2JXJA

Nmr structure of the arid domain from the histone h3k4 demethylase rbp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
b'GPLGSRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title The ARID domain of the H3K4 demethylase RBP2 binds to a DNA CCGCCC motif
pubmed doi rcsb
total genus 22
structure length 96
sequence length 96
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jxjA00
2OEHA 5K4LA 2LM1A 2JRZA 5CEHA 2EH9A 1IG6A 2CXYA 2LI6A 1KN5A 1RYUA 2RQ5A 4LJXA 1KQQA 2YQEA 2KK0A 2JXJA 1KKXA 2EQYA 1C20A
chains in the Genus database with same CATH superfamily
2HHVA 3GIJA 1XSLA 3UMBA 3RRHA 2PFOA 5HHIA 2BCUA 4JWMA 3BS5B 3BQ7A 2C2RA 3N28A 4B9TA 3M1YA 3OTQA 2KIVA 1NNLA 4Y2QA 3C5FA 3ORYA 4YVZA 1XSPA 9ICJA 5TZVA 5AKXA 1ZQLA 5HNKA 4DSKA 3PW4A 1NKCA 2JR5A 3QE9Y 3BQ2A 3H4BA 3KFUF 1PK1B 4M2YA 2UVUA 2F76X 2KD1A 3SENA 4MFAA 4DSEA 1ZQPA 2BZFA 2NO4A 2OEHA 4XUSA 2W7OA 2AH5A 1A76A 8ICXA 4QWBA 3JPTA 4MF8A 2ISOA 2D6FC 3F5AA 4HAIA 1IM4A 3LDAA 4J03A 3Q8SB 1L3UA 3DV9A 5AM5A 3WKDA 4ED0A 2DKZA 4Y2SA 2YMLA 2P6UA 1C7YA 1ZQDA 3SMVA 4YQWA 1TVAA 1C20A 4I27A 3IG8A 3KHRA 1NK9A 2KVCA 2YB1A 2FMSA 1KLNA 4ED7A 4YN4A 3PSPA 5KFPA 2J6SA 2A19A 2JRZA 1SZPA 4RPXA 1NJXA 4C8LA 4F4KA 2IOHA 4C8OA 3AQFA 4F5QA 4FE3A 5ALLA 4F2SA 3G6XA 8ICMA 3PSFA 3HW8A 2AGQA 1MA7A 3CNHA 2GWSA 2HVHA 4F5RA 4ECQA 2F3NA 2KVSA 2E8OA 3E2EA 1B0XA 1FFVA 2LYAA 2UVWA 3ED5A 2PMZC 3QUTA 3PW5A 4PL1A 4FZLA 1QLNA 1DOQA 3GV8B 3B0YA 2Y1JA 2IA6A 2RQ5A 1Q46A 2OH2A 3BZKA 5EE1A 3ZDBA 8ICTA 3RH6A 3RJHA 1BPYA 1UPHA 2NRXA 5CA7A 4GC7A 4NLBA 4KLOA 5DG8A 3SYZA 4F50A 1Z19A 3CRXA 4J9QA 5KFNA 2Z7JA 1MSWD 1BPBA 5BOLA 8ICIA 5L1MA 3LVWA 2KIWA 2W9CA 2V9WA 1DGJA 1IIPA 5KG2A 3N97B 5EWGA 1L5UA 2I1QA 4EX7A 5KFDA 3H0LB 2YX8A 2CXYA 4KMUA 3NVYA 1ZQCA 2XO7A 1T4GA 2LYBA 1H38A 4C8KA 3E58A 4B9NA 1QSLA 1S76D 3C23A 7ICGA 5KTQA 4K4GA 4WJ3B 2ZXIA 4QWDA 4DS4A 1Z4NA 8ICRA 5AKZA 1N60A 5AIAA 1ZD2P 3IP4B 1KRPA 5AHXA 2EH9A 4UB8U 1SZHA 1EXNA 1JUDA 2AU0A 3IG5A 8ICGA 3TAQA 3ISDA 2PXIA 5ALYA 5GTHU 8ICHA 4C4RA 5EOZA 1SL1A 5IIJA 2EANA 3QU4A 3C2KA 3T5JA 5L9XA 5AM1A 4YCXA 5G5HA 4F8RA 4CRXA 2WFAA 3WK9A 5AM2A 5J2BA 1TE2A 3KBBA 4RT3A 2JZBB 5ALPA 4FBTA 2I6XA 2W9AA 5KG7A 2WTFA 1RQNA 4O5EA 4ELTA 1QCKA 5CR0A 4CF3A 5KFFA 5DGAA 2RLTA 3Q8PB 7ICVA 4M9HA 5AI5A 2QLTA 3GV7B 9ICNA 3H8WA 9ICFA 4NXZA 1ZQXA 4ICAA 1JX4A 9ICWA 2LI6A 2NRVA 5KFRA 1TK8A 4U7CA 2FDRA 5IIKA 3TAPA 1UCVA 5IIMA 4KLJA 4R63A 2R8HA 4DL3A 3TFSA 3AL0B 2XCAA 3MFHA 2XVTA 2G5IB 4US8A 5BPCA 1MN8A 4PPXA 4YD2A 1ZQNA 5KFJA 5J2EA 2HHWA 2OYYA 3PSTA 4Y2TA 4RU9A 4IR9A 5DLFA 3RRGA 3IDWA 4ECWA 3NVVA 1BPXA 1J2NA 2XI9A 4O3OA 1NOMA 4HYKA 5A0LA 4CF5A 4EELA 2BCSA 2KTQA 2PFQA 4O9MA 2JMGA 2W9BA 3C29A 8ICQA 4MF2A 2GOLA 3ZD8A 3HKZF 4NWIA 3HP6A 1M6YA 3UXOA 1ZQBA 5DGBA 5KNIA 4P0PA 2V4RA 2HI0A 4BWJA 5J0PA 3BS7A 1T3QA 3NTUA 1JMSA 4P0PB 3LYSA 2DWQA 1SXDA 2ZIWA 5HP4A 3O0FA 4OJLA 4F92B 2Y9UA 4UB1A 3NASA 4OJPA 5AKHA 5HMMA 2Q4TA 3UXPA 5AKJA 2AGOA 4ECUA 4ECSA 2W04A 3KTQA 1NK0A 3PO4A 4Y2UA 3N4MB 2DL0A 3C21A 3Q8QB 4DQSA 1YT3A 5KAIU 4QZIA 4TQSA 1ECWA 2E8MA 3NVZA 3HX0A 1UQVA 5CWRA 2JEIA 4I2DA 4EEYA 4Q45A 4KLDA 5KG6A 4TURA 4DFKA 1LVHA 1NI3A 3FDSA 4Z6EA 3PX6A 5KT4A 4KLFA 4OO1J 4QNLA 2DPIA 2G07A 3UQ2A 2AQ4A 3V6HA 4G3IA 4UB4A 2HOQA 4NLKA 3HKZC 2H3FA 1L7PA 2HBLA 3QU5A 3C28A 5AKEA 2YMMA 1J97A 1NKEA 4F4XA 3TARA 2A3VA 1T94A 5J2DA 3F2CA 3WKBA 1LV5A 2KJ8A 4B9LA 2B21A 1IV8A 1Q8KA 5KG5A 3MFIA 2NRTA 4KTQA 1UT5A 3UM9A 3F5EA 2DGZA 1Q3UA 5KG1A 9ICUA 5HHHA 1ZQAA 3D2SA 4M9JA 2W9CB 2KV2A 3M8SA 1RPLA 3RTVA 1K1QA 2ZXHA 4IRCA 5J8YC 1QQ5A 1T3NA 4F71A 2OHFA 5C0YA 4IQTA 4NM2A 3RF9A 3TFRA 4Q43A 2Y0SF 2ESEA 4DFJA 5D46A 5KFLA 2B6GA 9ICGA 4IRDA 2BCVA 5KT6A 2ASLA 3OPXA 4DSJA 4IRKA 2G09A 2BGWA 