2JXIA

Solution structure of the dna-binding domain of pseudomonas putida proline utilization a (puta) bound to gttgca dna sequence
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
45
structure length
45
Chain Sequence
MATTTLGVKLDDPTRERLKAAAQSIDRTPHWLIKQAIFNYLEKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Pseudomonas putida protein PpPutA45 and its DNA complex
pubmed doi rcsb
molecule tags Dna binding protein, dna
molecule keywords Proline dehydrogenase
total genus 13
structure length 45
sequence length 45
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2jxiA01
2WVCA 1BDVA 2AY0A 3LGHA 4D8JA 2BJ1A 1NLAA 2BJ7A 1B01A 3QOQA 3FMTA 3H87C 2K9IA 2KELA 2RBFA 2K29A 2BJ9A 1MYKA 4HV0A 1X93A 1EA4A 2GPEA 2K1OA 1BAZA 1ARRA 3GXQA 2JXHA 2JXIA 3VW4A 2WVFA 1BDTA 2BJ3A 2K6LA 1ARQA 2WVEA 2H1OE 1B28A 1P94A 4ME7E 2CAJA 2K5JA 3OD2A 2WVDA 2BSQE 1MNTA 3VEAA 1QTGA 2BA3A 1Q5VA 1IRQA 2HZAA 2CAXA 2BNWA 1U9PA 3FT7A 2WVBA 4FXEA 2BJ8A 1PARA 2CPGA 2HZVA 2CADA 3VEBA 1MYLA 2JXGA 2BNZA 2CA9A
chains in the Genus database with same CATH superfamily
3QIDA 2AY0A 2BJ1A 1NLAA 3NAHA 3FMTA 2K9IA 3NNEA 2KELA 2K29A 2KKEA 1X93A 2GPEA 1BAZA 1ARRA 2JXHA 3VW4A 4LQ3A 2WVDA 1MNTA 1QTGA 1Q5VA 4NRUA 2CAXA 4FXEA 1PARA 1SH3A 2A2BA 2BJ8A 2WVCA 2CA9A 2H3AA 3G5OA 3H87C 2RBFA 4LQ9A 4HV0A 1MYKA 2Q2KA 2WK4A 1P94A 4ME7E 4NRTA 2CAJA 1SH2A 3OD2A 1SIWA 2UUTA 2HZAA 2BNWA 1OHNA 1U9PA 3UQSA 1Q16A 2WVBA 2CPGA 3LJPA 1MYLA 2BNZA 4LRVA 1BDVA 4D8JA 2KOEA 3SFGA 3NAIA 2JBVA 1OG7A 1SH0A 4AAIA 2JXIA 2WVFA 3BSNA 1BDTA 2BJ3A 2K6LA 3H5XA 3SFUA 2WVEA 1B28A 2K5JA 2BSQE 3H5YA 3BSOA 1IRQA 2UUWA 3UPFA 3NO7A 3FT7A 4QPXA 3VEBA 2K1OA 2JXGA 2CKWA 2BJ7A 1B01A 3QOQA 2AN7A 2BJ9A 1EA4A 3IR7A 4MJWA 2B43A 1ARQA 2H1OE 4O4RA 3VEAA 2ADLA 2BA3A 3UR0A 2HZVA 2CADA 3GXQA 3LGHA
chains in the Genus database with same CATH topology
2WVCA 1BDVA 2AY0A 3LGHA 4D8JA 2BJ1A 1NLAA 2BJ7A 1B01A 3QOQA 3FMTA 3H87C 2K9IA 2KELA 2RBFA 2K29A 2BJ9A 1MYKA 4HV0A 1X93A 1EA4A 2GPEA 2K1OA 1BAZA 1ARRA 3GXQA 2JXHA 2JXIA 3VW4A 2WVFA 1BDTA 2BJ3A 2K6LA 1ARQA 2WVEA 2H1OE 1B28A 1P94A 4ME7E 2CAJA 2K5JA 3OD2A 2WVDA 2BSQE 1MNTA 3VEAA 1QTGA 2BA3A 1Q5VA 1IRQA 2HZAA 2CAXA 2BNWA 1U9PA 3FT7A 2WVBA 4FXEA 2BJ8A 1PARA 2CPGA 2HZVA 2CADA 3VEBA 1MYLA 2JXGA 2BNZA 2CA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVC A;  1BDV A;  2AY0 A;  3LGH A;  4D8J A;  2BJ1 A;  1NLA A;  2BJ7 A;  1B01 