2JX5A

Solution structure of the ubiquitin domain n-terminal to the s27a ribosomal subunit of giardia lamblia
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
MLVIVRLQDQTLPFELPAGARASQLSNLLSSSGMAFSLHTQGRVLSEAAELNDKMVIDAFVPADGAGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlUb(S27a)
publication title Sequence and structure evolved separately in a ribosomal ubiquitin variant
pubmed doi rcsb
source organism Giardia lamblia atcc 50803
molecule tags Ribosomal protein
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2007-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jx5A00
1PFDA 1FRDA 1VLBA 4USAA 2WS3B 4YSZB 2K5PA 3DWGC 1E0ZA 2N0SB 3VR9B 4C7ZA 2BS4B 2MJEA 1JWAD 1WGKA 3P4SB 1FFUA 1FFVA 1T3QA 3AE4B 2L83A 5AUIA 4A9AA 3WCQA 1YQ3B 3VRAB 3HUIA 1VJKA 4WQMA 3AV8A 4FXCA 2G1EA 1V8CA 2PVGC 2BS3B 3NVWA 2CJNA 1N5XA 1NYQA 2CJOA 2KMMA 1TJEA 3DWMA 3AM9A 1WXQA 1V97A 1L0VB 4YTNB 4KX6B 1J7CA 5G5HA 2ACZB 1E7PB 1EWYC 1ROEA 2MH7A 1KRHA 4IDIA 2WU5B 1JW9D 4JWSC 1A70A 3L4PA 5EE0A 4ZHPA 1DOXA 2L52A 3AEEB 3AE6B 3CWIA 2WLBA 1E10A 2B76B 2H89B 2LEKA 3AN1A 5EE1A 3ABVB 1QOGA 1RM6C 3AE2B 3P1MA 1FO4A 3VRBB 1QOAA 1KF6B 3ETRA 3AEDB 1FM0D 3AE9B 1XO3A 1OQQA 1ZUD2 1YQ4B 1ZOYB 2QIEB 2WDVB 3AH7A 3NVYA 3RPFC 1QOBA 1FRRA 4JX1C 3FAHA 5C2TB 3P4PB 3PO0A 1TKYA 2EKIA 1N62A 1N61A 1N63A 5EE9A 3W5UB 1DGJA 1DOIA 1AWDA 1WRIA 1XLNA 3EUB2 1QT9A 1QOFA 2FBWB 1FXAA 2JQRB 2MJ3A 3AEFB 5EE3A 1NYRA 1JQ4A 1PDXA 1JROA 5GXGB 3FC4A 5C3JB 1F0ZA 2AX5A 3BIID 1QF6A 1RYJA 2PIAA 2WDQB 5G5GA 4ZHOA 4US8A 1GPXA 1NENB 1E6EB 1R7SA 1UWMA 3AMZA 3NVZA 3AE1B 2K22A 1DOYA 1SF0A 4YSXB 1CJEA 2H88B 1JALA 1SB3C 3VR8B 2HTME 1FIQA 3NRZA 1GAQB 3P4RB 4LTUA 2WP9B 1SIJA 1J7BA 1WWTA 3B2FA 4YTMB 3CIRB 4HRSA 1TYGB 1L6UA 1NEKB 1RFKA 4N58A 1B9RA 3AE3B 2CU3A 4YSYB 3SFEB 2BS2B 3AEBB 1VDVA 2WDRB 3W5VB 1L5PA 1RWSA 3NS1A 1FMAD 2E3TA 3NVVA 4C80A 2K9XA 1WYGA 3P4QB 1I7HA 1ZXIA 1E9MA 1TKGA 5H8YE 3HRDD 2QJLA 4ZOHC 3ZYYX 3AE5B 1N5WA 1TKEA 4YT0B 5MPOA 5H92C 4JWUC 2WU2B 4HROA 1QLBB 4YXDB 4US9A 4C7YA 2PKOA 2W55A 1KFYB 1YJIA 2BT6A 1ZP0B 5AUKA 2JX5A 3SR6A 1L6VA 1YJJA 2KAJA 2W3SA 3SFDB 2Q5WD 1N60A 1XLQA 2DBYA 4N6EB 2W54A 2WQYB 1J7AA 3HVZA 3B9JA 1AYFA 2W3RA 4YTPB 1XLOA 3AECB 3LXFA 1NI3A 1JRPA 3AB5A 1NVID 3AE8B 2OHFA 4ITKA 1OQRA 1IUEA 1OFFA 3P63A 2MJDA 1FXIA 3AEGB 3LB8C 1PUTA 3AE7B 3AEAB 3B2GA 1CZPA 2Y5CA 2PVOD 1XLPA 4P6VF 3W9CB 3KWLA 2DWQA 4WWMA 2M56B 1JWBD 2M19A 4N59A
chains in the Genus database with same CATH superfamily
1S1QB 5EDSA 2N0SB 4BBNC 2NPTA 1AARA 4LNOA 3AI5A 4BVUC 1X1MA 4DQOC 2FAZA 3C19A 3DBLI 3PGEA 1T0QC 2D10A 3TSSA 2KQ7A 2BB6A 2J7QB 3R2IA 3DVGY 1Q10A 3P2BA 2N9XA 2MSED 1V81A 5DPTA 2RPQA 4ZHPA 1JWMD 1E10A 3QWZB 4F8CB 1BMLC 4LJPB 2FCSA 4B6WA 2AL3A 2CHWA 1ZXHA 3H9DA 1XO3A 3IG3A 2E6XA 3RPFC 3ZVVA 4C56C 4W9KA 2KDFB 4NAWB 3PO0A 2DYBA 1GJZA 2O2VB 2KVZA 1N61A 4M8NA 2K1FA 2K25A 4HCNB 3RN9C 3AMZA 5KHOA 4G11A 4AOFA 2KQ4X 4FBJB 3VR8B 4AUQC 1PGBA 1J7BA 1WWTA 1Y8RC 3DBRB 4JLCA 4C4VB 4YTMB 4WIPA 3DPDA 2BS2B 3AEBB 1FCLA 1J19A 1SE2A 4HPPA 3H7PB 5CHFA 2HTHA 4LNKA 4W9CA 3ZJTA 1TY0A 3KYCD 5BYRA 1TKEA 1XT9B 4HCPB 4I6PA 3VTVA 4GDLB 2MWSB 2W3SA 5AZHA 2MW5A 4BKTA 2RMMA 3HVZA 1K52A 5HG2A 3W1SC 1ET6A 3QARA 2KDIA 3AE8B 1L0YB 1FXIA 3A1QA 2DWQA 4E71A 2Z0DB 1C4CA 1TS5A 3PHWB 2ZW1A 2JXXA 2YEPB 3RNAC 4BBNF 2HJ8A 4KZ0A 1WGGA 3Q8EA 2LRUA 2ASQA 4NQKE 4TUUA 3DBHB 3DWMA 1L0VB 1D3ZA 2HE7A 4KKIA 4HKZE 2BWES 4MELA 1V5TA 4O1NA 4DBGA 4A55A 3KYDD 1C79A 2DZJA 4JWUC 3X23A 4C7YA 1ZOYB 3V3XA 1TKYA 2DX5B 3H1UA 3W1SA 3EUB2 2VRRB 2FBWB 2AEHA 1PDXA 4XDCA 2V4IB 2ZNVB 1WJUA 1NENB 4DHZB 1UWMA 4HEA1 2KHWB 2LD9A 2JRIB 4RNAA 1I4GA 2UWQA 5TSSA 4G50A 1ENFA 3A4RA 1HTOA 1B9RA 5BO4B 3I9V1 1WX9A 1UGMA 1YNTE 4II3B 2KDBA 3RNBC 4US9A 1WJ4A 5IOIA 1KFYB 1KTKA 2BGFA 2JWZA 3WALA 1J7AA 2C7NB 3B9JA 3UI3A 1OEYJ 1AYFA 3FILB 4MM3A 2WXIA 4ITKA 2K0PA 4NJ7A 2DLBA 2LGIA 1WR1A 4EEWA 1SJHD 3TEZA 2LVPA 4W9FA 3EA6A 5C23A 2EMSA 2JF5A 4DDID 2D5GA 3I63C 4TMAB 1VJKA 1H8CA 3MHZA 4M0WB 4KDIC 3RNEC 4URKA 1WYWB 1WXQA 2ACZB 2MH7A 2MBEA 1Z5SB 2A5UA 4DDGD 1KJTA 3ZRCA 4XX5A 3BYTB 4IUMB 4GSWA 2KFKB 1KM7A 1N6ZA 1T0RC 3AH7A 3IHPC 3N3KB 2AWTA 5TR5A 4MGIE 5HFYA 1V1OA 1XLNA 1F0ZA 4EZJA 2MX2A 2G9HD 2MBOA 5JHBA 2DZKA 1E6EB 2QEJC 3JSVA 3PVLA 2K22A 2FCNA 2WNMA 4DXAB 3P4RB 1TYGB 4OHJA 3NZ3A 3PT2B 4NQLB 4HVBA 1K51A 3IFWB 3PSEB 1BT0A 1UD7A 1ZXIA 2KN5A 3UQAA 5H8YE 3Q2AC 2Z59B 4W9IA 1UELA 5G55A 4BKGA 3MC0B 5IP4D 4ARIA 2RPVA 3QAQA 2J4XA 1ZP0B 1V86A 2JX5A 4RGOS 2D07B 1WGHA 4N6EB 4RFBA 2BWFA 1WR6E 3KW5B 3VUXA 4A3PA 3P63A 1I4RA 2MJDA 3K9PB 4RF0A 3LB8C 2WXRA 4GB9A 1CZPA 4ICVA 4DK5A 4USAA 2MQJA 2RGFA 2M19A 3R3MA 1GB1A 4EOYA 5LLIA 4IOIE 4J3OD 2BS4B 3HK0A 1E8XA 2NBVB 3RNCC 1YOVB 1F1HA 3AULA 2FCQA 4B0MA 4II2B 3C8YA 2N9EB 2DHZA 1QILA 3Q3MC 3VUYA 2AQ2B 4GXBA 1LFDA 4M0WA 5LNK1 4W9JA 2LGSA 4A8XC 4NY0A 1U4AA 1PQSA 2KD0A 1DOXA 2K8BA 2L52A 3CWIA 1XF5L 2KWUB 1UH6A 2EMTA 3FKYA 5EE1A 4K3BA 4GN1A 3EFUA 5HKHA 2EKEC 1CQVA 2L0TA 2MRPA 4XWTA 4ARCA 1L2NA 1QOBA 2B3AA 3CSTA 4FHKA 3U8ZA 2D3GA 5HI1A 1MJDA 3RI7C 4WAAA 2NBWB 3ONSA 3N9YC 4DXFA 3AU5A 3SDLC 1GPXA 3O65B 4IWQA 2WDTB 1P0RA 1K53A 3UIPB 2BYVE 3ZTCA 1SF0A 2KTRB 2H88B 1T5XD 3NRZA 2AQ1B 4HKQA 2LASA 2WP9B 2ZZPB 2QC8A 5CHVC 2CU3A 3Q3OC 4OVZA 2WDRB 4PS3A 2C5LC 2NBUA 2WXMA 5FKAC 2BTEA 3B08A 4KV2A 1C4PA 2VZKD 5G2NA 1V9JA 1XXGA 2PKOA 3ECIA 1IGCA 1YJIA 3KUCB 2QSDA 1V2YA 1TY2A 1XLQA 4GDKA 4TQ0A 2KJ6A 1WGDA 2JSVX 1AN8A 1NBFC 5BYQA 2MA9B 2INDC 4GMVA 2VH1A 2NR2A 3J9CA 3EECA 5AEKB 1YX6B 3A9KB 4LJOB 3WCQA 2XNAC 3H8HA 3V05A 1XCTL 3U7DA 4MACA 3DVNV 3NOBA 1N5XA 2ZVNA 4KGSA 1P7EA 2MLBA 5EE0A 3KQ4A 2HDEA 3KUDB 