2JX5A

Solution structure of the ubiquitin domain n-terminal to the s27a ribosomal subunit of giardia lamblia
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
MLVIVRLQDQTLPFELPAGARASQLSNLLSSSGMAFSLHTQGRVLSEAAELNDKMVIDAFVPADGAGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlUb(S27a)
publication title Sequence and structure evolved separately in a ribosomal ubiquitin variant
pubmed doi rcsb
source organism Giardia lamblia atcc 50803
molecule tags Ribosomal protein
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jx5A00
3NS1A 3AE7B 3SR6A 1CJEA 3HRDD 3B2FA 1ZUD2 3AE2B 4WWMA 2WU2B 1E6EB 3AE1B 1FXAA 1YJJA 5G5HA 1FO4A 2K22A 3VRAB 5AUKA 3KWLA 1DOXA 1DOIA 1GAQB 1KRHA 1NVID 2DBYA 3AE8B 1DGJA 3VRBB 1DOYA 2K5PA 2L83A 1T3QA 2PVGC 2W3SA 3CIRB 4N59A 1JRPA 2BT6A 2WDRB 3AE4B 1QT9A 1QOGA 1XLQA 1N62A 4HRSA 4YTPB 4YSZB 5MPOA 4YT0B 2WLBA 3ETRA 5EE9A 1N61A 1FIQA 3AEDB 3AEFB 1PFDA 3RPFC 3AEEB 1QF6A 4N6EB 1JWBD 1FXIA 2JX5A 2FBWB 2KAJA 4C7ZA 1AWDA 4US8A 1JROA 1V8CA 3NRZA 1N60A 3DWGC 4USAA 3LXFA 2Y5CA 1OFFA 2AX5A 1YQ4B 2BS4B 2MJ3A 3AE6B 3AMZA 1NYRA 3FC4A 5EE3A 1L5PA 1KFYB 1V97A 4YSYB 4YTNB 2M19A 2W54A 3B9JA 3HVZA 2CJNA 4N58A 1SB3C 2M56B 3AN1A 4A9AA 4ZHOA 2WU5B 1CZPA 2MH7A 1KF6B 1FRDA 1RM6C 1TYGB 4KX6B 1UWMA 4FXCA 3ZYYX 1QOBA 4YTMB 2HTME 1JALA 1J7CA 1OQQA 2PKOA 1RFKA 4HROA 3ABVB 4WQMA 1NEKB 1WWTA 1L6UA 2DWQA 2L52A 1E9MA 4JX1C 2PIAA 1RWSA 4LTUA 2PVOD 4ITKA 1ZOYB 3W5UB 1JW9D 1IUEA 1FFUA 1L0VB 3P63A 5GXGB 1A70A 2MJDA 2ACZB 4C7YA 2G1EA 1E10A 2QJLA 1JWAD 1TKYA 3L4PA 3P4QB 4YSXB 3AE5B 3VR8B 1SIJA 2JQRB 1QOFA 3AEBB 3AEGB 1XLOA 4ZOHC 2WS3B 1GPXA 2OHFA 3AE3B 3W9CB 3P4SB 1EWYC 3FAHA 1WRIA 1R7SA 2LEKA 1AYFA 1E7PB 1ZP0B 1VJKA 1PUTA 2E3TA 3AE9B 1J7AA 1TJEA 1ZXIA 3B2GA 2WDQB 3AV8A 5EE1A 2W55A 3SFDB 4YXDB 3SFEB 4JWSC 2WDVB 1SF0A 2W3RA 2H88B 1FFVA 3CWIA 1RYJA 3AM9A 4US9A 2B76B 3P1MA 3PO0A 1NENB 1N63A 3NVYA 2QIEB 1YQ3B 1QLBB 1B9RA 2BS2B 3WCQA 1F0ZA 3AB5A 4P6VF 4IDIA 2H89B 1WXQA 1YJIA 1FMAD 1L6VA 2EKIA 3DWMA 3P4RB 5G5GA 3BIID 3EUB2 5H92C 3VR9B 1N5XA 4ZHPA 1WYGA 1XLPA 3LB8C 1OQRA 2BS3B 3NVVA 1TKGA 2WP9B 3AH7A 5C2TB 1JQ4A 1ROEA 2CU3A 2Q5WD 2WQYB 2CJOA 1E0ZA 1VDVA 1PDXA 3AEAB 5H8YE 1TKEA 2KMMA 1NYQA 3HUIA 3NVZA 3W5VB 4C80A 1QOAA 1XO3A 1WGKA 5C3JB 1FM0D 1N5WA 1NI3A 1XLNA 2N0SB 3NVWA 2K9XA 3P4PB 3AECB 5EE0A 1FRRA 2MJEA 4JWUC 5AUIA 1VLBA 1I7HA 1J7BA
chains in the Genus database with same CATH superfamily
3AE7B 4IW0A 4NJ6A 2MLBA 3PREA 3NY5A 1FO4A 4PK1A 3VRAB 3KWLA 2QC8A 2MP2B 4HRSA 4YSZB 2J0KA 3ETRA 3RNBC 5LNK1 3ZUNA 4KDIC 1TY0A 4JIOU 4JGHB 4J3OD 1XF5L 2D07B 1GC6A 5EE3A 1RAXA 4AWJA 2Z8LA 4CYEA 4KIKB 1I4XA 1JRUA 2MX2A 2WU5B 2MH7A 3VVWB 2IO2B 4BOZB 1UWMA 2O6VA 5L95C 1ZW7A 4FJZA 3NZUA 3PRPB 1BT0A 3VDZA 5BMGA 2C5LC 2D3GA 2ACZB 1P1AA 2GB1A 4KSLC 4YSXB 2JT4B 3A9JA 3DHIC 1E90A 2J0JA 4OVZA 1E7UA 2WXKA 1J7AA 3BY4B 1L7YA 3CSTA 3V6EB 3DBLB 3U8ZA 1QILA 5HFYA 3ZNGC 1YQ3B 3C8YA 2C7NB 4AUQC 2BYFA 3Q69A 3TJPA 3VR9B 4S17A 4QAYA 2CU1A 1V9JA 3PSEB 1BMLC 1WF9A 4OZBA 1WYWB 1I4HA 4NAWB 3PVLA 1XLNA 3L13A 1TS4A 4XDCA 3QWZB 3N1XC 1IBXB 1C4PA 2NBWB 1TT5B 4WWMA 3ZTCA 4IC7B 5IO9A 3VUYA 1KJTA 2BKFA 4WH4A 2L83A 5C1ZA 3DVGX 1B9RA 4EZJA 3U7ZA 3AEFB 3RCZA 2J0MA 2KT7A 1SGHA 3E9SA 1E7VA 3R66C 2BYVE 1HEZE 3UF8A 1OTRB 3H7PA 1RM6C 4CQNA 4H2AA 2GMIC 1QOBA 4XDDA 3APDA 2KQ7A 3BVZA 1E9MA 4JX1C 2PIAA 4PT5A 1S3SG 3TEWA 4B6WA 2MA9B 2NPTA 1Y8RC 2HD5B 2KTRB 4R3DA 4RM9A 2XNAC 1EU3A 2K6QA 2Z0EB 2QMTA 4LNIA 2C60A 3SD5A 1HE8A 4RMAA 2PLPA 4M0WB 1MHXA 2LVOA 3TUOA 3PZDA 1UNSA 2W3RA 2H88B 2WXMA 1LGRA 1NENB 3U7DA 1VZ7A 4PS7A 3SU8X 3MC8A 3Q8BA 4D2KA 5GMVA 3AB5A 1Q10A 4NAMA 4HLEA 3ML9A 2IPKD 1N5XA 3LB8C 3V61A 3NUHB 3JSVA 3A1QA 2I38A 2KLCA 3EGRA 1H4RA 2R61A 3UINB 2MQJA 2L0FA 4OW0A 1ZPSA 1MG8A 3APFA 1VLBA 3HRDD 4KGRA 3W5UB 1J7BA 2EELA 1C3TA 2WXJA 1HXYD 2G4SA 2LGIA 3H8HA 5J17A 3MJ5A 4L23A 2BB5A 1OGWA 1EF5A 3GZNB 3SEBA 2D2QA 2MEKA 5JH5C 2BT6A 1WXAA 4N6EB 3URYA 1F2RC 1V8CA 3DWGC 1MHHE 1OFFA 1YQ4B 2DZKA 3AE6B 3DBRB 2FIFA 2N1VA 4M01A 3RZWC 2PE6B 1YN3A 2LGSA 4GDKB 1SE9A 5AEKB 2KMCA 1ZXHA 2JXXA 4NY0A 1T0RC 1TYGB 2IGGA 3Q14C 4BZAA 1WWTA 2K8HA 2IDYA 2K3UA 3OJ4B 1YJ1A 2KDBA 1A70A 3ZDMC 3Q3MC 3IVFA 5IN7A 2MWSB 5E6PA 5D3DA 2LEKA 1VJKA 2ZZPB 5DPWA 2WDQB 2ICIA 2KWCA 2W55A 4YXDB 1YD8U 2DLBA 4JWSC 1I4PA 3KUCB 4G0NB 3W2DA 4EFOA 2LFIA 1S1QB 4KSKC 1EU4A 3WAMA 2QHOA 2EKIA 2M0XA 2N9EB 2KO3A 2KFKA 2ZNVC 1D4BA 3BWUD 2PEAA 1HZ6A 3IT6B 3N1YC 1E0ZA 1R4MB 2IO1B 2NS5A 1CK1A 4ZRIA 3FILA 2WXHA 4JQWC 1ZE3D 1F9JA 1WMHA 5D7GA 3AE2B 1I7HA 2DYBA 3JVZX 4G50A 1CJEA 4RCOA 2L7RA 2CHWA 4K3CA 1D6EC 5AZGA 1FXAA 1VRAB 3QAQA 1WR1A 2WNMA 2JYTA 2KDFB 2KJ6A 4KGSA 2RPQA 4TMAB 1HTQA 2KVZA 2TSSA 2M0AA 2D3AA 1N61A 3NS8A 1WGDA 4BKSA 3ZDTA 1P98A 4WAFA 4KDLB 4JL9A 3APCA 1WX8A 5CHFA 3HIZA 1J0GA 3PHXB 5LXHA 4YTNB 2W54A 5D6JB 4NPNA 1GG3A 4ZHOA 1KTKA 2BWFA 1KF6B 4MM3B 4KX6B 4NQLB 4XZ4A 4LTUA 5JZEB 2PVOD 2N9KA 4GSWA 3W1SC 1JW9D 2EKEC 1FFUA 2NMQA 3RMKC 1YMHE 2MJDA 2X38A 2LWPA 3WAOA 3JW0X 3QHTA 4DWFA 4G11A 2Z59B 4LNFA 4BOSC 2YEPB 1Y56A 1FFVA 4ASWC 2DNFA 2WGSA 4P16A 2INNE 4MJSA 1SE2A 5H92C 1GOZA 3IXSA 1TS3A 3UIPB 3DQVA 3ZJUA 4EOYA 4W9FA 1Z2MA 2L05A 4W9GA 1M4VA 2V3NA 4EKUA 2KX0A 3OWEB 3WAPA 2KK8A 3FAHA 1EUVB 4ZDVA 4FJVB 3DVNV 4DXAB 1E6EB 3Q2AC 4II3B 3KQ4A 1C4CA 2KX3A 2GBKA 3AE8B 4FLHA 4M8MA 2OJWA 3K9PB 4DQOC 2I1JA 4MT5A 4YT0B 3RPFC 2WWZA 3I57A 3ZNHB 1C9FA 1YN4A 3QC8B 1XD3B 1FXIA 2LGXA 4HKZE 1GC7A 3MC0B 2JPHA 1JWSD 4DHZE 1YN5A 3L08A 2LASA 2MJ3A 1NYRA 1P9DU 1C77A 1TZ1A 4WAAA 3UIOB 3A9KA 2RDBC 4FXCA 1JALA 1OQQA 2XK5A 1RFKA 3H7SA 1IGCA 3DBHB 4ITKA 1ZOYB 4ARIA 1L0VB 3I5JC 3AEGB 