2JXJA

Nmr structure of the arid domain from the histone h3k4 demethylase rbp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
b'GPLGSRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone demethylase JARID1A
publication title The ARID domain of the H3K4 demethylase RBP2 binds to a DNA CCGCCC motif
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 22
structure length 96
sequence length 96
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jxjA00
1KN5A 5K4LA 5CEHA 2JXJA 1KQQA 2EH9A 2OEHA 2CXYA 1IG6A 1C20A 1RYUA 2RQ5A 2LM1A 2KK0A 2EQYA 2JRZA 4LJXA 1KKXA 2LI6A 2YQEA
chains in the Genus database with same CATH superfamily
2RRDA 2FJ6A 3B0XA 4KLDA 2NYVA 1LVHA 2VKQA 4YD1A 1PVRA 2BCRA 5KFXA 4TUQA 2AGOA 2C2EA 2WTFA 4NM1A 8ICIA 2PMZF 4QW8A 1L8LA 5AKEA 2E1FA 4RUCA 1T3NA 4O5CA 1COKA 2HHSA 5BOMA 3WKBA 1U9LA 5J29A 1NZPA 1Z00B 4QJFB 1RQNA 1UHUA 4US9A 3ETLA 4QIWC 1TE2A 1A0PA 4HAIA 1RXVA 2G09A 4UAZA 5KT4A 2HOQA 3S6JA 2H3ZA 4ECZA 1L7MA 3HJEA 3M7DA 1DK3A 3I76A 2JZBA 3WK7A 8ICPA 3F5AA 2LI6A 4IQVA 1ZQQA 2W8LA 5C5JA 2PI5A 2PMZC 5DB6A 1NKBA 4BWJA 5EWEA 2B6GA 4DQIA 2ZTEA 7ICNA 4DLEA 9ICLA 2UVRA 4PGYA 2ZTCA 5DQIA 4X5VA 7ICRA 1RYUA 4QNLA 5ALEA 1NK4A 3UXOA 4DQSA 1HEKA 3ISDA 3PO4A 1CI4A 4ECWA 4KLTA 2BQRA 2K4EA 4YQWA 4Y2UA 4IQUA 3FM9A 3JPQA 2KSOA 9ICIA 5AK6A 5KFRA 4LZGA 2BHNA 2C2RA 1SZHA 1XSNA 1KFTA 4FZLA 1PUZA 4EZ9A 3KZIU 2E1EA 2GH1A 5DG7A 1S8OA 2YQEA 4OJLA 7ICGA 1ZQZA 1CEZA 2WF5A 1TK5A 5AK5A 3R9KA 4B9LA 5JU5A 3KFUF 1BPDA 1ZQEA 3H0LB 1RQLA 2FLLA 5KFJA 1ZQWA 2PXIA 3OTQA 1UA1A 4ED3A 2KD1A 5AKXA 4KLHA 3MR2A 4F50A 3Q8LA 5D4BA 4IL6U 4YFKA 1Z4NA 1U4BA 1ZQNA 1TVAA 1PZNA 4KITB 4KLJA 4TURA 2F76X 1SV0A 1QSLA 2ZIUA 3RJEA 5E79U 3UM9A 1S10A 3SV3A 4EELA 2BPCA 4FFDA 2BDPA 4EX7A 1KN5A 4MFAA 4IRCA 1ZQRA 4PHAA 1L6NA 2OEHA 1B4FA 1URJA 2FLNA 3ZDDA 3KBBA 1S77D 1BPXA 3NGDA 3KHGA 1ED1A 4UB1A 2HBLA 1Z3EB 2RQ5A 3LDAA 4YXJA 2V9WA 2A19A 3MR3A 4B9TA 2BCSA 3V7LA 2IOFA 4GXIA 1S0MA 1DOQA 5J2FA 8ICEA 2JXJA 2FPKA 4DFDA 4ECUA 4KLUA 3BZKA 3PVXA 5DLFA 1QQ5A 3ISBA 3WKEA 5JRTA 4RQ5A 5KFZA 9ICOA 4KX5A 2ASJA 9ICFA 1UCVA 5EE9A 4PHPA 3RB4A 1D8BA 3AQFA 4LZDA 4O3NA 1L7NA 3SMVA 3KHRA 3EW9A 4GXJA 2DWQA 5DG9A 2WB1F 3AU6A 1ZQGA 7ICOA 4OJ5A 2G07A 1B0XA 3RR7A 4UAUA 2JEFA 1NJWA 1KDHA 2XY7A 2RDJA 5AKGA 2ISOA 4NLBA 4DQQA 1N62A 1CUKA 3LVWA 5DDYA 2JMGA 2XICA 4RPXA 3L3FX 5KFEA 4RNNA 2PKEA 3ICXA 3PW2A 1LV5A 7ICMA 2BKEA 1JX4A 2DQNB 4FBTA 3IV6A 2HHUA 5EE0A 1B22A 1LKYA 2HHTA 2B21A 3HKZC 5J2DA 8ICWA 9ICWA 4RQNA 2KIWA 3QZ8A 4PHDA 1ZYQA 4RU9A 4DLGA 3V6HA 4U6PA 3PR5B 4O3RA 2WB1C 2YTUA 2XC9A 2VA2A 4F5QA 5AKLA 1XU4A 1NJYA 2A1AA 2VANA 4RQ6A 4C8KA 2BR0A 4ELUA 4EBEA 5ALSA 5KG0A 9ICHA 1KKXA 4YN4A 4RZRA 4J9OA 4ED1A 5ALPA 3F2DA 4FO6A 1NNLA 1JIHA 3M9MB 3UMCA 2ZIVA 3F53A 3JPSA 4KMUA 1SV4A 2EZZA 3T5KA 4BXOA 1N61A 4FZNA 3PO5A 5CB1A 4PH5A 5KAFU 5DQGA 4DO9A 2ESEA 3SZ2A 4JK1A 5AICA 2BDUA 2H3VA 2KVCA 4P4OA 2Y1JA 3PW5A 3FDSA 1SKSA 3NS1A 5KG1A 1ZQBA 2IHMA 1ECWA 3OJSA 1NZBA 4XQ8A 2LM1A 4F4KA 4KN4A 3NVWA 3HILA 1X2IA 3QU4A 1ZQKA 3ZD9A 4KLQA 1F44A 3BS5B 4BWMA 4RPZA 3TFSA 9ICJA 4F5RA 5H2FU 3QEBZ 5ALIA 4RQ1A 3EWAA 4EBCA 1BNOA 9ICNA 5CJ7A 2JHDA 5HMMA 3C5FA 1ZD3A 4YVZA 3LYSA 3SAGA 5GTHU 3WKCA 2RDIA 3AQEA 4P0PA 5KFNA 2ZJ5A 3RBDA 3H8SA 3N7SC 5KG6A 4F91B 1VLBA 1PVPA 2AQ0A 5J8YC 2PFQA 2XO7A 4NL9C 3KOOA 2VJ4A 4EEKA 2XVTA 1KTQA 1MA7A 1HJPA 5J0SA 5D49A 1Z1VA 2BPGA 3ONNA 5AM3A 4ED0A 5J2EA 1TAMA 3GIJA 1ZRMA 3GV8B 4ZOHC 4F2RA 4DSLA 3SQIA 4I2BA 1Z4OA 3C28A 3SV4A 3M1YA 1ZOLA 2JZBB 5AK3A 4KLGA 3MDCA 4K4HA 2BCQA 4DF4A 3BS7A 4BGDA 1DRGA 2ISPA 1K5OA 4IQTA 3V7JA 2KEYA 3RH5A 3C1ZA 1S0NA 1Q46A 1ZD4A 3PMLA 2KN7A 4QZBA 4KTQA 4R64A 1J97A 1IM4A 4Y2TA 4B9UA 4J9MA 1L7PA 2FI1A 1XS9D 2P35A 4OJPA 4ELVA 