1ZOLA 4F3OA 1S0VA 2KK0A 2GO7A 2IOFK 3V72A 8ICCA 3T5HA 4B9SA 2WB1C 5KFVA 5CB1A 1S0OA 3K4GA 4QZAA 4NJ8A 2JV3A 5FP0A 5AM0A 4F4ZA 2EZYA 5L1JA 2IMWP 4JV0A 4QW8A 4C4SA 3PW0A 2KZZA 1KKXA 5D49A 3BQ1A 1PVPA 2DQNB 3ZDCA 5DQGA 4CGZA 1N61A 1NJYA 2AHOB 4ED3A 1BNPA 3KOOA 2EQYA 3AM9A 8ICSA 2F2AB 2JH7A 4C4TA 4BXOB 3GILA 4BXOA 2AXTU 7ICKA 5J2KA 5KFAA 4IL6U 1DRGA 3HRDD 5AKYA 3HILA 1KFSA 3UXNA 5AICA 4DEZA 2OWOA 2UVVA 2A1AA 2FPLA 1QQ6A 2I5HA 4UAUA 3NS1A 1KTQA 4RQ3A 4UQGA 2WB1F 1L3SA 3JPNA 4KLUA 4RQ4A 5AKLA 5ALFA 4IR1A 5CP2A 4ED1A 3GV5B 3EUB2 7ICSA 3H8JA 2YY6A 3SAFA 2DFLA 2BDPA 5ALVA 9ICCA 4DSIA 4J9PA 5AKIA 2ZIXA 4I2AA 3NRWA 4MEYA 1V97A 4PZOA 1YZ7A 4AP9A 4J9NA 4M0AA 4MEXA 2EAMA 4JMUA 2RHFA 4Y2VA 2DUYA 5ALWA 1X40A 4LZDA 1X6IA 4EX6A 1FFUA 1URJA 4GLXA 4NY8A 2K4PA 1RM6C 2F1HA 4KLQA 5ALJA 2WF6A 1U48A 5CJ7A 2D8CA 2BDUA 4DF4A 3PSIA 1ZJMA 4QIWF 4NV0A 1KQQA 2NRZA 3MGHA 3SV4A 4GC6A 3QUCA 5DB8A 3WK4A 2NRWA 1Z4OA 2E1FA 1Z1BA 1ZD3A 3ISCA 4KITB 4R65A 2MSNA 2E8NA 4UB2A 2XICA 3RB4A 5K4LA 3FYHA 5B66U 2P35A 2ZUBA 2ZTEA 3N7PD 3CP8A 3EYZA 1NK5A 3RB3A 1DK3A 2QB1A 3KHHA 1X9SA 4EBCA 4MFCA 5AKKA 1SB3C 5JRTA 4QZ9A 4P0QA 3C1YA 1N48A 4YG2A 4DQPA 4USAA 4EZ9A 2K60A 2IBKA 2CRXA 2RDIA 3PVXA 4TQRA 3IN5A 4DOBA 5DQIA 2HOIA 4P4MA 4UATA 3ZI4A 5KFHA 4RQ0A 4DLGA 3RJFA 1JIHA 3B0XA 4QWAA 3TACB 1PK1A 1NK7A 5KT3A 1AQ6A 2Y1IA 4RQ7A 4YMMA 5KFTA 4I2FA 4YXMA 1V38A 3M6ZA 3GZFA 3PX0A 2XY5A 2A1JB 2BQRA 5KFQA 3PR5B 4JUZA 3WK5A 2WF8A 2MA1A 5CRXA 2E8PA 3IHQB 4P4OA 5AM3A 5IIIA 3Q8MA 3PW7A 2ZJ8A 2HHTA 1S77D 1RXVA 2M9NA 2RRDA 4RNNA 4OD0A 3B9JA 4BJQA 1O03A 1CRXA 5DBAA 1JN3A 3SAHA 2VA3A 9ICRA 3A0HU 2L5YA 1OW5A 2BQUA 9ICAA 5ALNA 2ASJA 1WCNA 5EWFA 3T3FA 4CF4A 1SWWA 4YMNA 2K8AA 4RUAA 1CEZA 2HHUA 3UQ0A 4QIWC 3Q8RB 4DL2A 4OJ5A 4K4HA 1ZQZA 4B9UA 1SKSA 4DSLA 2R8GA 3ONNA 9ICMA 2W8KA 4RNMA 4J9LA 5KFWA 1KBUA 4XRHA 5KFZA 7ICPA 3NRZA 5DQHA 2ZIVB 2R8KA 3GU3A 2PKEA 5J0SA 2K8CB 2ZIVA 4ELUA 4QW9A 1LKYA 4JK1A 4UAYA 3H40A 1WWUA 1ZQRA 3A0BU 3K1RB 3OSNA 1BNOA 5AIBA 1RYRA 2HOFA 3AN1A 5KAFU 1S5LU 4UAWA 4F4YA 3OJSA 4KX3A 8ICKA 3L3FX 2KFZA 2VANA 4YR2A 1X9XA 2W54A 4NLZA 1D9FA 1XO0A 3OJUA 2YN4A 3ICXA 4R8UB 4A8EA 3IM1A 2W11A 4QZFA 2QARA 1S8OA 2W3SA 3RBEA 3I76A 2ZJ5A 1Y88A 3Q8LA 2FE9A 4AYBC 1HUOA 5KFCA 4DQRA 9ICQA 1N63A 5JUMA 4C8MA 2I9GA 2JHDA 3MR3A 2Y9TA 3SI8A 1JALA 2ZJAA 1NJZA 5AK5A 3HPOA 2PFNA 5J0YA 1UHUA 3N7RC 5G5GA 4ECXA 4IS7A 4EYHB 2A1JA 3NUQA 3JPQA 3V7JA 3H0MB 4OCZA 4DL6A 4YXJA 1ZQJA 2XCPA 4FZNA 4DCCA 4DO9A 5KL8B 4NL9A 3ETRA 4PHAA 2NYVA 5GTIU 4KMOB 5IIOA 3GIKA 1L7NA 5JU5A 1ZQIA 1RYUA 1PVQA 4G9BA 1MQ2A 5KFXA 1L6NA 3THVA 4F5PA 2OXOA 1RXWA 3GFKB 3G6YA 1JRPA 1ZQMA 1MC8A 4QZCA 3F2DA 5KFEA 1A6SA 3GIMA 4I2EA 1IG6A 9ICIA 2G06A 4EEKA 2M0NA 4UBBA 4QZ8A 1T8EA 5ALRA 2BCRA 2HVIA 1L7MA 1RG6A 3RJKA 1BVSA 2MRLA 5AM4A 4O3MA 4JV2A 4FBUA 4J9RA 3C1ZA 3H4DA 1S9FA 4M6WA 2K4IA 4J9SA 3WK7A 2BR0A 4M6WB 2K4EA 4O5CA 2Q0ZX 3MGIA 3KZXA 4TUSA 4Z6DA 4TUPA 4CNQA 2LMRA 3LK9A 5AK3A 4PL2A 4CDGA 2KN7A 1KL9A 4ECVA 4LZGA 2YMQA 5J2JA 1ZQGA 4KLIA 3KKAA 4M9NA 1X42A 4EBDA 2Y0SC 5J2FA 4E0DA 4PGYA 1VDVA 4ZH4A 2PI4A 7ICOA 4AYBF 3PMNA 4FFDA 4YFKA 2K4HA 4C7YA 1RQLA 5AI0A 4R8UA 2ISPA 4PHDA 1X6JA 2HW3A 3H8MA 2QARB 2YB4A 4NM1A 5DBBA 1X9MA 3G6VA 2AQ0A 1NZPA 2JH1A 2VJ5A 5KG0A 2XGQA 3LWMA 1S0MA 5ALIA 3F53A 4RQMA 4I2IA 2H3QA 4QJFB 1U47A 1OUQA 1BPEA 2ODGA 5DB6A 1ZQFA 3EW9A 3ISBA 2H3VA 3MC1A 3HJEA 7ICUA 4F2RA 4Q44A 3ZDAA 4DFDA 9ICEA 1ZD5A 2FLLA 4UB5A 1SXEA 3WKAA 3M9MB 4I2CA 5KFYA 3E0FA 3DDHA 3ETLA 3RB0A 4YR0A 5ALXA 5DDMA 1FEZA 4EZ6A 5ALTA 2MU2A 2JXJA 4CCHA 3N7SC 4PJ0U 2C22A 1N62A 5ALHA 3KKAC 4O3QA 4DQQA 1ZD4A 3RBDA 2WHEA 3WU2U 4RPZA 1MQ3A 2BCQA 1KEJA 1XO1A 5DB9A 2DPJA 3PZPA 3WK8A 3OHBA 4O3SA 2ZTCA 4DFMA 1KN5A 2KNJA 1B4FA 