4RF0A 2WS3B 2KYWA 3L17A 4XYCA 2DYOA 4GMVA 4PYUA 4IWOA 3RYTA 1E8XA 4L2YA 3RNGC 4NJCA 4P1BC 3TSSA 4W9KA 1RFAA 1YJIA 5G5GA 3P4RB 1PGAA 2PE9A 2Y3AA 1IGDA 2GRIA 2FNJB 1ET9A 3KYDD 1WJ4A 1OEYA 1JQ4A 2Q5WD 1Z5SB 3W5VB 5H8YE 2KMMA 4FBJB 2JWZA 2PW9A 2WXNA 3P4PB 1GUAB 1C1YB 1IPGA 2FCNA 5AUIA 4HKQA 2QDFA 2AL3A 3ZQ4A 3B2FA 4A20A 4TQ1A 2BYTA 5G5HA 5IAAC 2AQ1B 3EA6A 3LJ3A 2J7QB 3VRBB 2GBMA 4RGTA 3W1SA 4OZAA 3SR6A 4X57B 3Q3FA 4WWPA 4GGQA 2ZEQA 3PLUA 1MJDA 3ZXVA 2V0GA 5FK9C 1XXGA 2KTFA 3Q8FA 4LNNA 1UH6A 5D2MB 3BYTB 1KFYB 4LJOB 4YSYB 2CJNA 2IJ0A 2JZPA 1LM8B 1V1PB 2BGFA 3WIMA 2MBQA 5G2NA 3U52E 3P63A 1HA5A 2PTLA 3N3KB 4C7YA 2JVCA 4BBNC 4OZCA 3AE5B 2WXGA 4BFRA 3M63B 3ONSA 4IUMB 1E7PB 1PUTA 4GN1A 1TJEA 2XEWA 2DAFA 3QK0A 1R4NB 3CSFA 2C7MB 2DX5B 3L16A 2OOBB 2BS2B 3WCQA 4GLSC 2RR9A 3ZNZB 1VZ8A 1OEYJ 2BS3B 1YOVB 1KLUD 4CHKA 5E6JA 4C80A 3Q6BA 1EO6A 3UGBB 2K39A 4KVGB 4PYZA 3IBEA 1WGHA 3PLVA 3NS1A 1TTNA 1LXDA 3QARA 3OAWA 1U4AA 1ENFA 2WXIA 5CX3A 1SE3A 1T3QA 2PVGC 2QILA 3I3TB 4IWPA 2IYDB 3B0AA 1WGGA 1L4DB 1ZDVA 2ZPYA 1JWBD 2FBWB 4ACFA 1JROA 2LMCA 4GXBA 4GB9A 4BKTA 2RDGA 2M1MA 4MGZE 2XBBC 2KFKB 3NZ3A 4BVUC 4DHZB 3DBSA 3DVGY 3IFWB 1ZKHA 4MEMA 4EE2A 4WJNA 2L00B 1WMHB 4DXFA 1SIFA 4KGTA 3U30A 3VH4B 1D5ZC 3PGEA 1WZ3A 1I4RA 3KUDB 4F1SA 1XEEA 4FHJA 1IUEA 2K8BA 1VR9A 2G1EA 3T9LA 1SIJA 3AE3B 1JCKB 2AEHA 2LRUA 1R7SA 4K7WA 4J6IA 4C4VB 3MJWA 3N32A 3T3OA 3BINA 2ZVNA 3SFEB 3TIXA 5I4DA 2KACA 4OVVA 2ZCCA 3VHTC 1KLVA 2JYEA 1JWUD 3R2IA 3VXWA 4W9JA 1WIAA 4OVUA 1GNUA 2KNBA 1XLPA 3Q3JA 1WGYA 2CU3A 1L4ZB 2KD0A 2KZRA 2LD9A 3BZDB 1STEA 3DVNU 1NI3A 3QQ8B 3V3XA 2AWTA 2G3QB 1H8CA 1QZEA 2QSDA 2ZW0A 2L32A 2DZIA 1F1HA 2KMAA 3BK2A 4MSMB 4LK0M 3AE1B 3R7RA 3TBLD 3DPDA 3WALA 5AUKA 4KKJA 1X1MA 2CR5A 1DGJA 4ANUA 4N59A 3CIRB 2GBJA 1PGBA 1I4QA 1I42A 1IP9A 5MPOA 1HZ5A 3Q8CA 1WE7A 5EE9A 4MJSB 2LHDA 4US8A 4MDKE 1VCBA 3LXFA 1LO5D 2AX5A 4A3OA 1HTOA 3FC4A 2N7DA 2HE7A 2FCSA 1K53A 4A9AA 2M4NA 2I2YA 2KKCA 2MP2A 2IO0B 4RH6A 4HROA 2IZVB 4MELA 1V49A 5KHQA 3VQIA 1QKZA 3RN9C 1JWAD 3MHSD 4AQ7A 3V62A 2BQQA 1WRIA 1FPYA 2WXQA 4II2B 4KIKA 3NZSA 4W9EA 4XGAB 1KLGD 1F52A 5FR3A 3ALBA 4BKGA 3NVYA 2QIEB 5L83A 1WXSA 4P6VF 2MSED 2BTEA 1GB4A 3HHMA 3EUB2 1V6EA 1WYGA 5AZFA 4DK5A 1FD6A 4RGOS 2N9PC 2NTSA 5D3IB 5BMHA 1VD2A 3X0WA 4IKGA 3MC9A 2LJIA 3AECB 5CTRC 1FCCC 2FIDA 5J18A 3PV1A 4URKA 1D5XC 2A4ZA 3VUXA 3MFGA 4ZRPA 4DHJB 1KRHA 3H6NA 2N7JA 2WDRB 1XLQA 2KOXA 2KAJA 4W9HA 2KDMA 2N9LA 1OQYA 2NBVB 1IBXA 4BAXA 1FNUA 2JWUA 1L5PA 3RFZB 1KM7A 2FAZA 4JE3B 4WWNA 1C79A 1UGMA 3RD2A 2MBEA 3VTUA 4GIVA 2QJLA 2L0TA 4LNOA 4BBNF 3VR8B 3AEBB 1TIFA 1E8ZA 3DBLI 1WJ6A 3Q8EA 1SJED 4GDLB 4LNKA 3M95A 1WGRA 1ZXIA 4A8XC 2KVRA 3TEZA 1Q1OA 3AM9A 2D10A 1WM2A 2VZKB 2OEDA 4EEWA 5JHBA 3DWMA 4UDUC 4EZLA 2IBIB 3R8BA 4LDTB 2KTRA 4MH0E 3CF6E 4JPSA 4ANXA 1BXTA 3NVZA 3NOBA 2CKHB 4HPMB 3IHPC 1C78A 3O13A 3DCGA 4WQOB 4M0WA 5EE0A 1TS5A 5IP4D 4JWUC 2V9HA 3ML8A 4KKIA 1UBIA 1FXTB 4Q2JA 3PHWB 2KWUB 2K25A 4RGMA 2O6VB 2WLBA 1QF6A 2D3CA 1YIWA 2K0PA 2JX5A 2ON8A 1EWCA 2I1KA 4ANVA 3K9OB 3NRZA 1D5MC 5DPSA 3T3NA 4USAA 4RGNA 3A9JB 1TS2A 4FULA 4IOIE 2LVQA 2KHWB 2BS4B 3VAWA 3LDZE 1T0YA 1N6ZA 1WJNA 3KH0A 4WWOA 2LGDA 4LJPB 4FA6A 2INDC 4K3BA 1WXVA 3T8MA 2G9HD 2PKOA 4DHJD 2MBOA 1RLFA 4TQ0A 3PTFC 4W9LA 1E10A 4I6PA 1QOFA 3UQBA 2VRRB 3KLSX 2WDTB 4NZLB 1IYFA 1FNVA 1AYFA 1MG4A 3GB1A 5AZHA 2L1AA 2JF5A 4GDKA 2PPHA 3ZRFA 2LXCA 5HKHA 2N7EA 4K81A 3RNEC 3M3JA 2FCMA 2RSUA 2DYMA 4A90A 4M02A 1L2NA 4IDIA 1GB1A 1ACCA 4F8CB 3UQAA 2L76A 1F77A 1TKGA 2WP9B 2WXFA 3VTWA 4F7ZA 1PDXA 3U4EG 1TKEA 3IG3A 2G4DB 2HJ8A 5TSSA 1XCQL 2K9XA 1MFWA 2BYEA 1FRRA 3GZNI 3ZNID 1SBBB 2JZ3B 3Q3OC 3VUWA 1L0XB 2LJ5A 2WU2B 4O1NA 2L3ZA 5CHWA 3R7QA 1NI2A 3H7PB 2SAKA 1JRPA 1ZDXA 4C00A 1BUIC 1QOGA 3ZRCA 2IY0B 2V3PA 2VZKD 3DBRI 3L10B 1AWDA 3O65B 4LDTD 4E3CA 2NPTB 3KW5B 1Q0WB 2QCZA 2B3AA 4WURA 5D94A 2WYQA 4AOFA 1B1ZA 2REXA 1CZPA 4I6NB 3MHZA 4MSQB 3EFCA 1FRDA 2KC2A 1NEKB 2MHJA 1SSNA 1TGZB 3QCAA 3C19A 3JYUA 2R2QA 2NVUI 1I35A 2O6VD 3MP9A 3PRZA 1SJHD 1GPXA 5HHDG 2OHFA 1EWYC 2GBRA 2AQ3B 2V4IB 3A1QB 3JSVB 2INPE 3AE9B 4IM3A 1WY8A 2GLSA 3KWVA 1EM7A 4MM3A 1E5WA 3RUIB 4PS3A 3OLMD 4REZA 1R4MI 3UI3A 1WE6A 1UBQA 3H9DA 1OQRA 2K1FA 1K51A 3ZJTA 1MVKA 4K1RB 1YX5B 3B1LX 3AEAB 1NYQA 3HUIA 3TEXA 1K8RB 1WGKA 5C3JB 1N5WA 3J9CA 4NQKE 2KWVB 1WXMA 3ZVVA 1UF0A 1XCTL 3TCAA 4HDOA 3P2BA 2BVCA 3NJTA 1SEBD 2AYOB 2JRIB 4AS1A 3AE4B 1QT9A 4YTPB 4HJKA 2NTTA 2YLMA 4LCDE 1WX9A 1WZ0A 3DOWA 1UUPA 1M94A 1MPEA 3GP7A 2ZW1A 2UU7A 4MH8A 2O2VA 2DZJA 3A33B 1V80A 4NNJB 3B9JA 5G55A 1TY2A 3PT2B 2CHXA 2L8JA 3ZYYX 4YTMB 2KWDA 2ASQA 4HVBA 4GU2A 3ABVB 2JZZA 2FCQA 2KFJA 5LXIB 3KVFB 3ZW3A 1TKYA 2N1WA 1P7EA 1P7FA 3P4SB 3Q3NC 2ZJDA 4DDID 1V2YA 3FILB 1ZP0B 3N1ZC 2LXAA 1AARA 3BVMA 2V3SA 2V4LA 3AU5A 2A5UA 1J19A 2WDVB 2JSVX 1UGJA 2M8SA 3CWIA 2D11A 2B76B 3R2TA 1P3QU 1N63A 2VH1A 4KZ0A 3RULA 2DHZA 2BW2A 4TKNA 1FMAD 1V5TA 3BIID 1UZXB 3EC8A 1T6BX 4XWTA 3ZLZA 2J52A 3MTNB 3OJ3A 1T0QC 1TBEA 3NG0A 3A4SC 1VDVA 2D5GA 2IGHA 4B95A 1XO3A 3PZ8A 2MRPA 2J4XA 5JHAA 4S0RA 3VTVA 3WA0A 4YL8A 3GE8C 2Y5PA 5TR5A 2WXLA 2DENB 3RNAC 3VFKA 4MGIE 4LLGM 4HCNB 4K7UA 2K22A 1C76A 3HM6X 1JWMD 1DOIA 1NVID 2KC1A 1KH0A 2QEJC 1E8YA 5T8IA 4ZYNA 5EDSA 2RGFA 3CMMB 4WJOA 3ZTDA 2AQ2B 2Y5CA 4A6QA 2IO3B 3L0WB 3SDLC 2YEPF 2M56B 3DBHI 4KV2A 5BYQA 1CQVA 4AJWA 1FEHA 2Y5BB 3AXCA 2HTME 5C23A 4CO7A 1L6UA 4ZYSA 4GOCA 4TV3A 3HM3A 1WR6E 2KJHB 1WSPA 4IM0A 1V5OA 2C9WB 3L4PA 3P4QB 3IAM1 2JQRB 1XLOA 2ONQA 2K6DB 3W9CB 3RNFC 2SEBD 3S2AA 3ZXRA 2BKRB 4A55A 4DBGA 4FJYA 3I63C 1V1PA 2KDIA 1NBFC 4FHKA 2LUEA 4US9A 2RMMA 4A3PA 3PO0A 5HI1A 3HK0A 2CHZA 3WANA 