4HWIB 3AN1A 4HPLB 1I4XA 3N1ZC 1WX7A 3QCAA 3V6CB 2Y5PA 4TSSA 2L05A 2PE9A 3P42A 2KOXA 2EKIA 4HXDA 1AWDA 1NYRA 3ALBA 2ZW0A 2RDBC 2LJIA 4QAYA 3IBEA 4K3CA 4YSXB 3PS6A 4YSYB 2CKHB 4G3XB 4C80A 3L13A 3VDZA 4PYZA 1MHHE 3APDA 3BYYB 1BUIC 3AU4A 3ZDTA 1Q5WB 2UYZB 1MG8A 4HROA 4OZAA 3KVFB 4LK0M 4MJSB 2WXKA 2KMAA 3RZWC 2WQYB 1E7VA 5FR3A 1FNVA 1SE4A 1C77A 1PUTA 3AEAB 4XZ4A 2MP2B 2I1JA 4K7UA 1TGZB 1T0SC 4A90A 1FFUA 1FFVA 2MEKA 3AE4B 2LGDA 4MGZE 3AV8A 3QJZA 2DYOA 2BS3B 5LXHA 1YIWA 3S2AA 2W9NA 3L0WB 1WM2A 2QMTA 1ESFA 2WXFA 3ML8A 2LFIA 5JXVA 2PW9A 1L4ZB 3Q8CA 5I4DA 1VCBA 2NCNA 1H4RA 4FA6A 2H89B 3RZFA 2ZCCA 3ABVB 4NPNA 4BKSA 2M0AA 4WQOB 4IM0A 2WXJA 1GC6A 3A4SC 3IXSA 3AE9B 2QIEB 1OQYA 2JPHA 4KDLB 2HD5B 1SJED 2MBBB 4HK2A 1STEA 5GXGB 3Q14C 2ZPYA 2BB5A 4KSKC 4W9EA 2WXHA 1E90A 4LDTB 3N30A 1HE8A 2WXQA 3CIRB 4W9HA 1KLGD 1WI0A 1LGRA 3TL5A 2J0KA 2E3TA 3ZW3A 4TQ1A 4DHZE 3HRDD 1GNUA 4ICUA 4JQWC 4YWGG 1XCQL 2XN9C 2WX0A 4YT0B 2KDEB 4MEMA 2GBRA 3SU8X 1QLBB 4YXDB 1P98A 1YJJA 1ZGUB 2WXGA 2IGGA 3ZKJC 5J18A 2R2OA 4RGMA 1HA5A 2I1KA 2IPKD 2YVCA 4B0EA 1J0GA 4FJYA 3W9CB 4WWMA 1ZKHA 1AW7A 1E5WA 1L4DB 2VZKB 2FCMA 4K7SA 1GG3A 4A9AA 4XDDA 5AUIA 3VRAB 2L1AA 4X57B 1WRDB 4HJKA 3GE8C 1NYQA 3QA8A 1TJEA 4IKGA 2K6DB 3U30A 4ZDVA 1NDDA 3AEEB 3AE6B 3APCA 4IW0A 2X38A 2LJ5A 1FEHA 1G6JA 4E3CA 3QC8B 3MC8A 4PS8A 4DXGA 4BZAA 3A9JB 5EE9A 1WH3A 1WXVA 1WX8A 1YD8U 4MGKE 3FC4A 2IGDA 3T3OA 2DZIA 2LGXA 4KVGB 2LWPA 3KUZA 1C3TA 2LHDA 1FIQA 2GBKA 2XEWA 1IGDA 4JPSA 4ZYNA 3N32A 2C7HA 4FJZA 1F9JA 1NEKB 2PTLA 3W5VB 1TS3A 4MT5A 4P16A 3DBLB 1HZ5A 4NAWA 1I7HA 2O2VA 2CHZA 3VAWA 4AJYB 3K9OB 2J0JA 1CK1A 3BK1A 4FULA 4ZRIA 1NI3A 2IY0B 1NI2A 1OFFA 4C4VA 1EUVB 3DHIC 3CF6E 1WF9A 2BYFA 2N7DA 2OJWA 3DBSA 1ZDVA 3KWLA 3H7PA 4LNFA 5D6JB 2C7MB 2W82A 4NZLB 3SD5A 2XBBC 4AP4C 1IPGA 1M94A 5D3DA 1YQ3B 1WIAA 2CHXA 4GDLA 2M1MA 1FXTB 2GRIA 2KMMA 4WWPA 1D6EC 2ZNVC 2LVQA 3W1YA 2GMIC 2K39A 2N7JA 1RM6C 2BBCA 3I3TB 3P1MA 3MP9A 2ZPNA 3ZNGC 3RFZB 1GUAB 5BMIA 1I42A 3QQ8B 2DZMA 4L2YA 2TSSA 2ONQA 1TTNA 3DQVA 2KX3A 2Y5BB 5T8IA 1QKZA 3NJTA 1JQ4A 2O6VB 1EWCA 2CS4A 1QF6A 1RYJA 3TUOA 3DVGX 1FD6A 4K1RB 5E6NA 1C76A 2MHJA 1VRAB 2QHOA 4EUTA 3V61A 2JZPA 1L6UA 4N58A 4S0RA 2IGHA 1FMAD 2KN4A 2D3AA 1WE7A 4PYUA 3OJ4B 4MGYE 3QX1A 4XC2A 3TJPA 5E6OA 1B1ZA 4DWFA 2IDYA 2KYWA 3OJ3A 1GB4A 4WWOA 1FNWA 3IT6B 2R61A 1ZW7A 2BQQA 4JL9A 2WXLA 2YEPF 4XE0A 1BXTA 2WGSA 5BYSA 3AB5A 2L8JA 3V62A 2KX0A 3AXCA 3VH4B 4P1BC 1ZDXA 3L54A 3E56A 1WGKA 3LYYA 4GIVA 1T3QA 1EO6A 3HUIA 4ZYSA 3TBLD 2OJRA 3NUHB 3PTFC 1HTQA 1MPEA 2WYQA 3W2DA 5G5HA 2LGYA 3FILA 3I57A 3EC8A 3ZNHB 1TIFA 4WWNA 4BFRA 4MH0E 2LEKA 2EELA 2LI5A 3BINA 3BWUD 2G4SA 3GOEA 2JT4B 3RUIB 1E0ZA 3NVYA 3VFKA 1R4MI 1OTRB 1SE3A 2Z8LA 1N63A 3L10B 5KHQA 4ZRPA 1QT9A 1IBXB 3ZNID 1WXSA 1WXAA 2L3ZA 4L23A 3Q8FA 3NVZA 2RD0A 2KJRA 2MBQA 1E8ZA 1R4NI 3R7QA 2KFKA 1D5MC 4ZRKA 4GU2A 2KWVB 1I4PA 2J52A 2DNFA 1RRBA 4F7ZA 1MI0A 3WIMA 1MFWA 2W55A 2BT6A 2IO1B 4CQNA 4LLGM 2D2QA 2V9HA 5BMHA 4A3OA 1P7FA 2W3RA 4D2KA 1IUEA 2FIDA 4BAXA 4PK1A 2QCZA 4HLEA 1D4BA 2PPHA 3R8BA 2KDMA 1EU4A 4M02A 2RDGA 3HM3A 3VR9B 3VTWA 4BOZB 4WJNA 4BOSC 1D5XC 4WQMA 2GBMA 4W9LA 2HJ1A 1Y56A 4IWPA 2V1YA 4TV3A 1D5ZC 4Q2JA 2REXA 3M62B 4UDUC 3LJ3A 1F2RC 5DPWA 3V60A 3VUWA 4RMAA 4NJCA 1WXMA 2JVCA 1QOAA 1P9DU 4JGHB 4REZA 3AEDB 4EKUA 3NZUA 3RD2A 1TZ1A 1FRRA 2JZ3B 4M00A 4S17A 1QOFA 1FXAA 3TMPB 5EE3A 3Q8BA 2LUEA 1SBBB 3ZIMA 3WANA 2KWCA 5G5GA 4US8A 3QIJA 4P7IA 2Y3AA 2RR9A 1JWSD 2LVOA 4KZCA 4B95A 3PV1A 1YN4A 2N1VA 1JALA 2LUMA 4RGTA 1E7UA 2CR5A 5GMVA 3DHGC 2JY6A 3PRZA 3UINB 1KLVA 3ZXRA 4XWWA 2JWUA 1E9MA 4G0NB 4N9F4 2NPTB 3BVZA 4ZOHC 2KC1A 3KLSX 2WHIA 4TKNA 1HQRD 2BF8B 1SXTA 2WU2B 3U52E 1SE9A 2IO0B 2PJHA 3TIXA 2XK5B 1RLFA 2BVCA 1FNUA 3N1XC 2KTRA 4YTPB 3AECB 1NVID 2BW2A 4XYCA 3MFGA 2D3BA 3IAM1 4I6LB 1ISNA 4EE2A 2L0FA 4B9KA 4NAMA 1VLBA 2WS3B 3L17A 4KGRA 1JWAD 2BYTA 1UUPA 2IY1B 1Q0WB 2LXCA 1A5RA 1V8CA 1JCKB 1Z2MA 3AM9A 1V97A 2X8XX 3KH0A 4MSQB 1J7CA 2IYDB 2NMQA 4EZLA 1V6EA 2NVUI 2N9LA 5J17A 4WJQA 1QQRA 2J53A 3TEWA 1KF6B 3A9KA 2VH2A 2KLGA 1ZUD2 3DDCB 4WAFA 2WDVB 4H2AA 3P4PB 3N1YC 1N62A 1DOIA 2CU1A 4HDQA 4AJWA 1MHXA 2V3NA 2KXJA 3PHXB 1TZOA 3BIID 4ZHOA 4R3DA 2N9KA 4IM2A 4XGAB 2FE8A 1LXDA 2PEAA 5JH5C 4LTUA 1GAQB 1XEEA 1IYFA 3GS2A 4HRSA 3SFEB 3WA0A 1I35A 3DHHC 3M3JA 1RWSA 2QILA 5IO9A 3P4QB 1WYGA 5C1ZA 1YN3A 1LM8B 2JYEA 4ACFA 5E6JA 3RYTA 1F52A 2L00B 2KC2A 1WGRA 2IO3B 4OVVA 1MVKA 3SR6A 4ANXA 2IJ0A 1N60A 2V0GA 4RM8A 2XK5A 3NS8A 4M8MA 1VR9A 4PT5A 4AS1A 2ZJDA 3DVNU 3UIOB 2PVOD 2J0MA 4AWJA 1PGAA 2M56B 2BPSA 4C7ZA 5D7GA 2MBHA 1V5OA 3Q3FA 4I6NB 2KANA 4MJSA 2INCC 3NVWA 2KACA 1YMHE 3X0WA 1FPYA 3U4EG 2KKCA 3GZNI 2GI9A 5JHAA 1ROEA 4FLHA 2YLMA 4JWSC 3L4PA 3L16A 2IO2B 3Q69A 2B76B 2DAJA 1PYWD 2MP2A 1QOGA 3BVMA 4EFOA 1L0XB 4HJGE 4IG7B 2OOBB 4RF1A 1OQQA 1YQ4B 1HZ6A 3TCAA 5C2TB 2BKRB 3EGRA 4RH6A 3DCGA 1EF5A 3WAMA 4LNIA 4KSLC 2GOWA 1LQBA 4LCDE 3URYA 1S3SG 3A33B 4IC7B 1K50A 3D32A 2FUHB 2RDHA 1SB3C 4FADA 3ZXVA 4MM3B 2MCNB 4A6QA 3UF8A 2FUG1 1F77A 1XQQA 2WWZA 5JZEB 3NY5A 5CX3A 3AE3B 4ASWC 1VDVA 2INPE 4WJPA 3T8MA 3QK0A 1HXYD 1TKGA 3DOWA 3AE5B 1XD3B 2KO3A 4ZRQA 3PREA 5IKCM 1P1AA 5HHDG 2OEDA 4DHJD 1WSPA 2DENB 2W54A 4IWOA 1C4AA 2ON8A 4EZKA 2OHFA 2JUOA 4GLSC 3V6EB 1EU3A 4HPMB 2K8HA 3RNFC 4MH8A 4K7WA 3HVDA 2KLCA 1EF1A 2KNBA 2K5PA 2KK8A 3ZJUA 5DPRA 1K8RB 3Q3JA 1LO5D 3VHTC 1ZE3D 2KJHB 1WGYA 4E74A 1EWYC 3JSVB 2KQSA 3SEBA 1UZXB 1TS4A 3OG5A 3RMKC 3Q3NC 2G3QB 4FHJA 3C0RB 3VXWA 1VZ6A 3JW0X 1PGXA 3W5UB 4PS7A 3ZNZB 1JROA 2A4ZA 4HDOA 2PIAA 2GLSA 3GZNB 5CHWA 3H7SA 2G4DB 2ZVOA 2BKFA 3N20C 1T6BX 1SIJA 4KKJA 1UBIA 3ML9A 1WZ0A 2I2YA 1E8WA 