3MGVA 3RJIA 3MR6A 1YZ6A 2FMPA 2WAQF 2G08A 1JXLA 2KICA 2CPRA 4C80A 5J0QA 4RQ5A 3D2NA 3IV6A 3H8SA 2RDJA 4Y2JA 5ALQA 4Y2PA 5B5EU 5KT2A 2R8JA 4F4WA 3TKAA 5EE3A 3ALRA 3D6JA 2DBYA 1TAMA 2IOFA 2ZIXB 4QZHA 2H3IA 5EWEA 2NV3A 3SD7A 5F9NA 2PFPA 3RFAA 3U26A 2KHQA 1TV9A 8ICEA 5BOMA 2HBKA 1DK2A 2ZG6A 2UVRA 1DXSA 5KT5A 1ZETA 3UMGA 3SEIA 2KKPA 1U45A 2C2DA 1F5SA 3CW2C 4J9KA 4KLTA 2ES6A 2VJ4A 3EWAA 1WWVA 3F2BA 3QUQA 4RT2A 5KFBA 3C2LA 4BWMA 7ICJA 8ICZA 1SIJA 3GQCA 2LPEA 5D4BA 2HBMA 2FPMA 4ECYA 3MR2A 8ICOA 2KOBA 4R64A 2AJQA 2XY6A 2J6UA 2JEFA 4GFJA 4O3PA 3QU7A 5KFGA 3MDCA 2ZTDA 2XY7A 5HR7A 4RNOA 2EAOA 1ZRNA 4Y2RA 2BQ3A 4BUGA 3RH5A 7ICEA 4Q8FA 4UAVA 4Z6FA 2KSOB 2KJ9A 1WYGA 2KSOA 5KT7A 5ALZA 7ICNA 4Q8EA 4F72A 1OXJA 9ICTA 1S0NA 2LBOA 1XU4A 1D8LA 3EZ5A 1F0MA 1SV0C 4IQVA 3PV8A 1Q3VA 3L4PA 1RDFA 5J0RA 1TAUA 4DWIA 1L7OA 5HR6A 4US9A 3ZDEA 2F1IA 1CUKA 4F5NA 3M8RA 3QXGA 3MABA 1CI4A 9ICLA 4PGXA 4Y2YA 2KJ5A 5KG3A 4BX9C 3ZD9A 1HEKA 5TISU 2C2EA 1NJWA 2BPFA 1U9LA 2JGAA 3VCBA 1L3TA 4ZOHC 4DFPA 2KEYA 1FIQA 3PO5A 3M7DA 1UA0A 4DOCA 3TANA 4B9MA 1XC9A 2LM4A 2HHQA 3AU6A 1QSYA 2FJ6A 2VA2A 7ICQA 3H0RB 4QZDA 3SAGA 4UASA 1ZQKA 1TK0A 4DL4A 4B9VA 4C0ZA 1KW4A 3K75D 2XGPA 2LM1A 1WG8A 4C8NA 2WF5A 3MDAA 1ZQSA 3OSPA 5EE0A 3HT3A 4U6PA 9ICSA 5CEHA 1PK3A 1N5WA 4M9GA 1V9PA 3UPQA 2IHMA 2ZUCA 1N56A 1BGXT 2E3TA 2W3RA 3TQ1A 2W03A 1NZBA 5J8YA 5DBCA 3HWTA 7ICIA 4UB6U 2R8IA 8ICFA 8ICNA 2W9BB 1XNSA 7ICHA 1ZQTA 3AU2A 3SR6A 1BPZA 2HMXA 2FLPA 5ALDA 2YMPA 3CYMA 2HHSA 3MR5A 5DDYA 4O0IA 2KE7A 4QZGA 5DLGA 3PX4A 5F9LA 1LB2B 3RR8A 3TADC 3ZDDA 4M04A 3SQIA 2LYHA 1Z00B 2F44A 2KG5A 5ALGA 1Z00A 2JEJA 2W55A 1T7PA 8ICWA 2ZIUA 2BHNA 5ALUA 1XSNA 1S10A 1U4BA 9ICXA 9ICHA 2D3DA 3KHLA 4KX5A 3GIIA 2EZZA 4J9MA 5AI9A 4IQUA 4LJXA 4PHPA 1SKRA 1ZQVA 2DF4B 4RUCA 4EYIB 9ICKA 4X5VA 4EBEA 3QU9A 3BZCA 3C5GA 2C28A 4JV1A 1COKA 4UAZA 3QEBZ 3BQ0A 1KFDA 2EDUA 1QH9A 4PHEA 4DQIA 5L1LA 1N2XA 1QSSA 4M9LA 9ICPA 2F8KA 1QQ7A 3LVVA 5KFIA 5DG9A 3PNCA 5ALKA 5AI4A 2HHXA 4KLLA 3JPRA 1V85A 5ALOA 3S6JA 1D8YA 5L1IA 3QYPA 4M47A 2W7PA 3FC4A 1Z3EB 1HJPA 2VIXA 4FS1A 4R66A 8ICVA 4MFFA 3VC8A 2YQEA 4DS5A 2XC9A 2BKEA 4F93B 8ICUA 1J2MA 4GIBA 3V7LA 8ICJA 2JEGA 5KL1B 4FS2A 1JROA 3BQTA 2KFNA 4ELVA 1U49A 4KN4A 1TFRA 5AI6A 1Z1VA 4FO6A 3IRUA 2FMQA 4F91B 8ICAA 5KFOA 4BGDA 4P4PA 1HIWA 2QB0B 2P6RA 1ED1A 1COOA 2W8LA 1SL0A 1B22A 4F5OA 3V7KA 1A77A 5ALMA 5DB7A 1NKBA 4GXJA 1ZQEA 3AMZA 1LKYB 7ICFA 5E79U 4KLSA 5CHGA 2ZIWB 4RQ6A 4PGQA 4YR3A 1KDHA 3LWLA 1X66A 3QU2A 5AKGA 1HUZA 4I2HA 3QNMA 5KFUA 5J0TA 2PI5A 4RZRA 2B0CA 5J0OA 3PY8A 8ICYA 4DSFA 5F3XB 4ED2A 5C5JA 1BPDA 1B43A 3I28A 3QUBA 4NLCA 4RQ1A 1PUZA 3WK6A 4EENA 4O5KA 3M9OB 3GDXA 4NL9C 5KFKA 2HSZA 4ECZA 4UARA 3JPPA 3EPIA 3R9KA 4JWNA 2KHVA 3QEAZ 3QZ8A 5JTIA 4QWCA 9ICBA 1JXEA 1D8BA 4ECTA 4B6JA 4TUQA 4LVSA 3AEVA 2VKQA 1WCLA 1AROP 1K1SA 4DLEA 2F8LA 9ICVA 2WF7A 3TADA 2N1RA 4XA5A 5J0UA 4I2BA 3BS5A 4YMOA 5J2AA 1ZXIA 3RAQA 1SV0A 3OHAA 1PZNA 3JPOA 4YD1A 2W9MA 5DKWA 4KLEA 3M6KA 3NGDA 3MBYA 2ZUDA 4RQNA 4C7ZA 3UMCA 4CE6A 2FPKA 5AK6A 5ALSA 1NK4A 4ACOA 2VA8A 5EE9A 3RJGA 3FM9A 1A0PA 3BDPA 1QTMA 4GXKA 4QZEA 2MAXA 2YTUA 9ICOA 3NVWA 1PVRA 2HCFA 4JB3A 7ICMA 5J0WA 4KLHA 2MUTB 2CN1A 2MUTA 4Y2XA 4ECRA 3WKEA 1ZQYA 1TK5A 2QKQA 2FLNA 3PMLA 1GO3F 1L8OA 3PR4A 1VJ5A 1VLBA 1D9DA 2XIDA 4UBCA 3KHGA 4DL7A 2ASDA 4QZBA 2KMDA 4O3RA 2KZMA 4O3NA 1ZJNA 3T5KA 3KD3A 2G5HB 4ED6A 3RJJA 3J81j 2O6KA 1XS9D 2EAPA 7ICRA 1NK8A 2P66A 4FZMA 3SZ2A 5DG7A 3OGUA 2NO5A 4PH5A 4K4IA 4KLMA 3BJYA 3C2MA 3AUOA 3AQEA 2FI1A 3FAHA 1XWLA 1SL2A 3T5LA 2IHNA 4KN7A 4QWEA 4DF8A 3QZ7A 1NK6A 3V6JA 1FO4A 8ICLA 5IINA 3EPGA 4J9OA 5AI8A 2F77X 4DL5A 1ZQHA 2R18A 5KFMA 5L1KA 4RPYA 4YP3A 2J6TA 5J2GA 3TI0A 4UW9A 5J0XA 1ZQUA 3RH4A 5J2HA 