2NBUA 3PRMB 2H89B 5CHVC 1L6VA 5BYRA 2INCC 1PYWD 1UD7A 2JY6A 2AL6A 2WXPA 3A4RA 3IT4B 5IA7A 5J2RA 4DDGD 2BF8B 2WX0A 2ZCBA 2OJRA 2WQYB 2JXTA 4FADA 4W9CA 4N9F4 3EECA 5FKAC 2N0SB 2KANA 3EFUA 4DXGA 4XWWA 2GOWA 3R3MA 3AH7A 3FKYA 3N20C 5DCNA 4B0MA 4E74A 2N9XA 3A9KB 3PPAA 1YJJA 1HQRD 1AN8A 2BPSA 4HJGE 1DOXA 1UELA 3QJZA 3ZGZA 2CS4A 5JXVA 4M00A 1UWXA 2IGDA 2XK5B 4ZRJA 1KOTA 1F0ZA 4HPLB 2WXRA 3AEDB 1PFDA 1V86A 2HDEA 2ZNVB 4ICVA 1N60A 3X23A 2PJHA 1JMLA 2G45B 2D3BA 4BKSD 2LI5A 2FUHB 1YQBA 2KN4A 3V60A 3AULA 2IY1B 4N58A 1SB3C 5DPRA 2R2OA 2RD0A 2RDHA 4MGYE 3PZ7A 3M62B 3GOEA 1FCLA 1J7CA 2UWQA 4PS8A 2KJRA 3U2SC 4WQMA 2DWQA 4B9KA 1RWSA 1V1OA 4NAWA 2LHEA 2GBNA 2FUG1 2PMVA 2K8CA 3HVDA 4RF1A 2HJ1A 3DHGC 1R4NI 1WH3A 4JLCA 2KQSA 4WJPA 2KN5A 5BYSA 5E6NA 3AU4A 4XC2A 4XX5A 4HDQA 1K52A 3SFDB 5EE1A 2FE8A 1ET6A 1SF0A 1P0RA 2BB6A 4AP4C 4K7SA 4P1CC 3H1UA 1QLBB 3D32A 4B0EA 2C7HA 1T5XD 2W9NA 1G6JA 2WXOA 4TUUA 4ZHPA 1NDDA 3I9V1 3ECIA 4ICUA 5C2TB 2WHIA 2ZVOA 1QOAA 3AI5A 1DYQA 4P7IA 2GI9A 3NVWA 4C4VA 2JUOA 5IOIA 2UYZB 5BO4B 4HEA1 5KHOA 1ZUD2 2MBBB 3B08A 1PGXA 1I4GA 3PS6A 2EMTA 2WX1A 1GAQB 4KZCA 1SXTA 5DPTA 1DOYA 4IWQA 3EHVA 2LRWA 2K5PA 2W3SA 4L1BA 4G3XB 3SHQA 1N62A 4ZRQA 2J42A 3AEEB 2MBHA 1SE4A 2MCNB 1AW7A 4W9IA 1E8WA 3RT3B 4HCPB 3AMZA 4RNAA 3E56A 2JRHA 3AN1A 1QQRA 1CMXB 4WJQA 3RNCC 4RM8A 3VH3B 2LGYA 3KYCD 3C0RB 4NJ7A 4ARCA 1FNWA 4HK2A 5GXGB 4EZKA 4E71A 3N9YC 1VZ6A 1WJUA 2XN9C 2HTHA 3V6CB 1J8CA 1RYJA 2KLGA 2O2VB 1ESFA 1XQQA 3P1MA 4OHJA 4TSSA 2MW5A 1K50A 1WXQA 2KQ4X 1V81A 3OG5A 3DHHC 1C4AA 3ENEA 3QA8A 2W82A 3W1YA 3NVVA 1WI0A 2Z0DB 2KDEB 4M8NA 4YWGG 3TL5A 1D3ZA 5HG2A 1GJZA 3ZJVA 1LQBA 3GE3C 3ZKJC 4ANWA 2LUMA 1XT9B 1WFYA 3RZFA 1PQSA 2RPVA 4FN2A 2EMSA 2DBYA 5IKCM 3ZIMA 3P42A 2BWES 4C56C 3TMPB 1FIQA 1RRBA 1TZOA 3N30A 1F2RI 4IG7B 1MI0A 2X8XX 4C7ZA 3BVGA 4AJYB 3NHEB 2NR2A 2E6XA 5E6OA 4ZRKA 1V97A 3GS2A 2M19A 3HVZA 2LZ6A 4WIPA 4EUTA 2BBCA 1T0SC 4HXDA 2YVCA 2LVPA 3TEYA 1YNTE 1Q5WB 4HPPA 4IM2A 2M17A 1ZGUB 4RFBA 2L52A 3L54A 2JU6X 3Q8AA 2V1YA 2N4FA 4XE0A 5LLIA 4HWIB 3LYYA 2ZPNA 4ZOHC 1LFDA 2DZMA 3DDCB 1ISNA 3RI7C 3BK1A 5FR6A 3QX1A 1WRDB 4MACA 2E3TA 2NCNA 3B2GA 3AV8A 1WX7A 3BYYB 2J53A 3IAS1 1EF1A 3V05A 4MGKE 2KXJA 1YX6B 4W9DA 1WM3A 2DAJA 3ZO5B 1ROEA 3KUZA 2CJOA 4GDLA 3QIJA 2VH2A 1L0YB 1FM0D 4I6LB 1A5RA 5BMIA 2MJEA
chains in the Genus database with same CATH topology
3AE7B 4LLGM 3MFGA 4ZRPA 1E6EB 3KQ4A 1FO4A 2K22A 3VRAB 1C76A 3KWLA 1C4CA 1JWMD 1DOIA 3AE8B 1KRHA 1NVID 4DQOC 1KH0A 2N7JA 2WDRB 4HRSA 1XLQA 2QEJC 4YSZB 4MT5A 4YT0B 3ETRA 3RPFC 3I57A 5T8IA 5LNK1 1C9FA 1YN4A 1FXIA 1TY0A 4HKZE 2KAJA 3MC0B 2KDMA 2N9LA 1JWSD 4J3OD 2AQ2B 1YN5A 1IBXA 2Y5CA 1XF5L 4A6QA 1FNUA 2MJ3A 1NYRA 5EE3A 2JWUA 1L5PA 1C77A 2YEPF 2Z8LA 3RFZB 2M56B 1I4XA 2WU5B 5BYQA 1CQVA 4JE3B 2MH7A 1FEHA 1UWMA 4FXCA 2HTME 1JALA 1OQQA 1RFKA 1L6UA 4ZYSA 1IGCA 1C79A 5BMGA 4ITKA 1ZOYB 4ARIA 1L0VB 1WSPA 2ACZB 2GB1A 2QJLA 3P4QB 3L4PA 4YSXB 3VR8B 3IAM1 2JQRB 3AEGB 3AEBB 4RF0A 1XLOA 2ONQA 2WS3B 4OVZA 3W9CB 3Q8EA 1SJED 2SEBD 4GDLB 2DYOA 2WXKA 4A55A 1J7AA 1ZXIA 1V1PA 4A8XC 3TEZA 4L2YA 3AM9A 4US9A 2RMMA 3PO0A 4NJCA 5HI1A 1QILA 5HFYA 1YQ3B 3C8YA 3TSSA 2H89B 2VZKB 3Q69A 2OEDA 1YJIA 5G5GA 1L6VA 3DWMA 3P4RB 4UDUC 1PYWD 1PGAA 5BYRA 3VR9B 2WXPA 2Y3AA 3IT4B 1IGDA 2GRIA 3R8BA 1ET9A 1JQ4A 2WQYB 2Q5WD 2JXTA 4JPSA 3W5VB 1BXTA 5H8YE 2KMMA 3NVZA 5FKAC 1BMLC 4OZBA 1I4HA 2PW9A 4NAWB 1C78A 1XLNA 2WXNA 2N0SB 3O13A 3P4PB 1TS4A 4XDCA 4M0WA 4DXGA 5EE0A 1TS5A 4XWWA 4JWUC 1IBXB 5AUIA 4HKQA 3AH7A 1C4PA 4KKIA 3ZQ4A 3B2FA 4B0MA 4WWMA 4TQ1A 4Q2JA 2BYTA 1YJJA 5G5HA 1HQRD 2AQ1B 1AN8A 3EA6A 4HJGE 4WH4A 1DOXA 3VRBB 3ZGZA 5JXVA 2L83A 4RGMA 4RGTA 1B9RA 1UWXA 2IGDA 3W1SA 4OZAA 3U7ZA 2WLBA 3SR6A 1QF6A 1F0ZA 2WXRA 3AEDB 3AEFB 1PFDA 2K0PA 2HDEA 2JX5A 2ON8A 1EWCA 3NRZA 1D5MC 1N60A 3T3NA 3E9SA 4USAA 4RGNA 1JMLA 5FK9C 2V0GA 4IOIE 1TS2A 1XXGA 3Q8FA 2BS4B 1HEZE 3BYTB 1KFYB 2KN4A 4YSYB 2CJNA 4N58A 1SB3C 2IJ0A 2JZPA 1V1PB 2RDHA 3PZ7A 1RM6C 4CQNA 4H2AA 1FCLA 1QOBA 4XDDA 1J7CA 2G9HD 2PKOA 3U2SC 4WQMA 2DWQA 3BVZA 1E9MA 4JX1C 2PIAA 1RWSA 1V1OA 4PT5A 4TQ0A 2LHEA 3U52E 3TEWA 2FUG1 2PMVA 3P63A 1HA5A 2PTLA 1E10A 4C7YA 3HVDA 4RF1A 4OZCA 3AE5B 2WXGA 4R3DA 1QOFA 3KLSX 4NZLB 2XNAC 1EU3A 5BYSA 1FNVA 1AYFA 2QMTA 3GB1A 1E7PB 2L1AA 1PUTA 1K52A 1TJEA 2PLPA 5EE1A 1MHXA 3SFDB 2FE8A 3TUOA 1ET6A 1UNSA 1SF0A 2W3RA 2H88B 2WXMA 2BB6A 1NENB 1VZ7A 2DYMA 4A90A 3Q8BA 4D2KA 1QLBB 2BS2B 3WCQA 3AB5A 4IDIA 4GLSC 1Q10A 4B0EA 4NAMA 1T5XD 1GB1A 2WXOA 4ZHPA 2IPKD 1ACCA 1N5XA 3I9V1 1VZ8A 3LB8C 2BS3B 1F77A 1TKGA 2WP9B 2WXFA 1KLUD 5C2TB 3NUHB 1PDXA 3U4EG 1TKEA 5E6JA 4C80A 2I38A 1QOAA 3EGRA 2R61A 1DYQA 2GI9A 3NVWA 5TSSA 1XCQL 2K9XA 4OW0A 1ZPSA 1FRRA 4KGRA 1VLBA 3HRDD 3W5UB 1J7BA 3NS1A 2EELA 4HEA1 1SBBB 1ZUD2 1L0XB 1PGXA 2WXJA 1HXYD 2WU2B 1I4GA 4O1NA 2LGIA 3H8HA 1ENFA 3MJ5A 2WXIA 4L23A 1SE3A 1GAQB 2BB5A 1SXTA 1DOYA 2K5PA 2W3SA 1T3QA 2PVGC 2QILA 2SAKA 2MEKA 3SEBA 1JRPA 1ZDXA 2BT6A 4L1BA 1BUIC 1QOGA 1N62A 2V3PA 1ZDVA 1L4DB 2VZKD 4ZRQA 2J42A 3AEEB 4N6EB 1JWBD 3URYA 1F2RC 2FBWB 1AWDA 1JROA 1V8CA 1SE4A 2LMCA 3DWGC 1AW7A 2RDGA 1MHHE 1OFFA 1YQ4B 3AE6B 3AMZA 3NZ3A 4RNAA 3E56A 4WURA 3AN1A 4EE2A 1YN3A 1B1ZA 4GDKB 1CZPA 1QQRA 1ZXHA 3MHZA 1FRDA 1TYGB 2IGGA 4DXFA 4KGTA 1NEKB 1WWTA 2IDYA 1SSNA 1D5ZC 1I4RA 2K3UA 4ARCA 1FNWA 1XEEA 3MP9A 1IUEA 5GXGB 1VR9A 1A70A 1SJHD 2G1EA 1SIJA 1GPXA 5HHDG 3N9YC 2OHFA 3AE3B 1JCKB 1VZ6A 1EWYC 2XN9C 5D3DA 2AQ3B 2V4IB 1R7SA 2LEKA 2INPE 1VJKA 3AE9B 3KWVA 1EM7A 2ICIA 2WDQB 2W55A 4YXDB 3T3OA 2DLBA 3SFEB 4JWSC 1I4PA 5I4DA 1RYJA 2KACA 1ESFA 3P1MA 3W2DA 4OHJA 4TSSA 2JYEA 2LFIA 1JWUD 3R2IA 4REZA 