2K3UA 1QZEA 1L7YA 3NS1A 2K9XA 3PZ8A 4RCOA 4W9GA 3A9JA 3H6NA 3ZYYX 3JVZX 1FCCC 4BKSD 2NTSA 1WM3A 1P3QU 1WMHB 1ZPSA 2K6QA 1L6VA 3PZDA 4ANWA 2DBYA 5J2RA 4YL8A 4OZCA 2G45B 1XLOA 3LXFA 2N4FA 1F2RI 1SIFA 2V4LA 3AEGB 1YQBA 3B2GA 2Y5CA 4P6VF 4N59A 2L7RA 1FRDA 3IAS1 3QHTA 2JU6X 1JMLA 3P4SB 3NZSA 2D11A 2C60A 1C78A 5IN7A 1C9FA 2PE6B 4JIOU 2R2QA 4IDIA 2WU5B 3ZDMC 3ZLZA 2WLBA 5L83A 1SSNA 2IZVB 2Z0EB 3MTNB 1FO4A 3B0AA 1C1YB 4K81A 4JX1C 4NNJB 1OEYA 3PLUA 4W9DA 3JYUA 5D94A 2MJ3A 2NTTA 3M63B 2DAFA 3UGBB 4GDKB 1EM7A 1DOYA 1OGWA 2HTME 2PMVA 5IAAC 3VTUA 1RFKA 3ZRFA 3BVGA 3WAOA 1L5PA 4AQ7A 2QDFA 2LHEA 3UQBA 1V1PB 3PRMB 2DYMA 2WXOA 2UU7A 2M8SA 2KTFA 1N5WA 2I38A 2KWDA 3NHEB 4LNNA 2O6VA 3TEXA 5LXIB 1VZ7A 2FNJB 4ANVA 2L76A 2IBIB 1WMHA 2M4NA 4WURA 5AUKA 2LXAA 2KAJA 3B1LX 1JRUA 2Q5WD 2KMCA 1YN5A 3HM6X 1JWUD 4J6IA 3EFCA 1KLUD 1OQRA 3R2TA 4RGNA 1WJ6A 2M0XA 4RM9A 1HEZE 3L08A 1V80A 1PFDA 2C9WB 4MDKE 4YSZB 3DWGC 1YX5B 3TEYA 3E9SA 1YJ1A 1RAXA 2J42A 2MJEA 1RFAA 2N1WA 3GP7A 1IP9A 4LDTD 1WE6A 4DHJB 4FXCA 2G1EA 3ZTDA 2V3SA 2CJNA 4M01A 2CJOA 2ICIA 4KIKB 2N7EA 4A20A 1E7PB 3GB1A 3RNGC 1KRHA 5BMGA 1JW9D 5CTRC 2RSUA 1UNSA 1KH0A 3VVWB 4C00A 4WH4A 4FN2A 5DPSA 3RCZA 2V3PA 3U7ZA 3U2SC 2NS5A 3MC9A 1FM0D 4L1BA 1TS2A 3ZUNA 3FAHA 1UBQA 2WX1A 4NJ6A 3PRPB 3HHMA 3AEFB 3PLVA 2AX5A 3ZJVA 2WDQB 3LDZE 1R7SA 1M4VA 3I5JC 3RULA 2M17A 3CMMB 1GC7A 1T0YA 2JXTA 4P1CC 3IVFA 3APFA 5E6PA 4CYEA 2WXPA 3NVVA 2LMCA 2BYEA 5D2MB 1V1PA 1IBXA 1GOZA 3MHSD 5H92C 4ZRJA 3NG0A 3RT3B 3VQIA 3OAWA 3WAPA 2SAKA 4FJVB 3SFDB 4OVUA 2KVRA 3BZDB 4GGQA 3HIZA 1ACCA 1R4MB 4OW0A 4OZBA 1XLPA 1WY8A 1SGHA 5AZGA 1JWBD 4CO7A 2GBJA 4KGTA 1V49A 3ZGZA 2L83A 1DYQA 3MJ5A 3MJWA 2N9PC 2PVGC 2PLPA 3KWVA 1R4NB 5IA7A 4YTNB 4KX6B 1CMXB 5FR6A 2WXNA 2AL6A 1A70A 1WZ3A 3OLMD 4KIKA 4IM3A 4JE3B 1WFYA 3AE2B 3DBRI 2JYTA 2KT7A 2LRWA 3ENEA 3VRBB 3ETRA 3PPAA 3R66C 1E8YA 1KOTA 2D3CA 2K8CA 2KZRA 3O13A 3T3NA 4MSMB 1SEBD 3Q8AA 3BK2A 1MG4A 3BY4B 1DGJA 1WRIA 1VZ8A 2JQRB 3R7RA 5C3JB 1UGJA 4F1SA 3ZQ4A 2GB1A 3AE1B 2ZCBA 5FK9C 1CJEA 5DCNA 3CSFA 3VH3B 3B2FA 2ZEQA 2JRHA 4WJOA 4GOCA 3PZ7A 3EHVA 1UWXA 3M95A 5AZFA 2QJLA 1TBEA 5L95C 3ZO5B 3SHQA 2INNE 2AQ3B 5MPOA 2GBNA 3OWEB 3Q6BA 3IT4B 4ANUA 2KFJA 1J8CA 2AYOB 3T9LA 5D3IB 1UF0A 3GE3C 2SEBD 3DBHI 1I4QA 4CHKA 3A1QB 1JRPA 1TT5B 1VD2A 1I4HA 1ET9A 3AE7B 1WJNA 2O6VD 2JZZA 2FIFA 2LZ6A 1Q1OA 2L32A
chains in the Genus database with same CATH topology
2K5PA 3ZJUA 2N0SB 1ZDXA 3E56A 1WGKA 3LYYA 1T3QA 3WCQA 2XNAC 3HUIA 4ZYSA 4DQOC 3H8HA 3V05A 1XCTL 3TSSA 1LO5D 4MACA 3NUHB 2BB6A 3R2IA 1MPEA 1ZE3D 3W2DA 1N5XA 1Q10A 4KGSA 1P7EA 5G5HA 3FILA 1EWYC 3I57A 5EE0A 4ZHPA 3SEBA 1JWMD 2HDEA 3KQ4A 1E10A 2LEKA 3AN1A 1TS4A 2EELA 1BMLC 1I4XA 3BWUD 1ZXHA 1VZ6A 1XO3A 1E0ZA 3NVYA 2E6XA 3RPFC 2Y5PA 4TSSA 4C56C 3P42A 1SE3A 3PO0A 4NAWB 2Z8LA 1PGXA 2EKIA 1N61A 1N63A 3W5UB 1AWDA 4ZRPA 1QT9A 1IBXB 1NYRA 1JROA 2ZW0A 2LJIA 2PIAA 3AMZA 4L23A 3Q8FA 3NVZA 2KQ4X 4YSXB 3VR8B 1PGBA 1T6BX 1SIJA 1J7BA 1WWTA 4KKJA 4YTMB 4WIPA 1D5MC 2I2YA 4YSYB 2BS2B 2K3UA 3AEBB 1FCLA 3NS1A 1SE2A 4C80A 2K9XA 3PZ8A 4RCOA 1I4PA 1MHHE 3BYYB 2J52A 1BUIC 3ZYYX 3ZJTA 1TY0A 1FCCC 2NTSA 1MI0A 5BYRA 1TKEA 1ZPSA 4HROA 4GDLB 4OZAA 4LK0M 2W55A 2BT6A 2WXKA 4CQNA 1L6VA 2W3SA 4LLGM 5BMHA 2DBYA 2RMMA 2WQYB 3HVZA 4OZCA 1K52A 5HG2A 1P7FA 2W3RA 1XLOA 3LXFA 1ET6A 4D2KA 5FR3A 3AE8B 1FNVA 1SE4A 1F2RI 1IUEA 1L0YB 1FXIA 3AEGB 1C77A 1PUTA 3B2GA 3AEAB 2Y5CA 1D4BA 4P6VF 2DWQA 2KDMA 3R8BA 4N59A 1EU4A 1FRDA 2RDGA 1C4CA 3IAS1 3VR9B 1TS5A 4A90A 2JU6X 1JMLA 1FFUA 1FFVA 2ZW1A 2MEKA 3P4SB 2YEPB 3AE4B 1D5XC 4WQMA 3AV8A 3Q8EA 1C78A 2DYOA 2BS3B 1Y56A 1C9FA 3DWMA 2QMTA 1ESFA 2WXFA 1L0VB 1D5ZC 2LFIA 4Q2JA 5JXVA 2PW9A 4KKIA 1L4ZB 4IDIA 2WU5B 4UDUC 3Q8CA 4HKZE 5I4DA 1F2RC 2WLBA 1SSNA 4O1NA 2H89B 3ABVB 4NJCA 2M0AA 1FO4A 1QOAA 2WXJA 4A55A 4REZA 3AEDB 3IXSA 1C79A 4JWUC 3AE9B 4C7YA 1ZOYB 2QIEB 1FRRA 4JX1C 3V3XA 1TKYA 3W1SA 3EUB2 2FBWB 1QOFA 1FXAA 2MJ3A 5EE3A 1STEA 3Q8BA 1PDXA 4XDCA 2V4IB 5GXGB 1SBBB 2NTTA 5G5GA 4US8A 1NENB 2BB5A 1UWMA 2Y3AA 4HEA1 1JWSD 4GDKB 1EM7A 3J9CA 4RNAA 1DOYA 2WXHA 1YN4A 1I4GA 1JALA 2HTME 5TSSA 2PMVA 2LUMA 4RGTA 2WXQA 3CIRB 1ENFA 1KLGD 1RFKA 1B9RA 3BVGA 1L5PA 4AQ7A 2LHEA 2E3TA 4XWWA 2JWUA 4TQ1A 1V1PB 3I9V1 2DYMA 1E9MA 2WXOA 3HRDD 4YWGG 3BVZA 4ZOHC 1N5WA 3KLSX 2I38A 1YNTE 1XCQL 2KWDA 2XN9C 4YT0B 1HQRD 3TEXA 1SXTA 2WU2B 1VZ7A 3U52E 1QLBB 4YXDB 4US9A 4WURA 1KFYB 1KTKA 5AUKA 1YJJA 2KAJA 2WXGA 2IGGA 2Q5WD 1YN5A 1FNUA 1J7AA 3B9JA 3UI3A 1JWUD 1AYFA 4YTPB 3AECB 4RGMA 1HA5A 1KLUD 1NVID 2WXIA 3FILB 2K0PA 4ITKA 1OQRA 2IPKD 2BW2A 3R2TA 2DLBA 2LGIA 4RGNA 1SJHD 4B0EA 3TEZA 3MFGA 1HEZE 3W9CB 3IAM1 4EE2A 3EA6A 4WWMA 1AW7A 1PFDA 4NAMA 1VLBA 4YSZB 2WS3B 1L4DB 3DWGC 2VZKB 3TEYA 3E9SA 2J42A 2MJEA 3GP7A 4KGRA 1JWAD 2D5GA 2BYTA 4A9AA 4XDDA 4TMAB 1UUPA 5AUIA 3VRAB 1VJKA 2L1AA 4FXCA 3MHZA 2G1EA 1V8CA 2CJNA 1JCKB 1NYQA 2CJOA 3AM9A 1TJEA 1WXQA 1V97A 4IKGA 2ICIA 1J7CA 2ACZB 2NMQA 1E7PB 2MH7A 3GB1A 1KRHA 5BMGA 1JW9D 1UNSA 3AEEB 3AE6B 1KH0A 2N9LA 4WH4A 1QQRA 3HVDA 2V3PA 3BYTB 3U7ZA 3U2SC 2J53A 2X38A 3TEWA 1FEHA 1KF6B 1FM0D 1ZUD2 4WAFA 2WDVB 4L1BA 3AH7A 4H2AA 1TS2A 3FAHA 3P4PB 4DXGA 1N62A 5EE9A 1V1OA 1DOIA 1XLNA 3AEFB 1MHXA 2V3NA 1F0ZA 1TZOA 3FC4A 2IGDA 2AX5A 3BIID 3ZJVA 2WDQB 3T3OA 4ZHOA 2G9HD 1E6EB 2QEJC 1R7SA 1M4VA 4R3DA 2N9KA 2K22A 2FE8A 2LHDA 2WNMA 1FIQA 4LTUA 1GAQB 3P4RB 1XEEA 2JXTA 1IGDA 3GS2A 4HRSA 4JPSA 1TYGB 1NEKB 3NZ3A 4OHJA 3SFEB 2PTLA 3W5VB 1RWSA 1TS3A 2QILA 2WXPA 4MT5A 4P16A 1HZ5A 3NVVA 1K51A 1WYGA 2LMCA 3P4QB 1YN3A 1I7HA 1ZXIA 2JYEA 5H8YE 5E6JA 1V1PA 1IBXA 1GOZA 5H92C 1CK1A 3MC0B 3BK1A 4ARIA 2RPVA 3VQIA 2J4XA 