2KNJA 2KSOB 2K8AA 2A1JA 8ICLA 3HX0A 1X9XA 3QU2A 3GDXA 1DGSA 2NRWA 2CRXA 5DQHA 3MGIA 3BZCA 1ZQIA 3N28A 3ZDCA 5J0OA 4R65A 1Q8KA 3NTUA 3MGVA 1NK7A 4P4PA 3CRXA 2G0AA 4CE6A 5J0TA 1X9WA 1NK9A 3F2CA 5AKYA 2KZ3A 4LVSA 4F72A 1SIJA 5KFSA 2Z7JA 2WFAA 2W9CA 4GC6A 5JUMA 2KTQA 3AL0B 3M9OB 2QLTA 3TANA 4UB6U 4KLLA 2LKYA 4EYHB 4UW9A 1X9MA 2VIXA 5TISU 4DWIA 5G5GA 3SR6A 3PX6A 5AK4A 4MFCA 2ZIUB 2NRZA 1EXNA 7ICPA 3TI0A 9ICTA 1LB2B 4YCXA 5DB8A 1QQ6A 2YX8A 3NVZA 4OO1J 1NK5A 3THVA 3IN5A 1L3TA 3WKDA 4QIWF 1RYSA 2UVVA 2VA8A 2QB1A 4M6WA 4NXZA 4DOBA 2QARA 4ICAA 4JV0A 3U26A 1UA0A 2JV3A 2E3TA 4RQ4A 2BQUA 2IBKA 2Y9UA 2W54A 3TKAA 4O3SA 2EZXA 4DL6A 4DSKA 4P2HA 3KZXA 4QWBA 5AM4A 5KFFA 2V4QA 4ED2A 1BNPA 4ECVA 4DQPA 4DFMA 5AM0A 4EYIB 9ICCA 2JEIA 1HIWA 3C2LA 2BCVA 1ZQMA 5AKHA 5KG3A 4QWEA 3SAFA 2NO4A 5ALDA 2HW3A 5DBCA 5KL1B 3UQ2A 9ICKA 2AU0A 2YN4A 2K4HA 4G3IA 1X6JA 5AKIA 5KFUA 4B6JA 2EDUA 5JTIA 3G6YA 2XY6A 4MF2A 3PV8A 1KEJA 4I2FA 3H40A 4GC7A 1WCLA 1MC8A 2E8PA 4J9SA 4K4IA 4F2SA 5ALJA 2F8LA 8ICHA 1TK8A 4UB4A 2IHNA 1B43A 4BJQA 4JV1A 4NJ8A 3QU5A 3QUQA 5B66U 5ALFA 3ZI4A 3F5EA 1BGXT 3PR4A 1LKYB 1NJZA 5DGBA 1RPLA 3AMZA 4ED6A 3HW8A 1MQ2A 5J2KA 1FFVA 4UQGA 1RDFA 5AI8A 4RNOA 3QXGA 5CR0A 3V72A 5KFPA 1ZETA 3MGHA 3Q8KA 3T3FA 1P7DA 2PFOA 2FMSA 4UAVA 4YMNA 1Y88A 4F92B 3C5GA 4TUSA 5ALQA 2B0CA 1KL9A 5KFLA 4GLXA 3QE9Y 5L1IA 3H8MA 5KFAA 2MUTA 4R66A 4NLZA 2CPRA 4Y2XA 4J9PA 1YT3A 2DUYA 2DPJA 2M0NA 5AM5A 2ASDA 4O3QA 2DFLA 9ICRA 2LPEA 4RUAA 4G9BA 5KFIA 1ZQTA 4KN7A 2R8HA 1XO1A 2ZIVB 1PK1A 4Y2RA 1S76D 2F3NA 2W7OA 5CA7A 3MFIA 4BXOB 3C1YA 2D3DA 3MR6A 2MU2A 4F71A 2R8GA 5KG5A 1N48A 3GV7B 4IR9A 4EBDA 2WAQC 4XUSA 4Q45A 1KFSA 3E58A 4KLOA 1JXLA 5IIKA 5HP4A 1A76A 2MA1A 4Y2YA 4JV2A 4DEZA 1L7OA 4FE3A 5ALHA 2XIDA 4ECTA 4KLEA 1L5UA 1XO0A 2KP7A 1BPEA 4Z6EA 2HMXA 1SZPA 3QUBA 2MAXA 4CGZA 3GILA 4YMOA 4QZHA 3TARA 3QU9A 3TADC 4LJXA 1L3SA 2KHVA 4F5OA 3RAXA 2IOFK 3GIMA 3TACB 4C8LA 4NLGA 3Q8RB 4NLCA 5IILA 3V6KA 4M9JA 4P0PB 1MN8A 3PW7A 2E8MA 2R8IA 3HKZF 8ICJA 4C8NA 2JRZA 5KFDA 2FPMA 2I5HA 2D6FC 5ALOA 3O0FA 4B9NA 8ICFA 2F77X 2G5HB 5ALLA 2ZIXA 3B9JA 3Q8MA 1QSSA 3GFKB 1UT5A 4YR2A 1ZD5A 1V9PA 4GXKA 3BQTA 1BPZA 1ZQCA 8ICGA 8ICKA 1ZJMA 1XC9A 9ICPA 2KIVA 4F5NA 1S0OA 4JB3A 1SL1A 3CP8A 4DOAA 9ICXA 3T79A 5CEHA 5AI6A 2W11A 1BVSA 2BCUA 1Z1BA 1WYGA 1NK6A 2KOBA 1A6SA 2OYYA 5L1KA 2WF8A 2ES6A 4IC9A 4QWDA 3RAQA 2AGQA 2LBOA 3TAQA 1DXSA 3Q8QB 4PPXA 2HSZA 5J0XA 2JH7A 4DCCA 2H3QA 2J6UA 5HR7A 4UAYA 4UAWA 4J9RA 2FDRA 2H5XA 2CXYA 2A1JB 2G08A 4NWIA 4B9SA 1IIPA 1X66A 3QZ7A 2W3RA 5CHGA 1TAUA 5ALGA 3IG5A 1X6IA 3RJJA 4QZFA 1FIQA 3FC4A 7ICVA 4I2JA 1U49A 4C4RA 3IP4B 2NV3A 3OHBA 1JUDA 1N5WA 2HHQA 1D9DA 5EWFA 4O3PA 3ALRA 2HHVA 1IG6A 9ICQA 1V85A 1N63A 2F2AB 2DPIA 5KG4A 2W9AA 3DDHA 7ICUA 5L1JA 4GFJA 2Y9TA 3D6JA 4R63A 3K4GA 1ZRNA 2KJ9A 5J0PA 3JPOA 1TFRA 3ED5A 4UASA 3FYHA 2C28A 2R18A 2BZFA 2D8CA 1TK0A 1XSPA 2KFZA 1L3VA 5AM1A 4ECQA 4Z6DA 5HR6A 3EYZA 1XNSA 4CCHA 3RBEA 2ZTDA 4OCZA 3Q8PB 3RJHA 4USAA 3M6ZA 5AI9A 2J6SA 1N2XA 3G6VA 1ZQ1C 1YZ6A 3C23A 4M6WB 5J0WA 5KFYA 1UT8A 2XGQA 2QARB 4M9LA 3PX4A 1SGGA 3BQ7A 2YMPA 3HP6A 2I1QA 2M9NA 2E8OA 8ICTA 2RLTA 5IIJA 2XGPA 3KHHA 2Y0SF 4MEYA 3SYZA 2N1RA 1X40A 2UVWA 5ALWA 3WKAA 5AM2A 4UARA 5ALUA 2GO7A 3N7PD 2EZYA 1U45A 2AH5A 2K89A 5KFQA 1ZQDA 4A8EA 3H8WA 3H4BA 4CF4A 4MFFA 2FLPA 3C2MA 3JPRA 2OCEA 2OXOA 2KJ5A 2H3FA 4EEYA 4ED8A 4RQ7A 2WF9A 2EANA 3ZDAA 1U47A 3PX0A 2P66A 1QTMA 5DB7A 4J9NA 7ICSA 8ICYA 4OD0A 3PNCA 3F2BA 2XI9A 4YR3A 5KG7A 1N60A 2ZUDA 1F0MA 4TQRA 2Y0SC 5K4LA 3IG8A 5AIBA 3NRZA 4RQ0A 7ICIA 4KLFA 2O6KA 4DL2A 3NVYA 3NVVA 2IOHA 1U48A 1T3QA 3NRWA 4C0ZA 2QB0A 4UB8U 3RJFA 5IINA 4I2DA 3L5KA 7ICTA 3KHLA 2OM6A 4RQ2A 3AEVA 4Y2JA 4P0QA 4UB3A 4Q8EA 4ED7A 4QZIA 3GQCA 1O03A 