM3 B;  1I4H A;  1FXI A;  3IT6 B;  1TJE A;  4EE2 A;  1QOB A;  2K22 A;  3PZ7 A;  4O1N A;  2G9H D;  1RFK A;  4DXG A;  4PT5 A;  3Q8A A;  2WXM A;  1XF5 L;  2NMQ A;  3W2D A;  3VR9 B;  1XXG A;  2JXT A;  1RYJ A;  1IGD A;  4B0M A;  1QOA A;  2Q5W D;  3L4P A;  3ZGZ A;  1DYQ A;  4HRO A;  1FNU A;  4TQ1 A;  2L1A A;  3P4R B;  1PUT A;  2EKI A;  2LFI A;  3AB5 A;  3W5U B;  4OVZ A;  2RMM A;  2V0G A;  1N60 A;  1F77 A;  1WGK A;  3MJ5 A;  2B76 B;  2D5G A;  4ARC A;  4DXF A;  1FCL A;  4KGT A;  4H2A A;  1KF6 B;  4RCO A;  1V1O A;  5EE3 A;  2WXI A;  3SFE B;  1IGC A;  1J7C A;  4RF1 A;  2M19 A;  2WS3 B;  4USA A;  2PVG C;  2ZW0 A;  1GB1 A;  4CQN A;  1FEH A;  1UWM A;  4JX1 C;  3Q8B A;  5D3D A;  4KKJ A;  5BYS A;  1I4Q A;  1JAL A;  1F2R C;  3PZ8 A;  3Q8E A;  5EE1 A;  3LXF A;  1NYR A;  5BMI A;  1FNW A;  1SJH D;  3B9J A;  1K50 A;  2GRI A;  3B2F A;  4NAW B;  2J42 A;  4KX6 B;  2ZW1 A;  2V3N A;  3FC4 A;  2WXH A;  3TEY A;  2G1E A;  4AQ7 A;  1HZ5 A;  1STE A;  1XCQ L;  1UUP A;  2K5P A;  2H88 B;  2MJ3 A;  3MHZ A;  1YN4 A;  4ZRQ A;  3AE1 B;  4JE3 B;  4IDI A;  4OW0 A;  1TY2 A;  2W55 A;  1ZXH A;  1N62 A;  2AX5 A;  2GI9 A;  2E3T A;  3E9S A;  4ITK A;  3RPF C;  2WXN A;  1JW9 D;  5AUK A;  3W1S A;  1L4Z B;  1ROE A;  1VJK A;  4YSZ B;  4XE0 A;  4OZA A;  5GXG B;  1JRP A;  1KH0 A;  2R61 A;  4GDK B;  2QIE B;  1N5X A;  1YN5 A;  1SF0 A;  4IKG A;  4L1B A;  3BYY B;  4REZ A;  1TS5 A;  2EEL A;  1DOX A;  4MH8 A;  2Y5P A;  1OFF A;  2Z8L A;  2JX5 A;  1I4P A;  4GLS C;  5G5H A;  4HJG E;  3HVZ A;  1BUI C;  1N61 A;  4JWU C;  3AE7 B;  3H8H A;  1L0V B;  2LMC A;  1WXQ A;  1I7H A;  4B0E A;  1PFD A;  2HDE A;  2ICI A;  1P7F A;  4Q2J A;  2Y5C A;  1V1P A;  4RGO S;  1EWC A;  1IBX B;  2FUG 1;  1E10 A;  3SFD B;  1TYG B;  5HHD G;  1XO3 A;  1L0Y B;  3ZQ4 A;  4HKZ E;  2LEK A;  2SEB D;  1TS3 A;  1VRA B;  2JWU A;  1FIQ A;  1JWS D;  2BB6 A;  2XNA C;  5BYR A;  4HEA 1;  2W3R A;  3W9C B;  1B9R A;  4ZHO A;  5D3I B;  1SJE D;  3AEF B;  3RFZ B;  3T3O A;  3KQ4 A;  4TSS A;  2Y3A A;  2WXJ A;  2AQ1 B;  2KQ4 X;  1V97 A;  2WDQ B;  3P42 A;  1QIL A;  2WDR B;  5G5G A;  1FCC C;  1WSP A;  1YNT E;  4RGM A;  3O13 A;  3I57 A;  3BWU D;  2M56 B;  1L6U A;  2QMT A;  2L52 A;  2ONQ A;  3NVV A;  1SE4 A;  1VZ8 A;  2J53 A;  1JQ4 A;  2DBY A;  1XLO A;  1CZP A;  1FFU A;  1SIJ A;  3MFG A;  3EGR A;  1FM0 D;  1SEB D;  1T6B X;  3U2S C;  1YQ4 B;  3AEG B;  1L0X B;  1B1Z A;  2IGD A;  2WXQ A;  1VLB A;  1HA5 A;  5H8Y E;  1P7E A;  4YXD B;  1ET6 A;  5EE0 A;  3SEB A;  3B2G A;  4A9A A;  1BML C;  4US8 A;  1IUE A;  1QQR A;  3V05 A;  4WQM A;  2DLB A;  2IGH A;  1CQV A;  2MJE A;  3C8Y A;  2IPK D;  5C2T B;  1QLB B;  4KGS A;  2ACZ B;  2BT6 A;  2GB1 A;  1LO5 D;  1JWU D;  1EU3 A;  3EA6 A;  2K0P A;  2LJI A;  4YTN B;  1M4V A;  3EUB 2;  1KLU D;  1YMH E;  2PVO D;  5H92 C;  4XWT A;  1PGX A;  4RFB A;  5E6J A;  5FK9 C;  4NAM A;  1C79 A;  1PYW D;  2KAJ A;  3UI3 A;  1FXA A;  1QOG A;  2KN4 A;  5LNK 1;  4P16 A;  4RH6 A;  2INN E;  4P6V F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...