2JXIA

Solution structure of the dna-binding domain of pseudomonas putida proline utilization a (puta) bound to gttgca dna sequence
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
45
structure length
45
Chain Sequence
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Pseudomonas putida protein PpPutA45 and its DNA complex
pubmed doi rcsb
molecule tags Dna binding protein, dna
molecule keywords Proline dehydrogenase
total genus 13
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2jxiA01
1X93A 2BJ8A 2CAXA 2K5JA 1MNTA 2JXGA 4D8JA 2CA9A 1ARRA 3LGHA 2JXIA 4HV0A 3QOQA 2BJ7A 1MYKA 2GPEA 3VEAA 2HZVA 1U9PA 2RBFA 3H87C 1NLAA 2BJ3A 2WVEA 2BNWA 4ME7E 1B01A 2WVBA 1B28A 1ARQA 2K1OA 2WVDA 3FMTA 1P94A 1BDTA 2KELA 3VW4A 1MYLA 1BDVA 2WVFA 2BA3A 2K6LA 1BAZA 2CADA 2BJ1A 4FXEA 2BJ9A 2K29A 3OD2A 2BNZA 2BSQE 2H1OE 2AY0A 3FT7A 1EA4A 1PARA 2K9IA 3VEBA 1IRQA 2CPGA 2JXHA 2WVCA 3GXQA 1QTGA 2CAJA 2HZAA 1Q5VA
chains in the Genus database with same CATH superfamily
1X93A 1SH3A 3BSOA 1Q16A 2JXIA 2BJ7A 2GPEA 3VEAA 2HZVA 2BNWA 3H87C 2BJ3A 2WVDA 3NAHA 2WVFA 2CADA 2BJ9A 3OD2A 2BSQE 2AY0A 3FT7A 2JXHA 3GXQA 1ARQA 1MNTA 2JXGA 3BSNA 2CA9A 3LGHA 3IR7A 3SFGA 2RBFA 2Q2KA 2WK4A 3FMTA 2H3AA 3UR0A 2KELA 4LRVA 3H5XA 2BA3A 2K6LA 3NAIA 2B43A 3QIDA 2K29A 2CPGA 2WVCA 1SIWA 3UPFA 2CAJA 1Q5VA 2BJ8A 2CAXA 2K5JA 4NRTA 3NO7A 4D8JA 4NRUA 2JBVA 3G5OA 4HV0A 1MYKA 1SH2A 1U9PA 2WVEA 4ME7E 1OG7A 2WVBA 2K1OA 2AN7A 4MJWA 1BDTA 3NNEA 3VW4A 1MYLA 2H1OE 1EA4A 4LQ9A 2ADLA 1IRQA 1QTGA 1ARRA 4QPXA 2KOEA 2A2BA 3SFUA 3QOQA 2HZAA 1NLAA 4LQ3A 1B01A 1B28A 2KKEA 4O4RA 3UQSA 1P94A 1SH0A 2CKWA 1BDVA 1BAZA 1OHNA 2BJ1A 4FXEA 3H5YA 2BNZA 1PARA 2UUTA 3LJPA 2K9IA 4AAIA 3VEBA 2UUWA
chains in the Genus database with same CATH topology
1X93A 2BJ8A 2CAXA 2K5JA 1MNTA 2JXGA 4D8JA 2CA9A 1ARRA 3LGHA 2JXIA 4HV0A 3QOQA 2BJ7A 1MYKA 2GPEA 3VEAA 2HZVA 1U9PA 2RBFA 3H87C 1NLAA 2BJ3A 2WVEA 2BNWA 4ME7E 1B01A 2WVBA 1B28A 1ARQA 2K1OA 2WVDA 3FMTA 1P94A 1BDTA 2KELA 3VW4A 1MYLA 1BDVA 2WVFA 2BA3A 2K6LA 1BAZA 2CADA 2BJ1A 4FXEA 2BJ9A 2K29A 3OD2A 2BNZA 2BSQE 2H1OE 2AY0A 3FT7A 1EA4A 1PARA 2K9IA 3VEBA 1IRQA 2CPGA 2JXHA 2WVCA 3GXQA 1QTGA 2CAJA 2HZAA 1Q5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X93 A;  2BJ8 A;  2CAX A;  2K5J A;  1MNT A;  2JXG A;  4D8J A;  2CA9 A;  1ARR A;  3LGH A;  2JXI A;  4HV0 A;  3QOQ A;  