4PZOA 9ICGA 2LHTA 4AYBF 5L1MA 8ICXA 1S97A 5KFOA 3QX7A 4CF5A 3SENA 8ICOA 7ICFA 5KFMA 3AU2A 3CYMA 2MUTB 7ICHA 5KT3A 1NOMA 2WF6A 1ZQSA 2ZUBA 2ALZA 2ZJAA 5TZVA 1RM6C 1CRXA 2PFPA 2XCAA 3V6JA 2W9BA 4UB5A 3PSIA 2E5SA 2ZUCA 3QU7A 2HHWA 7ICJA 4PGQA 2F1JA 1NKCA 9ICAA 3TAPA 4RQ8A 2BPFA 1PK1B 1OW5A 4DL3A 1SV0C 3N4MB 4KMOB 1ZQYA 4O5EA 4KLIA 1SXDA 2LYBA 4M9NA 4BX9C 4C8MA 3RB6A 4AYBC 5GTIU 5ALMA 2KV2A 2RP5A 2P6UA 2AGPA 3KTQA 2HI0A 2FPLA 4YG2A 2ASLA 1ZQHA 4I2GA 4OJOA 3LK9A 4F4ZA 3NUQA 4JWNA 4J9QA 4M04A 4C8OA 1S0VA 4Y2SA 5IIIA 5J2IA 4ECYA 1K1SA 3LWLA 5J2JA 4DSFA 5ALVA 4ZH4A 2QKQA 3IDWA 4PL2A 9ICSA 2OH2A 3Q8SB 3OSPA 2KKVA 1RZTA 1RG6A 4F5PA 2OWOA 3M6KA 4QW9A 5KT7A 5L1LA 1Q3UA 2I9GA 2KMDA 2YB4A 1O08A 4QZ8A 4EZ6A 3K1ZA 2KKPA 4IRKA 5ALNA 5DG8A 1SL0A 2E8NA 2H3IA 4YMMA 3C21A 3T5HA 2F1IA 1HUZA 5KFKA 2PFNA 1KRPA 4DQRA 3RH6A 5AI5A 5ALYA 1S5LU 1L3UA 2YMMA 4PGXA 5L9XA 1T94A 5AI0A 3E2EA 3CNHA 3RRGA 2NRVA 3D2NA 2ZIXB 1KSPA 2K4PA 3IM1A 4HYKA 3AM9A 4CF3A 3A0BU 2JGAA 4NV0A 2DGZA 3WK9A 3RRHA 2WF7A 4K4GA 4C4TA 1X9SA 5HNKA 5T14A 3TQ1A 2KZZA 2KHQA 4QZAA 4R8UA 2NRTA 2RHFA 3TFRA 5J8YA 3IHQB 4MEXA 5ALTA 4NL9A 4J03A 4XRHA 5J2BA 2ZIWA 2HVIA 3SI8A 1AQ6A 4NLKA 4C7YA 4M47A 3RJKA 2YMQA 2W9MA 3M8RA 5AKJA 1JROA 4NM2A 2JEGA 3B0YA 4F4WA 2AJQA 3DV9A 1XWLA 3BQ1A 4PL1A 2FE9A 4FS2A 4KLMA 3NASA 2VA3A 4B9MA 4E0DA 1QLNA 2WAQF 8ICVA 1A77A 2ODGA 5IIMA 4J9LA 3EPGA 3UQ0A 3UXNA 2HVHA 5J0RA 4QWCA 4AP9A 2I6XA 4C4SA 1L8OA 3OSNA 3WK8A 4EX6A 1PVQA 3PY8A 3RB0A 1ZQAA 1XSLA 3MBYA 2R8KA 5D46A 3M8SA 1ZD2P 5KFTA 1Q3VA 2KG5A 5KTQA 1F5SA 3SAHA 4RQ3A 5KFCA 1N5XA 4NY8A 2W55A 4KLSA 4DFJA 1K1QA 2LYHA 1M6YA 3PMNA 5KFHA 1OXJA 5B5EU 5AI4A 4TUPA 1VJ5A 4YP3A 3HT3A 9ICVA 5J0UA 2G5IB 2NRXA 4XA5A 3H4DA 8ICAA 4IRDA 1D8YA 3RF9A 8ICUA 2KK0A 9ICEA 4GIBA 4Y2QA 4DOCA 3VCBA 2KZMA 2OHFA 9ICMA 4RNMA 2YB1A 5AIAA 3H0RB 4ACOA 5KAIU 4MHVA 1V97A 2F1HA 5ALRA 2J6TA 1JXEA 2KJ8A 3PSTA 1SL2A 3PZPA 2W43A 3J81j 1RYRA 3WU2U 4DSEA 1FO4A 2BGWA 2FMPA 4DFPA 1MQ3A 3MFHA 1KQQA 4B9VA 2XY5A 4NLNA 1SWWA 3G6XA 1D8LA 3LVVA 2IA6A 2EAOA 4F4XA 3GIKA 1TV9A 3E0FA 3I1YA 1QQ7A 7ICLA 3L4PA 4QZGA 4DL4A 2HBMA 5EWGA 1JALA 3I28A 5KT6A 2JR5A 5DKWA 3OGUA 3QEAZ 1BPBA 2K4IA 4FZMA 4YXMA 2W04A 1Z00A 3ETRA 3JPTA 1KLNA 4Y2PA 2AXTU 1YZ7A 3KKAC 3QNMA 3BQ0A 2FMQA 4PJ0U 9ICBA 4UBBA 2W3SA 3AN1A 1ZQJA 4DL5A 4O5KA 4UBCA 3HRDD 4Y2VA 2NO5A 3GU3A 2QB0B 7ICKA 3ORYA 2K60A 2EAPA 1NJXA 1SB3C 3OPXA 4IR1A 1SWVA 4P0QB 2P6RA 3C29A 3A0HU 2K8BB 2WHEA 3OHAA 8ICCA 2CN1A 3D2SA 5J2GA 4Q43A 3DEEA 1D9FA 5IIOA 5KFGA 7ICEA 3WK4A 4EENA 4KX3A 1ZQPA 2HCFA 2VJ5A 1MSWD 1HUOA 1NK0A 1VDVA 2DKZA 3UMBA 3JPPA 5J2HA 1KBUA 4Q8FA 1JRPA 4J9KA 1WUDA 1OUQA 2KE7A 5AHXA 5J2AA 2DBYA 4M0AA 8ICZA 1FEZA 3LWMA 4DS5A 5F9LA 2W9BB 3H7IA 4P4MA 1IXRA 5KG2A 1GO3F 3KD3A 5F3XB 5KFBA 4Z6FA 4I2AA 4ECXA 4I2EA 3RB3A 1JI7A 1ZJNA 1ZQFA 2MSNA 2W9CB 4QZEA 1KFDA 2ZG6A 3K75D 4CDGA 3GV5B 2HOFA 5A0LA 5HHHA 2C2DA 8ICSA 4DS4A 4F93B 2R8JA 3D2QA 2BQ3A 4M9HA 4UB2A 3H0MB 5KT2A 5J2CA 4CNQA 1Z19A 3BJYA 1PK3A 1WG8A 5KFWA 2DL0A 3HWTA 1X42A 2L5YA 3MC1A 4I2CA 4DF8A 2EH9A 4O0IA 1UPHA 4IS7A 3MDAA 2AHOB 5EE1A 2W7PA 2Q4TA 2ZXIA 2G06A 2IMWP 4RQMA 8ICBA 3PSFA 5KNIA 4F8RA 2AQ4A 5EOZA 5BPCA 5EE3A 5CP2A 3RH4A 4I29A 2LMRA 3ZD8A 5AKZA 3MR5A 1NKEA 5AKKA 3SEIA 5C0YA 1ZQVA 3QYPA 2KICA 1DGJA 1J2NA 4WJ3B 5F9NA 3WK6A 5ALZA 2GWSA 2HBKA 1ZQXA 2HDOA 2W03A 2V4RA 4TQSA 5KFVA 3TADA 4ELTA 3UMGA 3V7KA 1T4GA 4O3MA 3M9NB 3RFAA 2ZXHA 5J0YA 3PW4A 1C20A 4DSJA 4QWAA 4FBUA 3EPIA 3AUOA 5CRXA 4Z6CA 2LYAA 4M2YA 1T7PA 1JN3A 4U7CA 4R8UB 4RT2A 1QSYA 1TKDA 2KVSA 1QCKA 3RJIA 1NI3A 2ZIWB 1WWUA 1QH9A 5DBBA 2YY6A 5HMLA 3ZDEA 4US8A 4F3OA 1V38A 1KW4A 1RXWA 5KT5A 2A3VA 3WK5A 4I27A 2W8KA 2YMLA 5BOLA 3ZDBA 5ALXA 5ALKA 5DGAA 3VC8A 1IV8A 