4UB3A 2RP5A 1N5XA 2LHTA 3DEEA 3T79A 3KZIU 7ICTA 2V4QA 8ICPA 1ZQ1C 3H7IA 4IQWA 2LKYA 4Z6CA 2GLEA 1UT8A 2BPGA 3K1ZA 2E5SA 1SWVA 5J2CA 4OJOA 1RZTA 3WKCA 1SGGA 4IC9A 2E1EA 1SKWA 2ATLA 4KLGA 1ZYQA 4NLGA 2WAQC 4BDPA 1TKDA 4I29A 1WUDA 2PMZF 4I28A 4GXIA 1SV4A 7ICLA 1L8LA 2QB0A 4OJ6A 1RYSA 2HDOA 1O08A 4P2HA 2OCEA 1X9WA 5IILA 2WF9A 3RB6A 2H3ZA 5T14A 1IXRA 4ED8A 4NLNA 3RAXA 1S97A 2KKVA 4I2JA 1DGSA 2BPCA 2GH1A 3QX7A 2W43A 1K5OA 1UA1A 2DKXA 2KZ3A 2KP7A 2AGPA 1KSPA 2EZXA 1TAQA 2ALZA 3JPSA 3SV3A 4DOAA 5KG4A 2K89A 5AK4A 1ZRMA 3V6KA 5HMLA 3RJEA 2HBJA 2K8BB 1KFTA 5ALEA 8ICBA 3M9NB 1ZQQA 4MHVA 2JZBA 4P0QB 2H5XA 5KFSA 3Q8KA 3RR7A 4XQ8A 4I2GA 2OM6A 5J29A 2F1JA 1X2IA 3L5KA 1ZQWA 4PZNA 5H2FU 4RQ8A 1JI7A 2G0AA 1ZQOA 5J2IA 1F44A 4RQ2A 1L3VA 3I1YA 2ZIUB 1P7DA 3PW2A 3D2QA
chains in the Genus database with same CATH topology
2OEHA 5K4LA 2LM1A 2JRZA 5CEHA 2EH9A 1IG6A 2CXYA 2LI6A 1KN5A 1RYUA 2RQ5A 4LJXA 1KQQA 2YQEA 2KK0A 2JXJA 1KKXA 2EQYA 1C20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEH A;  5K4L A;  2LM1 A;  2JRZ A;  5CEH A;  2EH9 A;  1IG6 A;  2CXY A;  2LI6 A;  1KN5 A;  1RYU A;  2RQ5 A;  4LJX A;  1KQQ A;  2YQE A;  2KK0 A;  2JXJ A;  1KKX A;  2EQY A;  1C20 A; 
#chains in the Genus database with same CATH topology
 2HHV A;  3GIJ A;  1XSL A;  3UMB A;  3RRH A;  2PFO A;  5HHI A;  2BCU A;  4JWM A;  3BS5 B;  3BQ7 A;  2C2R A;  3N28 A;  4B9T A;  3M1Y A;  3OTQ A;  2KIV A;  1NNL A;  4Y2Q A;  3C5F A;  3ORY A;  4YVZ A;  1XSP A;  9ICJ A;  5TZV A;  5AKX A;  1ZQL A;  5HNK A;  4DSK A;  3PW4 A;  1NKC A;  2JR5 A;  3QE9 Y;  3BQ2 A;  3H4B A;  3KFU F;  1PK1 B;  4M2Y A;  2UVU A;  2F76 X;  2KD1 A;  3SEN A;  4MFA A;  4DSE A;  1ZQP A;  2BZF A;  2NO4 A;  2OEH A;  4XUS A;  2W7O A;  2AH5 A;  1A76 A;  8ICX A;  4QWB A;  3JPT A;  4MF8 A;  2ISO A;  2D6F C;  3F5A A;  4HAI A;  1IM4 A;  3LDA A;  4J03 A;  3Q8S B;  1L3U A;  3DV9 A;  5AM5 A;  3WKD A;  4ED0 A;  2DKZ A;  4Y2S A;  2YML A;  2P6U A;  1C7Y A;  1ZQD A;  3SMV A;  4YQW A;  1TVA A;  1C20 A;  4I27 A;  3IG8 A;  3KHR A;  1NK9 A;  2KVC A;  2YB1 A;  2FMS A;  1KLN A;  4ED7 A;  4YN4 A;  3PSP A;  5KFP A;  2J6S A;  2A19 A;  2JRZ A;  1SZP A;  4RPX A;  1NJX A;  4C8L A;  4F4K A;  2IOH A;  4C8O A;  3AQF A;  4F5Q A;  4FE3 A;  5ALL A;  4F2S A;  3G6X A;  8ICM A;  3PSF A;  3HW8 A;  2AGQ A;  1MA7 A;  3CNH A;  2GWS A;  2HVH A;  4F5R A;  4ECQ A;  2F3N A;  2KVS A;  2E8O A;  3E2E A;  1B0X A;  1FFV A;  2LYA A;  2UVW A;  3ED5 A;  2PMZ C;  3QUT A;  3PW5 A;  4PL1 A;  4FZL A;  1QLN A;  1DOQ A;  3GV8 B;  3B0Y A;  2Y1J A;  2IA6 A;  2RQ5 A;  1Q46 A;  2OH2 A;  3BZK A;  5EE1 A;  3ZDB A;  8ICT A;  3RH6 A;  3RJH A;  1BPY A;  1UPH A;  2NRX A;  5CA7 A;  4GC7 A;  4NLB A;  4KLO A;  5DG8 A;  3SYZ A;  4F50 A;  1Z19 A;  3CRX A;  4J9Q A;  5KFN A;  2Z7J A;  1MSW D;  1BPB A;  5BOL A;  8ICI A;  5L1M A;  3LVW A;  2KIW A;  2W9C A;  2V9W A;  1DGJ A;  1IIP A;  5KG2 A;  3N97 B;  5EWG A;  1L5U A;  2I1Q A;  4EX7 A;  5KFD A;  3H0L B;  2YX8 A;  2CXY A;  4KMU A;  3NVY A;  1ZQC A;  2XO7 A;  1T4G A;  2LYB A;  1H38 A;  4C8K A;  3E58 A;  4B9N A;  1QSL A;  1S76 D;  3C23 A;  7ICG A;  5KTQ A;  4K4G A;  4WJ3 B;  2ZXI A;  4QWD A;  4DS4 A;  1Z4N A;  8ICR A;  5AKZ A;  1N60 A;  5AIA A;  1ZD2 P;  3IP4 B;  1KRP A;  5AHX A;  2EH9 A;  4UB8 U;  1SZH A;  1EXN A;  1JUD A;  2AU0 A;  3IG5 A;  8ICG A;  3TAQ A;  3ISD A;  2PXI A;  5ALY A;  5GTH U;  8ICH A;  4C4R A;  5EOZ A;  1SL1 A;  5IIJ A;  2EAN A;  3QU4 A;  3C2K A;  3T5J A;  5L9X A;  5AM1 A;  4YCX A;  5G5H A;  4F8R A;  4CRX A;  2WFA A;  3WK9 A;  5AM2 A;  5J2B A;  1TE2 A;  3KBB A;  4RT3 A;  2JZB B;  5ALP A;  4FBT A;  2I6X A;  2W9A A;  5KG7 A;  2WTF A;  1RQN A;  4O5E A;  4ELT A;  1QCK A;  5CR0 