1EU4A 1K50A 1WXQA 2KQ4X 3UI3A 2EKIA 1C4AA 1XLPA 1OQRA 2W82A 3ZJTA 1K51A 1D4BA 3NVVA 1MVKA 3BWUD 1HZ6A 2CU3A 3IT6B 1L4ZB 1E0ZA 3AEAB 1CK1A 1NYQA 3HUIA 3TEXA 3FILA 1WGKA 2WXHA 3BZDB 1STEA 1ZE3D 4YWGG 1N5WA 1NI3A 3V3XA 5HG2A 5C3JB 3ZJVA 5D7GA 3J9CA 2QSDA 3AE2B 1I7HA 2ZW0A 2L32A 2LUMA 1CJEA 4RCOA 1D6EC 3BK2A 2RPVA 4LK0M 3AE1B 1FXAA 1VRAB 5AUKA 1XCTL 4KKJA 2WNMA 2JYTA 2DBYA 1DGJA 4N59A 1SEBD 3CIRB 4KGSA 1PGBA 1I4QA 4TMAB 3P42A 3AE4B 1QT9A 4AS1A 2TSSA 4YTPB 2M0AA 1HZ5A 5MPOA 3Q8CA 4C56C 5EE9A 1N61A 1FIQA 1TZOA 2NTTA 1F2RI 1MI0A 4C7ZA 2LHDA 4US8A 4WAFA 1UUPA 1MPEA 3GP7A 3BVGA 2ZW1A 4MH8A 3LXFA 2E6XA 1LO5D 2AX5A 3FC4A 1V97A 3GS2A 4YTNB 2M19A 2W54A 3B9JA 1K53A 3HVZA 4WIPA 2BBCA 4A9AA 3TEYA 1YNTE 4ZHOA 1KTKA 1TY2A 1KF6B 2I2YA 4MM3B 4KX6B 3ZYYX 4YTMB 2KWDA 4RH6A 4HROA 3ABVB 4RFBA 2L52A 2JU6X 4LTUA 3Q8AA 2PVOD 2N9KA 3VQIA 1JW9D 1QKZA 4XE0A 1FFUA 2NMQA 1YMHE 2MJDA 3LYYA 2X38A 1JWAD 1TKYA 4AQ7A 1P7EA 1P7FA 4ZOHC 3P4SB 1WRIA 3BK1A 3FILB 1ZP0B 2WXQA 4MACA 2E3TA 3BVMA 3B2GA 3AV8A 1KLGD 2YEPB 5FR3A 1Y56A 3BYYB 2WDVB 2JSVX 1UGJA 1FFVA 3CWIA 2J53A 2B76B 3IAS1 3R2TA 1N63A 3V05A 3NVYA 4P16A 2QIEB 2BW2A 4P6VF 2INNE 2BTEA 1GB4A 1SE2A 1FMAD 5H92C 1GOZA 3BIID 3EUB2 3IXSA 1TS3A 1T6BX 1WYGA 4XWTA 3ZJUA 2J52A 1FD6A 4RGOS 1ROEA 2CJOA 2NTSA 1VDVA 2D5GA 5D3IB 1M4VA 2IGHA 2V3NA 5BMHA 1XO3A 4IKGA 3PZ8A 1L0YB 2J4XA 1FM0D 3OWEB 2LJIA 3AECB 5BMIA 1FCCC 2Y5PA 2WXLA 2MJEA 3FAHA 1D5XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS1 A;  3AE7 B;  3SR6 A;  1CJE A;  3HRD D;  3B2F A;  1ZUD 2;  3AE2 B;  4WWM A;  2WU2 B;  1E6E B;  3AE1 B;  1FXA A;  1YJJ A;  5G5H A;  1FO4 A;  2K22 A;  3VRA B;  5AUK A;  3KWL A;  1DOX A;  1DOI A;  1GAQ B;  1KRH A;  1NVI D;  2DBY A;  3AE8 B;  1DGJ A;  3VRB B;  1DOY A;  2K5P A;  2L83 A;  1T3Q A;  2PVG C;  2W3S A;  3CIR B;  4N59 A;  1JRP A;  2BT6 A;  2WDR B;  3AE4 B;  1QT9 A;  1QOG A;  1XLQ A;  1N62 A;  4HRS A;  4YTP B;  4YSZ B;  5MPO A;  4YT0 B;  2WLB A;  3ETR A;  5EE9 A;  1N61 A;  1FIQ A;  3AED B;  3AEF B;  1PFD A;  3RPF C;  3AEE B;  1QF6 A;  4N6E B;  1JWB D;  1FXI A;  2JX5 A;  2FBW B;  2KAJ A;  4C7Z A;  1AWD A;  4US8 A;  1JRO A;  1V8C A;  3NRZ A;  1N60 A;  3DWG C;  4USA A;  3LXF A;  2Y5C A;  1OFF A;  2AX5 A;  1YQ4 B;  2BS4 B;  2MJ3 A;  3AE6 B;  3AMZ A;  1NYR A;  3FC4 A;  5EE3 A;  1L5P A;  1KFY B;  1V97 A;  4YSY B;  4YTN B;  2M19 A;  2W54 A;  3B9J A;  3HVZ A;  2CJN A;  4N58 A;  1SB3 C;  2M56 B;  3AN1 A;  4A9A A;  4ZHO A;  2WU5 B;  1CZP A;  2MH7 A;  1KF6 B;  1FRD A;  1RM6 C;  1TYG B;  4KX6 B;  1UWM A;  4FXC A;  3ZYY X;  1QOB A;  4YTM B;  2HTM E;  1JAL A;  1J7C A;  1OQQ A;  2PKO A;  1RFK A;  4HRO A;  3ABV B;  4WQM A;  1NEK B;  1WWT A;  1L6U A;  2DWQ A;  2L52 A;  1E9M A;  4JX1 C;  2PIA A;  1RWS A;  4LTU A;  2PVO D;  4ITK A;  1ZOY B;  3W5U B;  1JW9 D;  1IUE A;  1FFU A;  1L0V B;  3P63 A;  5GXG B;  1A70 A;  2MJD A;  2ACZ B;  4C7Y A;  2G1E A;  1E10 A;  2QJL A;  1JWA D;  1TKY A;  3L4P A;  3P4Q B;  4YSX B;  3AE5 B;  3VR8 B;  1SIJ A;  2JQR B;  1QOF A;  3AEB B;  3AEG B;  1XLO A;  4ZOH C;  2WS3 B;  1GPX A;  2OHF A;  3AE3 B;  3W9C B;  3P4S B;  1EWY C;  3FAH A;  1WRI A;  1R7S A;  2LEK A;  1AYF A;  1E7P B;  1ZP0 B;  1VJK A;  1PUT A;  2E3T A;  3AE9 B;  1J7A A;  1TJE A;  1ZXI A;  3B2G A;  2WDQ B;  3AV8 A;  5EE1 A;  2W55 A;  3SFD B;  4YXD B;  3SFE B;  4JWS C;  2WDV B;  1SF0 A;  2W3R A;  2H88 B;  1FFV A;  3CWI A;  1RYJ A;  3AM9 A;  4US9 A;  2B76 B;  3P1M A;  3PO0 A;  1NEN B;  1N63 A;  3NVY A;  2QIE B;  1YQ3 B;  1QLB B;  1B9R A;  2BS2 B;  3WCQ A;  1F0Z A;  3AB5 A;  4P6V F;  4IDI A;  2H89 B;  1WXQ A;  1YJI A;  1FMA D;  1L6V A;  2EKI A;  3DWM A;  3P4R B;  5G5G A;  3BII D;  3EUB 2;  5H92 C;  3VR9 B;  1N5X A;  4ZHP A;  1WYG A;  1XLP A;  3LB8 C;  1OQR A;  2BS3 B;  3NVV A;  1TKG A;  2WP9 B;  3AH7 A;  5C2T B;  1JQ4 A;  1ROE A;  2CU3 A;  2Q5W D;  2WQY B;  2CJO A;  1E0Z A;  1VDV A;  1PDX A;  3AEA B;  5H8Y E;  1TKE A;  2KMM A;  1NYQ A;  3HUI A;  3NVZ A;  3W5V B;  4C80 A;  1QOA A;  1XO3 A;  1WGK A;  5C3J B;  1FM0 D;  1N5W A;  1NI3 A;  1XLN A;  2N0S B;  3NVW A;  2K9X A;  3P4P B;  3AEC B;  5EE0 A;  1FRR A;  2MJE A;  4JWU C;  5AUI A;  1VLB A;  1I7H A;  1J7B A; 
#chains in the Genus database with same CATH topology
 3AE7 B;  4IW0 A;  4NJ6 A;  2MLB A;  3PRE A;  3NY5 A;  1FO4 A;  4PK1 A;  3VRA B;  3KWL A;  2QC8 A;  2MP2 B;  4HRS A;  4YSZ B;  2J0K A;  3ETR A;  3RNB C;  5LNK 1;  3ZUN A;  4KDI C;  1TY0 A;  4JIO U;  4JGH B;  4J3O D;  1XF5 L;  2D07 B;  1GC6 A;  5EE3 A;  1RAX A;  4AWJ A;  2Z8L A;  4CYE A;  4KIK B;  1I4X A;  1JRU A;  2MX2 A;  2WU5 B;  2MH7 A;  3VVW B;  2IO2 B;  4BOZ B;  1UWM A;  2O6V A;  5L95 C;  1ZW7 A;  4FJZ A;  3NZU A;  3PRP B;  1BT0 A;  3VDZ A;  5BMG A;  2C5L C;  2D3G A;  2ACZ B;  1P1A A;  2GB1 A;  4KSL C;  4YSX B;  2JT4 B;  3A9J A;  3DHI C;  1E90 A;  2J0J A;  4OVZ A;  1E7U A;  2WXK A;  1J7A A;  3BY4 B;  1L7Y A;  3CST A;  3V6E B;  3DBL B;  3U8Z A;  1QIL A;  5HFY A;  3ZNG C;  1YQ3 B;  3C8Y A;  2C7N B;  4AUQ C;  2BYF A;  3Q69 A;  3TJP A;  3VR9 B;  4S17 A;  4QAY A;  2CU1 A;  1V9J A;  3PSE B;  1BML C;  1WF9 A;  4OZB A;  1WYW B;  1I4H A;  4NAW B;  3PVL A;  1XLN A;  3L13 A;  1TS4 A;  4XDC A;  3QWZ B;  3N1X C;  1IBX B;  1C4P A;  2NBW B;  1TT5 B;  4WWM A;  3ZTC A;  4IC7 B;  5IO9 A;  3VUY A;  1KJT A;  2BKF A;  4WH4 A;  2L83 A;  5C1Z A;  3DVG X;  1B9R A;  4EZJ A;  3U7Z A;  3AEF B;  3RCZ A;  2J0M A;  2KT7 A;  1SGH A;  3E9S A;  1E7V A;  3R66 C;  2BYV E;  1HEZ E;  3UF8 A;  1OTR B;  3H7P A;  1RM6 C;  4CQN A;  4H2A A;  2GMI C;  1QOB A;  4XDD A;  3APD A;  2KQ7 A;  