8ICQA 3UPQA 3SD7A 3KKAA 4I2HA 3EZ5A 1DK2A 3FAHA 1ZQLA 4DFKA 5KL8B 3RR8A 1N56A 1BPYA 3ISCA 5DDMA 3BDPA 3RTVA 4PZNA 3BQ2A 2XCPA 2UVUA 4YR0A 4IQWA 5HHIA 4PHEA 1UQVA 4JUZA 2Y1IA 1ZXIA 1T8EA 2HHXA 4ECRA 4QZDA 3QUCA 2HOIA 7ICQA 1JMSA 1SKRA 3T5LA 5DLGA 4Q44A 3GZFA 1NK8A 2LM4A 2JH1A 3CW2C 4C7ZA 4YD2A 1AROP 3OJUA 2F8KA 3EUB2 4DSIA 3N97B 1WCNA 4MF8A 1ZQOA 1ZQUA 4JMUA 4C80A 2DKXA 5J0QA 1S9FA 3IRUA 3T5JA 4QZ9A 4DL7A 3UXPA 3HPOA 2JEJA 4BUGA 4M9GA 4RPYA 1SXEA 4RT3A 5DB9A 5DBAA 3GIIA 1WWVA 2PI4A 3PSPA 4OJ6A 2ATLA 3C2KA 2ZJ8A 1FFUA 2C22A 2DF4B 1H38A 1C7YA 4ECSA 4FS1A 8ICNA 2MRLA 4UATA 4JWMA 4O3OA 2F44A 2EQYA 3PW0A 1COOA 2GOLA 3QUTA 1SKWA 8ICMA 5FP0A 4I2IA 3RJGA 3BS5A 1J2MA 9ICUA 5CWRA 2K8CB 4BDPA 5G5HA 4I28A 4F4YA 2EAMA 4O9MA 2HBJA 3H8JA 3N7RC 3JPNA 3K1RB 2Q0ZX 4QZCA 8ICRA 2KFNA 3MABA 4CRXA 2GLEA 1TAQA
chains in the Genus database with same CATH topology
1KN5A 5K4LA 5CEHA 2JXJA 1KQQA 2EH9A 2OEHA 2CXYA 1IG6A 1C20A 1RYUA 2RQ5A 2LM1A 2KK0A 2EQYA 2JRZA 4LJXA 1KKXA 2LI6A 2YQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  5K4L A;  5CEH A;  2JXJ A;  1KQQ A;  2EH9 A;  2OEH A;  2CXY A;  1IG6 A;  1C20 A;  1RYU A;  2RQ5 A;  2LM1 A;  2KK0 A;  2EQY A;  2JRZ A;  4LJX A;  1KKX A;  2LI6 A;  2YQE A; 
#chains in the Genus database with same CATH topology
 2RRD A;  2FJ6 A;  3B0X A;  4KLD A;  2NYV A;  1LVH A;  2VKQ A;  4YD1 A;  1PVR A;  2BCR A;  5KFX A;  4TUQ A;  2AGO A;  2C2E A;  2WTF A;  4NM1 A;  8ICI A;  2PMZ F;  4QW8 A;  1L8L A;  5AKE A;  2E1F A;  4RUC A;  1T3N A;  4O5C A;  1COK A;  2HHS A;  5BOM A;  3WKB A;  1U9L A;  5J29 A;  1NZP A;  1Z00 B;  4QJF B;  1RQN A;  1UHU A;  4US9 A;  3ETL A;  4QIW C;  1TE2 A;  1A0P A;  4HAI A;  1RXV A;  2G09 A;  4UAZ A;  5KT4 A;  2HOQ A;  3S6J A;  2H3Z A;  4ECZ A;  1L7M A;  3HJE A;  3M7D A;  1DK3 A;  3I76 A;  2JZB A;  3WK7 A;  8ICP A;  3F5A A;  2LI6 A;  4IQV A;  1ZQQ A;  2W8L A;  5C5J A;  2PI5 A;  2PMZ C;  5DB6 A;  1NKB A;  4BWJ A;  5EWE A;  2B6G A;  4DQI A;  2ZTE A;  7ICN A;  4DLE A;  9ICL A;  2UVR A;  4PGY A;  2ZTC A;  5DQI A;  4X5V A;  7ICR A;  1RYU A;  4QNL A;  5ALE A;  1NK4 A;  3UXO A;  4DQS A;  1HEK A;  3ISD A;  3PO4 A;  1CI4 A;  4ECW A;  4KLT A;  2BQR A;  2K4E A;  4YQW A;  4Y2U A;  4IQU A;  3FM9 A;  3JPQ A;  2KSO A;  9ICI A;  5AK6 A;  5KFR A;  4LZG A;  2BHN A;  2C2R A;  1SZH A;  1XSN A;  1KFT A;  4FZL A;  1PUZ A;  4EZ9 A;  3KZI U;  2E1E A;  2GH1 A;  5DG7 A;  1S8O A;  2YQE A;  4OJL A;  7ICG A;  1ZQZ A;  1CEZ A;  2WF5 A;  1TK5 A;  5AK5 A;  3R9K A;  4B9L A;  5JU5 A;  3KFU F;  1BPD A;  1ZQE A;  3H0L B;  1RQL A;  2FLL A;  5KFJ A;  1ZQW A;  2PXI A;  3OTQ A;  1UA1 A;  4ED3 A;  2KD1 A;  5AKX A;  4KLH A;  3MR2 A;  4F50 A;  3Q8L A;  5D4B A;  4IL6 U;  4YFK A;  1Z4N A;  1U4B A;  1ZQN A;  1TVA A;  1PZN A;  4KIT B;  4KLJ A;  4TUR A;  2F76 X;  1SV0 A;  1QSL A;  2ZIU A;  3RJE A;  5E79 U;  3UM9 A;  1S10 A;  3SV3 A;  4EEL A;  2BPC A;  4FFD A;  2BDP A;  4EX7 A;  1KN5 A;  4MFA A;  4IRC A;  1ZQR A;  4PHA A;  1L6N A;  2OEH A;  1B4F A;  1URJ A;  2FLN A;  3ZDD A;  3KBB A;  1S77 D;  1BPX A;  3NGD A;  3KHG A;  1ED1 A;  4UB1 A;  2HBL A;  1Z3E B;  2RQ5 A;  3LDA A;  4YXJ A;  2V9W A;  2A19 A;  3MR3 A;  4B9T A;  2BCS A;  3V7L A;  2IOF A;  4GXI A;  1S0M A;  1DOQ A;  5J2F A;  8ICE A;  2JXJ A;  2FPK A;  4DFD A;  4ECU A;  4KLU A;  3BZK A;  3PVX A;  5DLF A;  1QQ5 A;  3ISB A;  3WKE A;  5JRT A;  4RQ5 A;  5KFZ A;  9ICO A;  4KX5 A;  2ASJ A;  9ICF A;  1UCV A;  5EE9 A;  4PHP A;  3RB4 A;  1D8B A;  3AQF A;  4LZD A;  4O3N A;  1L7N A;  3SMV A;  3KHR A;  3EW9 A;  4GXJ A;  2DWQ A;  5DG9 A;  2WB1 F;  3AU6 A;  1ZQG A;  7ICO A;  4OJ5 A;  2G07 A;  1B0X A;  3RR7 A;  4UAU A;  2JEF A;  1NJW A;  1KDH A;  2XY7 A;  2RDJ A;  5AKG A;  2ISO A;  4NLB A;  4DQQ A;  1N62 A;  1CUK A;  3LVW A;  5DDY A;  2JMG A;  2XIC A;  4RPX A;  3L3F X;  5KFE A;  4RNN A;  2PKE A;  3ICX A;  3PW2 A;  1LV5 A;  7ICM A;  2BKE A;  1JX4 A;  2DQN B;  4FBT A;  3IV6 A;  2HHU A;  5EE0 A;  1B22 A;  1LKY A;  2HHT A;  2B21 A;  3HKZ C;  5J2D A;  8ICW A;  9ICW A;  4RQN A;  2KIW A;  3QZ8 A;  4PHD A;  1ZYQ A;  4RU9 A;  4DLG A;  3V6H A;  4U6P A;  3PR5 B;  4O3R A;  2WB1 C;  2YTU A;  2XC9 A;  2VA2 A;  4F5Q A;  5AKL A;  1XU4 A;  1NJY A;  2A1A A;  2VAN A;  4RQ6 A;  4C8K A;  2BR0 A;  4ELU A;  4EBE A;  5ALS A;  5KG0 A;  9ICH A;  1KKX A;  4YN4 A;  4RZR A;  4J9O A;  4ED1 A;  5ALP A;  3F2D A;  4FO6 A;  1NNL A;  1JIH A;  3M9M B;  3UMC A;  2ZIV A;  3F53 A;  3JPS A;  4KMU A;  1SV4 A;  2EZZ A;  3T5K A;  4BXO A;  1N61 A;  4FZN A;  3PO5 A;  5CB1 A;  4PH5 A;  5KAF U;  5DQG A;  4DO9 A;  2ESE A;  3SZ2 A;  4JK1 A;  5AIC A;  2BDU A;  2H3V A;  2KVC A;  4P4O A;  2Y1J A;  3PW5 A;  3FDS A;  1SKS A;  3NS1 A;  5KG1 A;  1ZQB A;  2IHM A;  1ECW A;  3OJS A;  1NZB A;  4XQ8 A;  2LM1 A;  4F4K A;  4KN4 A;  3NVW A;  3HIL A;  1X2I A;  3QU4 A;  1ZQK A;  3ZD9 A;  4KLQ A;  1F44 A;  3BS5 B;  4BWM A;  4RPZ A;  3TFS A;  9ICJ A;  4F5R A;  5H2F U;  3QEB Z;  5ALI A;  4RQ1 A;  3EWA A;  4EBC A;  1BNO A;  9ICN A;  5CJ7 A;  2JHD A;  5HMM A;  3C5F A;  1ZD3 A;  4YVZ A;  3LYS A;  3SAG A;  5GTH U;  3WKC A;  2RDI A;  3AQE A;  4P0P A;  5KFN A;  2ZJ5 A;  3RBD A;  3H8S A;  3N7S C;  5KG6 A;  4F91 B;  1VLB A;  1PVP A;  2AQ0 A;  5J8Y C;  2PFQ A;  2XO7 A;  4NL9 C;  3KOO A;  2VJ4 A;  4EEK A;  2XVT A;  1KTQ A;  1MA7 A;  1HJP A;  5J0S A;  5D49 A;  1Z1V A;  2BPG A;  3ONN A;  5AM3 A;  4ED0 A;  5J2E A;  1TAM A;  3GIJ A;  1ZRM A;  3GV8 B;  4ZOH C;  4F2R A;  4DSL A;  3SQI A;  4I2B A;  1Z4O A;  3C28 A;  3SV4 A;  3M1Y A;  1ZOL A;  2JZB B;  5AK3 A;  4KLG A;  3MDC A;  4K4H A;  2BCQ A;  4DF4 A;  3BS7 A;  4BGD A;  1DRG A;  2ISP A;  1K5O A;  4IQT A;  3V7J A;  2KEY A;  3RH5 A;  3C1Z A;  1S0N A;  1Q46 A;  1ZD4 A;  3PML A;  2KN7 A;  4QZB A;  4KTQ A;  4R64 A;  1J97 A;  1IM4 A;  4Y2T A;  4B9U A;  4J9M A;  1L7P A;  2FI1 A;  1XS9 D;  2P35 A;  4OJP A;  4ELV A;  2KNJ A;  2KSO B;  2K8A A;  2A1J A;  8ICL A;  3HX0 A;  1X9X A;  3QU2 A;  3GDX A;  1DGS A;  2NRW A;  2CRX A;  5DQH A;  3MGI A;  3BZC A;  1ZQI A;  3N28 A;  3ZDC A;  5J0O A;  4R65 A;  1Q8K A;  3NTU A;  3MGV A;  1NK7 A;  4P4P A;  3CRX A;  2G0A A;  4CE6 A;  5J0T A;  1X9W A;  1NK9 A;  3F2C A;  5AKY A;  2KZ3 A;  4LVS A;  4F72 A;  1SIJ A;  5KFS A;  2Z7J A;  2WFA A;  2W9C A;  4GC6 A;  5JUM A;  2KTQ A;  3AL0 B;  3M9O B;  2QLT A;  3TAN A;  4UB6 U;  4KLL A;  2LKY A;  4EYH B;  4UW9 A;  1X9M A;  2VIX A;  5TIS U;  4DWI A;  5G5G A;  3SR6 A;  3PX6 A;  5AK4 A;  4MFC A;  2ZIU B;  2NRZ A;  1EXN A;  7ICP A;  3TI0 A;  9ICT A;  1LB2 B;  4YCX A;  5DB8 A;  1QQ6 A;  2YX8 A;  3NVZ A;  4OO1 J;  1NK5 A;  3THV A;  3IN5 A;  1L3T A;  3WKD A;  4QIW F;  1RYS A;  2UVV A;  2VA8 A;  2QB1 A;  4M6W A;  4NXZ A;  4DOB A;  2QAR A;  4ICA A;  4JV0 A;  3U26 A;  1UA0 A;  2JV3 A;  2E3T A;  4RQ4 A;  2BQU A;  2IBK A;  2Y9U A;  2W54 A;  3TKA A;  4O3S A;  2EZX A;  4DL6 A;  4DSK A;  4P2H A;  3KZX A;  4QWB A;  5AM4 A;  5KFF A;  2V4Q A;  4ED2 A;  1BNP A;  4ECV A;  4DQP A;  4DFM A;  5AM0 A;  4EYI B;  9ICC A;  2JEI A;  1HIW A;  3C2L A;  2BCV A;  1ZQM A;  5AKH A;  5KG3 A;  4QWE A;  3SAF A;  2NO4 A;  5ALD A;  2HW3 A;  5DBC A;  5KL1 B;  3UQ2 A;  9ICK A;  2AU0 A;  2YN4 A;  2K4H A;  4G3I A;  1X6J A;  5AKI A;  5KFU A;  4B6J A;  2EDU A;  5JTI A;  3G6Y A;  2XY6 A;  4MF2 A;  3PV8 A;  1KEJ A;  4I2F A;  3H40 A;  4GC7 A;  1WCL A;  1MC8 A;  2E8P A;  4J9S A;  4K4I A;  4F2S A;  5ALJ A;  2F8L A;  8ICH A;  1TK8 A;  4UB4 A;  2IHN