2JXJA

Nmr structure of the arid domain from the histone h3k4 demethylase rbp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GPLGSRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
publication title The ARID domain of the H3K4 demethylase RBP2 binds to a DNA CCGCCC motif
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 22
structure length 96
sequence length 96
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jxjA00
1IG6A 2JXJA 2EH9A 4LJXA 5CEHA 1RYUA 5K4LA 2CXYA 1C20A 2KK0A 2JRZA 2LM1A 2RQ5A 1KKXA 1KQQA 2LI6A 2OEHA 1KN5A 2YQEA 2EQYA
chains in the Genus database with same CATH superfamily
2J6TA 5KG0A 3RH6A 3N4MB 5KFCA 5KG2A 1RYUA 1ZQVA 5AI0A 3E2EA 4MFCA 4C4SA 7ICSA 4M9HA 2W9BB 2MRLA 5CP2A 3SV3A 7ICHA 1ZQJA 4PL2A 1HUOA 1D8YA 3PW5A 1BPZA 1IIPA 4KMUA 3LVWA 4DL4A 5IILA 5HR6A 1KFTA 4KTQA 5DB9A 2NV3A 1C20A 2MUTB 2I1QA 4DEZA 1TFRA 3UQ2A 5KFEA 1KLNA 3I1YA 7ICQA 2Y1IA 4ECXA 3KTQA 4KLMA 2KKPA 3QYPA 4M9GA 5ALXA 4DS5A 2KE7A 3G6XA 2VKQA 1L5UA 2W11A 3ED5A 3ONNA 4F4YA 1A76A 3N7PD 5H2FU 1HEKA 2YMMA 1ZOLA 4UAWA 2A3VA 1NK8A 5KFZA 2ESEA 4G9BA 4DQSA 1EXNA 3I76A 2W7PA 3WKEA 2JEIA 2W9MA 3SAFA 4M0AA 2LPEA 5AM0A 1X9SA 4ECQA 1DRGA 2C2EA 4KLLA 1F0MA 3OHAA 2KJ9A 3GIMA 4FZLA 1XS9D 1U48A 1RZTA 8ICCA 5IIJA 1SV0C 4UB6U 8ICYA 4C8KA 1XO0A 4KX5A 2W9CB 1U4BA 2ZIUB 7ICUA 4QZIA 5KG1A 5J2FA 4O3QA 3UQ0A 4JWNA 3TI0A 5ALOA 4YFKA 1PZNA 3F5EA 3K1ZA 4I2EA 2JH7A 2NRVA 3PX0A 4F91B 2K60A 4DFPA 2IMWP 2QKQA 5J2BA 3QU7A 3JPPA 4YMOA 4P4OA 2WAQC 3Q8RB 3AU6A 3SENA 2DKZA 3EZ5A 1KW4A 4QZAA 4YXJA 4KLSA 2DGZA 3LWLA 2WF8A 7ICJA 2KJ8A 3BZKA 7ICPA 5ALWA 2BR0A 2P35A 3PVXA 3H8SA 4Q8EA 5KFGA 5AM3A 2QB1A 5KT7A 4JUZA 2DUYA 2Q4TA 3EUB2 3GDXA 5L1JA 3OPXA 2H3FA 4EX7A 1ZQHA 2WFAA 5L1LA 2XY6A 4C0ZA 4YVZA 2BCRA 4IRCA 2ZJAA 5D4BA 5KFKA 4KITB 3FAHA 3OSNA 5ALGA 1WUDA 2ZXIA 4O9MA 2LYBA 3C2KA 4AYBF 2E8OA 3K1RB 3PW4A 2JH1A 1Y88A 3MFIA 4DOAA 7ICLA 2MA1A 2HVHA 4GXIA 2I5HA 4RQ8A 7ICKA 4IQWA 8ICRA 3TFRA 1WYGA 4IQUA 5K4LA 3HX0A 5AKEA 3DV9A 9ICKA 4OJ5A 1LKYA 3QU5A 1U9LA 4Y2JA 1HJPA 2KIWA 1SL1A 5JUMA 2K8CB 2DF4B 4M6WA 5AI8A 7ICFA 4FZMA 1X40A 2W43A 5F9NA 1ZQGA 3BQ0A 1K5OA 4YD2A 3ICXA 4F5PA 2ASDA 4ED7A 2ALZA 3RJGA 5T14A 1J97A 1UHUA 4PHDA 3NVZA 9ICPA 3PSPA 4ICAA 1LVHA 2RRDA 3M1YA 3LDAA 3BJYA 2DFLA 5GTHU 2WB1C 4F4ZA 1H38A 4RUAA 3QZ8A 5DB6A 2UVWA 2ZIVA 4DFJA 3C28A 1ZJNA 2FPKA 2E8NA 2KJ5A 1NJYA 1T3QA 3R9KA 2XGPA 5C0YA 1MN8A 4EYHB 2K89A 1RDFA 2K8AA 5KFDA 4BGDA 5ALTA 5J2EA 3PZPA 2VIXA 5KFIA 1L7MA 2RQ5A 2Y1JA 5KAFU 4KMOB 5EE0A 5J2IA 1B0XA 1SKSA 4NLNA 2RDJA 5ALHA 4GXKA 2YMLA 4KLQA 5J8YC 1IM4A 2BPFA 1DGJA 5KFUA 4Q44A 2LM4A 2KFZA 2PFQA 8ICOA 1SL2A 1NI3A 3TACB 5DLGA 3KD3A 4KLFA 2JR5A 2NRTA 1NNLA 4KN4A 1RM6C 5L1IA 2V4QA 3AEVA 2BDUA 1B4FA 1OUQA 1X66A 4PJ0U 5TISU 1ZQAA 1COKA 2KTQA 4Z6FA 5AIBA 1QQ6A 4ECUA 4RNOA 1S0MA 5L9XA 3H0RB 5ALNA 1S9FA 2YTUA 2YMQA 2W7OA 4RQ6A 4TQRA 5AI4A 3TKAA 2VA8A 1XSPA 2ZUDA 3V7LA 2JEFA 4PHEA 1QQ7A 2NO4A 3QUTA 4OJPA 3F5AA 3RH4A 1V9PA 5C5JA 4O5CA 2HHVA 1HIWA 3QU4A 1X9MA 4DS4A 3MGVA 2ZUCA 1A0PA 2KOBA 3MGHA 3N97B 4DFMA 5AKHA 4YR3A 2MUTA 3M6ZA 2RDIA 5CB1A 8ICPA 9ICJA 3PX4A 4ECRA 1CI4A 3B9JA 5KG5A 4P4PA 2ES6A 4RQ3A 3PMLA 3NS1A 2XCAA 9ICSA 2F77X 1U49A 1QQ5A 5ALVA 1ZD5A 2XCPA 2R8JA 3ZI4A 1RYRA 1M6YA 8ICGA 2E1EA 1X42A 2PMZC 1GO3F 1ZQXA 5DBAA 3C5GA 4RZRA 4RQ4A 2HHXA 1UCVA 5CRXA 1D8LA 3EYZA 1TKDA 2H3ZA 2KEYA 1SWVA 3QUQA 5CHGA 3H7IA 3PX6A 1NZPA 2E5SA 3TADA 4F71A 7ICOA 2O6KA 4C4RA 5ALLA 3EWAA 2JZBB 4Y2QA 4DSEA 2CPRA 1B22A 2HOQA 1WWVA 1WCLA 2F8LA 2KSOB 4PPXA 5EOZA 4QNLA 4YQWA 2P66A 3SYZA 2F76X 1YZ6A 5AKKA 4YG2A 2IBKA 4K4GA 2ZIUA 3UXOA 4YR0A 4UAZA 8ICMA 1JN3A 2DBYA 1ZQTA 3AN1A 3MC1A 4EEKA 5HMMA 2HVIA 1PK3A 3UMBA 4O3MA 3PO4A 1B43A 3BZCA 5KFWA 