2JX5A

Solution structure of the ubiquitin domain n-terminal to the s27a ribosomal subunit of giardia lamblia
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
b'MLVIVRLQDQTLPFELPAGARASQLSNLLSSSGMAFSLHTQGRVLSEAAELNDKMVIDAFVPADGAGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlUb(S27a)
molecule tags Ribosomal protein
source organism Giardia lamblia atcc 50803
publication title Sequence and structure evolved separately in a ribosomal ubiquitin variant
pubmed doi rcsb
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jx5A00
2G1EA 4ITKA 4YTMB 3NVYA 1E10A 3P4RB 3LXFA 3AB5A 1OQRA 1QT9A 2MJ3A 3AEAB 1JALA 1ZP0B 2H89B 2BT6A 2W3RA 2WDQB 2WS3B 2WQYB 3HVZA 1E0ZA 1TKGA 3B2FA 2WDVB 4HRSA 3ETRA 2CJOA 1DOIA 3PO0A 1J7BA 3NVZA 5EE9A 1FO4A 3VRAB 1QOAA 2B76B 2PKOA 1WRIA 3BIID 4A9AA 2PIAA 3AEFB 3FAHA 1L6VA 1GAQB 1YJJA 3NS1A 1KFYB 4WWMA 1VJKA 1J7CA 5AUIA 1FXIA 4ZHOA 2KMMA 1NYRA 4P6VF 1JRPA 4YSXB 1SB3C 3DWMA 3SFDB 1E7PB 1OFFA 1FXAA 2L83A 5EE1A 5GXGB 5EE0A 1XO3A 1DOXA 3W9CB 5G5HA 2K5PA 2K22A 1QLBB 3LB8C 2CU3A 1FRRA 3AE5B 1N5WA 2BS4B 1JROA 4C7YA 1FMAD 3AE3B 4IDIA 2ACZB 4YSYB 1WGKA 3SFEB 5C3JB 1V8CA 2H88B 3AM9A 1J7AA 1R7SA 1XLNA 3AEGB 2L52A 4KX6B 4YXDB 1DOYA 5H8YE 1F0ZA 1YQ3B 4N59A 3RPFC 2MH7A 1JQ4A 1TJEA 1V97A 1IUEA 1N63A 3AE1B 3P63A 2QIEB 3AE2B 2N0SB 2OHFA 3AH7A 3AEBB 1YJIA 1WWTA 3VRBB 3SR6A 1E6EB 1XLQA 2M56B 3AE6B 4JX1C 5C2TB 1AYFA 1ZOYB 1SIJA 1ZUD2 1L5PA 2JX5A 1NI3A 3EUB2 2WU2B 3VR9B 1OQQA 4YSZB 1I7HA 4US8A 1NENB 2Q5WD 3NRZA 2DWQA 3WCQA 2MJEA 3CWIA 1AWDA 1FRDA 3FC4A 3VR8B 4C80A 1RM6C 2WU5B 1E9MA 1T3QA 1XLPA 2JQRB 2E3TA 3P4QB 2AX5A 1EWYC 1QOBA 1VDVA 1QOFA 3AE8B 1TYGB 2CJNA 2W54A 3AEEB 3AMZA 2PVGC 3P4PB 4FXCA 4US9A 1L0VB 1L6UA 2FBWB 3AEDB 3AV8A 3P4SB 4HROA 1KF6B 5G5GA 2KAJA 3AECB 1FFUA 4LTUA 1DGJA 1KRHA 4N6EB 2WP9B 3B2GA 1GPXA 3ABVB 4ZOHC 1JWBD 1RFKA 2WDRB 5H92C 4JWSC 1RWSA 3AE4B 1PUTA 1JW9D 2K9XA 1VLBA 1N62A 3AN1A 3HRDD 5MPOA 2PVOD 1PFDA 2BS2B 2LEKA 3P1MA 5AUKA 4JWUC 4YTNB 5EE3A 3HUIA 1RYJA 3ZYYX 1ZXIA 1NVID 3KWLA 3DWGC 1CJEA 2QJLA 1B9RA 1YQ4B 1ROEA 2HTME 3W5VB 1N5XA 1FIQA 1JWAD 2WLBA 4YT0B 4C7ZA 1UWMA 1WXQA 1WYGA 3AE9B 4YTPB 1PDXA 3CIRB 4N58A 1QF6A 3B9JA 4WQMA 2BS3B 1SF0A 2Y5CA 1NEKB 1TKEA 4ZHPA 3NVVA 3NVWA 1CZPA 2M19A 1XLOA 3L4PA 1FFVA 3W5UB 1TKYA 3AE7B 1QOGA 1N60A 2DBYA 4USAA 1N61A 2EKIA 1FM0D 1A70A 2W3SA 1NYQA 2MJDA 2W55A
chains in the Genus database with same CATH superfamily
1OQYA 5D3DA 3VTVA 3B2FA 4FJZA 3PLUA 3RUIB 3DHHC 4NJCA 1UELA 3TBLD 1KLVA 1TS5A 4XX5A 4GN1A 2PW9A 4DDID 5BYQA 2AL6A 2NTSA 4EUTA 3SFDB 2MBBB 3T3OA 1XO3A 1WGRA 1WXMA 1QLBB 2MHJA 3H9DA 3ZNZB 1N5WA 2WX0A 5G2NA 2DYBA 1MPEA 1N63A 5HFYA 4DHZB 1SJED 4EZJA 3JW0X 3VH3B 3P42A 3U52E 5J2RA 3R2IA 4MJSB 3CWIA 3V61A 2O6VA 4OZCA 1P7FA 1RM6C 2E3TA 3IT6B 1BMLC 3PRPB 5IP4D 2FBWB 1HE8A 2RR9A 1WGDA 1C1YB 1M94A 1GPXA 2K1FA 4HPLB 3N20C 4JWSC 3KVFB 2L05A 3P1MA 2GBMA 4OVZA 2YEPB 5EE3A 2NMQA 4IUMB 2BWFA 3DBRB 2XK5A 4FJYA 3WAOA 4KGSA 2D11A 2L00B 1WYGA 3CIRB 3Q8CA 4RGNA 4W9GA 1SF0A 2MSED 2WDTB 1UBQA 3NVVA 4KVGB 4ZHPA 3VTWA 1N61A 1V81A 1NYQA 1ZKHA 4OVUA 4HVBA 2G1EA 3I5JC 3P4RB 3LXFA 2W3RA 1V9JA 3VRAB 1QOAA 4MACA 1TGZB 1VCBA 3FAHA 3RNAC 3VTUA 3TJPA 1KLGD 3A9KB 3GZNB 3MJWA 2K5PA 4KGTA 1WXAA 5D6JB 2AYOB 2K6QA 4EOYA 3DPDA 1XT9B 4K7SA 1SSNA 2LXAA 4KX6B 5H8YE 3RPFC 2D3CA 2JT4B 1R4MB 3EGRA 2N4FA 2MWSB 3PZ8A 1WJ6A 2M56B 3AE6B 4KKJA 1L4DB 1NENB 1JWSD 1FRDA 3FC4A 1T0SC 5EDSA 4BZAA 2JQRB 1BXTA 1JRUA 1QOFA 2NS5A 4FXCA 1L0VB 2LHDA 4LTUA 3BVMA 2LVPA 4AS1A 3ZRCA 2JXXA 4MH0E 3N30A 2WXPA 3NZUA 2K6DB 3QHTA 3ZYYX 1SJHD 1D3ZA 2KANA 2PE6B 1J19A 1J8CA 2WXLA 4ASWC 2BYVE 2DAFA 2UYZB 2B3AA 1YX6B 2CHXA 2MX2A 1I4XA 4NJ6A 3PREA 2HTHA 3OWEB 3W1SA 1HA5A 2GB1A 3H8HA 2MP2B 1OQRA 3BK1A 2O2VA 2GMIC 1AN8A 2JYEA 3ZLZA 4X57B 3E9SA 1Z5SB 2I38A 2RDBC 2LVOA 3PTFC 2M17A 1I4PA 1YJJA 3KYDD 4LCDE 2O6VD 4YSXB 1SEBD 2L83A 1MHHE 4K3BA 1EU3A 2R2QA 2KJRA 2VH1A 2BGFA 1EWCA 4ANWA 4G11A 1T5XD 3AEGB 4M0WA 3H7PA 4N59A 1PGBA 4NAMA 3IHPC 3AH7A 3AEBB 3I9V1 2JF5A 4PS3A 5TR5A 3RNBC 1K8RB 2ICIA 4JX1C 1CMXB 1R4NI 2BKRB 4FADA 4N9F4 1WYWB 1E8XA 1QOBA 1FNUA 2KK8A 3RMKC 1QKZA 3P4SB 2LGIA 2IO2B 3E56A 4MGIE 4ZOHC 4AUQC 5H92C 4A90A 3SU8X 1IYFA 2BYFA 2KJHB 1MFWA 1BUIC 3OJ4B 1JMLA 2D3AA 3V6EB 5IO9A 1Q0WB 4I6LB 3RNEC 3TCAA 1UUPA 4GOCA 2J0MA 4MDKE 3GZNI 5AEKB 1WXQA 3ZUNA 2V4IB 3NOBA 1TKEA 2M19A 1UNSA 1XLOA 4WWOA 4IKGA 2WXRA 1TS2A 1TKYA 1GJZA 1HTOA 3U8ZA 1N60A 1NDDA 3ZXRA 1TZ1A 1X1MA 1IP9A 4KV2A 1MHXA 2YLMA 2WS3B 5AZFA 1WZ0A 1FCLA 2B76B 4G50A 5L83A 5KHQA 4LLGM 2FUG1 1U4AA 1CK1A 3ZRFA 5L95C 1VJKA 3VHTC 1KTKA 3I63C 4CHKA 1KLUD 3ZGZA 4ZRKA 2D5GA 4W9DA 2LMCA 5J17A 3QA8A 4MGZE 4FBJB 2CU3A 3AE5B 1JROA 1WI0A 5G55A 1EF5A 2QILA 2L7RA 2QSDA 2KXJA 5LNK1 3AE1B 4GMVA 1TIFA 4JPSA 4HPMB 1ZUD2 5E6JA 4NPNA 2QC8A 2Y5PA 4AOFA 2W9NA 3APFA 5IOIA 4BBNF 3QIJA 2CU1A 3AEEB 5AUKA 3ZNID 3PVLA 3AV8A 3HK0A 2C60A 3TMPB 3PRZA 2WDRB 1XD3B 3GE8C 2BS2B 4JWUC 2KTRB 1NVID 2W82A 3N3KB 1SBBB 2AQ1B 3PSEB 2IY0B 4HCPB 1M4VA 3NHEB 4NJ7A 3Q3NC 3A9JB 4PS8A 4M8MA 2C9WB 2PEAA 2ZVNA 1NEKB 2Z0DB 2KN5A 2BTEA 3RZWC 1ZPSA 1TT5B 1FEHA 1QOGA 3HIZA 1C79A 2W3SA 3HVZA 2LVQA 2INCC 1E10A 3NVYA 3VUWA 4ZDVA 1QQRA 4TQ0A 3R7QA 2KHWB 4IM2A 4HJKA 3V62A 3VVWB 2NBVB 2KX3A 1YMHE 3T8MA 4K7UA 2GBRA 3DHIC 1J7BA 3HHMA 2K8HA 4OW0A 2L8JA 2KT7A 2PIAA 3PHWB 1WGHA 4F1SA 1K50A 3CSFA 4M0WB 1P9DU 1ENFA 1VD2A 4WWMA 2GOWA 3UIOB 3EFCA 1D4BA 3GS2A 4WH4A 2DZKA 1I4HA 5G5HA 1I35A 2GBJA 2BS4B 4NY0A 4M01A 3WIMA 2RPVA 1OTRB 5E6NA 1S1QB 3L10B 3ZDMC 2INPE 2A5UA 2N1WA 4IG7B 2PE9A 3MC9A 2RMMA 4GDLB 5JHAA 2M0AA 3PPAA 1I4GA 4RF1A 1C4PA 4TQ1A 4II3B 