A;  1B43 A;  4BJQ A;  4JV1 A;  4NJ8 A;  3QU5 A;  3QUQ A;  5B66 U;  5ALF A;  3ZI4 A;  3F5E A;  1BGX T;  3PR4 A;  1LKY B;  1NJZ A;  5DGB A;  1RPL A;  3AMZ A;  4ED6 A;  3HW8 A;  1MQ2 A;  5J2K A;  1FFV A;  4UQG A;  1RDF A;  5AI8 A;  4RNO A;  3QXG A;  5CR0 A;  3V72 A;  5KFP A;  1ZET A;  3MGH A;  3Q8K A;  3T3F A;  1P7D A;  2PFO A;  2FMS A;  4UAV A;  4YMN A;  1Y88 A;  4F92 B;  3C5G A;  4TUS A;  5ALQ A;  2B0C A;  1KL9 A;  5KFL A;  4GLX A;  3QE9 Y;  5L1I A;  3H8M A;  5KFA A;  2MUT A;  4R66 A;  4NLZ A;  2CPR A;  4Y2X A;  4J9P A;  1YT3 A;  2DUY A;  2DPJ A;  2M0N A;  5AM5 A;  2ASD A;  4O3Q A;  2DFL A;  9ICR A;  2LPE A;  4RUA A;  4G9B A;  5KFI A;  1ZQT A;  4KN7 A;  2R8H A;  1XO1 A;  2ZIV B;  1PK1 A;  4Y2R A;  1S76 D;  2F3N A;  2W7O A;  5CA7 A;  3MFI A;  4BXO B;  3C1Y A;  2D3D A;  3MR6 A;  2MU2 A;  4F71 A;  2R8G A;  5KG5 A;  1N48 A;  3GV7 B;  4IR9 A;  4EBD A;  2WAQ C;  4XUS A;  4Q45 A;  1KFS A;  3E58 A;  4KLO A;  1JXL A;  5IIK A;  5HP4 A;  1A76 A;  2MA1 A;  4Y2Y A;  4JV2 A;  4DEZ A;  1L7O A;  4FE3 A;  5ALH A;  2XID A;  4ECT A;  4KLE A;  1L5U A;  1XO0 A;  2KP7 A;  1BPE A;  4Z6E A;  2HMX A;  1SZP A;  3QUB A;  2MAX A;  4CGZ A;  3GIL A;  4YMO A;  4QZH A;  3TAR A;  3QU9 A;  3TAD C;  4LJX A;  1L3S A;  2KHV A;  4F5O A;  3RAX A;  2IOF K;  3GIM A;  3TAC B;  4C8L A;  4NLG A;  3Q8R B;  4NLC A;  5IIL A;  3V6K A;  4M9J A;  4P0P B;  1MN8 A;  3PW7 A;  2E8M A;  2R8I A;  3HKZ F;  8ICJ A;  4C8N A;  2JRZ A;  5KFD A;  2FPM A;  2I5H A;  2D6F C;  5ALO A;  3O0F A;  4B9N A;  8ICF A;  2F77 X;  2G5H B;  5ALL A;  2ZIX A;  3B9J A;  3Q8M A;  1QSS A;  3GFK B;  1UT5 A;  4YR2 A;  1ZD5 A;  1V9P A;  4GXK A;  3BQT A;  1BPZ A;  1ZQC A;  8ICG A;  8ICK A;  1ZJM A;  1XC9 A;  9ICP A;  2KIV A;  4F5N A;  1S0O A;  4JB3 A;  1SL1 A;  3CP8 A;  4DOA A;  9ICX A;  3T79 A;  5CEH A;  5AI6 A;  2W11 A;  1BVS A;  2BCU A;  1Z1B A;  1WYG A;  1NK6 A;  2KOB A;  1A6S A;  2OYY A;  5L1K A;  2WF8 A;  2ES6 A;  4IC9 A;  4QWD A;  3RAQ A;  2AGQ A;  2LBO A;  3TAQ A;  1DXS A;  3Q8Q B;  4PPX A;  2HSZ A;  5J0X A;  2JH7 A;  4DCC A;  2H3Q A;  2J6U A;  5HR7 A;  4UAY A;  4UAW A;  4J9R A;  2FDR A;  2H5X A;  2CXY A;  2A1J B;  2G08 A;  4NWI A;  4B9S A;  1IIP A;  1X66 A;  3QZ7 A;  2W3R A;  5CHG A;  1TAU A;  5ALG A;  3IG5 A;  1X6I A;  3RJJ A;  4QZF A;  1FIQ A;  3FC4 A;  7ICV A;  4I2J A;  1U49 A;  4C4R A;  3IP4 B;  2NV3 A;  3OHB A;  1JUD A;  1N5W A;  2HHQ A;  1D9D A;  5EWF A;  4O3P A;  3ALR A;  2HHV A;  1IG6 A;  9ICQ A;  1V85 A;  1N63 A;  2F2A B;  2DPI A;  5KG4 A;  2W9A A;  3DDH A;  7ICU A;  5L1J A;  4GFJ A;  2Y9T A;  3D6J A;  4R63 A;  3K4G A;  1ZRN A;  2KJ9 A;  5J0P A;  3JPO A;  1TFR A;  3ED5 A;  4UAS A;  3FYH A;  2C28 A;  2R18 A;  2BZF A;  2D8C A;  1TK0 A;  1XSP A;  2KFZ A;  1L3V A;  5AM1 A;  4ECQ A;  4Z6D A;  5HR6 A;  3EYZ A;  1XNS A;  4CCH A;  3RBE A;  2ZTD A;  4OCZ A;  3Q8P B;  3RJH A;  4USA A;  3M6Z A;  5AI9 A;  2J6S A;  1N2X A;  3G6V A;  1ZQ1 C;  1YZ6 A;  3C23 A;  4M6W B;  5J0W A;  5KFY A;  1UT8 A;  2XGQ A;  2QAR B;  4M9L A;  3PX4 A;  1SGG A;  3BQ7 A;  2YMP A;  3HP6 A;  2I1Q A;  2M9N A;  2E8O A;  8ICT A;  2RLT A;  5IIJ A;  2XGP A;  3KHH A;  2Y0S F;  4MEY A;  3SYZ A;  2N1R A;  1X40 A;  2UVW A;  5ALW A;  3WKA A;  5AM2 A;  4UAR A;  5ALU A;  2GO7 A;  3N7P D;  2EZY A;  1U45 A;  2AH5 A;  2K89 A;  5KFQ A;  1ZQD A;  4A8E A;  3H8W A;  3H4B A;  4CF4 A;  4MFF A;  2FLP A;  3C2M A;  3JPR A;  2OCE A;  2OXO A;  2KJ5 A;  2H3F A;  4EEY A;  4ED8 A;  4RQ7 A;  2WF9 A;  2EAN A;  3ZDA A;  1U47 A;  3PX0 A;  2P66 A;  1QTM A;  5DB7 A;  4J9N A;  7ICS A;  8ICY A;  4OD0 A;  3PNC A;  3F2B A;  2XI9 A;  4YR3 A;  5KG7 A;  1N60 A;  2ZUD A;  1F0M A;  4TQR A;  2Y0S C;  5K4L A;  3IG8 A;  5AIB