1MVKA 2SAKA 1ZP0B 2IJ0A 2JX5A 4RGOS 3SR6A 3SFDB 1N60A 3BZDB 2V0GA 4N6EB 4RFBA 1NI3A 1VR9A 4PT5A 3P63A 1I4RA 1OFFA 2MJDA 1ACCA 4AS1A 4OW0A 4RF0A 3LB8C 2WXRA 4OZBA 1CZPA 2PVOD 1XLPA 1ZDVA 3KWLA 4USAA 1PGAA 1JWBD 2M56B 2M19A 1GB1A 2W82A 4C7ZA 5D7GA 4NZLB 4IOIE 2BS4B 4J3OD 4KGTA 5D3DA 3ZGZA 2L83A 1YQ3B 1DYQA 4B0MA 3C8YA 3MJ5A 1QILA 2PVGC 2AQ2B 2PLPA 3KWVA 3NVWA 2KACA 1YMHE 2GRIA 4M0WA 5LNK1 3U4EG 2KMMA 4YTNB 4KX6B 2GI9A 4A8XC 1ROEA 2WXNA 1D6EC 4JWSC 1DOXA 1A70A 3L4PA 2L52A 3CWIA 1XF5L 3Q69A 2B76B 1PYWD 2N7JA 4JE3B 5EE1A 1QOGA 1RM6C 3AE2B 3BVMA 2BBCA 2JYTA 3P1MA 1L0XB 3MP9A 4HJGE 3VRBB 3ETRA 1CQVA 3RFZB 4RF1A 1OQQA 4XWTA 1YQ4B 1HZ6A 5BMIA 4ARCA 3O13A 3T3NA 1QOBA 4L2YA 1SEBD 5C2TB 3Q8AA 5HI1A 2TSSA 3BK2A 2ONQA 3EGRA 1DGJA 1WRIA 1VZ8A 4RH6A 5T8IA 1QKZA 2JQRB 1JQ4A 5C3JB 1UGJA 1EWCA 3N9YC 4DXFA 1RYJA 3ZQ4A 3TUOA 1QF6A 1GPXA 1FD6A 1C76A 2GB1A 3URYA 1K53A 3AE1B 1SF0A 1K50A 1VRAB 5FK9C 1CJEA 2RDHA 2H88B 1SB3C 1T5XD 3NRZA 2AQ1B 4HKQA 4MM3B 2WP9B 4A6QA 3B2FA 2JZPA 2FUG1 1F77A 1L6UA 4N58A 3AE3B 2CU3A 4OVZA 1VDVA 2WDRB 2INPE 2IGHA 1FMAD 1HXYD 2KN4A 2WXMA 5FKAC 3PZ7A 1UWXA 2BTEA 1TKGA 2QJLA 1C4PA 3AE5B 2INNE 2AQ3B 5MPOA 1B1ZA 2VZKD 3OWEB 4ZRQA 2IDYA 3IT4B 1GB4A 1XXGA 2PKOA 1IGCA 1YJIA 1FNWA 3IT6B 5D3IB 2QSDA 2R61A 1XLQA 1TY2A 2OEDA 5HHDG 2SEBD 2WXLA 1WSPA 2W54A 2YEPF 4XE0A 4TQ0A 1I4QA 1BXTA 2JSVX 5BYSA 1JRPA 3AB5A 1AN8A 1C4AA 2ON8A 2OHFA 5BYQA 4GLSC 1EU3A 1I4HA 1ET9A 3AE7B 4MH8A 5HFYA 1SJED 2L32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFD A;  1FRD A;  1VLB A;  4USA A;  2WS3 B;  4YSZ B;  2K5P A;  3DWG C;  1E0Z A;  2N0S B;  3VR9 B;  4C7Z A;  2BS4 B;  2MJE A;  1JWA D;  1WGK A;  3P4S B;  1FFU A;  1FFV A;  1T3Q A;  3AE4 B;  2L83 A;  5AUI A;  4A9A A;  3WCQ A;  1YQ3 B;  3VRA B;  3HUI A;  1VJK A;  4WQM A;  3AV8 A;  4FXC A;  2G1E A;  1V8C A;  2PVG C;  2BS3 B;  3NVW A;  2CJN A;  1N5X A;  1NYQ A;  2CJO A;  2KMM A;  1TJE A;  3DWM A;  3AM9 A;  1WXQ A;  1V97 A;  1L0V B;  4YTN B;  4KX6 B;  1J7C A;  5G5H A;  2ACZ B;  1E7P B;  1EWY C;  1ROE A;  2MH7 A;  1KRH A;  4IDI A;  2WU5 B;  1JW9 D;  4JWS C;  1A70 A;  3L4P A;  5EE0 A;  4ZHP A;  1DOX A;  2L52 A;  3AEE B;  3AE6 B;  3CWI A;  2WLB A;  1E10 A;  2B76 B;  2H89 B;  2LEK A;  3AN1 A;  5EE1 A;  3ABV B;  1QOG A;  1RM6 C;  3AE2 B;  3P1M A;  1FO4 A;  3VRB B;  1QOA A;  1KF6 B;  3ETR A;  3AED B;  1FM0 D;  3AE9 B;  1XO3 A;  1OQQ A;  1ZUD 2;  1YQ4 B;  1ZOY B;  2QIE B;  2WDV B;  3AH7 A;  3NVY A;  3RPF C;  1QOB A;  1FRR A;  4JX1 C;  3FAH A;  5C2T B;  3P4P B;  3PO0 A;  1TKY A;  2EKI A;  1N62 A;  1N61 A;  1N63 A;  5EE9 A;  3W5U B;  1DGJ A;  1DOI A;  1AWD A;  1WRI A;  1XLN A;  3EUB 2;  1QT9 A;  1QOF A;  2FBW B;  1FXA A;  2JQR B;  2MJ3 A;  3AEF B;  5EE3 A;  1NYR A;  1JQ4 A;  1PDX A;  1JRO A;  5GXG B;  3FC4 A;  5C3J B;  1F0Z A;  2AX5 A;  3BII D;  1QF6 A;  1RYJ A;  2PIA A;  2WDQ B;  5G5G A;  4ZHO A;  4US8 A;  1GPX A;  1NEN B;  1E6E B;  1R7S A;  1UWM A;  3AMZ A;  3NVZ A;  3AE1 B;  2K22 A;  1DOY A;  1SF0 A;  4YSX B;  1CJE A;  2H88 B;  1JAL A;  1SB3 C;  3VR8 B;  2HTM E;  1FIQ A;  3NRZ A;  1GAQ B;  3P4R B;  4LTU A;  2WP9 B;  1SIJ A;  1J7B A;  1WWT A;  3B2F A;  4YTM B;  3CIR B;  4HRS A;  1TYG B;  1L6U A;  1NEK B;  1RFK A;  4N58 A;  1B9R A;  3AE3 B;  2CU3 A;  4YSY B;  3SFE B;  2BS2 B;  3AEB B;  1VDV A;  2WDR B;  3W5V B;  1L5P A;  1RWS A;  3NS1 A;  1FMA D;  2E3T A;  3NVV A;  4C80 A;  2K9X A;  1WYG A;  3P4Q B;  1I7H A;  1ZXI A;  1E9M A;  1TKG A;  5H8Y E;  3HRD D;  2QJL A;  4ZOH C;  3ZYY X;  3AE5 B;  1N5W A;  1TKE A;  4YT0 B;  5MPO A;  5H92 C;  4JWU C;  2WU2 B;  4HRO A;  1QLB B;  4YXD B;  4US9 A;  4C7Y A;  2PKO A;  2W55 A;  1KFY B;  1YJI A;  2BT6 A;  1ZP0 B;  5AUK A;  2JX5 A;  3SR6 A;  1L6V A;  1YJJ A;  2KAJ A;  2W3S A;  3SFD B;  2Q5W D;  1N60 A;  1XLQ A;  2DBY A;  4N6E B;  2W54 A;  2WQY B;  1J7A A;  3HVZ A;  3B9J A;  1AYF A;  2W3R A;  4YTP B;  1XLO A;  3AEC B;  3LXF A;  1NI3 A;  1JRP A;  3AB5 A;  1NVI D;  3AE8 B;  2OHF A;  4ITK A;  1OQR A;  1IUE A;  1OFF A;  3P63 A;  2MJD A;  1FXI A;  3AEG B;  3LB8 C;  1PUT A;  3AE7 B;  3AEA B;  3B2G A;  1CZP A;  2Y5C A;  2PVO D;  1XLP A;  4P6V F;  3W9C B;  3KWL A;  2DWQ A;  4WWM A;  2M56 B;  1JWB D;  2M19 A;  4N59 A; 
#chains in the Genus database with same CATH topology
 1S1Q B;  5EDS A;  2N0S B;  4BBN C;  2NPT A;  1AAR A;  4LNO A;  3AI5 A;  4BVU C;  1X1M A;  4DQO C;  2FAZ A;  3C19 A;  3DBL I;  3PGE A;  1T0Q C;  2D10 A;  3TSS A;  2KQ7 A;  2BB6 A;  2J7Q B;  3R2I A;  3DVG Y;  1Q10 A;  3P2B A;  2N9X A;  2MSE D;  1V81 A;  5DPT A;  2RPQ A;  4ZHP A;  1JWM D;  1E10 A;  3QWZ B;  4F8C B;  1BML C;  4LJP B;  2FCS A;  4B6W A;  2AL3 A;  2CHW A;  1ZXH A;  3H9D A;  1XO3 A;  3IG3 A;  2E6X A;  3RPF C;  3ZVV A;  4C56 C;  4W9K A;  2KDF B;  4NAW B;  3PO0 A;  2DYB A;  1GJZ A;  2O2V B;  2KVZ A;  1N61 A;  4M8N A;  2K1F A;  2K25 A;  4HCN B;  3RN9 C;  3AMZ A;  5KHO A;  4G11 A;  4AOF A;  2KQ4 X;  4FBJ B;  3VR8 B;  4AUQ C;  1PGB A;  1J7B A;  1WWT A;  1Y8R C;  3DBR B;  4JLC A;  4C4V B;  4YTM B;  4WIP A;  3DPD A;  2BS2 B;  3AEB B;  1FCL A;  1J19 A;  1SE2 A;  4HPP A;  3H7P B;  5CHF A;  2HTH A;  4LNK A;  4W9C A;  3ZJT A;  1TY0 A;  3KYC D;  5BYR A;  1TKE A;  1XT9 B;  4HCP B;  4I6P A;  3VTV A;  4GDL B;  2MWS B;  2W3S A;  5AZH A;  2MW5 A;  4BKT A;  2RMM A;  3HVZ A;  1K52 A;  5HG2 A;  3W1S C;  1ET6 A;  3QAR A;  2KDI A;  3AE8 B;  1L0Y B;  1FXI A;  3A1Q A;  2DWQ A;  4E71 A;  2Z0D B;  1C4C A;  1TS5 A;  3PHW B;  2ZW1 A;  2JXX A;  2YEP B;  3RNA C;  4BBN F;  2HJ8 A;  4KZ0 A;  1WGG A;  3Q8E A;  2LRU A;  2ASQ A;  4NQK E;  4TUU A;  