3WCQA 1RRBA 3U4EG 2MBQA 3ML9A 1SXTA 1T3QA 1MI0A 4LNNA 2KQSA 4PK1A 4KSLC 3HM3A 1KF6B 1YN5A 1PUTA 5BYRA 4M02A 2INNE 4IWOA 3AXCA 1D5MC 1GC6A 2JY6A 1SE4A 2FCQA 3PV1A 5JXVA 3APCA 2LJ5A 2OEDA 4RH6A 5D2MB 4WAFA 2WYQA 3BK2A 1GNUA 3DBLB 3ENEA 4XZ4A 2BS3B 1LGRA 3NG0A 1YN3A 2V3PA 4A6QA 2N9XA 1P1AA 1A70A 1VRAB 4I6NB 2RDHA 1UF0A 4A3PA 3AB5A 3U7ZA 1YN4A 3HVDA 4RM9A 1SIFA 3ETRA 1FO4A 4HEA1 4WAAA 3R3MA 3RI7C 2KZRA 1J7CA 3ALBA 3NUHB 4JQWC 1FXAA 5LLIA 4FA6A 2DLBA 4YWGG 1F2RI 3B1LX 4YSYB 3PLVA 4GU2A 4CO7A 4HPPA 1TS4A 2BB6A 4WWPA 1JQ4A 2MEKA 2QIEB 2JZPA 1P7EA 4YL8A 3SR6A 4ANXA 2K8CA 3ZNGC 3M95A 3ZDTA 4RM8A 2UWQA 2IO0B 3C19A 4LJPB 1GUAB 2Q5WD 3I57A 4ZRPA 2QHOA 3VR8B 1WY8A 1UD7A 2FIFA 2OOBB 4C4VB 1XLPA 5JHBA 3DDCB 3AE8B 2QMTA 2JRHA 2UU7A 3PRMB 4C4VA 2ZCCA 4FHJA 5CX3A 1YOVB 2KDIA 1WGYA 2IGHA 3NZSA 4WQOB 4WJPA 1WX8A 5HI1A 3ZJTA 2ZEQA 5D7GA 1WX7A 3VUYA 3UIPB 3ZJUA 2V1YA 3B9JA 5GMVA 3AI5A 3OLMD 4WIPA 2J52A 3NJTA 4MH8A 1R4NB 1FM0D 2AQ3B 1OEYJ 3N32A 4MJSA 4GXBA 3UINB 2MBOA 1QT9A 1ZP0B 5D94A 2IZVB 2G4SA 2WDVB 1WZ3A 3NZ3A 3MC8A 2PKOA 2AL3A 1NBFC 1L6VA 3Q3FA 4MGYE 1YQBA 4HXDA 3NS1A 1KFYB 2AQ2B 1VZ8A 3QC8B 3DWMA 2LFIA 2ZJDA 2BW2A 1DOXA 2D10A 4JIOU 2X8XX 1VR9A 5BYSA 4L23A 1TBEA 2FNJB 1WMHA 1F0ZA 2KOXA 4WJNA 4XC2A 4DHJB 4MELA 1V97A 1IUEA 3B08A 4MSMB 2A4ZA 1WRDB 3WA0A 1C4CA 3URYA 3SD5A 2WXJA 2KVRA 3KUZA 4K3CA 4DXGA 4ZYSA 1Y56A 4DWFA 3ZIMA 2LGSA 3WANA 1IGDA 1PGAA 1E8ZA 3L54A 3AMZA 1L6UA 4HROA 4DHZE 5G5GA 3TEZA 2ZNVC 4BBNC 5DPWA 2KFKB 2IPKD 3Q8EA 1ZXIA 2M4NA 1WR6E 1CJEA 1YQ4B 1MG8A 3L13A 3WAPA 1I4RA 2KACA 4W9KA 2J53A 2KQ4X 2XEWA 1WE6A 4BOZB 2ON8A 4LJOB 1WSPA 2C7MB 1DYQA 5FR6A 4KGRA 2KMAA 2RD0A 3IXSA 1XF5L 1AARA 1Y8RC 2PLPA 3KWVA 2HJ1A 1JALA 2DYMA 2WQYB 4GB9A 3UQAA 1R4MI 3B0AA 4CYEA 2KJ6A 4DQOC 2R61A 4A9AA 4E3CA 3RZFA 1GAQB 1WMHB 4K1RB 5AUIA 3DVGY 1V86A 1JRPA 1JWUD 2N9LA 2LD9A 2PPHA 4ZRIA 1F2RC 3EC8A 4WJOA 3ECIA 3O65B 2Z0EB 2KTRA 2KDBA 2DAJA 1L0XB 1V8CA 2H88B 2BPSA 1LO5D 4GGQA 5E6OA 2E6XA 1WWTA 3IFWB 2LJIA 4MEMA 2L0TA 1ZOYB 4OVVA 1NI3A 3EUB2 3VDZA 3KH0A 3VR9B 1I7HA 3KLSX 2DHZA 2KNBA 2IGGA 2WU5B 3N9YC 1WM3A 2VRRB 3IAM1 4UDUC 2PVGC 4ICUA 2CKHB 3WAMA 1DGJA 5T8IA 2KO3A 1QILA 2BQQA 2PJHA 1RWSA 4REZA 2K9XA 3R7RA 3RCZA 2TSSA 1I42A 2FIDA 3HUIA 1L7YA 1WXSA 2ZW0A 1V1PB 3M62B 2ZPNA 3W5VB 3A33B 1N5XA 1WH3A 2KWCA 1VZ7A 1PDXA 4WQMA 2IO1B 3RN9C 4RGTA 3MJ5A 3APDA 2MJDA 4N6EB 3MHSD 3DBLI 2X38A 2LGYA 2LGDA 3EA6A 1OGWA 1UGJA 2H89B 5J18A 1EU4A 3QARA 4GLSC 2K8BA 2KWVB 5EE9A 1I4QA 1UBIA 1PYWD 2V9HA 3DVNU 1LM8B 2AEHA 1HZ6A 3LDZE 1LQBA 4GSWA 2BWES 2KMMA 2KMCA 5EE1A 1P3QU 3W9CB 2NTTA 3EECA 5IAAC 5C23A 5FK9C 4FN2A 2KWUB 2V0GA 3UGBB 3TL5A 3LJ3A 2EMSA 5C3JB 1XLNA 1F9JA 2RSUA 3ZW3A 3VUXA 3AE2B 1F77A 2N0SB 3MC0B 4L2YA 4BKGA 2MQJA 3DBRI 2DX5B 3QAQA 5C2TB 3BINA 3RFZB 4B0MA 4L1BA 2J42A 3NY5A 4XWWA 4KIKA 3V6CB 2JPHA 2MJEA 2REXA 1ACCA 2J7QB 3PZDA 1GB1A 1EWYC 2W54A 1L4ZB 2L1AA 5DCNA 1C3TA 2KAJA 2KLCA 3DBSA 4OZBA 3GP7A 4HKQA 3BYTB 4RMAA 2G45B 3HRDD 1E7UA 3RNGC 3S2AA 2LRUA 3KUCB 4B9KA 2MCNB 2IJ0A 3CSTA 2D3BA 2KC2A 3QK0A 2HE7A 1STEA 2MRPA 1EM7A 4DK5A 2KDMA 4MGKE 4XDCA 1D5ZC 1WR1A 3W5UB 1V49A 2DBYA 2SEBD 4JE3B 3Q3OC 2K3UA 3Q69A 4JL9A 1SE3A 2N9EB 4EKUA 4ITKA 3TEYA 2KFKA 1UGMA 3JVZX 4W9EA 3V60A 3ZTDA 2HJ8A 1DOIA 1V5OA 3PHXB 3NVZA 4LNKA 3CMMB 2WNMA 3BIID 3H1UA 4ARCA 2N9KA 2WX1A 5IA7A 4G0NB 4ANUA 1A5RA 3ZTCA 2K0PA 2MP2A 1NYRA 1K52A 3N1YC 2Z59B 1IBXA 2FE8A 2I2YA 1WJ4A 3LB8C 1L0YB 4WURA 3IAS1 4HK2A 3V05A 4B0EA 2KD0A 3JYUA 4PYZA 1YX5B 3AM9A 3QX1A 1WX9A 4YXDB 1UWXA 4NNJB 2OHFA 5BMGA 4HDQA 5LXIB 1XLQA 5LXHA 4ZRJA 1GC7A 3NS8A 1OQQA 2FAZA 4HLEA 2QEJC 1WJNA 2KVZA 2WXQA 2LASA 3W2DA 2CJNA 1MVKA 2JVCA 4GDLA 1JWMD 3VXWA 3ZO5B 1E8YA 4TV3A 4NAWA 3Q8AA 4HCNB 4S17A 2ASQA 1JW9D 2LUMA 1PFDA 4XWTA 4C00A 5CHFA 3ZNHB 3DWGC 1B9RA 3RD2A 2RDGA 1YIWA 2GI9A 1SGHA 2ZVOA 3ZJVA 1RLFA 2Y5CA 3I3TB 4XE0A 3KUDB 3A4SC 2KX0A 1V80A 1HTQA 4USAA 1V5TA 4OZAA 4YTMB 2JRIB 2NVUI 3AEAB 2LI5A 2BT6A 2GRIA 3R66C 4KZ0A 4JLCA 4BKSD 2JZ3B 4P7IA 4A20A 2KDFB 4ZHOA 3IVFA 3X23A 4HWIB 1E7PB 3A9JA 3VAWA 4RFBA 3CF6E 1IBXB 1FRRA 4C7YA 1HQRD 2WXOA 3AE3B 2M1MA 4IM0A 3EHVA 2LUEA 2C7HA 5DPTA 1YQ3B 1C77A 3JSVB 4HKZE 4C56C 4MM3A 1WFYA 2G3QB 3AU5A 2INDC 4ZRQA 2VZKD 4WJQA 1T0QC 3PGEA 4AJWA 3OG5A 2AX5A 1F52A 2XN9C 3P4PB 4M8NA 4URKA 3EFUA 3SHQA 1KRHA 2CHZA 4JGHB 5DPSA 3BYYB 3AN1A 3W1SC 4TSSA 1C78A 1TS3A 5MPOA 3DBHI 2V4LA 2R2OA 2ZNVB 5E6PA 2QJLA 1LXDA 2HTME 5JH5C 2BYEA 1P0RA 2Y3AA 1C9FA 2WLBA 4EZKA 5D3IB 1FNWA 2DZJA 4N58A 4K81A 3L08A 3DVNV 3L4PA 4EZLA 2FCMA 2FUHB 1G6JA 4ACFA 3BZDB 4RCOA 3QCAA 1XCTL 2EKIA 4BVUC 2I1JA 4IC7B 3SDLC 1K53A 5I4DA 3PO0A 1KJTA 4DBGA 3UI3A 2RPQA 2M8SA 3Q3MC 2MLBA 4W9IA 4NQLB 2HD5B 1V2YA 2NCNA 1XEEA 3JSVA 4TUUA 4I6PA 4P6VF 2QDFA 4S0RA 4DXAB 3PS6A 5EE0A 1N6ZA 5AZHA 1WGGA 4F8CB 2MW5A 1FMAD 2C7NB 4GDKB 2ONQA 3A9KA 3M3JA 2JUOA 2MH7A 3W1YA 4GDKA 5C1ZA 2JZZA 3DOWA 3K9PB 1IGCA 3T9LA 1ZE3D 4TMAB 4B6WA 3D32A 1L5PA 3RYTA 2JX5A 2L0FA 5DPRA 1LFDA 3UQBA 4P1BC 4H2AA 1V1OA 1P98A 4C80A 4GIVA 2DENB 1ZXHA 3TEXA 1UH6A 2G9HD 1WE7A 2GBKA 3AEDB 3WALA 3U2SC 3H7PB 5BMIA 3B2GA 3ABVB 5KHOA 2CR5A 5HG2A 1N62A 4K7WA 2PVOD 3PT2B 4XYCA 4AP4C 4W9LA 4HJGE 2XBBC 3ML8A 4Q2JA 1WIAA 1XQQA 2QCZA 1T0YA 4ICVA 3AU4A 1FCCC 1VZ6A 5CHWA 1B1ZA 4C7ZA 1UWMA 4YTPB 1H4RA 3BVGA 1PQSA 4OHJA 1QF6A 2MBHA 1CZPA 3M63B 2BBCA 4PYUA 4DDGD 2KN4A 2JU6X 2YEPF 2GBNA 1NI2A 1MG4A 4TKNA 4BKTA 4BOSC 1E0ZA 4IW0A 4RGMA 3C8YA 4ARIA 1WRIA 2KYWA 2NPTB 3GE3C 3BWUD 4F7ZA 3ONSA 4E74A 1ET6A 2FCNA 1Q5WB 2L76A 2L32A 2WXKA 4ANVA 4J3OD 2D2QA 3DCGA 3GB1A 3QWZB 2SAKA 3H7SA 3DVGX 2I1KA 2KDEB 3O13A 2EKEC 1YJ1A 3P63A 1KH0A 