2BJ7 A;  1MYK A;  2GPE A;  3VEA A;  2HZV A;  1U9P A;  2RBF A;  3H87 C;  1NLA A;  2BJ3 A;  2WVE A;  2BNW A;  4ME7 E;  1B01 A;  2WVB A;  1B28 A;  1ARQ A;  2K1O A;  2WVD A;  3FMT A;  1P94 A;  1BDT A;  2KEL A;  3VW4 A;  1MYL A;  1BDV A;  2WVF A;  2BA3 A;  2K6L A;  1BAZ A;  2CAD A;  2BJ1 A;  4FXE A;  2BJ9 A;  2K29 A;  3OD2 A;  2BNZ A;  2BSQ E;  2H1O E;  2AY0 A;  3FT7 A;  1EA4 A;  1PAR A;  2K9I A;  3VEB A;  1IRQ A;  2CPG A;  2JXH A;  2WVC A;  3GXQ A;  1QTG A;  2CAJ A;  2HZA A;  1Q5V A; 
#chains in the Genus database with same CATH topology
 1X93 A;  1SH3 A;  3BSO A;  1Q16 A;  2JXI A;  2BJ7 A;  2GPE A;  3VEA A;  2HZV A;  2BNW A;  3H87 C;  2BJ3 A;  2WVD A;  3NAH A;  2WVF A;  2CAD A;  2BJ9 A;  3OD2 A;  2BSQ E;  2AY0 A;  3FT7 A;  2JXH A;  3GXQ A;  1ARQ A;  1MNT A;  2JXG A;  3BSN A;  2CA9 A;  3LGH A;  3IR7 A;  3SFG A;  2RBF A;  2Q2K A;  2WK4 A;  3FMT A;  2H3A A;  3UR0 A;  2KEL A;  4LRV A;  3H5X A;  2BA3 A;  2K6L A;  3NAI A;  2B43 A;  3QID A;  2K29 A;  2CPG A;  2WVC A;  1SIW A;  3UPF A;  2CAJ A;  1Q5V A;  2BJ8 A;  2CAX A;  2K5J A;  4NRT A;  3NO7 A;  4D8J A;  4NRU A;  2JBV A;  3G5O A;  4HV0 A;  1MYK A;  1SH2 A;  1U9P A;  2WVE A;  4ME7 E;  1OG7 A;  2WVB A;  2K1O A;  2AN7 A;  4MJW A;  1BDT A;  3NNE A;  3VW4 A;  1MYL A;  2H1O E;  1EA4 A;  4LQ9 A;  2ADL A;  1IRQ A;  1QTG A;  1ARR A;  4QPX A;  2KOE A;  2A2B A;  3SFU A;  3QOQ A;  2HZA A;  1NLA A;  4LQ3 A;  1B01 A;  1B28 A;  2KKE A;  4O4R A;  3UQS A;  1P94 A;  1SH0 A;  2CKW A;  1BDV A;  1BAZ A;  1OHN A;  2BJ1 A;  4FXE A;  3H5Y A;  2BNZ A;  1PAR A;  2UUT A;  3LJP A;  2K9I A;  4AAI A;  3VEB A;  2UUW A; 
#chains in the Genus database with same CATH homology
 1X93 A;  2BJ8 A;  2CAX A;  2K5J A;  1MNT A;  2JXG A;  4D8J A;  2CA9 A;  1ARR A;  3LGH A;  2JXI A;  4HV0 A;  3QOQ A;  2BJ7 A;  1MYK A;  2GPE A;  3VEA A;  2HZV A;  1U9P A;  2RBF A;  3H87 C;  1NLA A;  2BJ3 A;  2WVE A;  2BNW A;  4ME7 E;  1B01 A;  2WVB A;  1B28 A;  1ARQ A;  2K1O A;  2WVD A;  3FMT A;  1P94 A;  1BDT A;  2KEL A;  3VW4 A;  1MYL A;  1BDV A;  2WVF A;  2BA3 A;  2K6L A;  1BAZ A;  2CAD A;  2BJ1 A;  4FXE A;  2BJ9 A;  2K29 A;  3OD2 A;  2BNZ A;  2BSQ E;  2H1O E;  2AY0 A;  3FT7 A;  1EA4 A;  1PAR A;  2K9I A;  3VEB A;  1IRQ A;  2CPG A;  2JXH A;  2WVC A;  3GXQ A;  1QTG A;  2CAJ A;  2HZA A;  1Q5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...