3DBH B;  3DWM A;  1L0V B;  1D3Z A;  2HE7 A;  4KKI A;  4HKZ E;  2BWE S;  4MEL A;  1V5T A;  4O1N A;  4DBG A;  4A55 A;  3KYD D;  1C79 A;  2DZJ A;  4JWU C;  3X23 A;  4C7Y A;  1ZOY B;  3V3X A;  1TKY A;  2DX5 B;  3H1U A;  3W1S A;  3EUB 2;  2VRR B;  2FBW B;  2AEH A;  1PDX A;  4XDC A;  2V4I B;  2ZNV B;  1WJU A;  1NEN B;  4DHZ B;  1UWM A;  4HEA 1;  2KHW B;  2LD9 A;  2JRI B;  4RNA A;  1I4G A;  2UWQ A;  5TSS A;  4G50 A;  1ENF A;  3A4R A;  1HTO A;  1B9R A;  5BO4 B;  3I9V 1;  1WX9 A;  1UGM A;  1YNT E;  4II3 B;  2KDB A;  3RNB C;  4US9 A;  1WJ4 A;  5IOI A;  1KFY B;  1KTK A;  2BGF A;  2JWZ A;  3WAL A;  1J7A A;  2C7N B;  3B9J A;  3UI3 A;  1OEY J;  1AYF A;  3FIL B;  4MM3 A;  2WXI A;  4ITK A;  2K0P A;  4NJ7 A;  2DLB A;  2LGI A;  1WR1 A;  4EEW A;  1SJH D;  3TEZ A;  2LVP A;  4W9F A;  3EA6 A;  5C23 A;  2EMS A;  2JF5 A;  4DDI D;  2D5G A;  3I63 C;  4TMA B;  1VJK A;  1H8C A;  3MHZ A;  4M0W B;  4KDI C;  3RNE C;  4URK A;  1WYW B;  1WXQ A;  2ACZ B;  2MH7 A;  2MBE A;  1Z5S B;  2A5U A;  4DDG D;  1KJT A;  3ZRC A;  4XX5 A;  3BYT B;  4IUM B;  4GSW A;  2KFK B;  1KM7 A;  1N6Z A;  1T0R C;  3AH7 A;  3IHP C;  3N3K B;  2AWT A;  5TR5 A;  4MGI E;  5HFY A;  1V1O A;  1XLN A;  1F0Z A;  4EZJ A;  2MX2 A;  2G9H D;  2MBO A;  5JHB A;  2DZK A;  1E6E B;  2QEJ C;  3JSV A;  3PVL A;  2K22 A;  2FCN A;  2WNM A;  4DXA B;  3P4R B;  1TYG B;  4OHJ A;  3NZ3 A;  3PT2 B;  4NQL B;  4HVB A;  1K51 A;  3IFW B;  3PSE B;  1BT0 A;  1UD7 A;  1ZXI A;  2KN5 A;  3UQA A;  5H8Y E;  3Q2A C;  2Z59 B;  4W9I A;  1UEL A;  5G55 A;  4BKG A;  3MC0 B;  5IP4 D;  4ARI A;  2RPV A;  3QAQ A;  2J4X A;  1ZP0 B;  1V86 A;  2JX5 A;  4RGO S;  2D07 B;  1WGH A;  4N6E B;  4RFB A;  2BWF A;  1WR6 E;  3KW5 B;  3VUX A;  4A3P A;  3P63 A;  1I4R A;  2MJD A;  3K9P B;  4RF0 A;  3LB8 C;  2WXR A;  4GB9 A;  1CZP A;  4ICV A;  4DK5 A;  4USA A;  2MQJ A;  2RGF A;  2M19 A;  3R3M A;  1GB1 A;  4EOY A;  5LLI A;  4IOI E;  4J3O D;  2BS4 B;  3HK0 A;  1E8X A;  2NBV B;  3RNC C;  1YOV B;  1F1H A;  3AUL A;  2FCQ A;  4B0M A;  4II2 B;  3C8Y A;  2N9E B;  2DHZ A;  1QIL A;  3Q3M C;  3VUY A;  2AQ2 B;  4GXB A;  1LFD A;  4M0W A;  5LNK 1;  4W9J A;  2LGS A;  4A8X C;  4NY0 A;  1U4A A;  1PQS A;  2KD0 A;  1DOX A;  2K8B A;  2L52 A;  3CWI A;  1XF5 L;  2KWU B;  1UH6 A;  2EMT A;  3FKY A;  5EE1 A;  4K3B A;  4GN1 A;  3EFU A;  5HKH A;  2EKE C;  1CQV A;  2L0T A;  2MRP A;  4XWT A;  4ARC A;  1L2N A;  1QOB A;  2B3A A;  3CST A;  4FHK A;  3U8Z A;  2D3G A;  5HI1 A;  1MJD A;  3RI7 C;  4WAA A;  2NBW B;  3ONS A;  3N9Y C;  4DXF A;  3AU5 A;  3SDL C;  1GPX A;  3O65 B;  4IWQ A;  2WDT B;  1P0R A;  1K53 A;  3UIP B;  2BYV E;  3ZTC A;  1SF0 A;  2KTR B;  2H88 B;  1T5X D;  3NRZ A;  2AQ1 B;  4HKQ A;  2LAS A;  2WP9 B;  2ZZP B;  2QC8 A;  5CHV C;  2CU3 A;  3Q3O C;  4OVZ A;  2WDR B;  4PS3 A;  2C5L C;  2NBU A;  2WXM A;  5FKA C;  2BTE A;  3B08 A;  4KV2 A;  1C4P A;  2VZK D;  5G2N A;  1V9J A;  1XXG A;  2PKO A;  3ECI A;  1IGC A;  1YJI A;  3KUC B;  2QSD A;  1V2Y A;  1TY2 A;  1XLQ A;  4GDK A;  4TQ0 A;  2KJ6 A;  1WGD A;  2JSV X;  1AN8 A;  1NBF C;  5BYQ A;  2MA9 B;  2IND C;  4GMV A;  2VH1 A;  2NR2 A;  3J9C A;  3EEC A;  5AEK B;  1YX6 B;  3A9K B;  4LJO B;  3WCQ A;  2XNA C;  3H8H A;  3V05 A;  1XCT L;  3U7D A;  4MAC A;  3DVN V;  3NOB A;  1N5X A;  2ZVN A;  4KGS A;  1P7E A;  2MLB A;  5EE0 A;  3KQ4 A;  2HDE A;  3KUD B;  4HWI B;  3AN1 A;  4HPL B;  1I4X A;  3N1Z C;  1WX7 A;  3QCA A;  3V6C B;  2Y5P A;  4TSS A;  2L05 A;  2PE9 A;  3P42 A;  2KOX A;  2EKI A;  4HXD A;  1AWD A;  1NYR A;  3ALB A;  2ZW0 A;  2RDB C;  2LJI A;  4QAY A;  3IBE A;  4K3C A;  4YSX B;  3PS6 A;  4YSY B;  2CKH B;  4G3X B;  4C80 A;  3L13 A;  3VDZ A;  4PYZ A;  1MHH E;  3APD A;  3BYY B;  1BUI C;  3AU4 A;  3ZDT A;  1Q5W B;  2UYZ B;  1MG8 A;  4HRO A;  4OZA A;  3KVF B;  4LK0 M;  4MJS B;  2WXK A;  2KMA A;  3RZW C;  2WQY B;  1E7V A;  5FR3 A;  1FNV A;  1SE4 A;  1C77 A;  1PUT A;  3AEA B;  4XZ4 A;  2MP2 B;  2I1J A;  4K7U A;  1TGZ B;  1T0S C;  4A90 A;  1FFU A;  1FFV A;  2MEK A;  3AE4 B;  2LGD A;  4MGZ E;  3AV8 A;  3QJZ A;  2DYO A;  2BS3 B;  5LXH A;  1YIW A;  3S2A A;  2W9N A;  3L0W B;  1WM2 A;  2QMT A;  1ESF A;  2WXF A;  3ML8 A;  2LFI A;  5JXV A;  2PW9 A;  1L4Z B;  3Q8C A;  5I4D A;  1VCB A;  2NCN A;  1H4R A;  4FA6 A;  2H89 B;  3RZF A;  2ZCC A;  3ABV B;  4NPN A;  4BKS A;  2M0A A;  4WQO B;  4IM0 A;  2WXJ A;  1GC6 A;  3A4S C;  3IXS A;  3AE9 B;  2QIE B;  1OQY A;  2JPH A;  4KDL B;  2HD5 B;  1SJE D;  2MBB B;  4HK2 A;  1STE A;  5GXG B;  3Q14 C;  2ZPY A;  2BB5 A;  4KSK C;  4W9E A;  2WXH A;  1E90 A;  4LDT B;  3N30 A;  1HE8 A;  2WXQ A;  3CIR B;  4W9H A;  1KLG D;  1WI0 A;  1LGR A;  3TL5 A;  2J0K A;  2E3T A;  3ZW3 A;  4TQ1 A;  4DHZ E;  3HRD D;  1GNU A;  4ICU A;  4JQW C;  4YWG G;  1XCQ L;  2XN9 C;  2WX0 A;  4YT0 B;  2KDE B;  4MEM A;  2GBR A;  3SU8 X;  1QLB B;  4YXD B;  1P98 A;  1YJJ A;  1ZGU B;  2WXG A;  2IGG A;  3ZKJ C;  5J18 A;  2R2O A;  4RGM A;  1HA5 A;  2I1K A;  2IPK D;  2YVC A;  4B0E A;  1J0G A;  4FJY A;  3W9C B;  4WWM A;  1ZKH A;  1AW7 A;  1E5W A;  1L4D B;  2VZK B;  2FCM A;  4K7S A;  1GG3 A;  4A9A A;  4XDD A;  5AUI A;  3VRA B;  2L1A A;  4X57 B;  1WRD B;  4HJK A;  3GE8 C;  1NYQ A;  3QA8 A;  1TJE A;  4IKG A;  2K6D B;  3U30 A;  4ZDV A;  1NDD A;  3AEE B;  3AE6 B;  3APC A;  4IW0 A;  2X38 A;  2LJ5 A;  1FEH A;  1G6J A;  4E3C A;  3QC8 B;  3MC8 A;  4PS8 A;  4DXG A;  4BZA A;  3A9J B;  5EE9 A;  1WH3 A;  1WXV A;  1WX8 A;  1YD8 U;  4MGK E;  3FC4 A;  2IGD A;  3T3O A;  2DZI A;  2LGX A;  4KVG B;  2LWP A;  3KUZ A;  1C3T A;  2LHD A;  1FIQ A;  2GBK A;  2XEW A;  1IGD A;  4JPS A;  4ZYN