4NQKE 2DZMA 1YJIA 4IWPA 2NR2A 4AJYB 3Q6BA 2ZZPB 4O1NA 4W9FA 2J0JA 3TEWA 5IN7A 1XCQL 3FILA 3IG3A 1ESFA 1C4AA 2IO3B 4A3OA 1TY0A 4D2KA 2Z8LA 5CHVC 4RF0A 1UZXB 3P4QB 2WXIA 2KFJA 1VDVA 1D5XC 1F1HA 4US9A 4LDTD 4IWQA 1YD8U 3U7DA 1JWBD 3MFGA 2LXCA 2KQ7A 2LEKA 4LNIA 1JCKB 2DNFA 4IOIE 2FCSA 3V3XA 1WXVA 1PGXA 2KC1A 2WXMA 3MTNB 3K9OB 3H6NA 3AE9B 3U30A 3L0WB 1C76A 3PZ7A 2N9PC 3P2BA 4LK0M 2VH2A 2EELA 1Q1OA 2D07B 3A1QA 1E5WA 1ISNA 2MJ3A 2BKFA 2WDQB 2KLGA 1TKGA 1KM7A 3VFKA 3J9CA 2ZPYA 1L2NA 3VQIA 2K25A 2IBIB 3T3NA 3IT4B 1WJUA 1QZEA 4G3XB 3TIXA 2MA9B 1SE9A 3SEBA 3IBEA 4P1CC 3MP9A 2IDYA 1FNVA 2N1VA 3RT3B 1Z2MA 2IY1B 3SFEB 3AULA 5HKHA 3UF8A 2Y5BB 5BO4B 4P16A 1FXTB 3Q2AC 1YNTE 3N1ZC 5TSSA 3RULA 2EMTA 1E6EB 5HHDG 4BKSA 4FULA 2BVCA 1AYFA 1SIJA 2K39A 4PT5A 1WM2A 1GB4A 4US8A 4R3DA 1Q10A 1AWDA 1HZ5A 1AW7A 5CTRC 4W9HA 2KWDA 3KW5B 2JSVX 4EFOA 1IPGA 3RNFC 3L17A 4KIKB 2JWZA 1RFAA 4MM3B 4A55A 3QQ8B 1MJDA 3DHGC 5JZEB 3ZKJC 3HM6X 3ZQ4A 2KTFA 2WXHA 2YVCA 3Q8BA 1E7VA 3NVWA 1EO6A 1TY2A 3AE7B 2WWZA 2NBUA 5BMHA 2CHWA 2WXFA 4BAXA 2W55A 3GOEA 1BT0A 2D3GA 2LGXA 4IM3A 1E8WA 1EUVB 2N7JA 4LNOA 3TSSA 4NAWB 3AEFB 1EF1A 1KOTA 4WWNA 1FXIA 3L16A 1SB3C 4EEWA 2JYTA 2KKCA 4CQNA 3FKYA 2K22A 3Q8FA 3A4RA 4IDIA 4LDTB 1WGKA 1R7SA 3RNCC 3R2TA 1TJEA 4EE2A 2OJWA 2L3ZA 2WXGA 4A8XC 4PS7A 3DBHB 3Q14C 1V1PA 2WU2B 3Q3JA 3ZXVA 4MSQB 3FILB 4W9JA 2DZIA 4LNFA 1CQVA 1TYGB 1ZDXA 2JXTA 2BYTA 4II2B 3AECB 4B95A 1GOZA 2WP9B 2LWPA 2G4DB 2ZW1A 3BY4B 4YTNB 2V3SA 3MHZA 3VH4B 2XK5B 1RYJA 3KWLA 2WGSA 1ROEA 3A1QB 1K51A 1FIQA 5FR3A 1RAXA 2WXNA 2IYDB 2V3NA 4DXFA 2CS4A 4RNAA 1FFVA 2WHIA 2HDEA 2NPTA 4XGAB 2C5LC 4BFRA 1HEZE 3OJ3A 4KDIC 1GG3A 2MBEA 4RGOS 4AWJA 3QJZA 4FLHA 1H8CA 1S3SG 1XXGA 4HRSA 1T6BX 2CJOA 3LYYA 4HDOA 4E71A 2RGFA 4FHKA 1TZOA 2VZKB 2J0KA 2LHEA 1ZGUB 5GXGB 1OFFA 3R8BA 4J6IA 1T0RC 2BF8B 2JWUA 4M00A 4AQ7A 1ET9A 3OAWA 3KYCD 1WF9A 2ACZB 3KQ4A 4FJVB 1J7AA 4KZCA 3C0RB 2L52A 4KDLB 1DOYA 2AWTA 4KKIA 2GLSA 1D6EC 1J0GA 3VRBB 2N7EA 2LZ6A 4XDDA 4KSKC 4W9CA 3X0WA 2O6VB 4YSZB 2DWQA 2BB5A 2OJRA 1E9MA 3BVZA 5IKCM 1SE2A 3NRZA 3TUOA 1FD6A 4ZYNA 3N1XC 2LRWA 2M0XA 4QAYA 1FFUA 3DQVA 1FPYA 1RFKA 3AE4B 1HXYD 1VLBA 2O2VB 2XNAC 4DHJD 1E90A 3ZVVA 2N7DA 5AZGA 1V6EA 4NZLB 1JWAD 4YT0B 1OEYA 2ZCBA 2J4XA 2NBWB 5FKAC 2PTLA 1ZW7A 2IGDA 1ZDVA 2PMVA 4MT5A 2DYOA 1TTNA
chains in the Genus database with same CATH topology
2X38A 1E10A 3NVYA 1QQRA 3EA6A 4TQ0A 5D3DA 2H89B 1UGJA 1E0ZA 1EU4A 3B2FA 1YMHE 4GLSC 4NJCA 4RGMA 1J7BA 5EE9A 3C8YA 4ARIA 1WRIA 1TS5A 4OW0A 1I4QA 3BWUD 1PYWD 2PIAA 2PW9A 5BYQA 1ET6A 1K50A 2NTSA 1ENFA 1HZ6A 4WWMA 2KMMA 2L32A 3SFDB 1D4BA 3T3OA 5EE1A 2WXKA 3GS2A 4J3OD 1XO3A 3W9CB 4WH4A 1I4HA 5G5HA 2NTTA 3GB1A 5FK9C 1QLBB 2SAKA 1N5WA 2BS4B 2V0GA 3O13A 5C3JB 2RPVA 1XLNA 2INPE 1MPEA 1N63A 3P63A 1KH0A 3AE2B 5HFYA 1F77A 2N0SB 3MC0B 4L2YA 1YJIA 1SJED 2RMMA 4GDLB 2M0AA 1I4GA 4O1NA 3P42A 4RF1A 5C2TB 3RFZB 3TEWA 1XCQL 1C4PA 3FILA 3U52E 4B0MA 1ESFA 4L1BA 2J42A 1C4AA 3R2IA 4TQ1A 4XWWA 1TY0A 3WCQA 2MJEA 3CWIA 3U4EG 2Z8LA 4D2KA 4OZCA 1P7FA 1ACCA 1RM6C 1SXTA 2E3TA 1T3QA 3P4QB 1MI0A 4RF0A 1GB1A 1EWYC 2WXIA 1VDVA 3IT6B 1BMLC 2W54A 1D5XC 4US9A 1L4ZB 2FBWB 2L1AA 1KF6B 2KAJA 4OZBA 4N6EB 1YN5A 3GP7A 4HKQA 1GPXA 1JWBD 3BYTB 4JWSC 1PUTA 3MFGA 5BYRA 3HRDD 3P1MA 2INNE 2LEKA 1JCKB 4OVZA 2YEPB 5EE3A 1D5MC 4IOIE 2NMQA 2IJ0A 1SE4A 3V3XA 1PGXA 2WXMA 5JXVA 4KGSA 2OEDA 4RH6A 1STEA 4WAFA 1WYGA 3AE9B 1EM7A 3BK2A 3CIRB 3Q8CA 4RGNA 2KDMA 2BS3B 4XDCA 1SF0A 1C76A 4ZHPA 3NVVA 1D5ZC 3PZ7A 3W5UB 4LK0M 1YN3A 2V3PA 4A6QA 2DBYA 2SEBD 4JE3B 1N61A 1A70A 1VRAB 2EELA 2K3UA 1NYQA 3Q69A 1SE3A 2G1EA 4ITKA 3TEYA 2RDHA 3P4RB 3LXFA 3AB5A 3U7ZA 2MJ3A 1YN4A 2W3RA 2WDQB 3HVDA 1TKGA 3ETRA 3J9CA 1DOIA 1FO4A 3NVZA 4HEA1 3VRAB 1QOAA 4MACA 3VQIA 2WNMA 3BIID 4ARCA 3T3NA 2N9KA 3IT4B 3FAHA 1J7CA 3NUHB 3SEBA 2K0PA 1NYRA 1K52A 1FXAA 3MP9A 1IBXA 1KLGD 2FE8A 2IDYA 2I2YA 2K5PA 1FNVA 2DLBA 4KGTA 4YWGG 3LB8C 1L0YB 4WURA 1F2RI 3IAS1 3V05A 4B0EA 4YSYB 3SFEB 3AM9A 1SSNA 4KX6B 4YXDB 1TS4A 2BB6A 5H8YE 3RPFC 1JQ4A 4P16A 1UWXA 2MEKA 2QIEB 1YNTE 2JZPA 2OHFA 3EGRA 5BMGA 5TSSA 1P7EA 3PZ8A 3SR6A 1E6EB 5HHDG 1XLQA 2M56B 3AE6B 4KKJA 1AYFA 1SIJA 1L4DB 4PT5A 1OQQA 2QEJC 4ZRPA 4US8A 1NENB 2Q5WD 3I57A 1JWSD 2WXQA 1Q10A 4R3DA 1GB4A 1AWDA 1FRDA 1HZ5A 3FC4A 3VR8B 1AW7A 2JQRB 1XLPA 1BXTA 3W2DA 1QOFA 2QMTA 2CJNA 3AE8B 1MVKA 4FXCA 1L0VB 2LHDA 1JWMD 4LTUA 3BVMA 3Q8AA 2KWDA 2JSVX 4AS1A 1JW9D 2LUMA 2IGHA 1PFDA 4XWTA 2WXPA 3ZYYX 1SJHD 4MM3B 3DWGC 5HI1A 1B9RA 3ZJTA 4A55A 5D7GA 2RDGA 3ZQ4A 2WXHA 2GI9A 2WXLA 3ZJUA 3ZJVA 3Q8BA 3B9JA 2Y5CA 4XE0A 3NVWA 1I4XA 4WIPA 1TY2A 3AE7B 2J52A 4USAA 4MH8A 1FM0D 2AQ3B 4OZAA 5BMHA 2WXFA 2W55A 3OWEB 3W1SA 1HA5A 2GB1A 4YTMB 3H8HA 1OQRA 1QT9A 3BK1A 3AEAB 1ZP0B 3HVZA 2BT6A 2N7JA 2GRIA 1AN8A 2JYEA 2WDVB 3E9SA 2I38A 3NZ3A 3TSSA 2PKOA 4NAWB 3AEFB 1L6VA 1I4PA 1YJJA 3NS1A 1KFYB 2AQ2B 1FXIA 4ZHOA 1VZ8A 4YSXB 1SB3C 1SEBD 2JYTA 1E7PB 2L83A 2BW2A 2LFIA 3DWMA 4CQNA 1MHHE 1DOXA 1EU3A 4RFBA 1VR9A 2K22A 3Q8FA 5BYSA 1IBXB 4L23A 1FRRA 4C7YA 1HQRD 1EWCA 2WXOA 3AE3B 4IDIA 1WGKA 1T5XD 3AEGB 1R7SA 1F0ZA 4M0WA 1YQ3B 4N59A 1C77A 1PGBA 3R2TA 1TJEA 1V97A 1IUEA 4NAMA 4HKZE 3AH7A 3AEBB 4EE2A 3I9V1 4C56C 2WXGA 1C4CA 4A8XC 2ICIA 4JX1C 3URYA 2WXJA 1V1PA 4ZRQA 4DXGA 4ZYSA 2VZKD 2WU2B 1Y56A 3FILB 1IGDA 1PGAA 2AX5A 1CQVA 1QOBA 1TYGB 1FNUA 1ZDXA 2JXTA 3AMZA 2XN9C 3P4PB 1L6UA 1QKZA 3P4SB 2LGIA 4HROA 2BYTA 5G5GA 3E56A 3AECB 3TEZA 1GOZA 1KRHA 2WP9B 4ZOHC 5H92C 3BYYB 3AN1A 4TSSA 1C78A 2ZW1A 1TS3A 4A90A 5MPOA 2IPKD 3Q8EA 4YTNB 3MHZA 1BUIC 1RYJA 1ZXIA 1JMLA 3KWLA 1CJEA 2QJLA 1YQ4B 1ROEA 2HTME 1K51A 1UUPA 1FIQA 1I4RA 