A;  3NRZ A;  4RQ0 A;  7ICI A;  4KLF A;  2O6K A;  4DL2 A;  3NVY A;  3NVV A;  2IOH A;  1U48 A;  1T3Q A;  3NRW A;  4C0Z A;  2QB0 A;  4UB8 U;  3RJF A;  5IIN A;  4I2D A;  3L5K A;  7ICT A;  3KHL A;  2OM6 A;  4RQ2 A;  3AEV A;  4Y2J A;  4P0Q A;  4UB3 A;  4Q8E A;  4ED7 A;  4QZI A;  3GQC A;  1O03 A;  4PZO A;  9ICG A;  2LHT A;  4AYB F;  5L1M A;  8ICX A;  1S97 A;  5KFO A;  3QX7 A;  4CF5 A;  3SEN A;  8ICO A;  7ICF A;  5KFM A;  3AU2 A;  3CYM A;  2MUT B;  7ICH A;  5KT3 A;  1NOM A;  2WF6 A;  1ZQS A;  2ZUB A;  2ALZ A;  2ZJA A;  5TZV A;  1RM6 C;  1CRX A;  2PFP A;  2XCA A;  3V6J A;  2W9B A;  4UB5 A;  3PSI A;  2E5S A;  2ZUC A;  3QU7 A;  2HHW A;  7ICJ A;  4PGQ A;  2F1J A;  1NKC A;  9ICA A;  3TAP A;  4RQ8 A;  2BPF A;  1PK1 B;  1OW5 A;  4DL3 A;  1SV0 C;  3N4M B;  4KMO B;  1ZQY A;  4O5E A;  4KLI A;  1SXD A;  2LYB A;  4M9N A;  4BX9 C;  4C8M A;  3RB6 A;  4AYB C;  5GTI U;  5ALM A;  2KV2 A;  2RP5 A;  2P6U A;  2AGP A;  3KTQ A;  2HI0 A;  2FPL A;  4YG2 A;  2ASL A;  1ZQH A;  4I2G A;  4OJO A;  3LK9 A;  4F4Z A;  3NUQ A;  4JWN A;  4J9Q A;  4M04 A;  4C8O A;  1S0V A;  4Y2S A;  5III A;  5J2I A;  4ECY A;  1K1S A;  3LWL A;  5J2J A;  4DSF A;  5ALV A;  4ZH4 A;  2QKQ A;  3IDW A;  4PL2 A;  9ICS A;  2OH2 A;  3Q8S B;  3OSP A;  2KKV A;  1RZT A;  1RG6 A;  4F5P A;  2OWO A;  3M6K A;  4QW9 A;  5KT7 A;  5L1L A;  1Q3U A;  2I9G A;  2KMD A;  2YB4 A;  1O08 A;  4QZ8 A;  4EZ6 A;  3K1Z A;  2KKP A;  4IRK A;  5ALN A;  5DG8 A;  1SL0 A;  2E8N A;  2H3I A;  4YMM A;  3C21 A;  3T5H A;  2F1I A;  1HUZ A;  5KFK A;  2PFN A;  1KRP A;  4DQR A;  3RH6 A;  5AI5 A;  5ALY A;  1S5L U;  1L3U A;  2YMM A;  4PGX A;  5L9X A;  1T94 A;  5AI0 A;  3E2E A;  3CNH A;  3RRG A;  2NRV A;  3D2N A;  2ZIX B;  1KSP A;  2K4P A;  3IM1 A;  4HYK A;  3AM9 A;  4CF3 A;  3A0B U;  2JGA A;  4NV0 A;  2DGZ A;  3WK9 A;  3RRH A;  2WF7 A;  4K4G A;  4C4T A;  1X9S A;  5HNK A;  5T14 A;  3TQ1 A;  2KZZ A;  2KHQ A;  4QZA A;  4R8U A;  2NRT A;  2RHF A;  3TFR A;  5J8Y A;  3IHQ B;  4MEX A;  5ALT A;  4NL9 A;  4J03 A;  4XRH A;  5J2B A;  2ZIW A;  2HVI A;  3SI8 A;  1AQ6 A;  4NLK A;  4C7Y A;  4M47 A;  3RJK A;  2YMQ A;  2W9M A;  3M8R A;  5AKJ A;  1JRO A;  4NM2 A;  2JEG A;  3B0Y A;  4F4W A;  2AJQ A;  3DV9 A;  1XWL A;  3BQ1 A;  4PL1 A;  2FE9 A;  4FS2 A;  4KLM A;  3NAS A;  2VA3 A;  4B9M A;  4E0D A;  1QLN A;  2WAQ F;  8ICV A;  1A77 A;  2ODG A;  5IIM A;  4J9L A;  3EPG A;  3UQ0 A;  3UXN A;  2HVH A;  5J0R A;  4QWC A;  4AP9 A;  2I6X A;  4C4S A;  1L8O A;  3OSN A;  3WK8 A;  4EX6 A;  1PVQ A;  3PY8 A;  3RB0 A;  1ZQA A;  1XSL A;  3MBY A;  2R8K A;  5D46 A;  3M8S A;  1ZD2 P;  5KFT A;  1Q3V A;  2KG5 A;  5KTQ A;  1F5S A;  3SAH A;  4RQ3 A;  5KFC A;  1N5X A;  4NY8 A;  2W55 A;  4KLS A;  4DFJ A;  1K1Q A;  2LYH A;  1M6Y A;  3PMN A;  5KFH A;  1OXJ A;  5B5E U;  5AI4 A;  4TUP A;  1VJ5 A;  4YP3 A;  3HT3 A;  9ICV A;  5J0U A;  2G5I B;  2NRX A;  4XA5 A;  3H4D A;  8ICA A;  4IRD A;  1D8Y A;  3RF9 A;  8ICU A;  2KK0 A;  9ICE A;  4GIB A;  4Y2Q A;  4DOC A;  3VCB A;  2KZM A;  2OHF A;  9ICM A;  4RNM A;  2YB1 A;  5AIA A;  3H0R B;  4ACO A;  5KAI U;  4MHV A;  1V97 A;  2F1H A;  5ALR A;  2J6T A;  1JXE A;  2KJ8 A;  3PST A;  1SL2 A;  3PZP A;  2W43 A;  3J81 j;  1RYR A;  3WU2 U;  4DSE A;  1FO4 A;  2BGW A;  2FMP A;  4DFP A;  1MQ3 A;  3MFH A;  1KQQ A;  4B9V A;  2XY5 A;  4NLN A;  1SWW A;  3G6X A;  1D8L A;  3LVV A;  2IA6 A;  2EAO A;  4F4X A;  3GIK A;  1TV9 A;  3E0F A;  3I1Y A;  1QQ7 A;  7ICL A;  3L4P A;  4QZG A;  4DL4 A;  2HBM A;  5EWG A;  1JAL A;  3I28 A;  5KT6 A;  2JR5 A;  5DKW A;  3OGU A;  3QEA Z;  1BPB A;  2K4I A;  4FZM A;  4YXM A;  2W04 A;  1Z00 A;  3ETR A;  3JPT A;  1KLN A;  4Y2P A;  2AXT U;  1YZ7 A;  3KKA C;  3QNM A;  3BQ0 A;  2FMQ A;  4PJ0 