1NJWA 4ECYA 1COOA 1ZD3A 3I28A 4QZHA 3V6KA 3KFUF 2E8MA 5IIKA 4OO1J 2VJ4A 3PSIA 4FE3A 1UA0A 3V6HA 5AK6A 5KFSA 5DG9A 1UPHA 2W55A 4YD1A 4TUSA 3C1YA 3AM9A 2KICA 5DQIA 1MA7A 2P6RA 4JV0A 3C21A 3H4BA 2B21A 2DWQA 3TAQA 5J2JA 1X9WA 4BX9C 1Z4NA 2EH9A 4JV1A 5ALMA 3L5KA 5ALPA 5ALSA 4GFJA 9ICVA 2K4HA 2ZJ5A 3D2SA 4DL7A 3OJSA 2E8PA 5KFFA 1S76D 2ZIVB 1L6NA 4I2FA 3GIIA 2IOFK 2LI6A 4E0DA 2R8GA 3O0FA 1KRPA 4UARA 4O0IA 1FFUA 4RPXA 3M6KA 4QWBA 4IC9A 4M9NA 3SAHA 4DWIA 3H0MB 3IDWA 4BWMA 4ED6A 5DLFA 2QARB 4QJFB 2ATLA 8ICHA 2OCEA 4C8LA 3ZDEA 2OWOA 3MGIA 4Q8FA 4C8MA 3RR7A 3J81j 4ZH4A 1S0NA 2FE9A 1RXVA 3NVYA 3TQ1A 2BKEA 5DKWA 1JALA 3M9NB 2ZG6A 1N61A 3ZDCA 3ORYA 3IN5A 8ICQA 2OHFA 5KFTA 8ICAA 4NL9C 3Q8PB 1SIJA 2Y0SC 4YMNA 3HKZC 1Q3UA 3RB0A 4O3RA 3L3FX 3N7SC 3WKBA 4RU9A 7ICMA 1ZQ1C 1S5LU 2BCSA 5KG7A 4C8NA 4I27A 5KFMA 4G3IA 9ICCA 2E3TA 2Q0ZX 4R64A 1JUDA 4YP3A 2DL0A 3RFAA 5KNIA 4I28A 4QW8A 2N1RA 3SAGA 2OH2A 3MR6A 2AQ0A 3KZXA 4CGZA 2ZTDA 1T8EA 5J2CA 2PXIA 4EZ9A 1O03A 1VJ5A 3DEEA 5KFLA 7ICNA 4NLGA 1Z1VA 5KFYA 2LHTA 3KZIU 2G5IB 1MSWD 5DQGA 5DDYA 2LYAA 3NGDA 1ZQUA 2KHQA 1BPBA 4F8RA 2Z7JA 3GV8B 4M2YA 1NK5A 2AQ4A 9ICRA 2YMPA 8ICBA 3T3FA 1HUZA 3C2MA 1Z1BA 5B5EU 3N28A 2ASLA 5AICA 3KKAC 1XU4A 3QZ7A 4RUCA 1BPDA 2FPLA 5KFQA 1ZRMA 2GO7A 2KV2A 2PI4A 4KLIA 4DFKA 1F44A 4BXOA 1SZHA 4M9LA 2BZFA 4B9MA 2KNJA 3Q8QB 5AKLA 3DDHA 8ICKA 1TAUA 5DQHA 4ED1A 4KLUA 1SZPA 1ZD4A 3HP6A 2HHWA 1MQ3A 2HI0A 3KOOA 2WTFA 3OSPA 4J9OA 2OXOA 4C7ZA 3ZDAA 4NXZA 1A77A 4Y2VA 5E79U 5DDMA 3F2BA 4MEYA 2G07A 3PR5B 1SXDA 3OHBA 1TE2A 3RJEA 2HOIA 3WU2U 2C2DA 4ECZA 1JXEA 3RB3A 1KN5A 1ZQCA 2P6UA 5J2KA 4C4TA 3G6VA 5KAIU 4HYKA 5ALKA 5KFBA 2PFPA 4M04A 4EBEA 3PSFA 4IQVA 9ICMA 3M8RA 3WK9A 1JIHA 2HHTA 3OGUA 1IG6A 4Q43A 2BQUA 3CRXA 4NM2A 4F4XA 4UQGA 4QW9A 1NK0A 2EZXA 3S6JA 9ICHA 2JRZA 1D9DA 4QZ9A 1L3SA 2ISPA 1DK2A 2BCVA 5KFAA 2OYYA 5DGBA 2XY7A 1RYSA 5DG7A 2YN4A 7ICEA 3QU9A 3WK8A 3RJHA 5DG8A 2JZBA 3TANA 1K1QA 3RH5A 2KG5A 3FDSA 5HR7A 4QZCA 1NJXA 2KP7A 3THVA 4QIWC 2KFNA 2KSOA 5J0PA 4ACOA 1MQ2A 4PGYA 1WWUA 1X9XA 4Y2XA 2PKEA 2LMRA 4GLXA 2ASJA 1S77D 5IIOA 5J0OA 4DQRA 1RXWA 1KDHA 1IXRA 2YB1A 4DQPA 3Q8LA 2UVVA 3E58A 5EE3A 5IIIA 1X2IA 2FJ6A 3C2LA 1TAMA 1NOMA 4R63A 3IV6A 4RQ7A 4QZBA 3PY8A 4IR1A 4IS7A 1VDVA 4J9MA 3HJEA 4FS1A 2HBMA 4RQ1A 2EQYA 4B9LA 9ICBA 4GC6A 4FBTA 4Q45A 5ALZA 9ICXA 1Z3EB 1OW5A 2WAQF 2BHNA 4QZ8A 4P2HA 4QZEA 1JRPA 2W8LA 2KN7A 4M47A 3QE9Y 3BS5A 3NRWA 1PVRA 2XGQA 5AM5A 1ZQIA 2BPCA 4ECWA 8ICFA 4C7YA 8ICSA 2CN1A 2KZZA 3ISCA 4BJQA 3ISBA 2V4RA 9ICGA 5CR0A 2F1JA 3NASA 3H40A 2PFOA 2KVCA 1Q3VA 2QARA 3U26A 2BQRA 3RRHA 5HNKA 2ISOA 1ZQEA 2G09A 4J9KA 1RG6A 4Z6CA 5DBCA 4DLEA 4LZGA 5ALUA 2CXYA 3CP8A 4DF8A 2H5XA 2QB0A 3WK5A 3IRUA 1N5XA 1NK6A 4BWJA 4BXOB 4P0QA 3ETRA 4NL9A 4U6PA 1XSLA 4ELTA 3RJJA 1L7OA 1Z00A 2YY6A 3WK6A 8ICXA 2AU0A 1BVSA 5IIMA 2XIDA 4Y2TA 4UB8U 5KFNA 4K4HA 2VA2A 5BOMA 2AHOB 2E1FA 1KTQA 4DL5A 8ICUA 2W54A 1U47A 3N7RC 5G5HA 3UXNA 2JHDA 4RT2A 2F1HA 2EZYA 3MDAA 2H3VA 5HP4A 3E0FA 4UW9A 1BNPA 4ECVA 3C1ZA 5AKZA 5ALFA 1X6JA 5J0UA 5HMLA 2KD1A 4ED8A 4XA5A 2HOFA 2F1IA 4NJ8A 3QU2A 9ICTA 1Q8KA 2HHQA 1T94A 5KG4A 3T5HA 2D3DA 3T5JA 4RNNA 2WB1F 3FC4A 5DGAA 3PV8A 4P4MA 7ICVA 4NLKA 4F92B 1SL0A 8ICJA 4CF3A 2F2AB 4DSIA 4Y2UA 9ICOA 5JTIA 4USAA 4XUSA 3QNMA 2R18A 3PR4A 1UQVA 1JX4A 1SGGA 1L3VA 2FLLA 3GV5B 3A0BU 4XRHA 5CWRA 2BDPA 1ZQPA 4ED0A 1DK3A 2F3NA 3ZD9A 1SV0A 5TZVA 2C2RA 4O3NA 4R8UB 4NY8A 1DOQA 5B66U 4JV2A 3JPTA 1ZQWA 4LJXA 2BQ3A 4QZDA 3UPQA 3ZDBA 5KG6A 4K4IA 3RAQA 3MABA 4JWMA 3AQFA 2HCFA 3WKCA 5KFXA 2MAXA 2F8KA 1NK9A 2W3SA 3AQEA 1NKEA 2CRXA 4M9JA 4Z6EA 3HW8A 4YN4A 2RHFA 2WF5A 4F72A 4CF5A 2GH1A 3K4GA 4MF8A 1QCKA 4UAYA 2LM1A 3H0LB 2PFNA 4UB1A 3EW9A 5KT2A 3HRDD 2EZZA 8ICIA 2WF7A 