3BVZ A;  1E9M A;  4JX1 C;  2PIA A;  4PT5 A;  1S3S G;  3TEW A;  4B6W A;  2MA9 B;  2NPT A;  1Y8R C;  2HD5 B;  2KTR B;  4R3D A;  4RM9 A;  2XNA C;  1EU3 A;  2K6Q A;  2Z0E B;  2QMT A;  4LNI A;  2C60 A;  3SD5 A;  1HE8 A;  4RMA A;  2PLP A;  4M0W B;  1MHX A;  2LVO A;  3TUO A;  3PZD A;  1UNS A;  2W3R A;  2H88 B;  2WXM A;  1LGR A;  1NEN B;  3U7D A;  1VZ7 A;  4PS7 A;  3SU8 X;  3MC8 A;  3Q8B A;  4D2K A;  5GMV A;  3AB5 A;  1Q10 A;  4NAM A;  4HLE A;  3ML9 A;  2IPK D;  1N5X A;  3LB8 C;  3V61 A;  3NUH B;  3JSV A;  3A1Q A;  2I38 A;  2KLC A;  3EGR A;  1H4R A;  2R61 A;  3UIN B;  2MQJ A;  2L0F A;  4OW0 A;  1ZPS A;  1MG8 A;  3APF A;  1VLB A;  3HRD D;  4KGR A;  3W5U B;  1J7B A;  2EEL A;  1C3T A;  2WXJ A;  1HXY D;  2G4S A;  2LGI A;  3H8H A;  5J17 A;  3MJ5 A;  4L23 A;  2BB5 A;  1OGW A;  1EF5 A;  3GZN B;  3SEB A;  2D2Q A;  2MEK A;  5JH5 C;  2BT6 A;  1WXA A;  4N6E B;  3URY A;  1F2R C;  1V8C A;  3DWG C;  1MHH E;  1OFF A;  1YQ4 B;  2DZK A;  3AE6 B;  3DBR B;  2FIF A;  2N1V A;  4M01 A;  3RZW C;  2PE6 B;  1YN3 A;  2LGS A;  4GDK B;  1SE9 A;  5AEK B;  2KMC A;  1ZXH A;  2JXX A;  4NY0 A;  1T0R C;  1TYG B;  2IGG A;  3Q14 C;  4BZA A;  1WWT A;  2K8H A;  2IDY A;  2K3U A;  3OJ4 B;  1YJ1 A;  2KDB A;  1A70 A;  3ZDM C;  3Q3M C;  3IVF A;  5IN7 A;  2MWS B;  5E6P A;  5D3D A;  2LEK A;  1VJK A;  2ZZP B;  5DPW A;  2WDQ B;  2ICI A;  2KWC A;  2W55 A;  4YXD B;  1YD8 U;  2DLB A;  4JWS C;  1I4P A;  3KUC B;  4G0N B;  3W2D A;  4EFO A;  2LFI A;  1S1Q B;  4KSK C;  1EU4 A;  3WAM A;  2QHO A;  2EKI A;  2M0X A;  2N9E B;  2KO3 A;  2KFK A;  2ZNV C;  1D4B A;  3BWU D;  2PEA A;  1HZ6 A;  3IT6 B;  3N1Y C;  1E0Z A;  1R4M B;  2IO1 B;  2NS5 A;  1CK1 A;  4ZRI A;  3FIL A;  2WXH A;  4JQW C;  1ZE3 D;  1F9J A;  1WMH A;  5D7G A;  3AE2 B;  1I7H A;  2DYB A;  3JVZ X;  4G50 A;  1CJE A;  4RCO A;  2L7R A;  2CHW A;  4K3C A;  1D6E C;  5AZG A;  1FXA A;  1VRA B;  3QAQ A;  1WR1 A;  2WNM A;  2JYT A;  2KDF B;  2KJ6 A;  4KGS A;  2RPQ A;  4TMA B;  1HTQ A;  2KVZ A;  2TSS A;  2M0A A;  2D3A A;  1N61 A;  3NS8 A;  1WGD A;  4BKS A;  3ZDT A;  1P98 A;  4WAF A;  4KDL B;  4JL9 A;  3APC A;  1WX8 A;  5CHF A;  3HIZ A;  1J0G A;  3PHX B;  5LXH A;  4YTN B;  2W54 A;  5D6J B;  4NPN A;  1GG3 A;  4ZHO A;  1KTK A;  2BWF A;  1KF6 B;  4MM3 B;  4KX6 B;  4NQL B;  4XZ4 A;  4LTU A;  5JZE B;  2PVO D;  2N9K A;  4GSW A;  3W1S C;  1JW9 D;  2EKE C;  1FFU A;  2NMQ A;  3RMK C;  1YMH E;  2MJD A;  2X38 A;  2LWP A;  3WAO A;  3JW0 X;  3QHT A;  4DWF A;  4G11 A;  2Z59 B;  4LNF A;  4BOS C;  2YEP B;  1Y56 A;  1FFV A;  4ASW C;  2DNF A;  2WGS A;  4P16 A;  2INN E;  4MJS A;  1SE2 A;  5H92 C;  1GOZ A;  3IXS A;  1TS3 A;  3UIP B;  3DQV A;  3ZJU A;  4EOY A;  4W9F A;  1Z2M A;  2L05 A;  4W9G A;  1M4V A;  2V3N A;  4EKU A;  2KX0 A;  3OWE B;  3WAP A;  2KK8 A;  3FAH A;  1EUV B;  4ZDV A;  4FJV B;  3DVN V;  4DXA B;  1E6E B;  3Q2A C;  4II3 B;  3KQ4 A;  1C4C A;  2KX3 A;  2GBK A;  3AE8 B;  4FLH A;  4M8M A;  2OJW A;  3K9P B;  4DQO C;  2I1J A;  4MT5 A;  4YT0 B;  3RPF C;  2WWZ A;  3I57 A;  3ZNH B;  1C9F A;  1YN4 A;  3QC8 B;  1XD3 B;  1FXI A;  2LGX A;  4HKZ E;  1GC7 A;  3MC0 B;  2JPH A;  1JWS D;  4DHZ E;  1YN5 A;  3L08 A;  2LAS A;  2MJ3 A;  1NYR A;  1P9D U;  1C77 A;  1TZ1 A;  4WAA A;  3UIO B;  3A9K A;  2RDB C;  4FXC A;  1JAL A;  1OQQ A;  2XK5 A;  1RFK A;  3H7S A;  1IGC A;  3DBH B;  4ITK A;  1ZOY B;  4ARI A;  1L0V B;  3I5J C;  3AEG B;  4RF0 A;  2WS3 B;  2KYW A;  3L17 A;  4XYC A;  2DYO A;  4GMV A;  4PYU A;  4IWO A;  3RYT A;  1E8X A;  4L2Y A;  3RNG C;  4NJC A;  4P1B C;  3TSS A;  4W9K A;  1RFA A;  1YJI A;  5G5G A;  3P4R B;  1PGA A;  2PE9 A;  2Y3A A;  1IGD A;  2GRI A;  2FNJ B;  1ET9 A;  3KYD D;  1WJ4 A;  1OEY A;  1JQ4 A;  2Q5W D;  1Z5S B;  3W5V B;  5H8Y E;  2KMM A;  4FBJ B;  2JWZ A;  2PW9 A;  2WXN A;  3P4P B;  1GUA B;  1C1Y B;  1IPG A;  2FCN A;  5AUI A;  4HKQ A;  2QDF A;  2AL3 A;  3ZQ4 A;  3B2F A;  4A20 A;  4TQ1 A;  2BYT A;  5G5H A;  5IAA C;  2AQ1 B;  3EA6 A;  3LJ3 A;  2J7Q B;  3VRB B;  2GBM A;  4RGT A;  3W1S A;  4OZA A;  3SR6 A;  4X57 B;  3Q3F A;  4WWP A;  4GGQ A;  2ZEQ A;  3PLU A;  1MJD A;  3ZXV A;  2V0G A;  5FK9 C;  1XXG A;  2KTF A;  3Q8F A;  4LNN A;  1UH6 A;  5D2M B;  3BYT B;  1KFY B;  4LJO B;  4YSY B;  2CJN A;  2IJ0 A;  2JZP A;  1LM8 B;  1V1P B;  2BGF A;  3WIM A;  2MBQ A;  5G2N A;  3U52 E;  3P63 A;  1HA5 A;  2PTL A;  3N3K B;  4C7Y A;  2JVC A;  4BBN C;  4OZC A;  3AE5 B;  2WXG A;  4BFR A;  3M63 B;  3ONS A;  4IUM B;  1E7P B;  1PUT A;  4GN1 A;  1TJE A;  2XEW A;  2DAF A;  3QK0 A;  1R4N B;  3CSF A;  2C7M B;  2DX5 B;  3L16 A;  2OOB B;  2BS2 B;  3WCQ A;  4GLS C;  2RR9 A;  3ZNZ B;  1VZ8 A;  1OEY J;  2BS3 B;  1YOV B;  1KLU D;  4CHK A;  5E6J A;  4C80 A;  3Q6B A;  1EO6 A;  3UGB B;  2K39 A;  4KVG B;  4PYZ A;  3IBE A;  1WGH A;  3PLV A;  3NS1 A;  1TTN A;  1LXD A;  3QAR A;  3OAW A;  1U4A A;  1ENF A;  2WXI A;  5CX3 A;  1SE3 A;  1T3Q A;  2PVG C;  2QIL A;  3I3T B;  4IWP A;  2IYD B;  3B0A A;  1WGG A;  1L4D B;  1ZDV A;  2ZPY A;  1JWB D;  2FBW B;  4ACF A;  1JRO A;  2LMC A;  4GXB A;  4GB9 A;  4BKT A;  2RDG A;  2M1M A;  4MGZ E;  2XBB C;  2KFK B;  3NZ3 A;  4BVU C;  4DHZ B;  3DBS A;  3DVG Y;  3IFW B;  1ZKH A;  4MEM A;  4EE2 A;  4WJN A;  2L00 B;  1WMH B;  4DXF A;  1SIF A;  4KGT A;  3U30 A;  3VH4 B;  1D5Z C;  3PGE A;  1WZ3 A;  1I4R A;  3KUD B;  4F1S A;  1XEE A;  4FHJ A;  1IUE A;  2K8B A;  1VR9 A;  2G1E A;  3T9L A;  1SIJ A;  3AE3 B;  1JCK B;  2AEH A;  2LRU A;  1R7S A;  4K7W A;  4J6I A;  4C4V B;  3MJW A;  3N32 A;  3T3O A;  3BIN A;  2ZVN A;  3SFE B;  3TIX A;  5I4D A;  2KAC A;  4OVV A;  2ZCC A;  3VHT C;  