A;  4CF3 A;  5KFF A;  5DGA A;  2RLT A;  3Q8P B;  7ICV A;  4M9H A;  5AI5 A;  2QLT A;  3GV7 B;  9ICN A;  3H8W A;  9ICF A;  4NXZ A;  1ZQX A;  4ICA A;  1JX4 A;  9ICW A;  2LI6 A;  2NRV A;  5KFR A;  1TK8 A;  4U7C A;  2FDR A;  5IIK A;  3TAP A;  1UCV A;  5IIM A;  4KLJ A;  4R63 A;  2R8H A;  4DL3 A;  3TFS A;  3AL0 B;  2XCA A;  3MFH A;  2XVT A;  2G5I B;  4US8 A;  5BPC A;  1MN8 A;  4PPX A;  4YD2 A;  1ZQN A;  5KFJ A;  5J2E A;  2HHW A;  2OYY A;  3PST A;  4Y2T A;  4RU9 A;  4IR9 A;  5DLF A;  3RRG A;  3IDW A;  4ECW A;  3NVV A;  1BPX A;  1J2N A;  2XI9 A;  4O3O A;  1NOM A;  4HYK A;  5A0L A;  4CF5 A;  4EEL A;  2BCS A;  2KTQ A;  2PFQ A;  4O9M A;  2JMG A;  2W9B A;  3C29 A;  8ICQ A;  4MF2 A;  2GOL A;  3ZD8 A;  3HKZ F;  4NWI A;  3HP6 A;  1M6Y A;  3UXO A;  1ZQB A;  5DGB A;  5KNI A;  4P0P A;  2V4R A;  2HI0 A;  4BWJ A;  5J0P A;  3BS7 A;  1T3Q A;  3NTU A;  1JMS A;  4P0P B;  3LYS A;  2DWQ A;  1SXD A;  2ZIW A;  5HP4 A;  3O0F A;  4OJL A;  4F92 B;  2Y9U A;  4UB1 A;  3NAS A;  4OJP A;  5AKH A;  5HMM A;  2Q4T A;  3UXP A;  5AKJ A;  2AGO A;  4ECU A;  4ECS A;  2W04 A;  3KTQ A;  1NK0 A;  3PO4 A;  4Y2U A;  3N4M B;  2DL0 A;  3C21 A;  3Q8Q B;  4DQS A;  1YT3 A;  5KAI U;  4QZI A;  4TQS A;  1ECW A;  2E8M A;  3NVZ A;  3HX0 A;  1UQV A;  5CWR A;  2JEI A;  4I2D A;  4EEY A;  4Q45 A;  4KLD A;  5KG6 A;  4TUR A;  4DFK A;  1LVH A;  1NI3 A;  3FDS A;  4Z6E A;  3PX6 A;  5KT4 A;  4KLF A;  4OO1 J;  4QNL A;  2DPI A;  2G07 A;  3UQ2 A;  2AQ4 A;  3V6H A;  4G3I A;  4UB4 A;  2HOQ A;  4NLK A;  3HKZ C;  2H3F A;  1L7P A;  2HBL A;  3QU5 A;  3C28 A;  5AKE A;  2YMM A;  1J97 A;  1NKE A;  4F4X A;  3TAR A;  2A3V A;  1T94 A;  5J2D A;  3F2C A;  3WKB A;  1LV5 A;  2KJ8 A;  4B9L A;  2B21 A;  1IV8 A;  1Q8K A;  5KG5 A;  3MFI A;  2NRT A;  4KTQ A;  1UT5 A;  3UM9 A;  3F5E A;  2DGZ A;  1Q3U A;  5KG1 A;  9ICU A;  5HHH A;  1ZQA A;  3D2S A;  4M9J A;  2W9C B;  2KV2 A;  3M8S A;  1RPL A;  3RTV A;  1K1Q A;  2ZXH A;  4IRC A;  5J8Y C;  1QQ5 A;  1T3N A;  4F71 A;  2OHF A;  5C0Y A;  4IQT A;  4NM2 A;  3RF9 A;  3TFR A;  4Q43 A;  2Y0S F;  2ESE A;  4DFJ A;  5D46 A;  5KFL A;  2B6G A;  9ICG A;  4IRD A;  2BCV A;  5KT6 A;  2ASL A;  3OPX A;  4DSJ A;  4IRK A;  2G09 A;  2BGW A;  1ZOL A;  4F3O A;  1S0V A;  2KK0 A;  2GO7 A;  2IOF K;  3V72 A;  8ICC A;  3T5H A;  4B9S A;  2WB1 C;  5KFV A;  5CB1 A;  1S0O A;  3K4G A;  4QZA A;  4NJ8 A;  2JV3 A;  5FP0 A;  5AM0 A;  4F4Z A;  2EZY A;  5L1J A;  2IMW P;  4JV0 A;  4QW8 A;  4C4S A;  3PW0 A;  2KZZ A;  1KKX A;  5D49 A;  3BQ1 A;  1PVP A;  2DQN B;  3ZDC A;  5DQG A;  4CGZ A;  1N61 A;  1NJY A;  2AHO B;  4ED3 A;  1BNP A;  3KOO A;  2EQY A;  3AM9 A;  8ICS A;  2F2A B;  2JH7 A;  4C4T A;  4BXO B;  3GIL A;  4BXO A;  2AXT U;  7ICK A;  5J2K A;  5KFA A;  4IL6 U;  1DRG A;  3HRD D;  5AKY A;  3HIL A;  1KFS A;  3UXN A;  5AIC A;  4DEZ A;  2OWO A;  2UVV A;  2A1A A;  2FPL A;  1QQ6 A;  2I5H A;  4UAU A;  3NS1 A;  1KTQ A;  4RQ3 A;  4UQG A;  2WB1 F;  1L3S A;  3JPN A;  4KLU A;  4RQ4 A;  5AKL A;  5ALF A;  4IR1 A;  5CP2 A;  4ED1 A;  3GV5 B;  3EUB 2;  7ICS A;  3H8J A;  2YY6 A;  3SAF A;  2DFL A;  2BDP A;  5ALV A;  9ICC A;  4DSI A;  4J9P A;  5AKI A;  2ZIX A;  4I2A A;  3NRW A;  4MEY A;  1V97 A;  4PZO A;  1YZ7 A;  4AP9 A;  4J9N A;  4M0A A;  4MEX A;  2EAM A;  4JMU A;  2RHF A;  4Y2V A;  2DUY A;  5ALW A;  1X40 A;  4LZD A;  1X6I A;  4EX6 A;  1FFU A;  1URJ A;  4GLX A;  4NY8 A;  2K4P A;  1RM6 C;  2F1H A;  4KLQ A;  5ALJ A;  2WF6 A;  1U48 A;  5CJ7 A;  2D8C A;  2BDU A;  4DF4 A;  3PSI A;  1ZJM A;  4QIW F;  4NV0 A;  1KQQ A;  2NRZ A;  3MGH A;  3SV4 A;  4GC6 A;  3QUC A;  5DB8 A;  3WK4 A;  2NRW A;  1Z4O A;  2E1F A;  1Z1B A;  1ZD3 A;  3ISC A;  4KIT B;  4R65 A;  2MSN A;  2E8N A;  4UB2 A;  