2KACA 2WLBA 2Y3AA 5FR3A 1C9FA 2WXNA 5D3IB 1WXQA 1FNWA 2V3NA 4DXFA 4N58A 2J53A 2KQ4X 2V4IB 4RNAA 1TKEA 2M19A 1UNSA 1XLOA 3L4PA 4IKGA 2WXRA 1FFVA 2ON8A 1TS2A 1TKYA 3BZDB 1WSPA 1DYQA 2HDEA 1N60A 4RCOA 1XCTL 2EKIA 4KGRA 1HEZE 3IXSA 1XF5L 2PLPA 3KWVA 1MHXA 4RGOS 1JALA 2DYMA 2WS3B 2WQYB 1K53A 5I4DA 1XXGA 4HRSA 1FCLA 1T6BX 2CJOA 3PO0A 2B76B 3LYYA 3UI3A 4DQOC 2R61A 4A9AA 4LLGM 2FUG1 1GAQB 1CK1A 5AUIA 1VJKA 1TZOA 1XEEA 2VZKB 4P6VF 1JRPA 1KTKA 2LHEA 5GXGB 1OFFA 1JWUD 3R8BA 5EE0A 1KLUD 3ZGZA 2N9LA 2D5GA 1F2RC 2LMCA 2JWUA 4AQ7A 1ET9A 2CU3A 3AE5B 1JROA 1FMAD 1L0XB 2ACZB 3KQ4A 2QILA 4GDKB 2ONQA 1V8CA 2H88B 2QSDA 1J7AA 2L52A 1DOYA 1LO5D 2MH7A 5LNK1 3AE1B 4KKIA 2E6XA 1D6EC 1IGCA 1WWTA 4JPSA 3VRBB 4XDDA 1ZE3D 4TMAB 2LJIA 1ZOYB 1ZUD2 1L5PA 5E6JA 2JX5A 1NI3A 3EUB2 2Y5PA 3VR9B 4YSZB 1I7HA 3KLSX 2DWQA 4H2AA 1V1OA 2BB5A 4C80A 2IGGA 2WU5B 1E9MA 3N9YC 3BVZA 1ZXHA 3TEXA 1SE2A 3NRZA 3AEEB 2G9HD 3IAM1 4UDUC 2PVGC 5AUKA 3TUOA 1FD6A 3AEDB 3AV8A 3U2SC 1FFUA 1DGJA 5T8IA 5BMIA 3B2GA 1QILA 3ABVB 1RFKA 2WDRB 1RWSA 3AE4B 2K9XA 4REZA 5HG2A 1HXYD 1N62A 1VLBA 2PVOD 2TSSA 2BS2B 4JWUC 3HUIA 4HJGE 1NVID 2W82A 4Q2JA 2ZW0A 1SBBB 2AQ1B 2XNAC 1V1PB 3W5VB 1M4VA 1N5XA 4NZLB 1FCCC 1JWAD 4YT0B 1VZ6A 4C7ZA 1B1ZA 2J4XA 1VZ7A 1UWMA 4YTPB 3BVGA 1PDXA 4OHJA 4WQMA 1QF6A 1NEKB 5FKAC 2BTEA 1CZPA 2PTLA 2BBCA 2IGDA 1ZDVA 1ZPSA 4RGTA 2KN4A 1FEHA 1QOGA 3MJ5A 2JU6X 2PMVA 4MT5A 2YEPF 1C79A 2W3SA 2MJDA 2DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1E A;  4ITK A;  4YTM B;  3NVY A;  1E10 A;  3P4R B;  3LXF A;  3AB5 A;  1OQR A;  1QT9 A;  2MJ3 A;  3AEA B;  1JAL A;  1ZP0 B;  2H89 B;  2BT6 A;  2W3R A;  2WDQ B;  2WS3 B;  2WQY B;  3HVZ A;  1E0Z A;  1TKG A;  3B2F A;  2WDV B;  4HRS A;  3ETR A;  2CJO A;  1DOI A;  3PO0 A;  1J7B A;  3NVZ A;  5EE9 A;  1FO4 A;  3VRA B;  1QOA A;  2B76 B;  2PKO A;  1WRI A;  3BII D;  4A9A A;  2PIA A;  3AEF B;  3FAH A;  1L6V A;  1GAQ B;  1YJJ A;  3NS1 A;  1KFY B;  4WWM A;  1VJK A;  1J7C A;  5AUI A;  1FXI A;  4ZHO A;  2KMM A;  1NYR A;  4P6V F;  1JRP A;  4YSX B;  1SB3 C;  3DWM A;  3SFD B;  1E7P B;  1OFF A;  1FXA A;  2L83 A;  5EE1 A;  5GXG B;  5EE0 A;  1XO3 A;  1DOX A;  3W9C B;  5G5H A;  2K5P A;  2K22 A;  1QLB B;  3LB8 C;  2CU3 A;  1FRR A;  3AE5 B;  1N5W A;  2BS4 B;  1JRO A;  4C7Y A;  1FMA D;  3AE3 B;  4IDI A;  2ACZ B;  4YSY B;  1WGK A;  3SFE B;  5C3J B;  1V8C A;  2H88 B;  3AM9 A;  1J7A A;  1R7S A;  1XLN A;  3AEG B;  2L52 A;  4KX6 B;  4YXD B;  1DOY A;  5H8Y E;  1F0Z A;  1YQ3 B;  4N59 A;  3RPF C;  2MH7 A;  1JQ4 A;  1TJE A;  1V97 A;  1IUE A;  1N63 A;  3AE1 B;  3P63 A;  2QIE B;  3AE2 B;  2N0S B;  2OHF A;  3AH7 A;  3AEB B;  1YJI A;  1WWT A;  3VRB B;  3SR6 A;  1E6E B;  1XLQ A;  2M56 B;  3AE6 B;  4JX1 C;  5C2T B;  1AYF A;  1ZOY B;  1SIJ A;  1ZUD 2;  1L5P A;  2JX5 A;  1NI3 A;  3EUB 2;  2WU2 B;  3VR9 B;  1OQQ A;  4YSZ B;  1I7H A;  4US8 A;  1NEN B;  2Q5W D;  3NRZ A;  2DWQ A;  3WCQ A;  2MJE A;  3CWI A;  1AWD A;  1FRD A;  3FC4 A;  3VR8 B;  4C80 A;  1RM6 C;  2WU5 B;  1E9M A;  1T3Q A;  1XLP A;  2JQR B;  2E3T A;  3P4Q B;  2AX5 A;  1EWY C;  1QOB A;  1VDV A;  1QOF A;  3AE8 B;  1TYG B;  2CJN A;  2W54 A;  3AEE B;  3AMZ A;  2PVG C;  3P4P B;  4FXC A;  4US9 A;  1L0V B;  1L6U A;  2FBW B;  3AED B;  3AV8 A;  3P4S B;  4HRO A;  1KF6 B;  5G5G A;  2KAJ A;  3AEC B;  1FFU A;  4LTU A;  1DGJ A;  1KRH A;  4N6E B;  2WP9 B;  3B2G A;  1GPX A;  3ABV B;  4ZOH C;  1JWB D;  1RFK A;  2WDR B;  5H92 C;  4JWS C;  1RWS A;  3AE4 B;  1PUT A;  1JW9 D;  2K9X A;  1VLB A;  1N62 A;  3AN1 A;  3HRD D;  5MPO A;  2PVO D;  1PFD A;  2BS2 B;  2LEK A;  3P1M A;  5AUK A;  4JWU C;  4YTN B;  5EE3 A;  3HUI A;  1RYJ A;  3ZYY X;  1ZXI A;  1NVI D;  3KWL A;  3DWG C;  1CJE A;  2QJL A;  1B9R A;  1YQ4 B;  1ROE A;  2HTM E;  3W5V B;  1N5X A;  1FIQ A;  1JWA D;  2WLB A;  4YT0 B;  4C7Z A;  1UWM A;  1WXQ A;  1WYG A;  3AE9 B;  4YTP B;  1PDX A;  3CIR B;  4N58 A;  1QF6 A;  3B9J A;  4WQM A;  2BS3 B;  1SF0 A;  2Y5C A;  1NEK B;  1TKE A;  4ZHP A;  3NVV A;  3NVW A;  1CZP A;  2M19 A;  1XLO A;  3L4P A;  1FFV A;  3W5U B;  1TKY A;  3AE7 B;  1QOG A;  1N60 A;  2DBY A;  4USA A;  1N61 A;  2EKI A;  1FM0 D;  1A70 A;  2W3S A;  1NYQ A;  2MJD A;  2W55 A; 
#chains in the Genus database with same CATH topology
 1OQY A;  5D3D A;  3VTV A;  3B2F A;  4FJZ A;  3PLU A;  3RUI B;  3DHH C;  4NJC A;  1UEL A;  3TBL D;  1KLV A;  1TS5 A;  4XX5 A;  4GN1 A;  2PW9 A;  4DDI D;  5BYQ A;  2AL6 A;  2NTS A;  4EUT A;  3SFD B;  2MBB B;  3T3O A;  1XO3 A;  1WGR A;  1WXM A;  1QLB B;  2MHJ A;  3H9D A;  3ZNZ B;  1N5W A;  2WX0 A;  5G2N A;  2DYB A;  1MPE A;  1N63 A;  5HFY A;  4DHZ B;  1SJE D;  4EZJ A;  3JW0 X;  3VH3 B;  3P42 A;  3U52 E;  5J2R A;  3R2I A;  4MJS B;  3CWI A;  3V61 A;  2O6V A;  4OZC A;  1P7F A;  1RM6 C;  2E3T A;  3IT6 B;  1BML C;  3PRP B;  5IP4 D;  2FBW B;  1HE8 A;  2RR9 A;  1WGD A;  1C1Y B;  1M94 A;  1GPX A;  2K1F A;  4HPL B;  3N20 C;  4JWS C;  3KVF B;  2L05 A;  3P1M A;  2GBM A;  4OVZ A;  2YEP B;  5EE3 A;  2NMQ A;  4IUM B;  2BWF A;  3DBR B;  2XK5 A;  4FJY A;  3WAO A;  4KGS A;  2D11 A;  2L00 B;  1WYG A;  3CIR B;  3Q8C A;  4RGN A;  4W9G A;  1SF0 A;  2MSE D;  2WDT B;  1UBQ A;  3NVV A;  4KVG B;  4ZHP A;  3VTW A;  1N61 A;  1V81 A;  1NYQ A;  1ZKH A;  4OVU A;  4HVB A;  2G1E A;  3I5J C;  3P4R B;  3LXF A;  2W3R A;  1V9J A;  3VRA B;  1QOA A;  4MAC A;  1TGZ B;  1VCB A;  3FAH A;  3RNA C;  3VTU A;  3TJP A;  1KLG D;  3A9K B;  3GZN B;  3MJW A;  2K5P A;  4KGT A;  1WXA A;  5D6J B;  2AYO B;  2K6Q A;  4EOY A;  3DPD A;  1XT9 B;  4K7S A;  1SSN A;  2LXA A;  4KX6 B;  5H8Y E;  3RPF C;  2D3C A;  