1KLV A;  2JYE A;  1JWU D;  3R2I A;  3VXW A;  4W9J A;  1WIA A;  4OVU A;  1GNU A;  2KNB A;  1XLP A;  3Q3J A;  1WGY A;  2CU3 A;  1L4Z B;  2KD0 A;  2KZR A;  2LD9 A;  3BZD B;  1STE A;  3DVN U;  1NI3 A;  3QQ8 B;  3V3X A;  2AWT A;  2G3Q B;  1H8C A;  1QZE A;  2QSD A;  2ZW0 A;  2L32 A;  2DZI A;  1F1H A;  2KMA A;  3BK2 A;  4MSM B;  4LK0 M;  3AE1 B;  3R7R A;  3TBL D;  3DPD A;  3WAL A;  5AUK A;  4KKJ A;  1X1M A;  2CR5 A;  1DGJ A;  4ANU A;  4N59 A;  3CIR B;  2GBJ A;  1PGB A;  1I4Q A;  1I42 A;  1IP9 A;  5MPO A;  1HZ5 A;  3Q8C A;  1WE7 A;  5EE9 A;  4MJS B;  2LHD A;  4US8 A;  4MDK E;  1VCB A;  3LXF A;  1LO5 D;  2AX5 A;  4A3O A;  1HTO A;  3FC4 A;  2N7D A;  2HE7 A;  2FCS A;  1K53 A;  4A9A A;  2M4N A;  2I2Y A;  2KKC A;  2MP2 A;  2IO0 B;  4RH6 A;  4HRO A;  2IZV B;  4MEL A;  1V49 A;  5KHQ A;  3VQI A;  1QKZ A;  3RN9 C;  1JWA D;  3MHS D;  4AQ7 A;  3V62 A;  2BQQ A;  1WRI A;  1FPY A;  2WXQ A;  4II2 B;  4KIK A;  3NZS A;  4W9E A;  4XGA B;  1KLG D;  1F52 A;  5FR3 A;  3ALB A;  4BKG A;  3NVY A;  2QIE B;  5L83 A;  1WXS A;  4P6V F;  2MSE D;  2BTE A;  1GB4 A;  3HHM A;  3EUB 2;  1V6E A;  1WYG A;  5AZF A;  4DK5 A;  1FD6 A;  4RGO S;  2N9P C;  2NTS A;  5D3I B;  5BMH A;  1VD2 A;  3X0W A;  4IKG A;  3MC9 A;  2LJI A;  3AEC B;  5CTR C;  1FCC C;  2FID A;  5J18 A;  3PV1 A;  4URK A;  1D5X C;  2A4Z A;  3VUX A;  3MFG A;  4ZRP A;  4DHJ B;  1KRH A;  3H6N A;  2N7J A;  2WDR B;  1XLQ A;  2KOX A;  2KAJ A;  4W9H A;  2KDM A;  2N9L A;  1OQY A;  2NBV B;  1IBX A;  4BAX A;  1FNU A;  2JWU A;  1L5P A;  3RFZ B;  1KM7 A;  2FAZ A;  4JE3 B;  4WWN A;  1C79 A;  1UGM A;  3RD2 A;  2MBE A;  3VTU A;  4GIV A;  2QJL A;  2L0T A;  4LNO A;  4BBN F;  3VR8 B;  3AEB B;  1TIF A;  1E8Z A;  3DBL I;  1WJ6 A;  3Q8E A;  1SJE D;  4GDL B;  4LNK A;  3M95 A;  1WGR A;  1ZXI A;  4A8X C;  2KVR A;  3TEZ A;  1Q1O A;  3AM9 A;  2D10 A;  1WM2 A;  2VZK B;  2OED A;  4EEW A;  5JHB A;  3DWM A;  4UDU C;  4EZL A;  2IBI B;  3R8B A;  4LDT B;  2KTR A;  4MH0 E;  3CF6 E;  4JPS A;  4ANX A;  1BXT A;  3NVZ A;  3NOB A;  2CKH B;  4HPM B;  3IHP C;  1C78 A;  3O13 A;  3DCG A;  4WQO B;  4M0W A;  5EE0 A;  1TS5 A;  5IP4 D;  4JWU C;  2V9H A;  3ML8 A;  4KKI A;  1UBI A;  1FXT B;  4Q2J A;  3PHW B;  2KWU B;  2K25 A;  4RGM A;  2O6V B;  2WLB A;  1QF6 A;  2D3C A;  1YIW A;  2K0P A;  2JX5 A;  2ON8 A;  1EWC A;  2I1K A;  4ANV A;  3K9O B;  3NRZ A;  1D5M C;  5DPS A;  3T3N A;  4USA A;  4RGN A;  3A9J B;  1TS2 A;  4FUL A;  4IOI E;  2LVQ A;  2KHW B;  2BS4 B;  3VAW A;  3LDZ E;  1T0Y A;  1N6Z A;  1WJN A;  3KH0 A;  4WWO A;  2LGD A;  4LJP B;  4FA6 A;  2IND C;  4K3B A;  1WXV A;  3T8M A;  2G9H D;  2PKO A;  4DHJ D;  2MBO A;  1RLF A;  4TQ0 A;  3PTF C;  4W9L A;  1E10 A;  4I6P A;  1QOF A;  3UQB A;  2VRR B;  3KLS X;  2WDT B;  4NZL B;  1IYF A;  1FNV A;  1AYF A;  1MG4 A;  3GB1 A;  5AZH A;  2L1A A;  2JF5 A;  4GDK A;  2PPH A;  3ZRF A;  2LXC A;  5HKH A;  2N7E A;  4K81 A;  3RNE C;  3M3J A;  2FCM A;  2RSU A;  2DYM A;  4A90 A;  4M02 A;  1L2N A;  4IDI A;  1GB1 A;  1ACC A;  4F8C B;  3UQA A;  2L76 A;  1F77 A;  1TKG A;  2WP9 B;  2WXF A;  3VTW A;  4F7Z A;  1PDX A;  3U4E G;  1TKE A;  3IG3 A;  2G4D B;  2HJ8 A;  5TSS A;  1XCQ L;  2K9X A;  1MFW A;  2BYE A;  1FRR A;  3GZN I;  3ZNI D;  1SBB B;  2JZ3 B;  3Q3O C;  3VUW A;  1L0X B;  2LJ5 A;  2WU2 B;  4O1N A;  2L3Z A;  5CHW A;  3R7Q A;  1NI2 A;  3H7P B;  2SAK A;  1JRP A;  1ZDX A;  4C00 A;  1BUI C;  1QOG A;  3ZRC A;  2IY0 B;  2V3P A;  2VZK D;  3DBR I;  3L10 B;  1AWD A;  3O65 B;  4LDT D;  4E3C A;  2NPT B;  3KW5 B;  1Q0W B;  2QCZ A;  2B3A A;  4WUR A;  5D94 A;  2WYQ A;  4AOF A;  1B1Z A;  2REX A;  1CZP A;  4I6N B;  3MHZ A;  4MSQ B;  3EFC A;  1FRD A;  2KC2 A;  1NEK B;  2MHJ A;  1SSN A;  1TGZ B;  3QCA A;  3C19 A;  3JYU A;  2R2Q A;  2NVU I;  1I35 A;  2O6V D;  3MP9 A;  3PRZ A;  1SJH D;  1GPX A;  5HHD G;  2OHF A;  1EWY C;  2GBR A;  2AQ3 B;  2V4I B;  3A1Q B;  3JSV B;  2INP E;  3AE9 B;  4IM3 A;  1WY8 A;  2GLS A;  3KWV A;  1EM7 A;  4MM3 A;  1E5W A;  3RUI B;  4PS3 A;  3OLM D;  4REZ A;  1R4M I;  3UI3 A;  1WE6 A;  1UBQ A;  3H9D A;  1OQR A;  2K1F A;  1K51 A;  3ZJT A;  1MVK A;  4K1R B;  1YX5 B;  3B1L X;  3AEA B;  1NYQ A;  3HUI A;  3TEX A;  1K8R B;  1WGK A;  5C3J B;  1N5W A;  3J9C A;  4NQK E;  2KWV B;  1WXM A;  3ZVV A;  1UF0 A;  1XCT L;  3TCA A;  4HDO A;  3P2B A;  2BVC A;  3NJT A;  1SEB D;  2AYO B;  2JRI B;  4AS1 A;  3AE4 B;  1QT9 A;  4YTP B;  4HJK A;  2NTT A;  2YLM A;  4LCD E;  1WX9 A;  1WZ0 A;  3DOW A;  1UUP A;  1M94 A;  1MPE A;  3GP7 A;  2ZW1 A;  2UU7 A;  4MH8 A;  2O2V A;  2DZJ A;  3A33 B;  1V80 A;  4NNJ B;  3B9J A;  5G55 A;  1TY2 A;  3PT2 B;  2CHX A;  2L8J A;  3ZYY X;  4YTM B;  2KWD A;  2ASQ A;  4HVB A;  4GU2 A;  3ABV B;  2JZZ A;  2FCQ A;  2KFJ A;  5LXI B;  3KVF B;  3ZW3 A;  1TKY A;  2N1W A;  1P7E A;  1P7F A;  3P4S B;  3Q3N C;  2ZJD A;  4DDI D;  1V2Y A;  3FIL B;  1ZP0 B;  3N1Z C;  2LXA A;  1AAR A;  3BVM A;  2V3S A;  2V4L A;  3AU5 A;  2A5U A;  1J19 A;  2WDV B;  2JSV X;  1UGJ A;  2M8S A;  3CWI A;  2D11 A;  2B76 B;  3R2T A;  1P3Q U;  1N63 A;  2VH1 A;  4KZ0 A;  3RUL A;  2DHZ A;  2BW2 A;  4TKN A;  1FMA D;  1V5T A;  3BII D;  1UZX B;  3EC8 A;  1T6B X;  4XWT A;  3ZLZ A;  2J52 A;  3MTN B;  3OJ3 A;  1T0Q C;  1TBE A;  3NG0 A;  3A4S C;  1VDV A;  2D5G A;  2IGH A;  4B95 A;  1XO3 A;  3PZ8 A;  2MRP A;  2J4X A;  5JHA A;  4S0R A;  3VTV A;  3WA0 A;  4YL8 A;  3GE8 C;  2Y5P A;  5TR5 A;  2WXL A;  2DEN B;  3RNA C;  3VFK A;  4MGI E;  4LLG M;  4HCN B;  4K7U A;  2K22 A;  1C76 A;  3HM6 X;  1JWM D;  1DOI A;  1NVI D;  2KC1 A;  1KH0 A;  2QEJ C;  1E8Y A;  5T8I A;  4ZYN A;  5EDS