2XIC A;  3RB4 A;  5K4L A;  3FYH A;  5B66 U;  2P35 A;  2ZUB A;  2ZTE A;  3N7P D;  3CP8 A;  3EYZ A;  1NK5 A;  3RB3 A;  1DK3 A;  2QB1 A;  3KHH A;  1X9S A;  4EBC A;  4MFC A;  5AKK A;  1SB3 C;  5JRT A;  4QZ9 A;  4P0Q A;  3C1Y A;  1N48 A;  4YG2 A;  4DQP A;  4USA A;  4EZ9 A;  2K60 A;  2IBK A;  2CRX A;  2RDI A;  3PVX A;  4TQR A;  3IN5 A;  4DOB A;  5DQI A;  2HOI A;  4P4M A;  4UAT A;  3ZI4 A;  5KFH A;  4RQ0 A;  4DLG A;  3RJF A;  1JIH A;  3B0X A;  4QWA A;  3TAC B;  1PK1 A;  1NK7 A;  5KT3 A;  1AQ6 A;  2Y1I A;  4RQ7 A;  4YMM A;  5KFT A;  4I2F A;  4YXM A;  1V38 A;  3M6Z A;  3GZF A;  3PX0 A;  2XY5 A;  2A1J B;  2BQR A;  5KFQ A;  3PR5 B;  4JUZ A;  3WK5 A;  2WF8 A;  2MA1 A;  5CRX A;  2E8P A;  3IHQ B;  4P4O A;  5AM3 A;  5III A;  3Q8M A;  3PW7 A;  2ZJ8 A;  2HHT A;  1S77 D;  1RXV A;  2M9N A;  2RRD A;  4RNN A;  4OD0 A;  3B9J A;  4BJQ A;  1O03 A;  1CRX A;  5DBA A;  1JN3 A;  3SAH A;  2VA3 A;  9ICR A;  3A0H U;  2L5Y A;  1OW5 A;  2BQU A;  9ICA A;  5ALN A;  2ASJ A;  1WCN A;  5EWF A;  3T3F A;  4CF4 A;  1SWW A;  4YMN A;  2K8A A;  4RUA A;  1CEZ A;  2HHU A;  3UQ0 A;  4QIW C;  3Q8R B;  4DL2 A;  4OJ5 A;  4K4H A;  1ZQZ A;  4B9U A;  1SKS A;  4DSL A;  2R8G A;  3ONN A;  9ICM A;  2W8K A;  4RNM A;  4J9L A;  5KFW A;  1KBU A;  4XRH A;  5KFZ A;  7ICP A;  3NRZ A;  5DQH A;  2ZIV B;  2R8K A;  3GU3 A;  2PKE A;  5J0S A;  2K8C B;  2ZIV A;  4ELU A;  4QW9 A;  1LKY A;  4JK1 A;  4UAY A;  3H40 A;  1WWU A;  1ZQR A;  3A0B U;  3K1R B;  3OSN A;  1BNO A;  5AIB A;  1RYR A;  2HOF A;  3AN1 A;  5KAF U;  1S5L U;  4UAW A;  4F4Y A;  3OJS A;  4KX3 A;  8ICK A;  3L3F X;  2KFZ A;  2VAN A;  4YR2 A;  1X9X A;  2W54 A;  4NLZ A;  1D9F A;  1XO0 A;  3OJU A;  2YN4 A;  3ICX A;  4R8U B;  4A8E A;  3IM1 A;  2W11 A;  4QZF A;  2QAR A;  1S8O A;  2W3S A;  3RBE A;  3I76 A;  2ZJ5 A;  1Y88 A;  3Q8L A;  2FE9 A;  4AYB C;  1HUO A;  5KFC A;  4DQR A;  9ICQ A;  1N63 A;  5JUM A;  4C8M A;  2I9G A;  2JHD A;  3MR3 A;  2Y9T A;  3SI8 A;  1JAL A;  2ZJA A;  1NJZ A;  5AK5 A;  3HPO A;  2PFN A;  5J0Y A;  1UHU A;  3N7R C;  5G5G A;  4ECX A;  4IS7 A;  4EYH B;  2A1J A;  3NUQ A;  3JPQ A;  3V7J A;  3H0M B;  4OCZ A;  4DL6 A;  4YXJ A;  1ZQJ A;  2XCP A;  4FZN A;  4DCC A;  4DO9 A;  5KL8 B;  4NL9 A;  3ETR A;  4PHA A;  2NYV A;  5GTI U;  4KMO B;  5IIO A;  3GIK A;  1L7N A;  5JU5 A;  1ZQI A;  1RYU A;  1PVQ A;  4G9B A;  1MQ2 A;  5KFX A;  1L6N A;  3THV A;  4F5P A;  2OXO A;  1RXW A;  3GFK B;  3G6Y A;  1JRP A;  1ZQM A;  1MC8 A;  4QZC A;  3F2D A;  5KFE A;  1A6S A;  3GIM A;  4I2E A;  1IG6 A;  9ICI A;  2G06 A;  4EEK A;  2M0N A;  4UBB A;  4QZ8 A;  1T8E A;  5ALR A;  2BCR A;  2HVI A;  1L7M A;  1RG6 A;  3RJK A;  1BVS A;  2MRL A;  5AM4 A;  4O3M A;  4JV2 A;  4FBU A;  4J9R A;  3C1Z A;  3H4D A;  1S9F A;  4M6W A;  2K4I A;  4J9S A;  3WK7 A;  2BR0 A;  4M6W B;  2K4E A;  4O5C A;  2Q0Z X;  3MGI A;  3KZX A;  4TUS A;  4Z6D A;  4TUP A;  4CNQ A;  2LMR A;  3LK9 A;  5AK3 A;  4PL2 A;  4CDG A;  2KN7 A;  1KL9 A;  4ECV A;  4LZG A;  2YMQ A;  5J2J A;  1ZQG A;  4KLI A;  3KKA A;  4M9N A;  1X42 A;  4EBD A;  2Y0S C;  5J2F A;  4E0D A;  4PGY A;  1VDV A;  4ZH4 A;  2PI4 A;  7ICO A;  4AYB F;  3PMN A;  4FFD A;  4YFK A;  2K4H A;  4C7Y A;  1RQL A;  5AI0 A;  4R8U A;  2ISP A;  4PHD A;  1X6J A;  2HW3 A;  3H8M A;  2QAR B;  2YB4 A;  4NM1 A;  5DBB A;  1X9M A;  3G6V A;  2AQ0 A;  1NZP A;  2JH1 A;  2VJ5 A;  5KG0 A;  2XGQ A;  3LWM A;  1S0M A;  5ALI A;  3F53 A;  4RQM A;  4I2I A;  2H3Q A;  4QJF B;  1U47 A;  1OUQ A;  1BPE A;  2ODG A;  5DB6 A;  1ZQF A;  3EW9 A;  3ISB A;  2H3V A;  3MC1 A;  3HJE A;  7ICU A;  4F2R A;  4Q44 A;  3ZDA A;  4DFD A;  9ICE A;  1ZD5 A;  2FLL A;  4UB5 A;  1SXE A;  3WKA A;  3M9M B;  4I2C A;  5KFY A;  3E0F A;  3DDH A;  