2JT4 B;  1R4M B;  3EGR A;  2N4F A;  2MWS B;  3PZ8 A;  1WJ6 A;  2M56 B;  3AE6 B;  4KKJ A;  1L4D B;  1NEN B;  1JWS D;  1FRD A;  3FC4 A;  1T0S C;  5EDS A;  4BZA A;  2JQR B;  1BXT A;  1JRU A;  1QOF A;  2NS5 A;  4FXC A;  1L0V B;  2LHD A;  4LTU A;  3BVM A;  2LVP A;  4AS1 A;  3ZRC A;  2JXX A;  4MH0 E;  3N30 A;  2WXP A;  3NZU A;  2K6D B;  3QHT A;  3ZYY X;  1SJH D;  1D3Z A;  2KAN A;  2PE6 B;  1J19 A;  1J8C A;  2WXL A;  4ASW C;  2BYV E;  2DAF A;  2UYZ B;  2B3A A;  1YX6 B;  2CHX A;  2MX2 A;  1I4X A;  4NJ6 A;  3PRE A;  2HTH A;  3OWE B;  3W1S A;  1HA5 A;  2GB1 A;  3H8H A;  2MP2 B;  1OQR A;  3BK1 A;  2O2V A;  2GMI C;  1AN8 A;  2JYE A;  3ZLZ A;  4X57 B;  3E9S A;  1Z5S B;  2I38 A;  2RDB C;  2LVO A;  3PTF C;  2M17 A;  1I4P A;  1YJJ A;  3KYD D;  4LCD E;  2O6V D;  4YSX B;  1SEB D;  2L83 A;  1MHH E;  4K3B A;  1EU3 A;  2R2Q A;  2KJR A;  2VH1 A;  2BGF A;  1EWC A;  4ANW A;  4G11 A;  1T5X D;  3AEG B;  4M0W A;  3H7P A;  4N59 A;  1PGB A;  4NAM A;  3IHP C;  3AH7 A;  3AEB B;  3I9V 1;  2JF5 A;  4PS3 A;  5TR5 A;  3RNB C;  1K8R B;  2ICI A;  4JX1 C;  1CMX B;  1R4N I;  2BKR B;  4FAD A;  4N9F 4;  1WYW B;  1E8X A;  1QOB A;  1FNU A;  2KK8 A;  3RMK C;  1QKZ A;  3P4S B;  2LGI A;  2IO2 B;  3E56 A;  4MGI E;  4ZOH C;  4AUQ C;  5H92 C;  4A90 A;  3SU8 X;  1IYF A;  2BYF A;  2KJH B;  1MFW A;  1BUI C;  3OJ4 B;  1JML A;  2D3A A;  3V6E B;  5IO9 A;  1Q0W B;  4I6L B;  3RNE C;  3TCA A;  1UUP A;  4GOC A;  2J0M A;  4MDK E;  3GZN I;  5AEK B;  1WXQ A;  3ZUN A;  2V4I B;  3NOB A;  1TKE A;  2M19 A;  1UNS A;  1XLO A;  4WWO A;  4IKG A;  2WXR A;  1TS2 A;  1TKY A;  1GJZ A;  1HTO A;  3U8Z A;  1N60 A;  1NDD A;  3ZXR A;  1TZ1 A;  1X1M A;  1IP9 A;  4KV2 A;  1MHX A;  2YLM A;  2WS3 B;  5AZF A;  1WZ0 A;  1FCL A;  2B76 B;  4G50 A;  5L83 A;  5KHQ A;  4LLG M;  2FUG 1;  1U4A A;  1CK1 A;  3ZRF A;  5L95 C;  1VJK A;  3VHT C;  1KTK A;  3I63 C;  4CHK A;  1KLU D;  3ZGZ A;  4ZRK A;  2D5G A;  4W9D A;  2LMC A;  5J17 A;  3QA8 A;  4MGZ E;  4FBJ B;  2CU3 A;  3AE5 B;  1JRO A;  1WI0 A;  5G55 A;  1EF5 A;  2QIL A;  2L7R A;  2QSD A;  2KXJ A;  5LNK 1;  3AE1 B;  4GMV A;  1TIF A;  4JPS A;  4HPM B;  1ZUD 2;  5E6J A;  4NPN A;  2QC8 A;  2Y5P A;  4AOF A;  2W9N A;  3APF A;  5IOI A;  4BBN F;  3QIJ A;  2CU1 A;  3AEE B;  5AUK A;  3ZNI D;  3PVL A;  3AV8 A;  3HK0 A;  2C60 A;  3TMP B;  3PRZ A;  2WDR B;  1XD3 B;  3GE8 C;  2BS2 B;  4JWU C;  2KTR B;  1NVI D;  2W82 A;  3N3K B;  1SBB B;  2AQ1 B;  3PSE B;  2IY0 B;  4HCP B;  1M4V A;  3NHE B;  4NJ7 A;  3Q3N C;  3A9J B;  4PS8 A;  4M8M A;  2C9W B;  2PEA A;  2ZVN A;  1NEK B;  2Z0D B;  2KN5 A;  2BTE A;  3RZW C;  1ZPS A;  1TT5 B;  1FEH A;  1QOG A;  3HIZ A;  1C79 A;  2W3S A;  3HVZ A;  2LVQ A;  2INC C;  1E10 A;  3NVY A;  3VUW A;  4ZDV A;  1QQR A;  4TQ0 A;  3R7Q A;  2KHW B;  4IM2 A;  4HJK A;  3V62 A;  3VVW B;  2NBV B;  2KX3 A;  1YMH E;  3T8M A;  4K7U A;  2GBR A;  3DHI C;  1J7B A;  3HHM A;  2K8H A;  4OW0 A;  2L8J A;  2KT7 A;  2PIA A;  3PHW B;  1WGH A;  4F1S A;  1K50 A;  3CSF A;  4M0W B;  1P9D U;  1ENF A;  1VD2 A;  4WWM A;  2GOW A;  3UIO B;  3EFC A;  1D4B A;  3GS2 A;  4WH4 A;  2DZK A;  1I4H A;  5G5H A;  1I35 A;  2GBJ A;  2BS4 B;  4NY0 A;  4M01 A;  3WIM A;  2RPV A;  1OTR B;  5E6N A;  1S1Q B;  3L10 B;  3ZDM C;  2INP E;  2A5U A;  2N1W A;  4IG7 B;  2PE9 A;  3MC9 A;  2RMM A;  4GDL B;  5JHA A;  2M0A A;  3PPA A;  1I4G A;  4RF1 A;  1C4P A;  4TQ1 A;  4II3 B;  3WCQ A;  1RRB A;  3U4E G;  2MBQ A;  3ML9 A;  1SXT A;  1T3Q A;  1MI0 A;  4LNN A;  2KQS A;  4PK1 A;  4KSL C;  3HM3 A;  1KF6 B;  1YN5 A;  1PUT A;  5BYR A;  4M02 A;  2INN E;  4IWO A;  3AXC A;  1D5M C;  1GC6 A;  2JY6 A;  1SE4 A;  2FCQ A;  3PV1 A;  5JXV A;  3APC A;  2LJ5 A;  2OED A;  4RH6 A;  5D2M B;  4WAF A;  2WYQ A;  3BK2 A;  1GNU A;  3DBL B;  3ENE A;  4XZ4 A;  2BS3 B;  1LGR A;  3NG0 A;  1YN3 A;  2V3P A;  4A6Q A;  2N9X A;  1P1A A;  1A70 A;  1VRA B;  4I6N B;  2RDH A;  1UF0 A;  4A3P A;  3AB5 A;  3U7Z A;  1YN4 A;  3HVD A;  4RM9 A;  1SIF A;  3ETR A;  1FO4 A;  4HEA 1;  4WAA A;  3R3M A;  3RI7 C;  2KZR A;  1J7C A;  3ALB A;  3NUH B;  4JQW C;  1FXA A;  5LLI A;  4FA6 A;  2DLB A;  4YWG G;  1F2R I;  3B1L X;  4YSY B;  3PLV A;  4GU2 A;  4CO7 A;  4HPP A;  1TS4 A;  2BB6 A;  4WWP A;  1JQ4 A;  2MEK A;  2QIE B;  2JZP A;  1P7E A;  4YL8 A;  3SR6 A;  4ANX A;  2K8C A;  3ZNG C;  3M95 A;  3ZDT A;  4RM8 A;  2UWQ A;  2IO0 B;  3C19 A;  4LJP B;  1GUA B;  2Q5W D;  3I57 A;  4ZRP A;  2QHO A;  3VR8 B;  1WY8 A;  1UD7 A;  2FIF A;  2OOB B;  4C4V B;  1XLP A;  5JHB A;  3DDC B;  3AE8 B;  2QMT A;  2JRH A;  2UU7 A;  3PRM B;  4C4V A;  2ZCC A;  4FHJ A;  5CX3 A;  1YOV B;  2KDI A;  1WGY A;  2IGH A;  3NZS A;  4WQO B;  4WJP A;  1WX8 A;  5HI1 A;  3ZJT A;  2ZEQ A;  5D7G A;  1WX7 A;  3VUY A;  3UIP B;  3ZJU A;  2V1Y A;  3B9J A;  5GMV A;  3AI5 A;  3OLM D;  4WIP A;  2J52 A;  3NJT A;  4MH8 A;  1R4N B;  1FM0 D;  2AQ3 B;  1OEY J;  3N32 A;  4MJS A;  4GXB A;  3UIN B;  2MBO A;  1QT9 A;  1ZP0 B;  5D94 A;  2IZV B;  2G4S A;  2WDV B;  1WZ3 A;  3NZ3 A;  3MC8 A;  2PKO A;  2AL3 A;  1NBF C;  1L6V A;  3Q3F A;  4MGY E;  1YQB A;  4HXD A;  3NS1 A;  1KFY B;  2AQ2 B;  1VZ8 A;  3QC8 B;  3DWM A;  2LFI A;  2ZJD A;  2BW2 A;  1DOX A;  2D10 A;  4JIO U;  2X8X X;  1VR9 A;  5BYS A;  4L23 A;  1TBE A;  2FNJ B;  1WMH A;  1F0Z A;  2KOX A;  4WJN A;  4XC2 A;  4DHJ B;  4MEL A;  1V97 A;  1IUE A;  3B08 A;  4MSM B;  2A4Z A;  1WRD B;  3WA0 A;  1C4C A;  3URY A;  3SD5 A;  2WXJ A;  2KVR A;  3KUZ A;  4K3C A;  4DXG A;  4ZYS A;  1Y56 A;  4DWF A;  3ZIM A;  2LGS A;  3WAN A;  1IGD A;  1PGA A;  1E8Z A;  3L54 A;  3AMZ A;  1L6U A;  4HRO A;  4DHZ E;  5G5G A;  3TEZ A;  2ZNV C;  4BBN C;  5DPW A;  2KFK B;  2IPK D;  3Q8E A;  1ZXI A;  2M4N A;  1WR6 E;  1CJE A;  1YQ4 B;  1MG8 A;  3L13 A;  3WAP A;  1I4R A;  2KAC A;  4W9K A;  2J53 A;  2KQ4 X;  2XEW A;  1WE6 A;  4BOZ B;  2ON8 A;  4LJO B;  1WSP A;  2C7M B;  1DYQ A;  5FR6 A;  4KGR A;  2KMA A;  2RD0 A;  3IXS A;  1XF5 L;  1AAR A;  1Y8R C;  2PLP A;  3KWV A;  2HJ1 A;  1JAL A;  2DYM A;  2WQY B;  4GB9 A;  3UQA A;  1R4M I;  3B0A A;  4CYE A;  2KJ6 A;  4DQO C;  2R61 A;  4A9A A;  4E3C A;  3RZF A;  1GAQ B;  1WMH B;  4K1R B;  5AUI A;  3DVG Y;  1V86 A;  1JRP A;  1JWU D;  2N9L A;  2LD9 A;  2PPH A;  4ZRI A;  1F2R C;  3EC8 A;  4WJO A;  3ECI A;  3O65 B;  2Z0E B;  2KTR A;  2KDB A;  2DAJ A;  1L0X B;  1V8C A;  2H88 B;  2BPS A;  1LO5 D;  4GGQ A;  5E6O A;  2E6X A;  1WWT A;  3IFW B;  2LJI A;  4MEM A;  2L0T A;  1ZOY B;  4OVV A;  1NI3 A;  3EUB 2;  3VDZ A;  3KH0 A;  3VR9 B;  1I7H A;  3KLS X;  2DHZ A;  2KNB A;  2IGG A;  2WU5 B;  3N9Y C;  1WM3 A;  2VRR B;  3IAM 1;  4UDU C;  2PVG C;  4ICU A;  2CKH B;  3WAM A;  1DGJ A;  5T8I A;  2KO3 A;  1QIL A;  2BQQ A;  2PJH A;  1RWS A;  4REZ A;  2K9X A;  3R7R A;  3RCZ A;  2TSS A;  1I42 A;  2FID A;  3HUI A;  1L7Y A;  1WXS A;  2ZW0 A;  1V1P B;  3M62 B;  2ZPN A;  3W5V B;  3A33 B;  1N5X A;  1WH3 A;  2KWC A;  1VZ7 A;  1PDX A;  4WQM A;  2IO1 B;  3RN9 C;  4RGT A;  3MJ5 A;  3APD A;  2MJD A;  4N6E B;  3MHS D;  3DBL I;  2X38 A;  2LGY A;  2LGD A;  3EA6 A;  1OGW A;  1UGJ A;  2H89 B;  5J18 A;  1EU4 A;  3QAR A;  4GLS C;  2K8B A;  2KWV B;  5EE9 A;  1I4Q A;  1UBI A;  1PYW D;  2V9H A;  3DVN U;  1LM8 B;  2AEH A;  1HZ6 A;  3LDZ E;  1LQB A;  4GSW A;  2BWE S;  2KMM A;  2KMC A;  5EE1 A;  1P3Q U;  3W9C B;  2NTT A;  3EEC A;  5IAA C;  5C23 A;  5FK9 C;  4FN2 A;  2KWU B;  2V0G A;  3UGB B;  3TL5 A;  3LJ3 A;  2EMS A;  5C3J B;  1XLN A;  1F9J A;  2RSU A;  3ZW3 A;  3VUX A;  3AE2 B;  1F77 A;  2N0S B;  3MC0 B;  4L2Y A;  4BKG A;  2MQJ A;  3DBR I;  2DX5 B;  3QAQ A;  5C2T B;  3BIN A;  3RFZ B;  4B0M A;  4L1B A;  2J42 A;  3NY5 A;  4XWW A;  4KIK A;  3V6C B;  2JPH A;  2MJE A;  2REX A;  1ACC A;  2J7Q B;  3PZD A;  1GB1 A;  1EWY C;  2W54 A;  1L4Z B;  2L1A A;  5DCN A;  1C3T A;  2KAJ A;  2KLC A;  3DBS A;  4OZB A;  3GP7 A;  4HKQ A;  3BYT B;  4RMA A;  2G45 B;  3HRD D;  1E7U A;  3RNG C;  3S2A A;  2LRU A;  3KUC B;  4B9K A;  2MCN B;  2IJ0 A;  3CST A;  2D3B A;  2KC2 A;  3QK0 A;  2HE7 A;  1STE A;  2MRP A;  1EM7 A;  4DK5 A;  2KDM A;  4MGK E;  4XDC A;  1D5Z C;  1WR1 A;  3W5U B;  1V49 A;  2DBY A;  2SEB D;  4JE3 B;  3Q3O C;  2K3U A;  3Q69 A;  4JL9 A;  1SE3 A;  2N9E B;  4EKU A;  4ITK A;  3TEY A;  2KFK A;  1UGM A;  3JVZ X;  4W9E A;  3V60 A;  3ZTD A;  2HJ8 A;  1DOI A;  1V5O A;  3PHX B;  3NVZ A;  4LNK A;  3CMM B;  2WNM A;  3BII D;  3H1U A;  4ARC A;  2N9K A;  2WX1 A;  5IA7 A;  4G0N B;  4ANU A;  1A5R A;  3ZTC A;  2K0P A;  2MP2 A;  1NYR A;  1K52 A;  3N1Y C;  2Z59 B;  1IBX A;  2FE8 A;  2I2Y A;  1WJ4 A;  3LB8 C;  1L0Y B;  4WUR A;  3IAS 1;  4HK2 A;  3V05 A;  4B0E A;  2KD0 A;  3JYU A;  4PYZ A;  1YX5 B;  3AM9 A;  3QX1 A;  1WX9 A;  4YXD B;  1UWX A;  4NNJ B;  2OHF A;  5BMG A;  4HDQ A;  5LXI B;  1XLQ A;  5LXH A;  4ZRJ A;  1GC7 A;  3NS8 A;  1OQQ A;  2FAZ A;  4HLE A;  2QEJ C;  1WJN A;  2KVZ A;  2WXQ A;  2LAS A;  3W2D A;  2CJN A;  1MVK A;  2JVC A;  4GDL A;  1JWM D;  3VXW A;  3ZO5 B;  1E8Y A;  4TV3 A;  4NAW A;  3Q8A A;  4HCN B;  4S17 A;  2ASQ A;  1JW9 D;  2LUM A;  1PFD A;  4XWT A;  4C00 A;  5CHF A;  3ZNH B;  3DWG C;  1B9R A;  3RD2 A;  2RDG A;  1YIW A;  2GI9 A;  1SGH A;  2ZVO A;  3ZJV A;  1RLF A;  2Y5C A;  3I3T B;  4XE0 A;  3KUD B;  3A4S C;  2KX0 A;  1V80 A;  1HTQ A;  4USA A;  1V5T A;  4OZA A;  4YTM B;  2JRI B;  2NVU I;  3AEA B;  2LI5 A;  2BT6 A;  2GRI A;  3R66 C;  4KZ0 A;  4JLC A;  4BKS D;  2JZ3 B;  4P7I A;  4A20 A;  2KDF B;  4ZHO A;  3IVF A;  3X23 A;  4HWI B;  1E7P B;  3A9J A;  3VAW A;  4RFB A;  3CF6 E;  1IBX B;  1FRR A;  4C7Y A;  1HQR D;  2WXO A;  3AE3 B;  2M1M A;  4IM0 A;  3EHV A;  2LUE A;  2C7H A;  5DPT A;  1YQ3 B;  1C77 A;  3JSV B;  4HKZ E;  4C56 C;  4MM3 A;  1WFY A;  2G3Q B;  3AU5 A;  2IND C;  4ZRQ A;  2VZK D;  4WJQ A;  1T0Q C;  3PGE A;  4AJW A;  3OG5 A;  2AX5 A;  1F52 A;  2XN9 C;  3P4P B;  4M8N A;  4URK A;  3EFU A;  3SHQ A;  1KRH A;  2CHZ A;  4JGH B;  5DPS A;  3BYY B;  3AN1 A;  3W1S C;  4TSS A;  1C78 A;  1TS3 A;  5MPO A;  3DBH I;  2V4L A;  2R2O A;  2ZNV B;  5E6P A;  2QJL A;  1LXD A;  2HTM E;  5JH5 C;  2BYE A;  1P0R A;  2Y3A A;  1C9F A;  2WLB A;  4EZK A;  5D3I B;  1FNW A;  2DZJ A;  4N58 A;  4K81 A;  3L08 A;  3DVN V;  3L4P A;  4EZL A;  2FCM A;  2FUH B;  1G6J A;  4ACF A;  3BZD B;  4RCO A;  3QCA A;  1XCT L;  2EKI A;  4BVU C;  2I1J A;  4IC7 B;  3SDL C;  1K53 A;  5I4D A;  3PO0 A;  1KJT A;  4DBG A;  3UI3 A;  2RPQ A;  2M8S A;  3Q3M C;  2MLB A;  4W9I A;  4NQL B;  2HD5 B;  1V2Y A;  2NCN A;  1XEE A;  3JSV A;  4TUU A;  4I6P A;  4P6V F;  2QDF A;  4S0R A;  4DXA B;  3PS6 A;  5EE0 A;  1N6Z A;  5AZH A;  1WGG A;  4F8C B;  2MW5 A;  1FMA D;  2C7N B;  4GDK B;  2ONQ A;  3A9K A;  3M3J A;  2JUO A;  2MH7 A;  3W1Y A;  4GDK A;  5C1Z A;  2JZZ A;  3DOW A;  3K9P B;  1IGC A;  3T9L A;  1ZE3 D;  4TMA B;  4B6W A;  3D32 A;  1L5P A;  3RYT A;  2JX5 A;  2L0F A;  5DPR A;  1LFD A;  3UQB A;  4P1B C;  4H2A A;  1V1O A;  1P98 A;  4C80 A;  4GIV A;  2DEN B;  1ZXH A;  3TEX A;  1UH6 A;  2G9H D;  1WE7 A;  2GBK A;  3AED B;  3WAL A;  3U2S C;  3H7P B;  5BMI A;  3B2G A;  3ABV B;  5KHO A;  2CR5 A;  5HG2 A;  1N62 A;  4K7W A;  2PVO D;  3PT2 B;  4XYC A;  4AP4 C;  4W9L A;  4HJG E;  2XBB C;  3ML8 A;  4Q2J A;  1WIA A;  1XQQ A;  2QCZ A;  1T0Y