2G08A 1N60A 8ICTA 4CDGA 1QSSA 1NKBA 5IINA 3ISDA 5BOLA 1ZQZA 3BS5B 4I2HA 2H3QA 5ALRA 3LWMA 1QTMA 3EPIA 3PNCA 4F5QA 3ALRA 2AGPA 4UBBA 3NVVA 1V38A 3MBYA 3SV4A 5ALDA 2AH5A 3L4PA 1PVPA 1T7PA 3UMGA 3PO5A 5AKXA 4NWIA 5F9LA 1ZQFA 4DSJA 1IV8A 1OXJA 5D46A 4RQ0A 2AJQA 1SB3C 5AHXA 1TK8A 4ELVA 4CRXA 1XNSA 3B0YA 2M0NA 3SD7A 3TFSA 2OEHA 2KZMA 1JI7A 2PMZF 4NV0A 2QB0B 9ICIA 4O5EA 2XI9A 4RPYA 1ZQOA 3V7JA 7ICTA 5JRTA 2XC9A 3AL0B 4EBCA 4ECTA 4P0QB 4UAUA 3LK9A 4F93B 1JMSA 5FP0A 3UM9A 3EPGA 5HHHA 3PMNA 2EANA 3HT3A 3M9OB 4F4WA 1Z00B 3SQIA 4KLDA 1KFSA 5J0QA 2R8HA 4PGXA 3C29A 4PH5A 1ZQKA 4UB4A 4ED2A 1UT8A 3GZFA 4B9SA 1ZD2P 4EELA 3GILA 3B0XA 3OJUA 4GC7A 4DO9A 4O3SA 5EWGA 4P0PA 1CRXA 5AKJA 2JMGA 5J2DA 5AK3A 5BPCA 3VC8A 4EZ6A 4DOCA 2KKVA 4ED3A 3QX7A 5KFJA 2K8BB 2HBJA 1Q46A 1S10A 1ZQMA 2ZIWA 4JMUA 5CEHA 2NRZA 2FMQA 3GIJA 1PK1B 5EE9A 1KFDA 5AI5A 3RRGA 2XO7A 2M9NA 1Z4OA 2JEJA 2LBOA 2HHSA 3JPQA 1T3NA 3H4DA 4TQSA 9ICLA 3NTUA 2HW3A 1VLBA 5ALYA 1UA1A 1NK7A 4OJOA 3D2QA 4DF4A 2XY5A 3KHLA 2BGWA 4DL2A 9ICNA 4PZOA 4US8A 5J8YA 3PW2A 3F2CA 2RP5A 2HBKA 4RQ5A 5J29A 2ZTEA 3JPRA 4AYBC 1FEZA 2KVSA 4CF4A 4QWDA 5KT5A 4J9PA 5J0WA 2G5HB 4ECSA 4RQNA 1ZQRA 2HMXA 4YR2A 1JROA 3AMZA 3NVWA 4TUPA 4KLEA 1S0VA 1O08A 3KHGA 3V72A 2G0AA 3LYSA 5AKGA 4MFAA 4QWEA 2ODGA 3WKDA 4B9NA 2VANA 5DB8A 2HSZA 1TK5A 4MEXA 2EAPA 3Q8KA 4UB2A 2DKXA 3H8WA 3CYMA 1TAQA 2H3IA 4FZNA 2A1AA 5J2HA 2W3RA 4UBCA 3QUBA 3GIKA 4OJLA 3SI8A 4TUQA 4DSFA 4OD0A 3F53A 1ZYQA 4B9TA 3TADC 5ALEA 5KL8B 4NLCA 8ICWA 4F3OA 3KBBA 2KMDA 5EE1A 4NM1A 4F5RA 2IHNA 2L5YA 2DQNB 1S8OA 4DL6A 1RQLA 1ZRNA 2Y0SF 3HKZF 4PHPA 4O3PA 2WHEA 5KT4A 2DPJA 1BPXA 1ZETA 3IHQB 5ALIA 4OJ6A 1AQ6A 1U45A 2W9AA 1ZQBA 1ECWA 1SKRA 1XC9A 1ZQSA 2UVUA 1D8BA 4IQTA 4LZDA 5KT3A 3OTQA 4RQ2A 4Y2SA 2DPIA 4J9NA 3JPSA 1ZJMA 3KHHA 1YZ7A 4B6JA 1NJZA 1L3TA 3CNHA 3GU3A 2FLPA 2RLTA 4ELUA 1BPYA 5J2GA 2NYVA 4R65A 3PW7A 1ZQLA 4C80A 4IL6U 1S0OA 9ICQA 2C22A 3M9MB 3MDCA 3VCBA 1LB2B 1SWWA 1DXSA 4R8UA 2K4IA 1L3UA 2IOFA 1KKXA 2ZJ8A 1FIQA 1MC8A 1LV5A 5AK5A 2FMPA 4NLZA 2Y9TA 5AM2A 1K1SA 4UB5A 1SXEA 3V6JA 1T4GA 3ZD8A 3RBEA 5KFHA 2A1JB 4OCZA 3T5LA 2K4PA 2ZIXA 3D2NA 4KLTA 1CEZA 2OM6A 1CUKA 5AI9A 4LVSA 1SKWA 5J0TA 9ICAA 1XWLA 2A19A 1QH9A 2KZ3A 3BQ7A 5KFRA 4P0PB 4J9SA 3MFHA 3T5KA 3RAXA 3RTVA 2BCUA 2FMSA 2J6SA 5AIAA 4I2AA 2QLTA 4AP9A 3QXGA 3WKAA 2GWSA 4F2RA 5EWEA 2ZIWB 4U7CA 4MF2A 4EYIB 3C5FA 1F5SA 3SR6A 1KEJA 5ALJA 9ICUA 2YQEA 4B9UA 4CE6A 3BQ1A 3Q8SB 3IG8A 3RBDA 2F44A 5EWFA 3JPNA 2KIVA 3H8JA 5KFOA 3G6YA 1ZXIA 2AGOA 5J0RA 5L1MA 2MSNA 5KT6A 2KHVA 2W04A 4DL3A 2R8IA 3C23A 7ICRA 4GXJA 4EEYA 4PHAA 4UASA 5L1KA 2FLNA 7ICIA 1ED1A 1N5WA 2K4EA 5AM1A 4YMMA 4CNQA 4J9QA 5HHIA 4I29A 2NRWA 2NRXA 5F3XB 3F2DA 3T79A 1URJA 2C28A 4EX6A 1N56A 1QSLA 3HWTA 3WK4A 1P7DA 3IM1A 3JPOA 4DLGA 5ALQA 3WK7A 3BS7A 3H8MA 9ICEA 2YX8A 3K75D 4F4KA 4I2BA 2WF6A 8ICNA 1RPLA 2B6GA 4QIWF 2XICA 2W03A 1ZQNA 5AK4A 3PSTA 2FDRA 1AROP 2MU2A 4ZOHC 1N48A 1NKCA 3AU2A 4DFDA 4EENA 1X6IA 4NLBA 1KQQA 2FI1A 3FYHA 1UT5A 2IOHA 3ETLA 4Y2RA 5J0XA 2EDUA 3NUQA 4MHVA 4QZGA 4J9RA 1NZBA 2EAOA 2GOLA 1L7NA 1ZQDA 3D6JA 4Z6DA 4UB3A 4JB3A 5J2AA 4US9A 1SV4A 2I6XA 2Y9UA 1TVAA 4B9VA 3GQCA 4O5KA 1PK1A 1ZQYA 3HILA 3KHRA 1QSYA 2B0CA 4F2SA 2JXJA 4YCXA 2V9WA 2W9BA 2JEGA 1DGSA 5DB7A 1PUZA 3MR5A 4RT3A 4IRDA 1FO4A 2D8CA 3M8SA 4FS2A 3AUOA 4PZNA 1N63A 1L8OA 3SZ2A 8ICVA 3PW0A 3KKAA 4I2DA 3IG5A 4R66A 4QWAA 3BQTA 3MR3A 4CCHA 2HHUA 2AXTU 4KLHA 4KLOA 4KLGA 4EBDA 3GFKB 1L8LA 1N62A 3RR8A 4MFFA 4TURA 1XO1A 4RPZA 4KX3A 3V7KA 3RB6A 4KLJA 4J9LA 9ICFA 1KSPA 5KFPA 1KBUA 3RF9A 4PGQA 4J03A 3RJIA 1TK0A 1A6SA 4DCCA 2XVTA 4RNMA 2AGQA 9ICWA 2VJ5A 1BGXT 1KL9A 4DQQA 1PVQA 4DSLA 5J0SA 2FPMA 4A8EA 4WJ3B 1J2MA 5AKIA 4XQ8A 1C7YA 2VA3A 3LVVA 8ICEA 