U;  9ICB A;  4UBB A;  2W3S A;  3AN1 A;  1ZQJ A;  4DL5 A;  4O5K A;  4UBC A;  3HRD D;  4Y2V A;  2NO5 A;  3GU3 A;  2QB0 B;  7ICK A;  3ORY A;  2K60 A;  2EAP A;  1NJX A;  1SB3 C;  3OPX A;  4IR1 A;  1SWV A;  4P0Q B;  2P6R A;  3C29 A;  3A0H U;  2K8B B;  2WHE A;  3OHA A;  8ICC A;  2CN1 A;  3D2S A;  5J2G A;  4Q43 A;  3DEE A;  1D9F A;  5IIO A;  5KFG A;  7ICE A;  3WK4 A;  4EEN A;  4KX3 A;  1ZQP A;  2HCF A;  2VJ5 A;  1MSW D;  1HUO A;  1NK0 A;  1VDV A;  2DKZ A;  3UMB A;  3JPP A;  5J2H A;  1KBU A;  4Q8F A;  1JRP A;  4J9K A;  1WUD A;  1OUQ A;  2KE7 A;  5AHX A;  5J2A A;  2DBY A;  4M0A A;  8ICZ A;  1FEZ A;  3LWM A;  4DS5 A;  5F9L A;  2W9B B;  3H7I A;  4P4M A;  1IXR A;  5KG2 A;  1GO3 F;  3KD3 A;  5F3X B;  5KFB A;  4Z6F A;  4I2A A;  4ECX A;  4I2E A;  3RB3 A;  1JI7 A;  1ZJN A;  1ZQF A;  2MSN A;  2W9C B;  4QZE A;  1KFD A;  2ZG6 A;  3K75 D;  4CDG A;  3GV5 B;  2HOF A;  5A0L A;  5HHH A;  2C2D A;  8ICS A;  4DS4 A;  4F93 B;  2R8J A;  3D2Q A;  2BQ3 A;  4M9H A;  4UB2 A;  3H0M B;  5KT2 A;  5J2C A;  4CNQ A;  1Z19 A;  3BJY A;  1PK3 A;  1WG8 A;  5KFW A;  2DL0 A;  3HWT A;  1X42 A;  2L5Y A;  3MC1 A;  4I2C A;  4DF8 A;  2EH9 A;  4O0I A;  1UPH A;  4IS7 A;  3MDA A;  2AHO B;  5EE1 A;  2W7P A;  2Q4T A;  2ZXI A;  2G06 A;  2IMW P;  4RQM A;  8ICB A;  3PSF A;  5KNI A;  4F8R A;  2AQ4 A;  5EOZ A;  5BPC A;  5EE3 A;  5CP2 A;  3RH4 A;  4I29 A;  2LMR A;  3ZD8 A;  5AKZ A;  3MR5 A;  1NKE A;  5AKK A;  3SEI A;  5C0Y A;  1ZQV A;  3QYP A;  2KIC A;  1DGJ A;  1J2N A;  4WJ3 B;  5F9N A;  3WK6 A;  5ALZ A;  2GWS A;  2HBK A;  1ZQX A;  2HDO A;  2W03 A;  2V4R A;  4TQS A;  5KFV A;  3TAD A;  4ELT A;  3UMG A;  3V7K A;  1T4G A;  4O3M A;  3M9N B;  3RFA A;  2ZXH A;  5J0Y A;  3PW4 A;  1C20 A;  4DSJ A;  4QWA A;  4FBU A;  3EPI A;  3AUO A;  5CRX A;  4Z6C A;  2LYA A;  4M2Y A;  1T7P A;  1JN3 A;  4U7C A;  4R8U B;  4RT2 A;  1QSY A;  1TKD A;  2KVS A;  1QCK A;  3RJI A;  1NI3 A;  2ZIW B;  1WWU A;  1QH9 A;  5DBB A;  2YY6 A;  5HML A;  3ZDE A;  4US8 A;  4F3O A;  1V38 A;  1KW4 A;  1RXW A;  5KT5 A;  2A3V A;  3WK5 A;  4I27 A;  2W8K A;  2YML A;  5BOL A;  3ZDB A;  5ALX A;  5ALK A;  5DGA A;  3VC8 A;  1IV8 A;  8ICQ A;  3UPQ A;  3SD7 A;  3KKA A;  4I2H A;  3EZ5 A;  1DK2 A;  3FAH A;  1ZQL A;  4DFK A;  5KL8 B;  3RR8 A;  1N56 A;  1BPY A;  3ISC A;  5DDM A;  3BDP A;  3RTV A;  4PZN A;  3BQ2 A;  2XCP A;  2UVU A;  4YR0 A;  4IQW A;  5HHI A;  4PHE A;  1UQV A;  4JUZ A;  2Y1I A;  1ZXI A;  1T8E A;  2HHX A;  4ECR A;  4QZD A;  3QUC A;  2HOI A;  7ICQ A;  1JMS A;  1SKR A;  3T5L A;  5DLG A;  4Q44 A;  3GZF A;  1NK8 A;  2LM4 A;  2JH1 A;  3CW2 C;  4C7Z A;  4YD2 A;  1ARO P;  3OJU A;  2F8K A;  3EUB 2;  4DSI A;  3N97 B;  1WCN A;  4MF8 A;  1ZQO A;  1ZQU A;  4JMU A;  4C80 A;  2DKX A;  5J0Q A;  1S9F A;  3IRU A;  3T5J A;  4QZ9 A;  4DL7 A;  3UXP A;  3HPO A;  2JEJ A;  4BUG A;  4M9G A;  4RPY A;  1SXE A;  4RT3 A;  5DB9 A;  5DBA A;  3GII A;  1WWV A;  2PI4 A;  3PSP A;  4OJ6 A;  2ATL A;  3C2K A;  2ZJ8 A;  1FFU A;  2C22 A;  2DF4 B;  1H38 A;  1C7Y A;  4ECS A;  4FS1 A;  8ICN A;  2MRL A;  4UAT A;  4JWM A;  4O3O A;  2F44 A;  2EQY A;  3PW0 A;  1COO A;  2GOL A;  3QUT A;  1SKW A;  8ICM A;  5FP0 A;  4I2I A;  3RJG A;  3BS5 A;  1J2M A;  9ICU A;  5CWR A;  2K8C B;  4BDP A;  5G5H A;  4I28 A;  4F4Y A;  2EAM A;  4O9M A;  2HBJ A;  3H8J A;  3N7R C;  3JPN A;  3K1R B;  2Q0Z X;  4QZC A;  8ICR A;  2KFN A;  3MAB A;  4CRX A;  2GLE A;  1TAQ A; 
#chains in the Genus database with same CATH homology
 1KN5 A;  5K4L A;  5CEH A;  2JXJ A;  1KQQ A;  2EH9 A;  2OEH A;  2CXY A;  1IG6 A;  1C20 A;  1RYU A;  2RQ5 A;  2LM1 A;  2KK0 A;  2EQY A;  2JRZ A;  4LJX A;  1KKX A;  2LI6 A;  2YQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...