2JXJA

Nmr structure of the arid domain from the histone h3k4 demethylase rbp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
GPLGSRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The ARID domain of the H3K4 demethylase RBP2 binds to a DNA CCGCCC motif
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Histone demethylase JARID1A
total genus 22
structure length 96
sequence length 96
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2jxjA00
5K4LA 2EH9A 2JRZA 5CEHA 1C20A 2KK0A 1RYUA 2LM1A 1KKXA 4LJXA 2RQ5A 2CXYA 2YQEA 1KQQA 2OEHA 2EQYA 2LI6A 2JXJA 1KN5A 1IG6A
chains in the Genus database with same CATH superfamily
3KZIU 4QZAA 1U9LA 1KLNA 3FYHA 1NNLA 5ALKA 1UPHA 3PW0A 3H8WA 2ASJA 2KEYA 2MUTA 1L3SA 3KD3A 1TE2A 3C2MA 2FDRA 4BDPA 4C8MA 2VJ5A 4JWMA 1TV9A 1KBUA 4DFJA 3RF9A 1O08A 2LKYA 4R65A 3WK8A 4O3PA 8ICFA 4RNOA 5J0WA 2I6XA 3N28A 4EENA 4KLUA 5ALGA 4CDGA 4ECSA 2OH2A 2C2DA 4DFKA 3E2EA 2HOQA 2ZXHA 3CRXA 1RPLA 5AHXA 1JXLA 2CRXA 8ICUA 4O3NA 2LM1A 1XO1A 9ICVA 2LMRA 4NWIA 1D8LA 3TADA 1ZQGA 9ICMA 3ZDCA 9ICWA 2PMZC 4KLOA 5KFBA 1T4GA 2FJ6A 2RRDA 1UCVA 1QSYA 1NK4A 1AQ6A 3WKEA 1A77A 3UPQA 3WK7A 1X9XA 2VJ4A 1UT8A 1ZQPA 8ICEA 2RHFA 5KFRA 1SGGA 2ALZA 2HDOA 2BCQA 2F3NA 4JUZA 3IV6A 2ZTEA 1L8OA 1KDHA 4J9QA 3JPNA 5AK6A 5C0YA 2FMSA 2FLLA 5AKHA 5DG8A 5BOLA 1FFUA 1WG8A 3OHBA 2HHQA 5DB9A 2A19A 3EYZA 2KN7A 1IM4A 4DL5A 1SKSA 9ICJA 5AM5A 2DWQA 4RU9A 1FFVA 3RH5A 2ZXIA 3MR3A 1ZJMA 1XSLA 3HKZF 1IIPA 2LBOA 2NRZA 2XCPA 4OO1J 1HUOA 3ORYA 4FBTA 5KFLA 3HP6A 5J2IA 5K4LA 2ZJAA 9ICOA 2E1EA 3AM9A 5AIAA 5DB6A 3KKAC 5J0XA 4A8EA 4Q43A 4B9VA 4M9GA 1ZQOA 1ZJNA 3QU9A 2H3FA 1V38A 4ECYA 1U45A 2FMPA 1TAUA 4RUCA 2PFNA 1ZQQA 1ZQHA 5J2DA 1N48A 1EXNA 4PHPA 1NKCA 1U49A 4GC7A 1X40A 3H4BA 2AH5A 2F8LA 3FM9A 4NM2A 3G6YA 1D9DA 2L5YA 4F71A 5KT3A 2EAMA 1XNSA 4KMOB 1AROP 1KFDA 5J2FA 1QH9A 1SKRA 1SZPA 1LV5A 4M9JA 3Q8KA 2JMGA 4I2HA 1ZRNA 2BQUA 1ZQXA 2R8KA 4CNQA 4Y2PA 4EX6A 5DDYA 2AHOB 4K4HA 3EPIA 5CB1A 1K1QA 1TVAA 