1YT3A 3Q8MA 4UATA 4I2GA 1XSNA 2ZIXB 1N2XA 3RB4A 2ZUBA 1LKYB 1ZQQA 3FM9A 2EAMA 2W9CA 1V85A 4JK1A 3ZDDA 4PL1A 2G06A 2LYHA 1NK4A 4HAIA 4DSKA 3RJKA 4DQIA 4IR9A 2HBLA 8ICZA 5JU5A 5D49A 4M6WB 4BUGA 2I9GA 5A0LA 3A0HU 4QZFA 5KL1B 4RQMA 2ZTCA 4FFDA 4KN7A 3TAPA 1Z19A 5KG3A 8ICLA 4F5OA 4IRKA 4F5NA 4F50A 1QLNA 5AI6A 3RJFA 3SMVA 2BPGA 2PI5A 2ZXHA 4YXMA 5G5GA 1JXLA 2IHMA 1BNOA 4Y2PA 4FO6A 2IA6A 4FBUA 2R8KA 3QEAZ 1J2NA 5AKYA 5KFVA 2JGAA 2NO5A 5AM4A 3UMCA 2KK0A 4QWCA 1WG8A 4BDPA 3QUCA 2JV3A 4O3OA 1TV9A 1FFVA 2WF9A 3QEBZ 2HDOA 4Y2YA 5DBBA 4X5VA 2BCQA 4GIBA 1S97A 4I2JA 3MR2A 3GV7B 7ICGA 1L7PA 5GTIU 2D6FC 5KTQA 1D9FA 3SEIA 2A1JA 3M7DA 4UAVA 2LKYA 4I2IA 3IP4B 4C8OA 3BQ2A 5CJ7A 1BPEA 3UXPA 3BDPA 1WCNA 5CA7A 2W8KA 3CW2C 1RQNA 2GLEA 4DOBA 3TARA 4I2CA 5J0YA 1V97A 2UVRA 3NRZA 2YB4A 3HPOA 2J6UA
chains in the Genus database with same CATH topology
1IG6A 2JXJA 2EH9A 4LJXA 5CEHA 1RYUA 5K4LA 2CXYA 1C20A 2KK0A 2JRZA 2LM1A 2RQ5A 1KKXA 1KQQA 2LI6A 2OEHA 1KN5A 2YQEA 2EQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG6 A;  2JXJ A;  2EH9 A;  4LJX A;  5CEH A;  1RYU A;  5K4L A;  2CXY A;  1C20 A;  2KK0 A;  2JRZ A;  2LM1 A;  2RQ5 A;  1KKX A;  1KQQ A;  2LI6 A;  2OEH A;  1KN5 A;  2YQE A;  2EQY A; 
#chains in the Genus database with same CATH topology
 2J6T A;  5KG0 A;  3RH6 A;  3N4M B;  5KFC A;  5KG2 A;  1RYU A;  1ZQV A;  5AI0 A;  3E2E A;  4MFC A;  4C4S A;  7ICS A;  4M9H A;  2W9B B;  2MRL A;  5CP2 A;  3SV3 A;  7ICH A;  1ZQJ A;  4PL2 A;  1HUO A;  1D8Y A;  3PW5 A;  1BPZ A;  1IIP A;  4KMU A;  3LVW A;  4DL4 A;  5IIL A;  5HR6 A;  1KFT A;  4KTQ A;  5DB9 A;  2NV3 A;  1C20 A;  2MUT B;  2I1Q A;  4DEZ A;  1TFR A;  3UQ2 A;  5KFE A;  1KLN A;  3I1Y A;  7ICQ A;  2Y1I A;  4ECX A;  3KTQ A;  4KLM A;  2KKP A;  3QYP A;  4M9G A;  5ALX A;  4DS5 A;  2KE7 A;  3G6X A;  2VKQ A;  1L5U A;  2W11 A;  3ED5 A;  3ONN A;  4F4Y A;  1A76 A;  3N7P D;  5H2F U;  1HEK A;  2YMM A;  1ZOL A;  4UAW A;  2A3V A;  1NK8 A;  5KFZ A;  2ESE A;  4G9B A;  4DQS A;  1EXN A;  3I76 A;  2W7P A;  3WKE A;  2JEI A;  2W9M A;  3SAF A;  4M0A A;  2LPE A;  5AM0 A;  1X9S A;  4ECQ A;  1DRG A;  2C2E A;  4KLL A;  1F0M A;  3OHA A;  2KJ9 A;  3GIM A;  4FZL A;  1XS9 D;  1U48 A;  1RZT A;  8ICC A;  5IIJ A;  1SV0 C;  4UB6 U;  8ICY A;  4C8K A;  1XO0 A;  4KX5 A;  2W9C B;  1U4B A;  2ZIU B;  7ICU A;  4QZI A;  5KG1 A;  5J2F A;  4O3Q A;  3UQ0 A;  4JWN A;  3TI0 A;  5ALO A;  4YFK A;  1PZN A;  3F5E A;  3K1Z A;  4I2E A;  2JH7 A;  2NRV A;  3PX0 A;  4F91 B;  2K60 A;  4DFP A;  2IMW P;  2QKQ A;  5J2B A;  3QU7 A;  3JPP A;  4YMO A;  4P4O A;  2WAQ C;  3Q8R B;  3AU6 A;  3SEN A;  2DKZ A;  3EZ5 A;  1KW4 A;  4QZA A;  4YXJ A;  4KLS A;  2DGZ A;  3LWL A;  2WF8 A;  7ICJ A;  2KJ8 A;  3BZK A;  7ICP A;  5ALW A;  2BR0 A;  2P35 A;  3PVX A;  3H8S A;  4Q8E A;  5KFG A;  5AM3 A;  2QB1 A;  5KT7 A;  4JUZ A;  2DUY A;  2Q4T A;  3EUB 2;  3GDX A;  5L1J A;  3OPX A;  2H3F A;  4EX7 A;  1ZQH A;  2WFA A;  5L1L A;  2XY6 A;  4C0Z A;  4YVZ A;  2BCR A;  4IRC A;  2ZJA A;  5D4B A;  5KFK A;  4KIT B;  3FAH A;  3OSN A;  5ALG A;  1WUD A;  2ZXI A;  4O9M A;  2LYB A;  3C2K A;  4AYB F;  2E8O A;  3K1R B;  3PW4 A;  2JH1 A;  1Y88 A;  3MFI A;  4DOA A;  7ICL A;  2MA1 A;  2HVH A;  4GXI A;  2I5H A;  4RQ8 A;  7ICK A;  4IQW A;  8ICR A;  3TFR A;  1WYG A;  4IQU A;  5K4L A;  3HX0 A;  5AKE A;  3DV9 A;  9ICK A;  4OJ5 A;  1LKY A;  3QU5 A;  1U9L A;  4Y2J A;  1HJP A;  2KIW A;  1SL1 A;  5JUM A;  2K8C B;  2DF4 B;  4M6W A;  5AI8 A;  7ICF A;  4FZM A;  1X40 A;  2W43 A;  5F9N A;  1ZQG A;  3BQ0 A;  1K5O A;  4YD2 A;  3ICX A;  4F5P A;  2ASD A;  4ED7 A;  2ALZ A;  3RJG A;  5T14 A;  1J97 A;  1UHU A;  4PHD A;  3NVZ A;  9ICP A;  3PSP A;  4ICA A;  1LVH A;  2RRD A;  3M1Y