A;  4ICV A;  3AU4 A;  1FCC C;  1VZ6 A;  5CHW A;  1B1Z A;  4C7Z A;  1UWM A;  4YTP B;  1H4R A;  3BVG A;  1PQS A;  4OHJ A;  1QF6 A;  2MBH A;  1CZP A;  3M63 B;  2BBC A;  4PYU A;  4DDG D;  2KN4 A;  2JU6 X;  2YEP F;  2GBN A;  1NI2 A;  1MG4 A;  4TKN A;  4BKT A;  4BOS C;  1E0Z A;  4IW0 A;  4RGM A;  3C8Y A;  4ARI A;  1WRI A;  2KYW A;  2NPT B;  3GE3 C;  3BWU D;  4F7Z A;  3ONS A;  4E74 A;  1ET6 A;  2FCN A;  1Q5W B;  2L76 A;  2L32 A;  2WXK A;  4ANV A;  4J3O D;  2D2Q A;  3DCG A;  3GB1 A;  3QWZ B;  2SAK A;  3H7S A;  3DVG X;  2I1K A;  2KDE B;  3O13 A;  2EKE C;  1YJ1 A;  3P63 A;  1KH0 A;  4NQK E;  2DZM A;  1YJI A;  4IWP A;  2NR2 A;  4AJY B;  3Q6B A;  2ZZP B;  4O1N A;  4W9F A;  2J0J A;  3TEW A;  5IN7 A;  1XCQ L;  3FIL A;  3IG3 A;  1ESF A;  1C4A A;  2IO3 B;  4A3O A;  1TY0 A;  4D2K A;  2Z8L A;  5CHV C;  4RF0 A;  1UZX B;  3P4Q B;  2WXI A;  2KFJ A;  1VDV A;  1D5X C;  1F1H A;  4US9 A;  4LDT D;  4IWQ A;  1YD8 U;  3U7D A;  1JWB D;  3MFG A;  2LXC A;  2KQ7 A;  2LEK A;  4LNI A;  1JCK B;  2DNF A;  4IOI E;  2FCS A;  3V3X A;  1WXV A;  1PGX A;  2KC1 A;  2WXM A;  3MTN B;  3K9O B;  3H6N A;  3AE9 B;  3U30 A;  3L0W B;  1C76 A;  3PZ7 A;  2N9P C;  3P2B A;  4LK0 M;  2VH2 A;  2EEL A;  1Q1O A;  2D07 B;  3A1Q A;  1E5W A;  1ISN A;  2MJ3 A;  2BKF A;  2WDQ B;  2KLG A;  1TKG A;  1KM7 A;  3VFK A;  3J9C A;  2ZPY A;  1L2N A;  3VQI A;  2K25 A;  2IBI B;  3T3N A;  3IT4 B;  1WJU A;  1QZE A;  4G3X B;  3TIX A;  2MA9 B;  1SE9 A;  3SEB A;  3IBE A;  4P1C C;  3MP9 A;  2IDY A;  1FNV A;  2N1V A;  3RT3 B;  1Z2M A;  2IY1 B;  3SFE B;  3AUL A;  5HKH A;  3UF8 A;  2Y5B B;  5BO4 B;  4P16 A;  1FXT B;  3Q2A C;  1YNT E;  3N1Z C;  5TSS A;  3RUL A;  2EMT A;  1E6E B;  5HHD G;  4BKS A;  4FUL A;  2BVC A;  1AYF A;  1SIJ A;  2K39 A;  4PT5 A;  1WM2 A;  1GB4 A;  4US8 A;  4R3D A;  1Q10 A;  1AWD A;  1HZ5 A;  1AW7 A;  5CTR C;  4W9H A;  2KWD A;  3KW5 B;  2JSV X;  4EFO A;  1IPG A;  3RNF C;  3L17 A;  4KIK B;  2JWZ A;  1RFA A;  4MM3 B;  4A55 A;  3QQ8 B;  1MJD A;  3DHG C;  5JZE B;  3ZKJ C;  3HM6 X;  3ZQ4 A;  2KTF A;  2WXH A;  2YVC A;  3Q8B A;  1E7V A;  3NVW A;  1EO6 A;  1TY2 A;  3AE7 B;  2WWZ A;  2NBU A;  5BMH A;  2CHW A;  2WXF A;  4BAX A;  2W55 A;  3GOE A;  1BT0 A;  2D3G A;  2LGX A;  4IM3 A;  1E8W A;  1EUV B;  2N7J A;  4LNO A;  3TSS A;  4NAW B;  3AEF B;  1EF1 A;  1KOT A;  4WWN A;  1FXI A;  3L16 A;  1SB3 C;  4EEW A;  2JYT A;  2KKC A;  4CQN A;  3FKY A;  2K22 A;  3Q8F A;  3A4R A;  4IDI A;  4LDT B;  1WGK A;  1R7S A;  3RNC C;  3R2T A;  1TJE A;  4EE2 A;  2OJW A;  2L3Z A;  2WXG A;  4A8X C;  4PS7 A;  3DBH B;  3Q14 C;  1V1P A;  2WU2 B;  3Q3J A;  3ZXV A;  4MSQ B;  3FIL B;  4W9J A;  2DZI A;  4LNF A;  1CQV A;  1TYG B;  1ZDX A;  2JXT A;  2BYT A;  4II2 B;  3AEC B;  4B95 A;  1GOZ A;  2WP9 B;  2LWP A;  2G4D B;  2ZW1 A;  3BY4 B;  4YTN B;  2V3S A;  3MHZ A;  3VH4 B;  2XK5 B;  1RYJ A;  3KWL A;  2WGS A;  1ROE A;  3A1Q B;  1K51 A;  1FIQ A;  5FR3 A;  1RAX A;  2WXN A;  2IYD B;  2V3N A;  4DXF A;  2CS4 A;  4RNA A;  1FFV A;  2WHI A;  2HDE A;  2NPT A;  4XGA B;  2C5L C;  4BFR A;  1HEZ E;  3OJ3 A;  4KDI C;  1GG3 A;  2MBE A;  4RGO S;  4AWJ A;  3QJZ A;  4FLH A;  1H8C A;  1S3S G;  1XXG A;  4HRS A;  1T6B X;  2CJO A;  3LYY A;  4HDO A;  4E71 A;  2RGF A;  4FHK A;  1TZO A;  2VZK B;  2J0K A;  2LHE A;  1ZGU B;  5GXG B;  1OFF A;  3R8B A;  4J6I A;  1T0R C;  2BF8 B;  2JWU A;  4M00 A;  4AQ7 A;  1ET9 A;  3OAW A;  3KYC D;  1WF9 A;  2ACZ B;  3KQ4 A;  4FJV B;  1J7A A;  4KZC A;  3C0R B;  2L52 A;  4KDL B;  1DOY A;  2AWT A;  4KKI A;  2GLS A;  1D6E C;  1J0G A;  3VRB B;  2N7E A;  2LZ6 A;  4XDD A;  4KSK C;  4W9C A;  3X0W A;  2O6V B;  4YSZ B;  2DWQ A;  2BB5 A;  2OJR A;  1E9M A;  3BVZ A;  5IKC M;  1SE2 A;  3NRZ A;  3TUO A;  1FD6 A;  4ZYN A;  3N1X C;  2LRW A;  2M0X A;  4QAY A;  1FFU A;  3DQV A;  1FPY A;  1RFK A;  3AE4 B;  1HXY D;  1VLB A;  2O2V B;  2XNA C;  4DHJ D;  1E90 A;  3ZVV A;  2N7D A;  5AZG A;  1V6E A;  4NZL B;  1JWA D;  4YT0 B;  1OEY A;  2ZCB A;  2J4X A;  2NBW B;  5FKA C;  2PTL A;  1ZW7 A;  2IGD A;  1ZDV A;  2PMV A;  4MT5 A;  2DYO A;  1TTN A; 
#chains in the Genus database with same CATH homology
 2X38 A;  1E10 A;  3NVY A;  1QQR A;  3EA6 A;  4TQ0 A;  5D3D A;  2H89 B;  1UGJ A;  1E0Z A;  1EU4 A;  3B2F A;  1YMH E;  4GLS C;  4NJC A;  4RGM A;  1J7B A;  5EE9 A;  3C8Y A;  4ARI A;  1WRI A;  1TS5 A;  4OW0 A;  1I4Q A;  3BWU D;  1PYW D;  2PIA A;  2PW9 A;  5BYQ A;  1ET6 A;  1K50 A;  2NTS A;  1ENF A;  1HZ6 A;  4WWM A;  2KMM A;  2L32 A;  3SFD B;  1D4B A;  3T3O A;  5EE1 A;  2WXK A;  3GS2 A;  4J3O D;  1XO3 A;  3W9C B;  4WH4 A;  1I4H A;  5G5H A;  2NTT A;  3GB1 A;  5FK9 C;  1QLB B;  2SAK A;  1N5W A;  2BS4 B;  2V0G A;  3O13 A;  5C3J B;  2RPV A;  1XLN A;  2INP E;  1MPE A;  1N63 A;  3P63 A;  1KH0 A;  3AE2 B;  5HFY A;  1F77 A;  2N0S B;  3MC0 B;  4L2Y A;  1YJI A;  1SJE D;  2RMM A;  4GDL B;  2M0A A;  1I4G A;  4O1N A;  3P42 A;  4RF1 A;  5C2T B;  3RFZ B;  3TEW A;  1XCQ L;  1C4P A;  3FIL A;  3U52 E;  4B0M A;  1ESF A;  4L1B A;  2J42 A;  1C4A A;  3R2I A;  4TQ1 A;  4XWW A;  1TY0 A;  3WCQ A;  2MJE A;  3CWI A;  3U4E G;  2Z8L A;  4D2K A;  4OZC A;  1P7F A;  1ACC A;  1RM6 C;  1SXT A;  2E3T A;  1T3Q A;  3P4Q B;  1MI0 A;  4RF0 A;  1GB1 A;  1EWY C;  2WXI A;  1VDV A;  3IT6 B;  1BML C;  2W54 A;  1D5X C;  4US9 A;  1L4Z B;  2FBW B;  2L1A A;  1KF6 B;  2KAJ A;  4OZB A;  4N6E B;  1YN5 A;  3GP7 A;  4HKQ A;  1GPX A;  1JWB D;  3BYT B;  4JWS C;  1PUT A;  3MFG A;  5BYR A;  3HRD D;  3P1M A;  2INN E;  2LEK A;  1JCK B;  4OVZ A;  2YEP B;  5EE3 A;  1D5M C;  4IOI E;  2NMQ A;  2IJ0 A;  1SE4 A;  3V3X A;  