2A1JB 3RJGA 1SWWA 2AQ0A 8ICCA 5F3XB 3OSPA 1KFSA 2W9CB 4BXOB 2R8IA 5AKZA 3EPGA 2DUYA 4CGZA 4XUSA 5KFQA 2OM6A 4EYIB 3H0RB 3V6HA 3OHAA 1RYSA 3RRHA 5DQHA 4C0ZA 1KEJA 4ED3A 1QQ7A 1TK5A 1YT3A 4KN7A 3V7KA 3RRGA 1X42A 3DV9A 4YMNA 5AK5A 3NRWA 5KG3A 5KFEA 3LVWA 4UB5A 4JB3A 2P66A 1NI3A 4B9MA 4ED0A 3V7LA 5BOMA 1F5SA 1F44A 1ZQUA 4ZOHC 3ONNA 2KICA 1JUDA 2W3SA 5DG9A 4KLSA 2ZIUB 2VIXA 2NV3A 2R8HA 4DQQA 2KTQA 5J0RA 1XU4A 4YMOA 1ZQKA 4OJPA 4DCCA 4YVZA 4QZGA 4TURA 2EDUA 4YN4A 1N2XA 2BZFA 3N7PD 5TISU 5D4BA 5L9XA 1X6JA 9ICTA 4XA5A 1DGSA 1Z3EB 4QJFB 9ICPA 2Y1IA 3PSFA 1J2MA 5AKKA 4R63A 4U7CA 4TQSA 4J9PA 4ECVA 4US9A 4O3SA 2W8KA 4DL7A 4I27A 3PV8A 4PGYA 5EWEA 2WAQC 4M6WB 5CRXA 7ICVA 2V4QA 1COOA 5KFCA 3H8MA 1D9FA 2LHTA 4NV0A 2AJQA 2BCUA 5IIJA 2EAPA 5G5GA 2A1JA 2P6RA 2PFPA 4K4GA 7ICRA 2K4EA 3B9JA 3UMBA 1L7NA 8ICWA 4B9TA 2IA6A 4G9BA 3V6JA 3GIKA 4IRCA 4DF4A 2H3VA 1L7PA 2XC9A 4J9OA 1ZQBA 4PZOA 5H2FU 1RM6C 4GC6A 3H0MB 4FS1A 5DG7A 3K1ZA 5IIOA 1Z00A 3D6JA 1VJ5A 5KL8B 2W3RA 2B6GA 3KHRA 8ICVA 3GIMA 4Z6DA 1K1SA 4RQ2A 3JPQA 2K4IA 3PVXA 2ZIXA 5KFXA 4MFFA 2YB1A 3MGHA 3ISDA 1KFTA 5J0QA 3F5EA 3UMGA 4DSLA 1Q46A 3AU6A 2W04A 3H0LB 2HBMA 3QX7A 3AQFA 1S76D 2ZJ5A 3ED5A 4PHDA 1F0MA 2BDUA 4M04A 2IHMA 5ALNA 4I2IA 2HHXA 2IOHA 1S10A 3NUQA 5KG6A 2ZUDA 4B6JA 4F4ZA 4MEXA 1PVRA 4R8UB 2ZIUA 1MSWD 3C1ZA 5DGBA 2W43A 4X5VA 3F5AA 3L4PA 4BX9C 2DBYA 1ZQYA 5IIIA 4O5EA 4KX5A 2JV3A 3BQTA 1SZHA 4RQ3A 1SIJA 2RDIA 4KLEA 2LYHA 1N63A 4C4TA 5ALMA 4MF8A 4EBDA 2D8CA 2YN4A 3NVZA 2WF7A 5KT7A 1LKYA 3MR2A 5KL1B 3HJEA 3PR4A 2AU0A 2ESEA 4C8NA 2GH1A 2BQRA 3PSTA 5DBBA 3MABA 5GTHU 2PKEA 3QU5A 1A76A 4PH5A 3SYZA 4P0PA 5IINA 4DSJA 2F1HA 1PVPA 3PO4A 2JHDA 4I29A 4J9SA 7ICHA 3O0FA 5HMMA 1D8YA 1ZQNA 9ICBA 4EYHB 3RBEA 4EELA 3NS1A 4DSKA 1SL2A 2K8AA 4DQRA 3TARA 5DQGA 1BPYA 3SEIA 8ICSA 2CN1A 2YMMA 4UB2A 3BS5B 1UA0A 3KFUF 1DGJA 1XC9A 9ICFA 1Z1BA 2FPLA 5L1LA 2XVTA 5KFPA 5CJ7A 9ICNA 4R64A 1COKA 3D2NA 5KAIU 3QUTA 5J29A 1Z1VA 8ICNA 3THVA 2KE7A 3EW9A 3V72A 