A;  3LDA A;  3BJY A;  2DFL A;  5GTH U;  2WB1 C;  4F4Z A;  1H38 A;  4RUA A;  3QZ8 A;  5DB6 A;  2UVW A;  2ZIV A;  4DFJ A;  3C28 A;  1ZJN A;  2FPK A;  2E8N A;  2KJ5 A;  1NJY A;  1T3Q A;  3R9K A;  2XGP A;  5C0Y A;  1MN8 A;  4EYH B;  2K89 A;  1RDF A;  2K8A A;  5KFD A;  4BGD A;  5ALT A;  5J2E A;  3PZP A;  2VIX A;  5KFI A;  1L7M A;  2RQ5 A;  2Y1J A;  5KAF U;  4KMO B;  5EE0 A;  5J2I A;  1B0X A;  1SKS A;  4NLN A;  2RDJ A;  5ALH A;  4GXK A;  2YML A;  4KLQ A;  5J8Y C;  1IM4 A;  2BPF A;  1DGJ A;  5KFU A;  4Q44 A;  2LM4 A;  2KFZ A;  2PFQ A;  8ICO A;  1SL2 A;  1NI3 A;  3TAC B;  5DLG A;  3KD3 A;  4KLF A;  2JR5 A;  2NRT A;  1NNL A;  4KN4 A;  1RM6 C;  5L1I A;  2V4Q A;  3AEV A;  2BDU A;  1B4F A;  1OUQ A;  1X66 A;  4PJ0 U;  5TIS U;  1ZQA A;  1COK A;  2KTQ A;  4Z6F A;  5AIB A;  1QQ6 A;  4ECU A;  4RNO A;  1S0M A;  5L9X A;  3H0R B;  5ALN A;  1S9F A;  2YTU A;  2YMQ A;  2W7O A;  4RQ6 A;  4TQR A;  5AI4 A;  3TKA A;  2VA8 A;  1XSP A;  2ZUD A;  3V7L A;  2JEF A;  4PHE A;  1QQ7 A;  2NO4 A;  3QUT A;  4OJP A;  3F5A A;  3RH4 A;  1V9P A;  5C5J A;  4O5C A;  2HHV A;  1HIW A;  3QU4 A;  1X9M A;  4DS4 A;  3MGV A;  2ZUC A;  1A0P A;  2KOB A;  3MGH A;  3N97 B;  4DFM A;  5AKH A;  4YR3 A;  2MUT A;  3M6Z A;  2RDI A;  5CB1 A;  8ICP A;  9ICJ A;  3PX4 A;  4ECR A;  1CI4 A;  3B9J A;  5KG5 A;  4P4P A;  2ES6 A;  4RQ3 A;  3PML A;  3NS1 A;  2XCA A;  9ICS A;  2F77 X;  1U49 A;  1QQ5 A;  5ALV A;  1ZD5 A;  2XCP A;  2R8J A;  3ZI4 A;  1RYR A;  1M6Y A;  8ICG A;  2E1E A;  1X42 A;  2PMZ C;  1GO3 F;  1ZQX A;  5DBA A;  3C5G A;  4RZR A;  4RQ4 A;  2HHX A;  1UCV A;  5CRX A;  1D8L A;  3EYZ A;  1TKD A;  2H3Z A;  2KEY A;  1SWV A;  3QUQ A;  5CHG A;  3H7I A;  3PX6 A;  1NZP A;  2E5S A;  3TAD A;  4F71 A;  7ICO A;  2O6K A;  4C4R A;  5ALL A;  3EWA A;  2JZB B;  4Y2Q A;  4DSE A;  2CPR A;  1B22 A;  2HOQ A;  1WWV A;  1WCL A;  2F8L A;  2KSO B;  4PPX A;  5EOZ A;  4QNL A;  4YQW A;  2P66 A;  3SYZ A;  2F76 X;  1YZ6 A;  5AKK A;  4YG2 A;  2IBK A;  4K4G A;  2ZIU A;  3UXO A;  4YR0 A;  4UAZ A;  8ICM A;  1JN3 A;  2DBY A;  1ZQT A;  3AN1 A;  3MC1 A;  4EEK A;  5HMM A;  2HVI A;  1PK3 A;  3UMB A;  4O3M A;  3PO4 A;  1B43 A;  3BZC A;  5KFW A;  1NJW A;  4ECY A;  1COO A;  1ZD3 A;  3I28 A;  4QZH A;  3V6K A;  3KFU F;  2E8M A;  5IIK A;  4OO1 J;  2VJ4 A;  3PSI A;  4FE3 A;  1UA0 A;  3V6H A;  5AK6 A;  5KFS A;  5DG9 A;  1UPH A;  2W55 A;  4YD1 A;  4TUS A;  3C1Y A;  3AM9 A;  2KIC A;  5DQI A;  1MA7 A;  2P6R A;  4JV0 A;  3C21 A;  3H4B A;  2B21 A;  2DWQ A;  3TAQ A;  5J2J A;  1X9W A;  4BX9 C;  1Z4N A;  2EH9 A;  4JV1 A;  5ALM A;  3L5K A;  5ALP A;  5ALS A;  4GFJ A;  9ICV A;  2K4H A;  2ZJ5 A;  3D2S A;  4DL7 A;  3OJS A;  2E8P A;  5KFF A;  1S76 D;  2ZIV B;  1L6N A;  4I2F A;  3GII A;  2IOF K;  2LI6 A;  4E0D A;  2R8G A;  3O0F A;  1KRP A;  4UAR A;  4O0I A;  1FFU A;  4RPX A;  3M6K A;  4QWB A;  4IC9 A;  4M9N A;  3SAH A;  4DWI A;  3H0M B;  3IDW A;  4BWM A;  4ED6 A;  5DLF A;  2QAR B;  4QJF B;  2ATL A;  8ICH A;  2OCE A;  4C8L A;  3ZDE A;  2OWO A;  3MGI A;  4Q8F A;  4C8M A;  3RR7 A;  3J81 j;  4ZH4 A;  1S0N A;  2FE9 A;  1RXV A;  3NVY A;  3TQ1 A;  2BKE A;  5DKW A;  1JAL A;  3M9N B;  2ZG6 A;  1N61 A;  3ZDC A;  3ORY A;  3IN5 A;  8ICQ A;  2OHF A;  5KFT A;  8ICA A;  4NL9 C;  3Q8P B;  1SIJ A;  2Y0S C;  4YMN A;  3HKZ C;  1Q3U A;  3RB0 A;  4O3R A;  3L3F X;  3N7S C;  3WKB A;  4RU9 A;  7ICM A;  1ZQ1 C;  1S5L U;  2BCS A;  5KG7 A;  4C8N A;  4I27 A;  5KFM A;  4G3I A;  9ICC A;  2E3T A;  2Q0Z X;  4R64 A;  1JUD A;  4YP3 A;  2DL0 A;  3RFA A;  5KNI A;  4I28 A;  4QW8 A;  2N1R A;  3SAG A;  2OH2 A;  3MR6 A;  2AQ0 A;  3KZX A;  4CGZ A;  2ZTD A;  1T8E A;  5J2C A;  2PXI A;  4EZ9 A;  1O03 A;  1VJ5 A;  3DEE A;  5KFL A;  7ICN