A;  2RGF A;  3CMM B;  4WJO A;  3ZTD A;  2AQ2 B;  2Y5C A;  4A6Q A;  2IO3 B;  3L0W B;  3SDL C;  2YEP F;  2M56 B;  3DBH I;  4KV2 A;  5BYQ A;  1CQV A;  4AJW A;  1FEH A;  2Y5B B;  3AXC A;  2HTM E;  5C23 A;  4CO7 A;  1L6U A;  4ZYS A;  4GOC A;  4TV3 A;  3HM3 A;  1WR6 E;  2KJH B;  1WSP A;  4IM0 A;  1V5O A;  2C9W B;  3L4P A;  3P4Q B;  3IAM 1;  2JQR B;  1XLO A;  2ONQ A;  2K6D B;  3W9C B;  3RNF C;  2SEB D;  3S2A A;  3ZXR A;  2BKR B;  4A55 A;  4DBG A;  4FJY A;  3I63 C;  1V1P A;  2KDI A;  1NBF C;  4FHK A;  2LUE A;  4US9 A;  2RMM A;  4A3P A;  3PO0 A;  5HI1 A;  3HK0 A;  2CHZ A;  3WAN A;  2NBU A;  3PRM B;  2H89 B;  5CHV C;  1L6V A;  5BYR A;  2INC C;  1PYW D;  1UD7 A;  2JY6 A;  2AL6 A;  2WXP A;  3A4R A;  3IT4 B;  5IA7 A;  5J2R A;  4DDG D;  2BF8 B;  2WX0 A;  2ZCB A;  2OJR A;  2WQY B;  2JXT A;  4FAD A;  4W9C A;  4N9F 4;  3EEC A;  5FKA C;  2N0S B;  2KAN A;  3EFU A;  4DXG A;  4XWW A;  2GOW A;  3R3M A;  3AH7 A;  3FKY A;  3N20 C;  5DCN A;  4B0M A;  4E74 A;  2N9X A;  3A9K B;  3PPA A;  1YJJ A;  1HQR D;  1AN8 A;  2BPS A;  4HJG E;  1DOX A;  1UEL A;  3QJZ A;  3ZGZ A;  2CS4 A;  5JXV A;  4M00 A;  1UWX A;  2IGD A;  2XK5 B;  4ZRJ A;  1KOT A;  1F0Z A;  4HPL B;  2WXR A;  3AED B;  1PFD A;  1V86 A;  2HDE A;  2ZNV B;  4ICV A;  1N60 A;  3X23 A;  2PJH A;  1JML A;  2G45 B;  2D3B A;  4BKS D;  2LI5 A;  2FUH B;  1YQB A;  2KN4 A;  3V60 A;  3AUL A;  2IY1 B;  4N58 A;  1SB3 C;  5DPR A;  2R2O A;  2RD0 A;  2RDH A;  4MGY E;  3PZ7 A;  3M62 B;  3GOE A;  1FCL A;  1J7C A;  2UWQ A;  4PS8 A;  2KJR A;  3U2S C;  4WQM A;  2DWQ A;  4B9K A;  1RWS A;  1V1O A;  4NAW A;  2LHE A;  2GBN A;  2FUG 1;  2PMV A;  2K8C A;  3HVD A;  4RF1 A;  2HJ1 A;  3DHG C;  1R4N I;  1WH3 A;  4JLC A;  2KQS A;  4WJP A;  2KN5 A;  5BYS A;  5E6N A;  3AU4 A;  4XC2 A;  4XX5 A;  4HDQ A;  1K52 A;  3SFD B;  5EE1 A;  2FE8 A;  1ET6 A;  1SF0 A;  1P0R A;  2BB6 A;  4AP4 C;  4K7S A;  4P1C C;  3H1U A;  1QLB B;  3D32 A;  4B0E A;  2C7H A;  1T5X D;  2W9N A;  1G6J A;  2WXO A;  4TUU A;  4ZHP A;  1NDD A;  3I9V 1;  3ECI A;  4ICU A;  5C2T B;  2WHI A;  2ZVO A;  1QOA A;  3AI5 A;  1DYQ A;  4P7I A;  2GI9 A;  3NVW A;  4C4V A;  2JUO A;  5IOI A;  2UYZ B;  5BO4 B;  4HEA 1;  5KHO A;  1ZUD 2;  2MBB B;  3B08 A;  1PGX A;  1I4G A;  3PS6 A;  2EMT A;  2WX1 A;  1GAQ B;  4KZC A;  1SXT A;  5DPT A;  1DOY A;  4IWQ A;  3EHV A;  2LRW A;  2K5P A;  2W3S A;  4L1B A;  4G3X B;  3SHQ A;  1N62 A;  4ZRQ A;  2J42 A;  3AEE B;  2MBH A;  1SE4 A;  2MCN B;  1AW7 A;  4W9I A;  1E8W A;  3RT3 B;  4HCP B;  3AMZ A;  4RNA A;  3E56 A;  2JRH A;  3AN1 A;  1QQR A;  1CMX B;  4WJQ A;  3RNC C;  4RM8 A;  3VH3 B;  2LGY A;  3KYC D;  3C0R B;  4NJ7 A;  4ARC A;  1FNW A;  4HK2 A;  5GXG B;  4EZK A;  4E71 A;  3N9Y C;  1VZ6 A;  1WJU A;  2XN9 C;  2HTH A;  3V6C B;  1J8C A;  1RYJ A;  2KLG A;  2O2V B;  1ESF A;  1XQQ A;  3P1M A;  4OHJ A;  4TSS A;  2MW5 A;  1K50 A;  1WXQ A;  2KQ4 X;  1V81 A;  3OG5 A;  3DHH C;  1C4A A;  3ENE A;  3QA8 A;  2W82 A;  3W1Y A;  3NVV A;  1WI0 A;  2Z0D B;  2KDE B;  4M8N A;  4YWG G;  3TL5 A;  1D3Z A;  5HG2 A;  1GJZ A;  3ZJV A;  1LQB A;  3GE3 C;  3ZKJ C;  4ANW A;  2LUM A;  1XT9 B;  1WFY A;  3RZF A;  1PQS A;  2RPV A;  4FN2 A;  2EMS A;  2DBY A;  5IKC M;  3ZIM A;  3P42 A;  2BWE S;  4C56 C;  3TMP B;  1FIQ A;  1RRB A;  1TZO A;  3N30 A;  1F2R I;  4IG7 B;  1MI0 A;  2X8X X;  4C7Z A;  3BVG A;  4AJY B;  3NHE B;  2NR2 A;  2E6X A;  5E6O A;  4ZRK A;  1V97 A;  3GS2 A;  2M19 A;  3HVZ A;  2LZ6 A;  4WIP A;  4EUT A;  2BBC A;  1T0S C;  4HXD A;  2YVC A;  2LVP A;  3TEY A;  1YNT E;  1Q5W B;  4HPP A;  4IM2 A;  2M17 A;  1ZGU B;  4RFB A;  2L52 A;  3L54 A;  2JU6 X;  3Q8A A;  2V1Y A;  2N4F A;  4XE0 A;  5LLI A;  4HWI B;  3LYY A;  2ZPN A;  4ZOH C;  1LFD A;  2DZM A;  3DDC B;  1ISN A;  3RI7 C;  3BK1 A;  5FR6 A;  3QX1 A;  1WRD B;  4MAC A;  2E3T A;  2NCN A;  3B2G A;  3AV8 A;  1WX7 A;  3BYY B;  2J53 A;  3IAS 1;  1EF1 A;  3V05 A;  4MGK E;  2KXJ A;  1YX6 B;  4W9D A;  1WM3 A;  2DAJ A;  3ZO5 B;  1ROE A;  3KUZ A;  2CJO A;  4GDL A;  3QIJ A;  2VH2 A;  1L0Y B;  1FM0 D;  4I6L B;  1A5R A;  5BMI A;  2MJE A; 
#chains in the Genus database with same CATH homology
 3AE7 B;  4LLG M;  3MFG A;  4ZRP A;  1E6E B;  3KQ4 A;  1FO4 A;  2K22 A;  3VRA B;  1C76 A;  3KWL A;  1C4C A;  1JWM D;  1DOI A;  3AE8 B;  1KRH A;  1NVI D;  4DQO C;  1KH0 A;  2N7J A;  2WDR B;  4HRS A;  1XLQ A;  2QEJ C;  4YSZ B;  4MT5 A;  4YT0 B;  3ETR A;  3RPF C;  3I57 A;  5T8I A;  5LNK 1;  1C9F A;  1YN4 A;  1FXI A;  1TY0 A;  4HKZ E;  2KAJ A;  3MC0 B;  2KDM A;  2N9L A;  1JWS D;  4J3O D;  2AQ2 B;  1YN5 A;  1IBX A;  2Y5C A;  1XF5 L;  4A6Q A;  1FNU A;  2MJ3 A;  1NYR A;  5EE3 A;  2JWU A;  1L5P A;  1C77 A;  2YEP F;  2Z8L A;  3RFZ B;  2M56 B;  1I4X A;  2WU5 B;  5BYQ A;  1CQV A;  4JE3 B;  2MH7 A;  1FEH A;  1UWM A;  4FXC A;  2HTM E;  1JAL A;  1OQQ A;  1RFK A;  1L6U A;  4ZYS A;  1IGC A;  1C79 A;  5BMG A;  4ITK A;  1ZOY B;  4ARI A;  1L0V B;  1WSP A;  2ACZ B;  2GB1 A;  2QJL A;  3P4Q B;  3L4P A;  4YSX B;  3VR8 B;  3IAM 1;  2JQR B;  3AEG B;  3AEB B;  4RF0 A;  1XLO A;  2ONQ A;  2WS3 B;  4OVZ A;  3W9C B;  3Q8E A;  1SJE D;  2SEB D;  4GDL B;  2DYO A;  2WXK A;  4A55 A;  1J7A A;  1ZXI A;  1V1P A;  4A8X C;  3TEZ A;  4L2Y A;  3AM9 A;  4US9 A;  2RMM A;  3PO0 A;  4NJC A;  5HI1 A;  1QIL A;  5HFY A;  1YQ3 B;  3C8Y A;  3TSS A;  2H89 B;  2VZK B;  3Q69 A;  2OED A;  1YJI A;  5G5G A;  1L6V A;  3DWM A;  3P4R B;  4UDU C;  1PYW D;  1PGA A;  5BYR A;  3VR9 B;  2WXP A;  2Y3A A;  3IT4 B;  1IGD A;  2GRI A;  3R8B A;  1ET9 A;  1JQ4 A;  2WQY B;  2Q5W D;  2JXT A;  4JPS A;  3W5V B;  1BXT A;  5H8Y E;  