2HBJA 4CCHA 1SKWA 2WB1F 2BGWA 1P7DA 3TAQA 3E0FA 3QEBZ 4F5QA 4F5RA 3TAPA 5JU5A 5ALJA 1YZ6A 3LYSA 4UB6U 5ALQA 8ICIA 3WKBA 2ATLA 3RB0A 4QZ8A 2V4RA 1NJWA 1VDVA 5ALZA 3ZDDA 3S6JA 3GZFA 4KLMA 5KTQA 1MA7A 2QARB 2KP7A 3WK4A 7ICEA 2MAXA 2WB1C 5IIMA 2WF6A 3OPXA 1S77D 8ICMA 4Y2RA 5L1MA 5DB7A 4DO9A 1D8BA 4GXJA 5AKIA 2M9NA 2RLTA 2BPCA 4F5NA 4OJLA 1UHUA 4RT2A 4DFPA 4FFDA 5KFKA 4DQSA 1ZQDA 2BDPA 5J2KA 3Q8RB 2EH9A 3ZDEA 2HVIA 5AM4A 4C7YA 3MR5A 3BDPA 9ICRA 4O5CA 5AI6A 1ZQRA 3QYPA 4MFCA 2RP5A 5JUMA 2WTFA 3F2CA 2A1AA 2NRVA 1T94A 3HWTA 4Y2VA 4J9NA 2G5HB 3QUQA 5HP4A 5ALYA 3AQEA 3LK9A 2QKQA 3I1YA 4I2FA 1JXEA 5KT6A 4MEYA 3RAXA 4EX7A 1NK5A 4CE6A 2HHUA 4RPXA 4QNLA 3PNCA 1B0XA 3UQ2A 4NL9C 3NGDA 9ICQA 1ZRMA 2JRZA 1JRPA 3MFHA 1TAMA 2VA8A 1JN3A 2W9MA 2K8BB 5KG7A 3SI8A 1ZD3A 4IQVA 4PHEA 1ZQMA 5KAFU 4EEYA 2E5SA 1U4BA 3OGUA 3RB3A 9ICHA 4DL2A 5HR6A 4Q8FA 7ICKA 3QZ7A 2ZTCA 3R9KA 4F5PA 9ICKA 4LZGA 3PY8A 2XI9A 4RQ5A 2XO7A 1ZQ1C 2ASLA 3IM1A 4QZ9A 2R18A 2GLEA 2VANA 3JPOA 1SV4A 4DFDA 1SV0C 5KFVA 1RZTA 5J0OA 1NK9A 2M0NA 3AMZA 4RQMA 5ALTA 4F3OA 3SMVA 2H3QA 2B21A 5J2BA 2DGZA 1N5WA 4PHAA 4Q44A 2G06A 2HSZA 9ICXA 4P4MA 4I2GA 4EEKA 2OEHA 4C4SA 4JMUA 3SV3A 3V7JA 1BVSA 5KFZA 5C5JA 3KHGA 3KBBA 9ICEA 5HHHA 2UVVA 4RNNA 7ICIA 2F77X 7ICPA 3GIJA 4BJQA 3BQ7A 2MA1A 1WCLA 1NJZA 3RJKA 1TK0A 2BKEA 3OJSA 9ICUA 1XWLA 3UMCA 2Y1JA 2D3DA 4KLDA 4M6WA 4FBUA 4IRKA 2UVWA 1XSPA 1Z00B 2DPJA 3I76A 2ZG6A 4NLNA 5EWGA 3NVVA 1IG6A 2Y0SC 1TFRA 1OXJA 3HT3A 4QWAA 3HRDD 4M0AA 1S0OA 2ZIXB 4IQTA 4ELTA 3GIIA 3SENA 2YMPA 3SAFA 4YXMA 2F8KA 4RUAA 1Z19A 4ECWA 1ZQZA 4GXKA 1ZD5A 2W9AA 4FZNA 4ELVA 5J2AA 2J6TA 2KK0A 2LYAA 4RQ6A 4Y2UA 3RJHA 5EE3A 3Q8MA 1NKEA 4RZRA 2JEFA 2DQNB 1X6IA 2K89A 4RPYA 2I9GA 4JV1A 4KTQA 3BS5A 1TK8A 4LZDA 5ALOA 4P0QA 1C7YA 3SZ2A 4F4YA 2W54A 1TKDA 1OW5A 5AM1A 5AKLA 3SD7A 1BPEA 1SL0A 3MGVA 1WYGA 3RH6A 5AK3A 3WKCA 2EZYA 1S9FA 3UXOA 1DK2A 3PMNA 4C8OA 4KITB 2PXIA 5D49A 2P35A 5D46A 4YD1A 2K4HA 4NLZA 2PFQA 1Z4NA 1KL9A 1PVQA 4BWMA 