A;  4NLG A;  1Z1V A;  5KFY A;  2LHT A;  3KZI U;  2G5I B;  1MSW D;  5DQG A;  5DDY A;  2LYA A;  3NGD A;  1ZQU A;  2KHQ A;  1BPB A;  4F8R A;  2Z7J A;  3GV8 B;  4M2Y A;  1NK5 A;  2AQ4 A;  9ICR A;  2YMP A;  8ICB A;  3T3F A;  1HUZ A;  3C2M A;  1Z1B A;  5B5E U;  3N28 A;  2ASL A;  5AIC A;  3KKA C;  1XU4 A;  3QZ7 A;  4RUC A;  1BPD A;  2FPL A;  5KFQ A;  1ZRM A;  2GO7 A;  2KV2 A;  2PI4 A;  4KLI A;  4DFK A;  1F44 A;  4BXO A;  1SZH A;  4M9L A;  2BZF A;  4B9M A;  2KNJ A;  3Q8Q B;  5AKL A;  3DDH A;  8ICK A;  1TAU A;  5DQH A;  4ED1 A;  4KLU A;  1SZP A;  1ZD4 A;  3HP6 A;  2HHW A;  1MQ3 A;  2HI0 A;  3KOO A;  2WTF A;  3OSP A;  4J9O A;  2OXO A;  4C7Z A;  3ZDA A;  4NXZ A;  1A77 A;  4Y2V A;  5E79 U;  5DDM A;  3F2B A;  4MEY A;  2G07 A;  3PR5 B;  1SXD A;  3OHB A;  1TE2 A;  3RJE A;  2HOI A;  3WU2 U;  2C2D A;  4ECZ A;  1JXE A;  3RB3 A;  1KN5 A;  1ZQC A;  2P6U A;  5J2K A;  4C4T A;  3G6V A;  5KAI U;  4HYK A;  5ALK A;  5KFB A;  2PFP A;  4M04 A;  4EBE A;  3PSF A;  4IQV A;  9ICM A;  3M8R A;  3WK9 A;  1JIH A;  2HHT A;  3OGU A;  1IG6 A;  4Q43 A;  2BQU A;  3CRX A;  4NM2 A;  4F4X A;  4UQG A;  4QW9 A;  1NK0 A;  2EZX A;  3S6J A;  9ICH A;  2JRZ A;  1D9D A;  4QZ9 A;  1L3S A;  2ISP A;  1DK2 A;  2BCV A;  5KFA A;  2OYY A;  5DGB A;  2XY7 A;  1RYS A;  5DG7 A;  2YN4 A;  7ICE A;  3QU9 A;  3WK8 A;  3RJH A;  5DG8 A;  2JZB A;  3TAN A;  1K1Q A;  3RH5 A;  2KG5 A;  3FDS A;  5HR7 A;  4QZC A;  1NJX A;  2KP7 A;  3THV A;  4QIW C;  2KFN A;  2KSO A;  5J0P A;  4ACO A;  1MQ2 A;  4PGY A;  1WWU A;  1X9X A;  4Y2X A;  2PKE A;  2LMR A;  4GLX A;  2ASJ A;  1S77 D;  5IIO A;  5J0O A;  4DQR A;  1RXW A;  1KDH A;  1IXR A;  2YB1 A;  4DQP A;  3Q8L A;  2UVV A;  3E58 A;  5EE3 A;  5III A;  1X2I A;  2FJ6 A;  3C2L A;  1TAM A;  1NOM A;  4R63 A;  3IV6 A;  4RQ7 A;  4QZB A;  3PY8 A;  4IR1 A;  4IS7 A;  1VDV A;  4J9M A;  3HJE A;  4FS1 A;  2HBM A;  4RQ1 A;  2EQY A;  4B9L A;  9ICB A;  4GC6 A;  4FBT A;  4Q45 A;  5ALZ A;  9ICX A;  1Z3E B;  1OW5 A;  2WAQ F;  2BHN A;  4QZ8 A;  4P2H A;  4QZE A;  1JRP A;  2W8L A;  2KN7 A;  4M47 A;  3QE9 Y;  3BS5 A;  3NRW A;  1PVR A;  2XGQ A;  5AM5 A;  1ZQI A;  2BPC A;  4ECW A;  8ICF A;  4C7Y A;  8ICS A;  2CN1 A;  2KZZ A;  3ISC A;  4BJQ A;  3ISB A;  2V4R A;  9ICG A;  5CR0 A;  2F1J A;  3NAS A;  3H40 A;  2PFO A;  2KVC A;  1Q3V A;  2QAR A;  3U26 A;  2BQR A;  3RRH A;  5HNK A;  2ISO A;  1ZQE A;  2G09 A;  4J9K A;  1RG6 A;  4Z6C A;  5DBC A;  4DLE A;  4LZG A;  5ALU A;  2CXY A;  3CP8 A;  4DF8 A;  2H5X A;  2QB0 A;  3WK5 A;  3IRU A;  1N5X A;  1NK6 A;  4BWJ A;  4BXO B;  4P0Q A;  3ETR A;  4NL9 A;  4U6P A;  1XSL A;  4ELT A;  3RJJ A;  1L7O A;  1Z00 A;  2YY6 A;  3WK6 A;  8ICX A;  2AU0 A;  1BVS A;  5IIM A;  2XID A;  4Y2T A;  4UB8 U;  5KFN A;  4K4H A;  2VA2 A;  5BOM A;  2AHO B;  2E1F A;  1KTQ A;  4DL5 A;  8ICU A;  2W54 A;  1U47 A;  3N7R C;  5G5H A;  3UXN A;  2JHD A;  4RT2 A;  2F1H A;  2EZY A;  3MDA A;  2H3V A;  5HP4 A;  3E0F A;  4UW9 A;  1BNP A;  4ECV A;  3C1Z A;  5AKZ A;  5ALF A;  1X6J A;  5J0U A;  5HML A;  2KD1 A;  4ED8 A;  4XA5 A;  2HOF A;  2F1I A;  4NJ8 A;  3QU2 A;  9ICT A;  1Q8K A;  2HHQ A;  1T94 A;  5KG4 A;  3T5H A;  2D3D A;  3T5J A;  4RNN A;  2WB1 F;  3FC4 A;  5DGA A;  3PV8 A;  4P4M A;  7ICV A;  4NLK A;  4F92 B;  1SL0 A;  8ICJ A;  4CF3 A;  2F2A B;  4DSI A;  4Y2U A;  9ICO A;  5JTI A;  4USA A;  4XUS A;  3QNM A;  2R18 A;  3PR4 A;  1UQV A;  1JX4 A;  1SGG A;  1L3V A;  2FLL A;  3GV5 B;  3A0B U;  4XRH A;  5CWR A;  2BDP A;  1ZQP A;  4ED0 A;  1DK3 A;  2F3N A;  3ZD9 A;  1SV0 A;  5TZV A;  2C2R A;  4O3N A;  4R8U B;  4NY8 A;  1DOQ A;  5B66 U;  4JV2 A;  3JPT A;  1ZQW A;  4LJX A;  2BQ3 A;  4QZD A;  3UPQ A;  3ZDB A;  5KG6 A;  4K4I A;  3RAQ A;  3MAB A;  