3ETL A;  3RB0 A;  4YR0 A;  5ALX A;  5DDM A;  1FEZ A;  4EZ6 A;  5ALT A;  2MU2 A;  2JXJ A;  4CCH A;  3N7S C;  4PJ0 U;  2C22 A;  1N62 A;  5ALH A;  3KKA C;  4O3Q A;  4DQQ A;  1ZD4 A;  3RBD A;  2WHE A;  3WU2 U;  4RPZ A;  1MQ3 A;  2BCQ A;  1KEJ A;  1XO1 A;  5DB9 A;  2DPJ A;  3PZP A;  3WK8 A;  3OHB A;  4O3S A;  2ZTC A;  4DFM A;  1KN5 A;  2KNJ A;  1B4F A;  3MGV A;  3RJI A;  3MR6 A;  1YZ6 A;  2FMP A;  2WAQ F;  2G08 A;  1JXL A;  2KIC A;  2CPR A;  4C80 A;  5J0Q A;  4RQ5 A;  3D2N A;  3IV6 A;  3H8S A;  2RDJ A;  4Y2J A;  5ALQ A;  4Y2P A;  5B5E U;  5KT2 A;  2R8J A;  4F4W A;  3TKA A;  5EE3 A;  3ALR A;  3D6J A;  2DBY A;  1TAM A;  2IOF A;  2ZIX B;  4QZH A;  2H3I A;  5EWE A;  2NV3 A;  3SD7 A;  5F9N A;  2PFP A;  3RFA A;  3U26 A;  2KHQ A;  1TV9 A;  8ICE A;  5BOM A;  2HBK A;  1DK2 A;  2ZG6 A;  2UVR A;  1DXS A;  5KT5 A;  1ZET A;  3UMG A;  3SEI A;  2KKP A;  1U45 A;  2C2D A;  1F5S A;  3CW2 C;  4J9K A;  4KLT A;  2ES6 A;  2VJ4 A;  3EWA A;  1WWV A;  3F2B A;  3QUQ A;  4RT2 A;  5KFB A;  3C2L A;  4BWM A;  7ICJ A;  8ICZ A;  1SIJ A;  3GQC A;  2LPE A;  5D4B A;  2HBM A;  2FPM A;  4ECY A;  3MR2 A;  8ICO A;  2KOB A;  4R64 A;  2AJQ A;  2XY6 A;  2J6U A;  2JEF A;  4GFJ A;  4O3P A;  3QU7 A;  5KFG A;  3MDC A;  2ZTD A;  2XY7 A;  5HR7 A;  4RNO A;  2EAO A;  1ZRN A;  4Y2R A;  2BQ3 A;  4BUG A;  3RH5 A;  7ICE A;  4Q8F A;  4UAV A;  4Z6F A;  2KSO B;  2KJ9 A;  1WYG A;  2KSO A;  5KT7 A;  5ALZ A;  7ICN A;  4Q8E A;  4F72 A;  1OXJ A;  9ICT A;  1S0N A;  2LBO A;  1XU4 A;  1D8L A;  3EZ5 A;  1F0M A;  1SV0 C;  4IQV A;  3PV8 A;  1Q3V A;  3L4P A;  1RDF A;  5J0R A;  1TAU A;  4DWI A;  1L7O A;  5HR6 A;  4US9 A;  3ZDE A;  2F1I A;  1CUK A;  4F5N A;  3M8R A;  3QXG A;  3MAB A;  1CI4 A;  9ICL A;  4PGX A;  4Y2Y A;  2KJ5 A;  5KG3 A;  4BX9 C;  3ZD9 A;  1HEK A;  5TIS U;  2C2E A;  1NJW A;  2BPF A;  1U9L A;  2JGA A;  3VCB A;  1L3T A;  4ZOH C;  4DFP A;  2KEY A;  1FIQ A;  3PO5 A;  3M7D A;  1UA0 A;  4DOC A;  3TAN A;  4B9M A;  1XC9 A;  2LM4 A;  2HHQ A;  3AU6 A;  1QSY A;  2FJ6 A;  2VA2 A;  7ICQ A;  3H0R B;  4QZD A;  3SAG A;  4UAS A;  1ZQK A;  1TK0 A;  4DL4 A;  4B9V A;  4C0Z A;  1KW4 A;  3K75 D;  2XGP A;  2LM1 A;  1WG8 A;  4C8N A;  2WF5 A;  3MDA A;  1ZQS A;  3OSP A;  5EE0 A;  3HT3 A;  4U6P A;  9ICS A;  5CEH A;  1PK3 A;  1N5W A;  4M9G A;  1V9P A;  3UPQ A;  2IHM A;  2ZUC A;  1N56 A;  1BGX T;  2E3T A;  2W3R A;  3TQ1 A;  2W03 A;  1NZB A;  5J8Y A;  5DBC A;  3HWT A;  7ICI A;  4UB6 U;  2R8I A;  8ICF A;  8ICN A;  2W9B B;  1XNS A;  7ICH A;  1ZQT A;  3AU2 A;  3SR6 A;  1BPZ A;  2HMX A;  2FLP A;  5ALD A;  2YMP A;  3CYM A;  2HHS A;  3MR5 A;  5DDY A;  4O0I A;  2KE7 A;  4QZG A;  5DLG A;  3PX4 A;  5F9L A;  1LB2 B;  3RR8 A;  3TAD C;  3ZDD A;  4M04 A;  3SQI A;  2LYH A;  1Z00 B;  2F44 A;  2KG5 A;  5ALG A;  1Z00 A;  2JEJ A;  2W55 A;  1T7P A;  8ICW A;  2ZIU A;  2BHN A;  5ALU A;  1XSN A;  1S10 A;  1U4B A;  9ICX A;  9ICH A;  2D3D A;  3KHL A;  4KX5 A;  3GII A;  2EZZ A;  4J9M A;  5AI9 A;  4IQU A;  4LJX A;  4PHP A;  1SKR A;  1ZQV A;  2DF4 B;  4RUC A;  4EYI B;  9ICK A;  4X5V A;  4EBE A;  3QU9 A;  3BZC A;  3C5G A;  2C28 A;  4JV1 A;  1COK A;  4UAZ A;  3QEB Z;  3BQ0 A;  1KFD A;  2EDU A;  1QH9 A;  4PHE A;  4DQI A;  5L1L A;  1N2X A;  1QSS A;  4M9L A;  9ICP A;  2F8K A;  1QQ7 A;  3LVV A;  5KFI A;  5DG9 A;  3PNC A;  5ALK A;  5AI4 A;  2HHX A;  4KLL A;  3JPR A;  1V85 A;  5ALO A;  3S6J A;  1D8Y A;  5L1I A;  3QYP A;  4M47 A;  2W7P A;  3FC4 A;  1Z3E B;  1HJP A;  2VIX A;  4FS1 A;  4R66 A;  8ICV A;  4MFF A;  3VC8 A;  2YQE A;  4DS5 A;  2XC9 A;  2BKE A;  4F93 B;  8ICU A;  1J2M A;  4GIB A;  3V7L A;  8ICJ A;  2JEG A;  5KL1 B;  4FS2 A;  1JRO A;  3BQT A;  2KFN A;  4ELV A;  1U49 A;  4KN4 A;  1TFR