1PGX A;  2WXM A;  5JXV A;  4KGS A;  2OED A;  4RH6 A;  1STE A;  4WAF A;  1WYG A;  3AE9 B;  1EM7 A;  3BK2 A;  3CIR B;  3Q8C A;  4RGN A;  2KDM A;  2BS3 B;  4XDC A;  1SF0 A;  1C76 A;  4ZHP A;  3NVV A;  1D5Z C;  3PZ7 A;  3W5U B;  4LK0 M;  1YN3 A;  2V3P A;  4A6Q A;  2DBY A;  2SEB D;  4JE3 B;  1N61 A;  1A70 A;  1VRA B;  2EEL A;  2K3U A;  1NYQ A;  3Q69 A;  1SE3 A;  2G1E A;  4ITK A;  3TEY A;  2RDH A;  3P4R B;  3LXF A;  3AB5 A;  3U7Z A;  2MJ3 A;  1YN4 A;  2W3R A;  2WDQ B;  3HVD A;  1TKG A;  3ETR A;  3J9C A;  1DOI A;  1FO4 A;  3NVZ A;  4HEA 1;  3VRA B;  1QOA A;  4MAC A;  3VQI A;  2WNM A;  3BII D;  4ARC A;  3T3N A;  2N9K A;  3IT4 B;  3FAH A;  1J7C A;  3NUH B;  3SEB A;  2K0P A;  1NYR A;  1K52 A;  1FXA A;  3MP9 A;  1IBX A;  1KLG D;  2FE8 A;  2IDY A;  2I2Y A;  2K5P A;  1FNV A;  2DLB A;  4KGT A;  4YWG G;  3LB8 C;  1L0Y B;  4WUR A;  1F2R I;  3IAS 1;  3V05 A;  4B0E A;  4YSY B;  3SFE B;  3AM9 A;  1SSN A;  4KX6 B;  4YXD B;  1TS4 A;  2BB6 A;  5H8Y E;  3RPF C;  1JQ4 A;  4P16 A;  1UWX A;  2MEK A;  2QIE B;  1YNT E;  2JZP A;  2OHF A;  3EGR A;  5BMG A;  5TSS A;  1P7E A;  3PZ8 A;  3SR6 A;  1E6E B;  5HHD G;  1XLQ A;  2M56 B;  3AE6 B;  4KKJ A;  1AYF A;  1SIJ A;  1L4D B;  4PT5 A;  1OQQ A;  2QEJ C;  4ZRP A;  4US8 A;  1NEN B;  2Q5W D;  3I57 A;  1JWS D;  2WXQ A;  1Q10 A;  4R3D A;  1GB4 A;  1AWD A;  1FRD A;  1HZ5 A;  3FC4 A;  3VR8 B;  1AW7 A;  2JQR B;  1XLP A;  1BXT A;  3W2D A;  1QOF A;  2QMT A;  2CJN A;  3AE8 B;  1MVK A;  4FXC A;  1L0V B;  2LHD A;  1JWM D;  4LTU A;  3BVM A;  3Q8A A;  2KWD A;  2JSV X;  4AS1 A;  1JW9 D;  2LUM A;  2IGH A;  1PFD A;  4XWT A;  2WXP A;  3ZYY X;  1SJH D;  4MM3 B;  3DWG C;  5HI1 A;  1B9R A;  3ZJT A;  4A55 A;  5D7G A;  2RDG A;  3ZQ4 A;  2WXH A;  2GI9 A;  2WXL A;  3ZJU A;  3ZJV A;  3Q8B A;  3B9J A;  2Y5C A;  4XE0 A;  3NVW A;  1I4X A;  4WIP A;  1TY2 A;  3AE7 B;  2J52 A;  4USA A;  4MH8 A;  1FM0 D;  2AQ3 B;  4OZA A;  5BMH A;  2WXF A;  2W55 A;  3OWE B;  3W1S A;  1HA5 A;  2GB1 A;  4YTM B;  3H8H A;  1OQR A;  1QT9 A;  3BK1 A;  3AEA B;  1ZP0 B;  3HVZ A;  2BT6 A;  2N7J A;  2GRI A;  1AN8 A;  2JYE A;  2WDV B;  3E9S A;  2I38 A;  3NZ3 A;  3TSS A;  2PKO A;  4NAW B;  3AEF B;  1L6V A;  1I4P A;  1YJJ A;  3NS1 A;  1KFY B;  2AQ2 B;  1FXI A;  4ZHO A;  1VZ8 A;  4YSX B;  1SB3 C;  1SEB D;  2JYT A;  1E7P B;  2L83 A;  2BW2 A;  2LFI A;  3DWM A;  4CQN A;  1MHH E;  1DOX A;  1EU3 A;  4RFB A;  1VR9 A;  2K22 A;  3Q8F A;  5BYS A;  1IBX B;  4L23 A;  1FRR A;  4C7Y A;  1HQR D;  1EWC A;  2WXO A;  3AE3 B;  4IDI A;  1WGK A;  1T5X D;  3AEG B;  1R7S A;  1F0Z A;  4M0W A;  1YQ3 B;  4N59 A;  1C77 A;  1PGB A;  3R2T A;  1TJE A;  1V97 A;  1IUE A;  4NAM A;  4HKZ E;  3AH7 A;  3AEB B;  4EE2 A;  3I9V 1;  4C56 C;  2WXG A;  1C4C A;  4A8X C;  2ICI A;  4JX1 C;  3URY A;  2WXJ A;  1V1P A;  4ZRQ A;  4DXG A;  4ZYS A;  2VZK D;  2WU2 B;  1Y56 A;  3FIL B;  1IGD A;  1PGA A;  2AX5 A;  1CQV A;  1QOB A;  1TYG B;  1FNU A;  1ZDX A;  2JXT A;  3AMZ A;  2XN9 C;  3P4P B;  1L6U A;  1QKZ A;  3P4S B;  2LGI A;  4HRO A;  2BYT A;  5G5G A;  3E56 A;  3AEC B;  3TEZ A;  1GOZ A;  1KRH A;  2WP9 B;  4ZOH C;  5H92 C;  3BYY B;  3AN1 A;  4TSS A;  1C78 A;  2ZW1 A;  1TS3 A;  4A90 A;  5MPO A;  2IPK D;  3Q8E A;  4YTN B;  3MHZ A;  1BUI C;  1RYJ A;  1ZXI A;  1JML A;  3KWL A;  1CJE A;  2QJL A;  1YQ4 B;  1ROE A;  2HTM E;  1K51 A;  1UUP A;  1FIQ A;  1I4R A;  2KAC A;  2WLB A;  2Y3A A;  5FR3 A;  1C9F A;  2WXN A;  5D3I B;  1WXQ A;  1FNW A;  2V3N A;  4DXF A;  4N58 A;  2J53 A;  2KQ4 X;  2V4I B;  4RNA A;  1TKE A;  2M19 A;  1UNS A;  1XLO A;  3L4P A;  4IKG A;  2WXR A;  1FFV A;  2ON8 A;  1TS2 A;  1TKY A;  3BZD B;  1WSP A;  1DYQ A;  2HDE A;  1N60 A;  4RCO A;  1XCT L;  2EKI A;  4KGR A;  1HEZ E;  3IXS A;  1XF5 L;  2PLP A;  3KWV A;  1MHX A;  4RGO S;  1JAL A;  2DYM A;  2WS3 B;  2WQY B;  1K53 A;  5I4D A;  1XXG A;  4HRS A;  1FCL A;  1T6B X;  2CJO A;  3PO0 A;  2B76 B;  3LYY A;  3UI3 A;  4DQO C;  2R61 A;  4A9A A;  4LLG M;  2FUG 1;  1GAQ B;  1CK1 A;  5AUI A;  1VJK A;  1TZO A;  1XEE A;  2VZK B;  4P6V F;  1JRP A;  1KTK A;  2LHE A;  5GXG B;  1OFF A;  1JWU D;  3R8B A;  5EE0 A;  1KLU D;  3ZGZ A;  2N9L A;  2D5G A;  1F2R C;  2LMC A;  2JWU A;  4AQ7 A;  1ET9 A;  2CU3 A;  3AE5 B;  1JRO A;  1FMA D;  1L0X B;  2ACZ B;  3KQ4 A;  2QIL A;  4GDK B;  2ONQ A;  1V8C A;  2H88 B;  2QSD A;  1J7A A;  2L52 A;  1DOY A;  1LO5 D;  2MH7 A;  5LNK 1;  3AE1 B;  4KKI A;  2E6X A;  1D6E C;  1IGC A;  1WWT A;  4JPS A;  3VRB B;  4XDD A;  1ZE3 D;  4TMA B;  2LJI A;  1ZOY B;  1ZUD 2;  1L5P A;  5E6J A;  2JX5 A;  1NI3 A;  3EUB 2;  2Y5P A;  3VR9 B;  4YSZ B;  1I7H A;  3KLS X;  2DWQ A;  4H2A A;  1V1O A;  2BB5 A;  4C80 A;  2IGG A;  2WU5 B;  1E9M A;  3N9Y C;  3BVZ A;  1ZXH A;  3TEX A;  1SE2 A;  3NRZ A;  3AEE B;  2G9H D;  3IAM 1;  4UDU C;  2PVG C;  5AUK A;  3TUO A;  1FD6 A;  3AED B;  3AV8 A;  3U2S C;  1FFU A;  1DGJ A;  5T8I A;  5BMI A;  3B2G A;  1QIL A;  3ABV B;  1RFK A;  2WDR B;  1RWS A;  3AE4 B;  2K9X A;  4REZ A;  5HG2 A;  1HXY D;  1N62 A;  1VLB A;  2PVO D;  2TSS A;  2BS2 B;  4JWU C;  3HUI A;  4HJG E;  1NVI D;  2W82 A;  4Q2J A;  2ZW0 A;  1SBB B;  2AQ1 B;  2XNA C;  1V1P B;  3W5V B;  1M4V A;  1N5X A;  4NZL B;  1FCC C;  1JWA D;  4YT0 B;  1VZ6 A;  4C7Z A;  1B1Z A;  2J4X A;  1VZ7 A;  1UWM A;  4YTP B;  3BVG A;  1PDX A;  4OHJ A;  4WQM A;  1QF6 A;  1NEK B;  5FKA C;  2BTE A;  1CZP A;  2PTL A;  2BBC A;  2IGD A;  1ZDV A;  1ZPS A;  4RGT A;  2KN4 A;  1FEH A;  1QOG A;  3MJ5 A;  2JU6 X;  2PMV A;  4MT5 A;  2YEP F;  1C79 A;  2W3S A;  2MJD A;  2DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...