4JWM A;  3AQF A;  2HCF A;  3WKC A;  5KFX A;  2MAX A;  2F8K A;  1NK9 A;  2W3S A;  3AQE A;  1NKE A;  2CRX A;  4M9J A;  4Z6E A;  3HW8 A;  4YN4 A;  2RHF A;  2WF5 A;  4F72 A;  4CF5 A;  2GH1 A;  3K4G A;  4MF8 A;  1QCK A;  4UAY A;  2LM1 A;  3H0L B;  2PFN A;  4UB1 A;  3EW9 A;  5KT2 A;  3HRD D;  2EZZ A;  8ICI A;  2WF7 A;  2G08 A;  1N60 A;  8ICT A;  4CDG A;  1QSS A;  1NKB A;  5IIN A;  3ISD A;  5BOL A;  1ZQZ A;  3BS5 B;  4I2H A;  2H3Q A;  5ALR A;  3LWM A;  1QTM A;  3EPI A;  3PNC A;  4F5Q A;  3ALR A;  2AGP A;  4UBB A;  3NVV A;  1V38 A;  3MBY A;  3SV4 A;  5ALD A;  2AH5 A;  3L4P A;  1PVP A;  1T7P A;  3UMG A;  3PO5 A;  5AKX A;  4NWI A;  5F9L A;  1ZQF A;  4DSJ A;  1IV8 A;  1OXJ A;  5D46 A;  4RQ0 A;  2AJQ A;  1SB3 C;  5AHX A;  1TK8 A;  4ELV A;  4CRX A;  1XNS A;  3B0Y A;  2M0N A;  3SD7 A;  3TFS A;  2OEH A;  2KZM A;  1JI7 A;  2PMZ F;  4NV0 A;  2QB0 B;  9ICI A;  4O5E A;  2XI9 A;  4RPY A;  1ZQO A;  3V7J A;  7ICT A;  5JRT A;  2XC9 A;  3AL0 B;  4EBC A;  4ECT A;  4P0Q B;  4UAU A;  3LK9 A;  4F93 B;  1JMS A;  5FP0 A;  3UM9 A;  3EPG A;  5HHH A;  3PMN A;  2EAN A;  3HT3 A;  3M9O B;  4F4W A;  1Z00 B;  3SQI A;  4KLD A;  1KFS A;  5J0Q A;  2R8H A;  4PGX A;  3C29 A;  4PH5 A;  1ZQK A;  4UB4 A;  4ED2 A;  1UT8 A;  3GZF A;  4B9S A;  1ZD2 P;  4EEL A;  3GIL A;  3B0X A;  3OJU A;  4GC7 A;  4DO9 A;  4O3S A;  5EWG A;  4P0P A;  1CRX A;  5AKJ A;  2JMG A;  5J2D A;  5AK3 A;  5BPC A;  3VC8 A;  4EZ6 A;  4DOC A;  2KKV A;  4ED3 A;  3QX7 A;  5KFJ A;  2K8B B;  2HBJ A;  1Q46 A;  1S10 A;  1ZQM A;  2ZIW A;  4JMU A;  5CEH A;  2NRZ A;  2FMQ A;  3GIJ A;  1PK1 B;  5EE9 A;  1KFD A;  5AI5 A;  3RRG A;  2XO7 A;  2M9N A;  1Z4O A;  2JEJ A;  2LBO A;  2HHS A;  3JPQ A;  1T3N A;  3H4D A;  4TQS A;  9ICL A;  3NTU A;  2HW3 A;  1VLB A;  5ALY A;  1UA1 A;  1NK7 A;  4OJO A;  3D2Q A;  4DF4 A;  2XY5 A;  3KHL A;  2BGW A;  4DL2 A;  9ICN A;  4PZO A;  4US8 A;  5J8Y A;  3PW2 A;  3F2C A;  2RP5 A;  2HBK A;  4RQ5 A;  5J29 A;  2ZTE A;  3JPR A;  4AYB C;  1FEZ A;  2KVS A;  4CF4 A;  4QWD A;  5KT5 A;  4J9P A;  5J0W A;  2G5H B;  4ECS A;  4RQN A;  1ZQR A;  2HMX A;  4YR2 A;  1JRO A;  3AMZ A;  3NVW A;  4TUP A;  4KLE A;  1S0V A;  1O08 A;  3KHG A;  3V72 A;  2G0A A;  3LYS A;  5AKG A;  4MFA A;  4QWE A;  2ODG A;  3WKD A;  4B9N A;  2VAN A;  5DB8 A;  2HSZ A;  1TK5 A;  4MEX A;  2EAP A;  3Q8K A;  4UB2 A;  2DKX A;  3H8W A;  3CYM A;  1TAQ A;  2H3I A;  4FZN A;  2A1A A;  5J2H A;  2W3R A;  4UBC A;  3QUB A;  3GIK A;  4OJL A;  3SI8 A;  4TUQ A;  4DSF A;  4OD0 A;  3F53 A;  1ZYQ A;  4B9T A;  3TAD C;  5ALE A;  5KL8 B;  4NLC A;  8ICW A;  4F3O A;  3KBB A;  2KMD A;  5EE1 A;  4NM1 A;  4F5R A;  2IHN A;  2L5Y A;  2DQN B;  1S8O A;  4DL6 A;  1RQL A;  1ZRN A;  2Y0S F;  3HKZ F;  4PHP A;  4O3P A;  2WHE A;  5KT4 A;  2DPJ A;  1BPX A;  1ZET A;  3IHQ B;  5ALI A;  4OJ6 A;  1AQ6 A;  1U45 A;  2W9A A;  1ZQB A;  1ECW A;  1SKR A;  1XC9 A;  1ZQS A;  2UVU A;  1D8B A;  4IQT A;  4LZD A;  5KT3 A;  3OTQ A;  4RQ2 A;  4Y2S A;  2DPI A;  4J9N A;  3JPS A;  1ZJM A;  3KHH A;  1YZ7 A;  4B6J A;  1NJZ A;  1L3T A;  3CNH A;  3GU3 A;  2FLP A;  2RLT A;  4ELU A;  1BPY A;  5J2G A;  2NYV A;  4R65 A;  3PW7 A;  1ZQL A;  4C80 A;  4IL6 U;  1S0O A;  9ICQ A;  2C22 A;  3M9M B;  3MDC A;  3VCB A;  1LB2 B;  1SWW A;  1DXS A;  4R8U A;  2K4I A;  1L3U A;  2IOF A;  1KKX A;  2ZJ8 A;  1FIQ A;  1MC8 A;  1LV5 A;  5AK5 A;  2FMP A;  4NLZ A;  2Y9T A;  5AM2 A;  1K1S A;  4UB5 A;  1SXE A;  3V6J A;  1T4G A;  3ZD8 A;  3RBE A;  5KFH A;  2A1J B;  4OCZ A;  3T5L A;  2K4P A;  2ZIX A;  3D2N A;  4KLT A;  1CEZ A;  2OM6 A;  1CUK A;  5AI9 A;  4LVS A;  1SKW A;  5J0T A;  9ICA A;  1XWL A;  2A19 A;  1QH9 A;  2KZ3 A;  3BQ7 A;  5KFR A;  4P0P B;  4J9S A;  3MFH A;  3T5K A;  