A;  3N32 A;  2C7H A;  4FJZ A;  1F9J A;  1NEK B;  2PTL A;  3W5V B;  1TS3 A;  4MT5 A;  4P16 A;  3DBL B;  1HZ5 A;  4NAW A;  1I7H A;  2O2V A;  2CHZ A;  3VAW A;  4AJY B;  3K9O B;  2J0J A;  1CK1 A;  3BK1 A;  4FUL A;  4ZRI A;  1NI3 A;  2IY0 B;  1NI2 A;  1OFF A;  4C4V A;  1EUV B;  3DHI C;  3CF6 E;  1WF9 A;  2BYF A;  2N7D A;  2OJW A;  3DBS A;  1ZDV A;  3KWL A;  3H7P A;  4LNF A;  5D6J B;  2C7M B;  2W82 A;  4NZL B;  3SD5 A;  2XBB C;  4AP4 C;  1IPG A;  1M94 A;  5D3D A;  1YQ3 B;  1WIA A;  2CHX A;  4GDL A;  2M1M A;  1FXT B;  2GRI A;  2KMM A;  4WWP A;  1D6E C;  2ZNV C;  2LVQ A;  3W1Y A;  2GMI C;  2K39 A;  2N7J A;  1RM6 C;  2BBC A;  3I3T B;  3P1M A;  3MP9 A;  2ZPN A;  3ZNG C;  3RFZ B;  1GUA B;  5BMI A;  1I42 A;  3QQ8 B;  2DZM A;  4L2Y A;  2TSS A;  2ONQ A;  1TTN A;  3DQV A;  2KX3 A;  2Y5B B;  5T8I A;  1QKZ A;  3NJT A;  1JQ4 A;  2O6V B;  1EWC A;  2CS4 A;  1QF6 A;  1RYJ A;  3TUO A;  3DVG X;  1FD6 A;  4K1R B;  5E6N A;  1C76 A;  2MHJ A;  1VRA B;  2QHO A;  4EUT A;  3V61 A;  2JZP A;  1L6U A;  4N58 A;  4S0R A;  2IGH A;  1FMA D;  2KN4 A;  2D3A A;  1WE7 A;  4PYU A;  3OJ4 B;  4MGY E;  3QX1 A;  4XC2 A;  3TJP A;  5E6O A;  1B1Z A;  4DWF A;  2IDY A;  2KYW A;  3OJ3 A;  1GB4 A;  4WWO A;  1FNW A;  3IT6 B;  2R61 A;  1ZW7 A;  2BQQ A;  4JL9 A;  2WXL A;  2YEP F;  4XE0 A;  1BXT A;  2WGS A;  5BYS A;  3AB5 A;  2L8J A;  3V62 A;  2KX0 A;  3AXC A;  3VH4 B;  4P1B C;  1ZDX A;  3L54 A;  3E56 A;  1WGK A;  3LYY A;  4GIV A;  1T3Q A;  1EO6 A;  3HUI A;  4ZYS A;  3TBL D;  2OJR A;  3NUH B;  3PTF C;  1HTQ A;  1MPE A;  2WYQ A;  3W2D A;  5G5H A;  2LGY A;  3FIL A;  3I57 A;  3EC8 A;  3ZNH B;  1TIF A;  4WWN A;  4BFR A;  4MH0 E;  2LEK A;  2EEL A;  2LI5 A;  3BIN A;  3BWU D;  2G4S A;  3GOE A;  2JT4 B;  3RUI B;  1E0Z A;  3NVY A;  3VFK A;  1R4M I;  1OTR B;  1SE3 A;  2Z8L A;  1N63 A;  3L10 B;  5KHQ A;  4ZRP A;  1QT9 A;  1IBX B;  3ZNI D;  1WXS A;  1WXA A;  2L3Z A;  4L23 A;  3Q8F A;  3NVZ A;  2RD0 A;  2KJR A;  2MBQ A;  1E8Z A;  1R4N I;  3R7Q A;  2KFK A;  1D5M C;  4ZRK A;  4GU2 A;  2KWV B;  1I4P A;  2J52 A;  2DNF A;  1RRB A;  4F7Z A;  1MI0 A;  3WIM A;  1MFW A;  2W55 A;  2BT6 A;  2IO1 B;  4CQN A;  4LLG M;  2D2Q A;  2V9H A;  5BMH A;  4A3O A;  1P7F A;  2W3R A;  4D2K A;  1IUE A;  2FID A;  4BAX A;  4PK1 A;  2QCZ A;  4HLE A;  1D4B A;  2PPH A;  3R8B A;  2KDM A;  1EU4 A;  4M02 A;  2RDG A;  3HM3 A;  3VR9 B;  3VTW A;  4BOZ B;  4WJN A;  4BOS C;  1D5X C;  4WQM A;  2GBM A;  4W9L A;  2HJ1 A;  1Y56 A;  4IWP A;  2V1Y A;  4TV3 A;  1D5Z C;  4Q2J A;  2REX A;  3M62 B;  4UDU C;  3LJ3 A;  1F2R C;  5DPW A;  3V60 A;  3VUW A;  4RMA A;  4NJC A;  1WXM A;  2JVC A;  1QOA A;  1P9D U;  4JGH B;  4REZ A;  3AED B;  4EKU A;  3NZU A;  3RD2 A;  1TZ1 A;  1FRR A;  2JZ3 B;  4M00 A;  4S17 A;  1QOF A;  1FXA A;  3TMP B;  5EE3 A;  3Q8B A;  2LUE A;  1SBB B;  3ZIM A;  3WAN A;  2KWC A;  5G5G A;  4US8 A;  3QIJ A;  4P7I A;  2Y3A A;  2RR9 A;  1JWS D;  2LVO A;  4KZC A;  4B95 A;  3PV1 A;  1YN4 A;  2N1V A;  1JAL A;  2LUM A;  4RGT A;  1E7U A;  2CR5 A;  5GMV A;  3DHG C;  2JY6 A;  3PRZ A;  3UIN B;  1KLV A;  3ZXR A;  4XWW A;  2JWU A;  1E9M A;  4G0N B;  4N9F 4;  2NPT B;  3BVZ A;  4ZOH C;  2KC1 A;  3KLS X;  2WHI A;  4TKN A;  1HQR D;  2BF8 B;  1SXT A;  2WU2 B;  3U52 E;  1SE9 A;  2IO0 B;  2PJH A;  3TIX A;  2XK5 B;  1RLF A;  2BVC A;  1FNU A;  3N1X C;  2KTR A;  4YTP B;  3AEC B;  1NVI D;  2BW2 A;  4XYC A;  3MFG A;  2D3B A;  3IAM 1;  4I6L B;  1ISN A;  4EE2 A;  2L0F A;  4B9K A;  4NAM A;  1VLB A;  2WS3 B;  3L17 A;  4KGR A;  1JWA D;  2BYT A;  1UUP A;  2IY1 B;  1Q0W B;  2LXC A;  1A5R A;  1V8C A;  1JCK B;  1Z2M A;  3AM9 A;  1V97 A;  2X8X X;  3KH0 A;  4MSQ B;  1J7C A;  2IYD B;  2NMQ A;  4EZL A;  1V6E A;  2NVU I;  2N9L A;  5J17 A;  4WJQ A;  1QQR A;  2J53 A;  3TEW A;  1KF6 B;  3A9K A;  2VH2 A;  2KLG A;  1ZUD 2;  3DDC B;  4WAF A;  2WDV B;  4H2A A;  3P4P B;  3N1Y C;  1N62 A;  1DOI A;  2CU1 A;  4HDQ A;  4AJW A;  1MHX A;  2V3N A;  2KXJ A;  3PHX B;  1TZO A;  3BII D;  4ZHO A;  4R3D A;  2N9K A;  4IM2 A;  4XGA B;  2FE8 A;  1LXD A;  2PEA A;  5JH5 C;  4LTU A;  1GAQ B;  1XEE A;  1IYF A;  3GS2 A;  4HRS A;  3SFE B;  3WA0 A;  1I35 A;  3DHH C;  3M3J A;  1RWS A;  2QIL A;  5IO9 A;  3P4Q B;  1WYG A;  5C1Z A;  1YN3 A;  1LM8 B;  2JYE A;  4ACF A;  5E6J A;  3RYT A;  1F52 A;  2L00 B;  2KC2 A;  1WGR A;  2IO3 B;  4OVV A;  1MVK A;  3SR6 A;  4ANX A;  2IJ0 A;  1N60 A;  2V0G A;  4RM8 A;  2XK5 A;  3NS8 A;  4M8M A;  1VR9 A;  4PT5 A;  4AS1 A;  2ZJD A;  3DVN U;  3UIO B;  2PVO D;  2J0M A;  4AWJ A;  1PGA A;  2M56 B;  2BPS A;  4C7Z A;  5D7G A;  2MBH A;  1V5O A;  3Q3F A;  4I6N B;  2KAN A;  4MJS A;  2INC C;  3NVW A;  2KAC A;  1YMH E;  3X0W A;  1FPY A;  3U4E G;  2KKC A;  3GZN I;  2GI9 A;  5JHA A;  1ROE A;  4FLH A;  2YLM A;  4JWS C;  3L4P A;  3L16 A;  2IO2 B;  3Q69 A;  2B76 B;  2DAJ A;  1PYW D;  2MP2 A;  1QOG A;  3BVM A;  4EFO A;  1L0X B;  4HJG E;  4IG7 B;  2OOB B;  4RF1 A;  1OQQ A;  1YQ4 B;  1HZ6 A;  3TCA A;  5C2T B;  2BKR B;  3EGR A;  4RH6 A;  3DCG A;  1EF5 A;  3WAM A;  4LNI A;  4KSL C;  2GOW A;  1LQB A;  4LCD E;  3URY A;  1S3S G;  3A33 B;  4IC7 B;  1K50 A;  3D32 A;  2FUH B;  2RDH A;  1SB3 C;  4FAD A;  3ZXV A;  4MM3 B;  2MCN B;  4A6Q A;  3UF8 A;  2FUG 1;  1F77 A;  1XQQ A;  2WWZ A;  5JZE B;  3NY5 A;  5CX3 A;  3AE3 B;  4ASW C;  1VDV A;  2INP E;  4WJP A;  3T8M A;  3QK0 A;  1HXY D;  1TKG A;  3DOW A;  3AE5 B;  1XD3 B;  2KO3 A;  4ZRQ A;  3PRE A;  5IKC M;  1P1A A;  5HHD G;  2OED A;  4DHJ D;  1WSP A;  2DEN B;  2W54 A;  4IWO A;  1C4A A;  2ON8 A;  4EZK A;  2OHF A;  2JUO A;  4GLS C;  3V6E B;  1EU3 A;  4HPM B;  