A;  5AI6 A;  1Z1V A;  4FO6 A;  3IRU A;  2FMQ A;  4F91 B;  8ICA A;  5KFO A;  4BGD A;  4P4P A;  1HIW A;  2QB0 B;  2P6R A;  1ED1 A;  1COO A;  2W8L A;  1SL0 A;  1B22 A;  4F5O A;  3V7K A;  1A77 A;  5ALM A;  5DB7 A;  1NKB A;  4GXJ A;  1ZQE A;  3AMZ A;  1LKY B;  7ICF A;  5E79 U;  4KLS A;  5CHG A;  2ZIW B;  4RQ6 A;  4PGQ A;  4YR3 A;  1KDH A;  3LWL A;  1X66 A;  3QU2 A;  5AKG A;  1HUZ A;  4I2H A;  3QNM A;  5KFU A;  5J0T A;  2PI5 A;  4RZR A;  2B0C A;  5J0O A;  3PY8 A;  8ICY A;  4DSF A;  5F3X B;  4ED2 A;  5C5J A;  1BPD A;  1B43 A;  3I28 A;  3QUB A;  4NLC A;  4RQ1 A;  1PUZ A;  3WK6 A;  4EEN A;  4O5K A;  3M9O B;  3GDX A;  4NL9 C;  5KFK A;  2HSZ A;  4ECZ A;  4UAR A;  3JPP A;  3EPI A;  3R9K A;  4JWN A;  2KHV A;  3QEA Z;  3QZ8 A;  5JTI A;  4QWC A;  9ICB A;  1JXE A;  1D8B A;  4ECT A;  4B6J A;  4TUQ A;  4LVS A;  3AEV A;  2VKQ A;  1WCL A;  1ARO P;  1K1S A;  4DLE A;  2F8L A;  9ICV A;  2WF7 A;  3TAD A;  2N1R A;  4XA5 A;  5J0U A;  4I2B A;  3BS5 A;  4YMO A;  5J2A A;  1ZXI A;  3RAQ A;  1SV0 A;  3OHA A;  1PZN A;  3JPO A;  4YD1 A;  2W9M A;  5DKW A;  4KLE A;  3M6K A;  3NGD A;  3MBY A;  2ZUD A;  4RQN A;  4C7Z A;  3UMC A;  4CE6 A;  2FPK A;  5AK6 A;  5ALS A;  1NK4 A;  4ACO A;  2VA8 A;  5EE9 A;  3RJG A;  3FM9 A;  1A0P A;  3BDP A;  1QTM A;  4GXK A;  4QZE A;  2MAX A;  2YTU A;  9ICO A;  3NVW A;  1PVR A;  2HCF A;  4JB3 A;  7ICM A;  5J0W A;  4KLH A;  2MUT B;  2CN1 A;  2MUT A;  4Y2X A;  4ECR A;  3WKE A;  1ZQY A;  1TK5 A;  2QKQ A;  2FLN A;  3PML A;  1GO3 F;  1L8O A;  3PR4 A;  1VJ5 A;  1VLB A;  1D9D A;  2XID A;  4UBC A;  3KHG A;  4DL7 A;  2ASD A;  4QZB A;  2KMD A;  4O3R A;  2KZM A;  4O3N A;  1ZJN A;  3T5K A;  3KD3 A;  2G5H B;  4ED6 A;  3RJJ A;  3J81 j;  2O6K A;  1XS9 D;  2EAP A;  7ICR A;  1NK8 A;  2P66 A;  4FZM A;  3SZ2 A;  5DG7 A;  3OGU A;  2NO5 A;  4PH5 A;  4K4I A;  4KLM A;  3BJY A;  3C2M A;  3AUO A;  3AQE A;  2FI1 A;  3FAH A;  1XWL A;  1SL2 A;  3T5L A;  2IHN A;  4KN7 A;  4QWE A;  4DF8 A;  3QZ7 A;  1NK6 A;  3V6J A;  1FO4 A;  8ICL A;  5IIN A;  3EPG A;  4J9O A;  5AI8 A;  2F77 X;  4DL5 A;  1ZQH A;  2R18 A;  5KFM A;  5L1K A;  4RPY A;  4YP3 A;  2J6T A;  5J2G A;  3TI0 A;  4UW9 A;  5J0X A;  1ZQU A;  3RH4 A;  5J2H A;  4UB3 A;  2RP5 A;  1N5X A;  2LHT A;  3DEE A;  3T79 A;  3KZI U;  7ICT A;  2V4Q A;  8ICP A;  1ZQ1 C;  3H7I A;  4IQW A;  2LKY A;  4Z6C A;  2GLE A;  1UT8 A;  2BPG A;  3K1Z A;  2E5S A;  1SWV A;  5J2C A;  4OJO A;  1RZT A;  3WKC A;  1SGG A;  4IC9 A;  2E1E A;  1SKW A;  2ATL A;  4KLG A;  1ZYQ A;  4NLG A;  2WAQ C;  4BDP A;  1TKD A;  4I29 A;  1WUD A;  2PMZ F;  4I28 A;  4GXI A;  1SV4 A;  7ICL A;  1L8L A;  2QB0 A;  4OJ6 A;  1RYS A;  2HDO A;  1O08 A;  4P2H A;  2OCE A;  1X9W A;  5IIL A;  2WF9 A;  3RB6 A;  2H3Z A;  5T14 A;  1IXR A;  4ED8 A;  4NLN A;  3RAX A;  1S97 A;  2KKV A;  4I2J A;  1DGS A;  2BPC A;  2GH1 A;  3QX7 A;  2W43 A;  1K5O A;  1UA1 A;  2DKX A;  2KZ3 A;  2KP7 A;  2AGP A;  1KSP A;  2EZX A;  1TAQ A;  2ALZ A;  3JPS A;  3SV3 A;  4DOA A;  5KG4 A;  2K89 A;  5AK4 A;  1ZRM A;  3V6K A;  5HML A;  3RJE A;  2HBJ A;  2K8B B;  1KFT A;  5ALE A;  8ICB A;  3M9N B;  1ZQQ A;  4MHV A;  2JZB A;  4P0Q B;  2H5X A;  5KFS A;  3Q8K A;  3RR7 A;  4XQ8 A;  4I2G A;  2OM6 A;  5J29 A;  2F1J A;  1X2I A;  3L5K A;  1ZQW A;  4PZN A;  5H2F U;  4RQ8 A;  1JI7 A;  2G0A A;  1ZQO A;  5J2I A;  1F44 A;  4RQ2 A;  1L3V A;  3I1Y A;  2ZIU B;  1P7D A;  3PW2 A;  3D2Q A; 
#chains in the Genus database with same CATH homology
 2OEH A;  5K4L A;  2LM1 A;  2JRZ A;  5CEH A;  2EH9 A;  1IG6 A;  2CXY A;  2LI6 A;  1KN5 A;  1RYU A;  2RQ5 A;  4LJX A;  1KQQ A;  2YQE A;  2KK0 A;  2JXJ A;  1KKX A;  2EQY A;  1C20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...