3RAX A;  3RTV A;  2BCU A;  2FMS A;  2J6S A;  5AIA A;  4I2A A;  2QLT A;  4AP9 A;  3QXG A;  3WKA A;  2GWS A;  4F2R A;  5EWE A;  2ZIW B;  4U7C A;  4MF2 A;  4EYI B;  3C5F A;  1F5S A;  3SR6 A;  1KEJ A;  5ALJ A;  9ICU A;  2YQE A;  4B9U A;  4CE6 A;  3BQ1 A;  3Q8S B;  3IG8 A;  3RBD A;  2F44 A;  5EWF A;  3JPN A;  2KIV A;  3H8J A;  5KFO A;  3G6Y A;  1ZXI A;  2AGO A;  5J0R A;  5L1M A;  2MSN A;  5KT6 A;  2KHV A;  2W04 A;  4DL3 A;  2R8I A;  3C23 A;  7ICR A;  4GXJ A;  4EEY A;  4PHA A;  4UAS A;  5L1K A;  2FLN A;  7ICI A;  1ED1 A;  1N5W A;  2K4E A;  5AM1 A;  4YMM A;  4CNQ A;  4J9Q A;  5HHI A;  4I29 A;  2NRW A;  2NRX A;  5F3X B;  3F2D A;  3T79 A;  1URJ A;  2C28 A;  4EX6 A;  1N56 A;  1QSL A;  3HWT A;  3WK4 A;  1P7D A;  3IM1 A;  3JPO A;  4DLG A;  5ALQ A;  3WK7 A;  3BS7 A;  3H8M A;  9ICE A;  2YX8 A;  3K75 D;  4F4K A;  4I2B A;  2WF6 A;  8ICN A;  1RPL A;  2B6G A;  4QIW F;  2XIC A;  2W03 A;  1ZQN A;  5AK4 A;  3PST A;  2FDR A;  1ARO P;  2MU2 A;  4ZOH C;  1N48 A;  1NKC A;  3AU2 A;  4DFD A;  4EEN A;  1X6I A;  4NLB A;  1KQQ A;  2FI1 A;  3FYH A;  1UT5 A;  2IOH A;  3ETL A;  4Y2R A;  5J0X A;  2EDU A;  3NUQ A;  4MHV A;  4QZG A;  4J9R A;  1NZB A;  2EAO A;  2GOL A;  1L7N A;  1ZQD A;  3D6J A;  4Z6D A;  4UB3 A;  4JB3 A;  5J2A A;  4US9 A;  1SV4 A;  2I6X A;  2Y9U A;  1TVA A;  4B9V A;  3GQC A;  4O5K A;  1PK1 A;  1ZQY A;  3HIL A;  3KHR A;  1QSY A;  2B0C A;  4F2S A;  2JXJ A;  4YCX A;  2V9W A;  2W9B A;  2JEG A;  1DGS A;  5DB7 A;  1PUZ A;  3MR5 A;  4RT3 A;  4IRD A;  1FO4 A;  2D8C A;  3M8S A;  4FS2 A;  3AUO A;  4PZN A;  1N63 A;  1L8O A;  3SZ2 A;  8ICV A;  3PW0 A;  3KKA A;  4I2D A;  3IG5 A;  4R66 A;  4QWA A;  3BQT A;  3MR3 A;  4CCH A;  2HHU A;  2AXT U;  4KLH A;  4KLO A;  4KLG A;  4EBD A;  3GFK B;  1L8L A;  1N62 A;  3RR8 A;  4MFF A;  4TUR A;  1XO1 A;  4RPZ A;  4KX3 A;  3V7K A;  3RB6 A;  4KLJ A;  4J9L A;  9ICF A;  1KSP A;  5KFP A;  1KBU A;  3RF9 A;  4PGQ A;  4J03 A;  3RJI A;  1TK0 A;  1A6S A;  4DCC A;  2XVT A;  4RNM A;  2AGQ A;  9ICW A;  2VJ5 A;  1BGX T;  1KL9 A;  4DQQ A;  1PVQ A;  4DSL A;  5J0S A;  2FPM A;  4A8E A;  4WJ3 B;  1J2M A;  5AKI A;  4XQ8 A;  1C7Y A;  2VA3 A;  3LVV A;  8ICE A;  1YT3 A;  3Q8M A;  4UAT A;  4I2G A;  1XSN A;  2ZIX B;  1N2X A;  3RB4 A;  2ZUB A;  1LKY B;  1ZQQ A;  3FM9 A;  2EAM A;  2W9C A;  1V85 A;  4JK1 A;  3ZDD A;  4PL1 A;  2G06 A;  2LYH A;  1NK4 A;  4HAI A;  4DSK A;  3RJK A;  4DQI A;  4IR9 A;  2HBL A;  8ICZ A;  5JU5 A;  5D49 A;  4M6W B;  4BUG A;  2I9G A;  5A0L A;  3A0H U;  4QZF A;  5KL1 B;  4RQM A;  2ZTC A;  4FFD A;  4KN7 A;  3TAP A;  1Z19 A;  5KG3 A;  8ICL A;  4F5O A;  4IRK A;  4F5N A;  4F50 A;  1QLN A;  5AI6 A;  3RJF A;  3SMV A;  2BPG A;  2PI5 A;  2ZXH A;  4YXM A;  5G5G A;  1JXL A;  2IHM A;  1BNO A;  4Y2P A;  4FO6 A;  2IA6 A;  4FBU A;  2R8K A;  3QEA Z;  1J2N A;  5AKY A;  5KFV A;  2JGA A;  2NO5 A;  5AM4 A;  3UMC A;  2KK0 A;  4QWC A;  1WG8 A;  4BDP A;  3QUC A;  2JV3 A;  4O3O A;  1TV9 A;  1FFV A;  2WF9 A;  3QEB Z;  2HDO A;  4Y2Y A;  5DBB A;  4X5V A;  2BCQ A;  4GIB A;  1S97 A;  4I2J A;  3MR2 A;  3GV7 B;  7ICG A;  1L7P A;  5GTI U;  2D6F C;  5KTQ A;  1D9F A;  3SEI A;  2A1J A;  3M7D A;  4UAV A;  2LKY A;  4I2I A;  3IP4 B;  4C8O A;  3BQ2 A;  5CJ7 A;  1BPE A;  3UXP A;  3BDP A;  1WCN A;  5CA7 A;  2W8K A;  3CW2 C;  1RQN A;  2GLE A;  4DOB A;  3TAR A;  4I2C A;  5J0Y A;  1V97 A;  2UVR A;  3NRZ A;  2YB4 A;  3HPO A;  2J6U A; 
#chains in the Genus database with same CATH homology
 1IG6 A;  2JXJ A;  2EH9 A;  4LJX A;  5CEH A;  1RYU A;  5K4L A;  2CXY A;  1C20 A;  2KK0 A;  2JRZ A;  2LM1 A;  2RQ5 A;  1KKX A;  1KQQ A;  2LI6 A;  2OEH A;  1KN5 A;  2YQE A;  2EQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...