2K8H A;  3RNF C;  4MH8 A;  4K7W A;  3HVD A;  2KLC A;  1EF1 A;  2KNB A;  2K5P A;  2KK8 A;  3ZJU A;  5DPR A;  1K8R B;  3Q3J A;  1LO5 D;  3VHT C;  1ZE3 D;  2KJH B;  1WGY A;  4E74 A;  1EWY C;  3JSV B;  2KQS A;  3SEB A;  1UZX B;  1TS4 A;  3OG5 A;  3RMK C;  3Q3N C;  2G3Q B;  4FHJ A;  3C0R B;  3VXW A;  1VZ6 A;  3JW0 X;  1PGX A;  3W5U B;  4PS7 A;  3ZNZ B;  1JRO A;  2A4Z A;  4HDO A;  2PIA A;  2GLS A;  3GZN B;  5CHW A;  3H7S A;  2G4D B;  2ZVO A;  2BKF A;  3N20 C;  1T6B X;  1SIJ A;  4KKJ A;  1UBI A;  3ML9 A;  1WZ0 A;  2I2Y A;  1E8W A;  2K3U A;  1QZE A;  1L7Y A;  3NS1 A;  2K9X A;  3PZ8 A;  4RCO A;  4W9G A;  3A9J A;  3H6N A;  3ZYY X;  3JVZ X;  1FCC C;  4BKS D;  2NTS A;  1WM3 A;  1P3Q U;  1WMH B;  1ZPS A;  2K6Q A;  1L6V A;  3PZD A;  4ANW A;  2DBY A;  5J2R A;  4YL8 A;  4OZC A;  2G45 B;  1XLO A;  3LXF A;  2N4F A;  1F2R I;  1SIF A;  2V4L A;  3AEG B;  1YQB A;  3B2G A;  2Y5C A;  4P6V F;  4N59 A;  2L7R A;  1FRD A;  3IAS 1;  3QHT A;  2JU6 X;  1JML A;  3P4S B;  3NZS A;  2D11 A;  2C60 A;  1C78 A;  5IN7 A;  1C9F A;  2PE6 B;  4JIO U;  2R2Q A;  4IDI A;  2WU5 B;  3ZDM C;  3ZLZ A;  2WLB A;  5L83 A;  1SSN A;  2IZV B;  2Z0E B;  3MTN B;  1FO4 A;  3B0A A;  1C1Y B;  4K81 A;  4JX1 C;  4NNJ B;  1OEY A;  3PLU A;  4W9D A;  3JYU A;  5D94 A;  2MJ3 A;  2NTT A;  3M63 B;  2DAF A;  3UGB B;  4GDK B;  1EM7 A;  1DOY A;  1OGW A;  2HTM E;  2PMV A;  5IAA C;  3VTU A;  1RFK A;  3ZRF A;  3BVG A;  3WAO A;  1L5P A;  4AQ7 A;  2QDF A;  2LHE A;  3UQB A;  1V1P B;  3PRM B;  2DYM A;  2WXO A;  2UU7 A;  2M8S A;  2KTF A;  1N5W A;  2I38 A;  2KWD A;  3NHE B;  4LNN A;  2O6V A;  3TEX A;  5LXI B;  1VZ7 A;  2FNJ B;  4ANV A;  2L76 A;  2IBI B;  1WMH A;  2M4N A;  4WUR A;  5AUK A;  2LXA A;  2KAJ A;  3B1L X;  1JRU A;  2Q5W D;  2KMC A;  1YN5 A;  3HM6 X;  1JWU D;  4J6I A;  3EFC A;  1KLU D;  1OQR A;  3R2T A;  4RGN A;  1WJ6 A;  2M0X A;  4RM9 A;  1HEZ E;  3L08 A;  1V80 A;  1PFD A;  2C9W B;  4MDK E;  4YSZ B;  3DWG C;  1YX5 B;  3TEY A;  3E9S A;  1YJ1 A;  1RAX A;  2J42 A;  2MJE A;  1RFA A;  2N1W A;  3GP7 A;  1IP9 A;  4LDT D;  1WE6 A;  4DHJ B;  4FXC A;  2G1E A;  3ZTD A;  2V3S A;  2CJN A;  4M01 A;  2CJO A;  2ICI A;  4KIK B;  2N7E A;  4A20 A;  1E7P B;  3GB1 A;  3RNG C;  1KRH A;  5BMG A;  1JW9 D;  5CTR C;  2RSU A;  1UNS A;  1KH0 A;  3VVW B;  4C00 A;  4WH4 A;  4FN2 A;  5DPS A;  3RCZ A;  2V3P A;  3U7Z A;  3U2S C;  2NS5 A;  3MC9 A;  1FM0 D;  4L1B A;  1TS2 A;  3ZUN A;  3FAH A;  1UBQ A;  2WX1 A;  4NJ6 A;  3PRP B;  3HHM A;  3AEF B;  3PLV A;  2AX5 A;  3ZJV A;  2WDQ B;  3LDZ E;  1R7S A;  1M4V A;  3I5J C;  3RUL A;  2M17 A;  3CMM B;  1GC7 A;  1T0Y A;  2JXT A;  4P1C C;  3IVF A;  3APF A;  5E6P A;  4CYE A;  2WXP A;  3NVV A;  2LMC A;  2BYE A;  5D2M B;  1V1P A;  1IBX A;  1GOZ A;  3MHS D;  5H92 C;  4ZRJ A;  3NG0 A;  3RT3 B;  3VQI A;  3OAW A;  3WAP A;  2SAK A;  4FJV B;  3SFD B;  4OVU A;  2KVR A;  3BZD B;  4GGQ A;  3HIZ A;  1ACC A;  1R4M B;  4OW0 A;  4OZB A;  1XLP A;  1WY8 A;  1SGH A;  5AZG A;  1JWB D;  4CO7 A;  2GBJ A;  4KGT A;  1V49 A;  3ZGZ A;  2L83 A;  1DYQ A;  3MJ5 A;  3MJW A;  2N9P C;  2PVG C;  2PLP A;  3KWV A;  1R4N B;  5IA7 A;  4YTN B;  4KX6 B;  1CMX B;  5FR6 A;  2WXN A;  2AL6 A;  1A70 A;  1WZ3 A;  3OLM D;  4KIK A;  4IM3 A;  4JE3 B;  1WFY A;  3AE2 B;  3DBR I;  2JYT A;  2KT7 A;  2LRW A;  3ENE A;  3VRB B;  3ETR A;  3PPA A;  3R66 C;  1E8Y A;  1KOT A;  2D3C A;  2K8C A;  2KZR A;  3O13 A;  3T3N A;  4MSM B;  1SEB D;  3Q8A A;  3BK2 A;  1MG4 A;  3BY4 B;  1DGJ A;  1WRI A;  1VZ8 A;  2JQR B;  3R7R A;  5C3J B;  1UGJ A;  4F1S A;  3ZQ4 A;  2GB1 A;  3AE1 B;  2ZCB A;  5FK9 C;  1CJE A;  5DCN A;  3CSF A;  3VH3 B;  3B2F A;  2ZEQ A;  2JRH A;  4WJO A;  4GOC A;  3PZ7 A;  3EHV A;  1UWX A;  3M95 A;  5AZF A;  2QJL A;  1TBE A;  5L95 C;  3ZO5 B;  3SHQ A;  2INN E;  2AQ3 B;  5MPO A;  2GBN A;  3OWE B;  3Q6B A;  3IT4 B;  4ANU A;  2KFJ A;  1J8C A;  2AYO B;  3T9L A;  5D3I B;  1UF0 A;  3GE3 C;  2SEB D;  3DBH I;  1I4Q A;  4CHK A;  3A1Q B;  1JRP A;  1TT5 B;  1VD2 A;  1I4H A;  1ET9 A;  3AE7 B;  1WJN A;  2O6V D;  2JZZ A;  2FIF A;  2LZ6 A;  1Q1O A;  2L32 A; 
#chains in the Genus database with same CATH homology
 2K5P A;  3ZJU A;  2N0S B;  1ZDX A;  3E56 A;  1WGK A;  3LYY A;  1T3Q A;  3WCQ A;  2XNA C;  3HUI A;  4ZYS A;  4DQO C;  3H8H A;  3V05 A;  1XCT L;  3TSS A;  1LO5 D;  4MAC A;  3NUH B;  2BB6 A;  3R2I A;  1MPE A;  1ZE3 D;  3W2D A;  1N5X A;  1Q10 A;  4KGS A;  1P7E A;  5G5H A;  3FIL A;  1EWY C;  3I57 A;  5EE0 A;  4ZHP A;  3SEB A;  1JWM D;  2HDE A;  3KQ4 A;  1E10 A;  2LEK A;  3AN1 A;  1TS4 A;  2EEL A;  1BML C;  1I4X A;  3BWU D;  1ZXH A;  1VZ6 A;  1XO3 A;  1E0Z A;  3NVY A;  2E6X A;  3RPF C;  2Y5P A;  4TSS A;  4C56 C;  3P42 A;  1SE3 A;  3PO0 A;  4NAW B;  2Z8L A;  1PGX A;  2EKI A;  1N61 A;  1N63 A;  3W5U B;  1AWD A;  4ZRP A;  1QT9 A;  1IBX B;  1NYR A;  1JRO A;  2ZW0 A;  2LJI A;  2PIA A;  3AMZ A;  4L23 A;  3Q8F A;  3NVZ A;  2KQ4 X;  4YSX B;  3VR8 B;  1PGB A;  1T6B X;  1SIJ A;  1J7B A;  1WWT A;  4KKJ A;  4YTM B;  4WIP A;  1D5M C;  2I2Y A;  4YSY B;  2BS2 B;  2K3U A;  3AEB B;  1FCL A;  3NS1 A;  1SE2 A;  4C80 A;  2K9X A;  3PZ8 A;  4RCO A;  1I4P A;  1MHH E;  3BYY B;  2J52 A;  1BUI C;  3ZYY X;  3ZJT A;  1TY0 A;  1FCC C;  2NTS A;  1MI0 A;  5BYR A;  1TKE A;  1ZPS A;  4HRO A;  4GDL B;  4OZA A;  4LK0 M;  2W55 A;  2BT6 A;  2WXK A;  4CQN A;  1L6V A;  2W3S A;  4LLG M;  5BMH A;  2DBY A;  2RMM A;  2WQY B;  3HVZ A;  4OZC A;  1K52 A;  5HG2 A;  1P7F A;  2W3R A;  1XLO A;  3LXF A;  1ET6 A;  4D2K A;  5FR3 A;  3AE8 B;  1FNV A;  1SE4 A;  1F2R I;  1IUE A;  1L0Y B;  1FXI A;  3AEG B;  