2KMM A;  3NVZ A;  5FKA C;  1BML C;  4OZB A;  1I4H A;  2PW9 A;  4NAW B;  1C78 A;  1XLN A;  2WXN A;  2N0S B;  3O13 A;  3P4P B;  1TS4 A;  4XDC A;  4M0W A;  4DXG A;  5EE0 A;  1TS5 A;  4XWW A;  4JWU C;  1IBX B;  5AUI A;  4HKQ A;  3AH7 A;  1C4P A;  4KKI A;  3ZQ4 A;  3B2F A;  4B0M A;  4WWM A;  4TQ1 A;  4Q2J A;  2BYT A;  1YJJ A;  5G5H A;  1HQR D;  2AQ1 B;  1AN8 A;  3EA6 A;  4HJG E;  4WH4 A;  1DOX A;  3VRB B;  3ZGZ A;  5JXV A;  2L83 A;  4RGM A;  4RGT A;  1B9R A;  1UWX A;  2IGD A;  3W1S A;  4OZA A;  3U7Z A;  2WLB A;  3SR6 A;  1QF6 A;  1F0Z A;  2WXR A;  3AED B;  3AEF B;  1PFD A;  2K0P A;  2HDE A;  2JX5 A;  2ON8 A;  1EWC A;  3NRZ A;  1D5M C;  1N60 A;  3T3N A;  3E9S A;  4USA A;  4RGN A;  1JML A;  5FK9 C;  2V0G A;  4IOI E;  1TS2 A;  1XXG A;  3Q8F A;  2BS4 B;  1HEZ E;  3BYT B;  1KFY B;  2KN4 A;  4YSY B;  2CJN A;  4N58 A;  1SB3 C;  2IJ0 A;  2JZP A;  1V1P B;  2RDH A;  3PZ7 A;  1RM6 C;  4CQN A;  4H2A A;  1FCL A;  1QOB A;  4XDD A;  1J7C A;  2G9H D;  2PKO A;  3U2S C;  4WQM A;  2DWQ A;  3BVZ A;  1E9M A;  4JX1 C;  2PIA A;  1RWS A;  1V1O A;  4PT5 A;  4TQ0 A;  2LHE A;  3U52 E;  3TEW A;  2FUG 1;  2PMV A;  3P63 A;  1HA5 A;  2PTL A;  1E10 A;  4C7Y A;  3HVD A;  4RF1 A;  4OZC A;  3AE5 B;  2WXG A;  4R3D A;  1QOF A;  3KLS X;  4NZL B;  2XNA C;  1EU3 A;  5BYS A;  1FNV A;  1AYF A;  2QMT A;  3GB1 A;  1E7P B;  2L1A A;  1PUT A;  1K52 A;  1TJE A;  2PLP A;  5EE1 A;  1MHX A;  3SFD B;  2FE8 A;  3TUO A;  1ET6 A;  1UNS A;  1SF0 A;  2W3R A;  2H88 B;  2WXM A;  2BB6 A;  1NEN B;  1VZ7 A;  2DYM A;  4A90 A;  3Q8B A;  4D2K A;  1QLB B;  2BS2 B;  3WCQ A;  3AB5 A;  4IDI A;  4GLS C;  1Q10 A;  4B0E A;  4NAM A;  1T5X D;  1GB1 A;  2WXO A;  4ZHP A;  2IPK D;  1ACC A;  1N5X A;  3I9V 1;  1VZ8 A;  3LB8 C;  2BS3 B;  1F77 A;  1TKG A;  2WP9 B;  2WXF A;  1KLU D;  5C2T B;  3NUH B;  1PDX A;  3U4E G;  1TKE A;  5E6J A;  4C80 A;  2I38 A;  1QOA A;  3EGR A;  2R61 A;  1DYQ A;  2GI9 A;  3NVW A;  5TSS A;  1XCQ L;  2K9X A;  4OW0 A;  1ZPS A;  1FRR A;  4KGR A;  1VLB A;  3HRD D;  3W5U B;  1J7B A;  3NS1 A;  2EEL A;  4HEA 1;  1SBB B;  1ZUD 2;  1L0X B;  1PGX A;  2WXJ A;  1HXY D;  2WU2 B;  1I4G A;  4O1N A;  2LGI A;  3H8H A;  1ENF A;  3MJ5 A;  2WXI A;  4L23 A;  1SE3 A;  1GAQ B;  2BB5 A;  1SXT A;  1DOY A;  2K5P A;  2W3S A;  1T3Q A;  2PVG C;  2QIL A;  2SAK A;  2MEK A;  3SEB A;  1JRP A;  1ZDX A;  2BT6 A;  4L1B A;  1BUI C;  1QOG A;  1N62 A;  2V3P A;  1ZDV A;  1L4D B;  2VZK D;  4ZRQ A;  2J42 A;  3AEE B;  4N6E B;  1JWB D;  3URY A;  1F2R C;  2FBW B;  1AWD A;  1JRO A;  1V8C A;  1SE4 A;  2LMC A;  3DWG C;  1AW7 A;  2RDG A;  1MHH E;  1OFF A;  1YQ4 B;  3AE6 B;  3AMZ A;  3NZ3 A;  4RNA A;  3E56 A;  4WUR A;  3AN1 A;  4EE2 A;  1YN3 A;  1B1Z A;  4GDK B;  1CZP A;  1QQR A;  1ZXH A;  3MHZ A;  1FRD A;  1TYG B;  2IGG A;  4DXF A;  4KGT A;  1NEK B;  1WWT A;  2IDY A;  1SSN A;  1D5Z C;  1I4R A;  2K3U A;  4ARC A;  1FNW A;  1XEE A;  3MP9 A;  1IUE A;  5GXG B;  1VR9 A;  1A70 A;  1SJH D;  2G1E A;  1SIJ A;  1GPX A;  5HHD G;  3N9Y C;  2OHF A;  3AE3 B;  1JCK B;  1VZ6 A;  1EWY C;  2XN9 C;  5D3D A;  2AQ3 B;  2V4I B;  1R7S A;  2LEK A;  2INP E;  1VJK A;  3AE9 B;  3KWV A;  1EM7 A;  2ICI A;  2WDQ B;  2W55 A;  4YXD B;  3T3O A;  2DLB A;  3SFE B;  4JWS C;  1I4P A;  5I4D A;  1RYJ A;  2KAC A;  1ESF A;  3P1M A;  3W2D A;  4OHJ A;  4TSS A;  2JYE A;  2LFI A;  1JWU D;  3R2I A;  4REZ A;  1EU4 A;  1K50 A;  1WXQ A;  2KQ4 X;  3UI3 A;  2EKI A;  1C4A A;  1XLP A;  1OQR A;  2W82 A;  3ZJT A;  1K51 A;  1D4B A;  3NVV A;  1MVK A;  3BWU D;  1HZ6 A;  2CU3 A;  3IT6 B;  1L4Z B;  1E0Z A;  3AEA B;  1CK1 A;  1NYQ A;  3HUI A;  3TEX A;  3FIL A;  1WGK A;  2WXH A;  3BZD B;  1STE A;  1ZE3 D;  4YWG G;  1N5W A;  1NI3 A;  3V3X A;  5HG2 A;  5C3J B;  3ZJV A;  5D7G A;  3J9C A;  2QSD A;  3AE2 B;  1I7H A;  2ZW0 A;  2L32 A;  2LUM A;  1CJE A;  4RCO A;  1D6E C;  3BK2 A;  2RPV A;  4LK0 M;  3AE1 B;  1FXA A;  1VRA B;  5AUK A;  1XCT L;  4KKJ A;  2WNM A;  2JYT A;  2DBY A;  1DGJ A;  4N59 A;  1SEB D;  3CIR B;  4KGS A;  1PGB A;  1I4Q A;  4TMA B;  3P42 A;  3AE4 B;  1QT9 A;  4AS1 A;  2TSS A;  4YTP B;  2M0A A;  1HZ5 A;  5MPO A;  3Q8C A;  4C56 C;  5EE9 A;  1N61 A;  1FIQ A;  1TZO A;  2NTT A;  1F2R I;  1MI0 A;  4C7Z A;  2LHD A;  4US8 A;  4WAF A;  1UUP A;  1MPE A;  3GP7 A;  3BVG A;  2ZW1 A;  4MH8 A;  3LXF A;  2E6X A;  1LO5 D;  2AX5 A;  3FC4 A;  1V97 A;  3GS2 A;  4YTN B;  2M19 A;  2W54 A;  3B9J A;  1K53 A;  3HVZ A;  4WIP A;  2BBC A;  4A9A A;  3TEY A;  1YNT E;  4ZHO A;  1KTK A;  1TY2 A;  1KF6 B;  2I2Y A;  4MM3 B;  4KX6 B;  3ZYY X;  4YTM B;  2KWD A;  4RH6 A;  4HRO A;  3ABV B;  4RFB A;  2L52 A;  2JU6 X;  4LTU A;  3Q8A A;  2PVO D;  2N9K A;  3VQI A;  1JW9 D;  1QKZ A;  4XE0 A;  1FFU A;  2NMQ A;  1YMH E;  2MJD A;  3LYY A;  2X38 A;  1JWA D;  1TKY A;  4AQ7 A;  1P7E A;  1P7F A;  4ZOH C;  3P4S B;  1WRI A;  3BK1 A;  3FIL B;  1ZP0 B;  2WXQ A;  4MAC A;  2E3T A;  3BVM A;  3B2G A;  3AV8 A;  1KLG D;  2YEP B;  5FR3 A;  1Y56 A;  3BYY B;  2WDV B;  2JSV X;  1UGJ A;  1FFV A;  3CWI A;  2J53 A;  2B76 B;  3IAS 1;  3R2T A;  1N63 A;  3V05 A;  3NVY A;  4P16 A;  2QIE B;  2BW2 A;  4P6V F;  2INN E;  2BTE A;  1GB4 A;  1SE2 A;  1FMA D;  5H92 C;  1GOZ A;  3BII D;  3EUB 2;  3IXS A;  1TS3 A;  1T6B X;  1WYG A;  4XWT A;  3ZJU A;  2J52 A;  1FD6 A;  4RGO S;  1ROE A;  2CJO A;  2NTS A;  1VDV A;  2D5G A;  5D3I B;  1M4V A;  2IGH A;  2V3N A;  5BMH A;  1XO3 A;  4IKG A;  3PZ8 A;  1L0Y B;  2J4X A;  1FM0 D;  3OWE B;  2LJI A;  3AEC B;  5BMI A;  1FCC C;  2Y5P A;  2WXL A;  2MJE A;  3FAH A;  1D5X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...