A;  3QOQ A;  3FMT A;  3H87 C;  2K9I A;  2KEL A;  2RBF A;  2K29 A;  2BJ9 A;  1MYK A;  4HV0 A;  1X93 A;  1EA4 A;  2GPE A;  2K1O A;  1BAZ A;  1ARR A;  3GXQ A;  2JXH A;  2JXI A;  3VW4 A;  2WVF A;  1BDT A;  2BJ3 A;  2K6L A;  1ARQ A;  2WVE A;  2H1O E;  1B28 A;  1P94 A;  4ME7 E;  2CAJ A;  2K5J A;  3OD2 A;  2WVD A;  2BSQ E;  1MNT A;  3VEA A;  1QTG A;  2BA3 A;  1Q5V A;  1IRQ A;  2HZA A;  2CAX A;  2BNW A;  1U9P A;  3FT7 A;  2WVB A;  4FXE A;  2BJ8 A;  1PAR A;  2CPG A;  2HZV A;  2CAD A;  3VEB A;  1MYL A;  2JXG A;  2BNZ A;  2CA9 A; 
#chains in the Genus database with same CATH topology
 3QID A;  2AY0 A;  2BJ1 A;  1NLA A;  3NAH A;  3FMT A;  2K9I A;  3NNE A;  2KEL A;  2K29 A;  2KKE A;  1X93 A;  2GPE A;  1BAZ A;  1ARR A;  2JXH A;  3VW4 A;  4LQ3 A;  2WVD A;  1MNT A;  1QTG A;  1Q5V A;  4NRU A;  2CAX A;  4FXE A;  1PAR A;  1SH3 A;  2A2B A;  2BJ8 A;  2WVC A;  2CA9 A;  2H3A A;  3G5O A;  3H87 C;  2RBF A;  4LQ9 A;  4HV0 A;  1MYK A;  2Q2K A;  2WK4 A;  1P94 A;  4ME7 E;  4NRT A;  2CAJ A;  1SH2 A;  3OD2 A;  1SIW A;  2UUT A;  2HZA A;  2BNW A;  1OHN A;  1U9P A;  3UQS A;  1Q16 A;  2WVB A;  2CPG A;  3LJP A;  1MYL A;  2BNZ A;  4LRV A;  1BDV A;  4D8J A;  2KOE A;  3SFG A;  3NAI A;  2JBV A;  1OG7 A;  1SH0 A;  4AAI A;  2JXI A;  2WVF A;  3BSN A;  1BDT A;  2BJ3 A;  2K6L A;  3H5X A;  3SFU A;  2WVE A;  1B28 A;  2K5J A;  2BSQ E;  3H5Y A;  3BSO A;  1IRQ A;  2UUW A;  3UPF A;  3NO7 A;  3FT7 A;  4QPX A;  3VEB A;  2K1O A;  2JXG A;  2CKW A;  2BJ7 A;  1B01 A;  3QOQ A;  2AN7 A;  2BJ9 A;  1EA4 A;  3IR7 A;  4MJW A;  2B43 A;  1ARQ A;  2H1O E;  4O4R A;  3VEA A;  2ADL A;  2BA3 A;  3UR0 A;  2HZV A;  2CAD A;  3GXQ A;  3LGH A; 
#chains in the Genus database with same CATH homology
 2WVC A;  1BDV A;  2AY0 A;  3LGH A;  4D8J A;  2BJ1 A;  1NLA A;  2BJ7 A;  1B01 A;  3QOQ A;  3FMT A;  3H87 C;  2K9I A;  2KEL A;  2RBF A;  2K29 A;  2BJ9 A;  1MYK A;  4HV0 A;  1X93 A;  1EA4 A;  2GPE A;  2K1O A;  1BAZ A;  1ARR A;  3GXQ A;  2JXH A;  2JXI A;  3VW4 A;  2WVF A;  1BDT A;  2BJ3 A;  2K6L A;  1ARQ A;  2WVE A;  2H1O E;  1B28 A;  1P94 A;  4ME7 E;  2CAJ A;  2K5J A;  3OD2 A;  2WVD A;  2BSQ E;  1MNT A;  3VEA A;  1QTG A;  2BA3 A;  1Q5V A;  1IRQ A;  2HZA A;  2CAX A;  2BNW A;  1U9P A;  3FT7 A;  2WVB A;  4FXE A;  2BJ8 A;  1PAR A;  2CPG A;  2HZV A;  2CAD A;  3VEB A;  1MYL A;  2JXG A;  2BNZ A;  2CA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...