1C77 A;  1PUT A;  3B2G A;  3AEA B;  2Y5C A;  1D4B A;  4P6V F;  2DWQ A;  2KDM A;  3R8B A;  4N59 A;  1EU4 A;  1FRD A;  2RDG A;  1C4C A;  3IAS 1;  3VR9 B;  1TS5 A;  4A90 A;  2JU6 X;  1JML A;  1FFU A;  1FFV A;  2ZW1 A;  2MEK A;  3P4S B;  2YEP B;  3AE4 B;  1D5X C;  4WQM A;  3AV8 A;  3Q8E A;  1C78 A;  2DYO A;  2BS3 B;  1Y56 A;  1C9F A;  3DWM A;  2QMT A;  1ESF A;  2WXF A;  1L0V B;  1D5Z C;  2LFI A;  4Q2J A;  5JXV A;  2PW9 A;  4KKI A;  1L4Z B;  4IDI A;  2WU5 B;  4UDU C;  3Q8C A;  4HKZ E;  5I4D A;  1F2R C;  2WLB A;  1SSN A;  4O1N A;  2H89 B;  3ABV B;  4NJC A;  2M0A A;  1FO4 A;  1QOA A;  2WXJ A;  4A55 A;  4REZ A;  3AED B;  3IXS A;  1C79 A;  4JWU C;  3AE9 B;  4C7Y A;  1ZOY B;  2QIE B;  1FRR A;  4JX1 C;  3V3X A;  1TKY A;  3W1S A;  3EUB 2;  2FBW B;  1QOF A;  1FXA A;  2MJ3 A;  5EE3 A;  1STE A;  3Q8B A;  1PDX A;  4XDC A;  2V4I B;  5GXG B;  1SBB B;  2NTT A;  5G5G A;  4US8 A;  1NEN B;  2BB5 A;  1UWM A;  2Y3A A;  4HEA 1;  1JWS D;  4GDK B;  1EM7 A;  3J9C A;  4RNA A;  1DOY A;  2WXH A;  1YN4 A;  1I4G A;  1JAL A;  2HTM E;  5TSS A;  2PMV A;  2LUM A;  4RGT A;  2WXQ A;  3CIR B;  1ENF A;  1KLG D;  1RFK A;  1B9R A;  3BVG A;  1L5P A;  4AQ7 A;  2LHE A;  2E3T A;  4XWW A;  2JWU A;  4TQ1 A;  1V1P B;  3I9V 1;  2DYM A;  1E9M A;  2WXO A;  3HRD D;  4YWG G;  3BVZ A;  4ZOH C;  1N5W A;  3KLS X;  2I38 A;  1YNT E;  1XCQ L;  2KWD A;  2XN9 C;  4YT0 B;  1HQR D;  3TEX A;  1SXT A;  2WU2 B;  1VZ7 A;  3U52 E;  1QLB B;  4YXD B;  4US9 A;  4WUR A;  1KFY B;  1KTK A;  5AUK A;  1YJJ A;  2KAJ A;  2WXG A;  2IGG A;  2Q5W D;  1YN5 A;  1FNU A;  1J7A A;  3B9J A;  3UI3 A;  1JWU D;  1AYF A;  4YTP B;  3AEC B;  4RGM A;  1HA5 A;  1KLU D;  1NVI D;  2WXI A;  3FIL B;  2K0P A;  4ITK A;  1OQR A;  2IPK D;  2BW2 A;  3R2T A;  2DLB A;  2LGI A;  4RGN A;  1SJH D;  4B0E A;  3TEZ A;  3MFG A;  1HEZ E;  3W9C B;  3IAM 1;  4EE2 A;  3EA6 A;  4WWM A;  1AW7 A;  1PFD A;  4NAM A;  1VLB A;  4YSZ B;  2WS3 B;  1L4D B;  3DWG C;  2VZK B;  3TEY A;  3E9S A;  2J42 A;  2MJE A;  3GP7 A;  4KGR A;  1JWA D;  2D5G A;  2BYT A;  4A9A A;  4XDD A;  4TMA B;  1UUP A;  5AUI A;  3VRA B;  1VJK A;  2L1A A;  4FXC A;  3MHZ A;  2G1E A;  1V8C A;  2CJN A;  1JCK B;  1NYQ A;  2CJO A;  3AM9 A;  1TJE A;  1WXQ A;  1V97 A;  4IKG A;  2ICI A;  1J7C A;  2ACZ B;  2NMQ A;  1E7P B;  2MH7 A;  3GB1 A;  1KRH A;  5BMG A;  1JW9 D;  1UNS A;  3AEE B;  3AE6 B;  1KH0 A;  2N9L A;  4WH4 A;  1QQR A;  3HVD A;  2V3P A;  3BYT B;  3U7Z A;  3U2S C;  2J53 A;  2X38 A;  3TEW A;  1FEH A;  1KF6 B;  1FM0 D;  1ZUD 2;  4WAF A;  2WDV B;  4L1B A;  3AH7 A;  4H2A A;  1TS2 A;  3FAH A;  3P4P B;  4DXG A;  1N62 A;  5EE9 A;  1V1O A;  1DOI A;  1XLN A;  3AEF B;  1MHX A;  2V3N A;  1F0Z A;  1TZO A;  3FC4 A;  2IGD A;  2AX5 A;  3BII D;  3ZJV A;  2WDQ B;  3T3O A;  4ZHO A;  2G9H D;  1E6E B;  2QEJ C;  1R7S A;  1M4V A;  4R3D A;  2N9K A;  2K22 A;  2FE8 A;  2LHD A;  2WNM A;  1FIQ A;  4LTU A;  1GAQ B;  3P4R B;  1XEE A;  2JXT A;  1IGD A;  3GS2 A;  4HRS A;  4JPS A;  1TYG B;  1NEK B;  3NZ3 A;  4OHJ A;  3SFE B;  2PTL A;  3W5V B;  1RWS A;  1TS3 A;  2QIL A;  2WXP A;  4MT5 A;  4P16 A;  1HZ5 A;  3NVV A;  1K51 A;  1WYG A;  2LMC A;  3P4Q B;  1YN3 A;  1I7H A;  1ZXI A;  2JYE A;  5H8Y E;  5E6J A;  1V1P A;  1IBX A;  1GOZ A;  5H92 C;  1CK1 A;  3MC0 B;  3BK1 A;  4ARI A;  2RPV A;  3VQI A;  2J4X A;  1MVK A;  2SAK A;  1ZP0 B;  2IJ0 A;  2JX5 A;  4RGO S;  3SR6 A;  3SFD B;  1N60 A;  3BZD B;  2V0G A;  4N6E B;  4RFB A;  1NI3 A;  1VR9 A;  4PT5 A;  3P63 A;  1I4R A;  1OFF A;  2MJD A;  1ACC A;  4AS1 A;  4OW0 A;  4RF0 A;  3LB8 C;  2WXR A;  4OZB A;  1CZP A;  2PVO D;  1XLP A;  1ZDV A;  3KWL A;  4USA A;  1PGA A;  1JWB D;  2M56 B;  2M19 A;  1GB1 A;  2W82 A;  4C7Z A;  5D7G A;  4NZL B;  4IOI E;  2BS4 B;  4J3O D;  4KGT A;  5D3D A;  3ZGZ A;  2L83 A;  1YQ3 B;  1DYQ A;  4B0M A;  3C8Y A;  3MJ5 A;  1QIL A;  2PVG C;  2AQ2 B;  2PLP A;  3KWV A;  3NVW A;  2KAC A;  1YMH E;  2GRI A;  4M0W A;  5LNK 1;  3U4E G;  2KMM A;  4YTN B;  4KX6 B;  2GI9 A;  4A8X C;  1ROE A;  2WXN A;  1D6E C;  4JWS C;  1DOX A;  1A70 A;  3L4P A;  2L52 A;  3CWI A;  1XF5 L;  3Q69 A;  2B76 B;  1PYW D;  2N7J A;  4JE3 B;  5EE1 A;  1QOG A;  1RM6 C;  3AE2 B;  3BVM A;  2BBC A;  2JYT A;  3P1M A;  1L0X B;  3MP9 A;  4HJG E;  3VRB B;  3ETR A;  1CQV A;  3RFZ B;  4RF1 A;  1OQQ A;  4XWT A;  1YQ4 B;  1HZ6 A;  5BMI A;  4ARC A;  3O13 A;  3T3N A;  1QOB A;  4L2Y A;  1SEB D;  5C2T B;  3Q8A A;  5HI1 A;  2TSS A;  3BK2 A;  2ONQ A;  3EGR A;  1DGJ A;  1WRI A;  1VZ8 A;  4RH6 A;  5T8I A;  1QKZ A;  2JQR B;  1JQ4 A;  5C3J B;  1UGJ A;  1EWC A;  3N9Y C;  4DXF A;  1RYJ A;  3ZQ4 A;  3TUO A;  1QF6 A;  1GPX A;  1FD6 A;  1C76 A;  2GB1 A;  3URY A;  1K53 A;  3AE1 B;  1SF0 A;  1K50 A;  1VRA B;  5FK9 C;  1CJE A;  2RDH A;  2H88 B;  1SB3 C;  1T5X D;  3NRZ A;  2AQ1 B;  4HKQ A;  4MM3 B;  2WP9 B;  4A6Q A;  3B2F A;  2JZP A;  2FUG 1;  1F77 A;  1L6U A;  4N58 A;  3AE3 B;  2CU3 A;  4OVZ A;  1VDV A;  2WDR B;  2INP E;  2IGH A;  1FMA D;  1HXY D;  2KN4 A;  2WXM A;  5FKA C;  3PZ7 A;  1UWX A;  2BTE A;  1TKG A;  2QJL A;  1C4P A;  3AE5 B;  2INN E;  2AQ3 B;  5MPO A;  1B1Z A;  2VZK D;  3OWE B;  4ZRQ A;  2IDY A;  3IT4 B;  1GB4 A;  1XXG A;  2PKO A;  1IGC A;  1YJI A;  1FNW A;  3IT6 B;  5D3I B;  2QSD A;  2R61 A;  1XLQ A;  1TY2 A;  2OED A;  5HHD G;  2SEB D;  2WXL A;  1WSP A;  2W54 A;  2YEP F;  4XE0 A;  4TQ0 A;  1I4Q A;  1BXT A;  2JSV X;  5BYS A;  1JRP A;  3AB5 A;  1AN8 A;  1C4A A;  2ON8 A;  2OHF A;  5BYQ A;  4GLS C;  1EU3 A;  1I4H A;  1ET9 A;  3AE7 B;  4MH8 A;  5HFY A;  1SJE D;  2L32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...