2AGQA 4M2YA 1DK3A 3HILA 1MN8A 2KKPA 2KV2A 4CRXA 1ZQJA 1U48A 4OJ6A 4UARA 3F53A 3VC8A 5AICA 2NO4A 5ALIA 4C4RA 3N7RC 2DKZA 4C80A 1NZBA 9ICAA 4F92B 1UT5A 1B22A 4IR1A 3WU2U 1NJXA 3K75D 3H8SA 5EE1A 3JPSA 5J2HA 1Q3VA 3H8JA 3UXPA 3RJJA 4P4OA 4EBCA 1QCKA 4QZIA 3AU2A 4TUQA 2EANA 3IRUA 5DGAA 3PSIA 4DFMA 5KG4A 2XY6A 3WKAA 9ICIA 1RXWA 2HHWA 2G0AA 3N7SC 1L7MA 2JGAA 4ECTA 5AI9A 1ZQWA 4O9MA 2K60A 4QIWF 5HR7A 1S0VA 1BNPA 4I2EA 1RQNA 3NVWA 5FP0A 3PMLA 4GLXA 8ICJA 4R66A 4JK1A 3RBDA 2BCRA 2Y9TA 3PR5B 2XCAA 4AYBC 4ECQA 5DBCA 3RTVA 3IG5A 2KSOA 1L3UA 1V85A 1HUZA 3L3FX 3V6KA 2OYYA 2Z7JA 5ALPA 5HMLA 5KFDA 4M9NA 3ETRA 5KT2A 2JR5A 1RG6A 1NJYA 2NRTA 1MC8A 2KMDA 2HCFA 1ZOLA 1BGXT 5F9NA 5KG1A 4UB8U 5DLFA 1X9SA 9ICGA 7ICSA 3PW4A 2ZUCA 3PW5A 5CEHA 2EZXA 1DXSA 4UAWA 5G5HA 4UQGA 2BPFA 3T5JA 4LJXA 8ICGA 3QEAZ 2DKXA 2WAQF 3L5KA 2VA2A 5KG5A 4B9SA 4KLQA 2UVUA 3QUBA 2MRLA 4O5KA 4ECRA 2A3VA 4QZFA 4F4KA 2ISOA 4J9KA 1IV8A 1JALA 1JROA 4DS4A 3NASA 2IHNA 7ICTA 3C5FA 1CEZA 2F1JA 1O03A 3PW7A 4RQ1A 4I2JA 3HW8A 2JEIA 8ICKA 1DOQA 8ICRA 2EAOA 4DL4A 3RB4A 1L3TA 3JPPA 3DEEA 4PL1A 2BR0A 4J03A 4CF5A 2KZMA 1L7OA 2FMQA 3F2BA 2C2EA 4O3OA 4F4XA 4EZ9A 1B4FA 3FDSA 3RAQA 4Z6EA 1SXDA 4OCZA 1ZQVA 3LDAA 2KHQA 3SAHA 8ICXA 2RDJA 2XGQA 3EZ5A 7ICGA 1CRXA 1LVHA 3T5LA 4IR9A 2G5IB 4DSFA 5EOZA 1MQ3A 4F8RA 1URJA 2XY7A 2FLNA 1H38A 3BJYA 2V9WA 5J8YA 5KG2A 2HOFA 1HJPA 3PSPA 5J0UA 4G3IA 1T3NA 4NLCA 2FI1A 5AKGA 2KIVA 5A0LA 5AIBA 2G09A 3ZD8A 1S0MA 1JX4A 2UVRA 1NK6A 2JEGA 4J9MA 2W7OA 4RT3A 2W11A 3A0BU 4M47A 1Q8KA 2Y9UA 4F2SA 3UQ0A 1ZQFA 3QUCA 1N61A 4UAZA 2LYBA 3RR7A 2ZIWB 3IN5A 2ZIWA 3ALRA 4F91B 1L6NA 4FE3A 7ICOA 4QWEA 1XO0A 2YQEA 2W55A 3ZD9A 4KLFA 8ICAA 5DDMA 4FZLA 3UXNA 5HNKA 2NYVA 2O6KA 2W9BB 2GWSA 1L3VA 1DRGA 4ED7A 5AKXA 1JIHA 4QIWC 4OD0A 4BWJA 1ZD4A 2K4PA 5CR0A 4F72A 2KJ8A 2W7PA 3MGIA 1OUQA 3SAGA 1CI4A 8ICYA 4KLIA 4ED1A 3N97B 5KFIA 4QZHA 3PO5A 4NY8A 2F44A 4QWDA 4GFJA 1S0NA 3ISCA 7ICMA 3WK6A 2E3TA 2I5HA 4KLGA 2EQYA 1RQLA 3G6XA 4ED2A 2KFZA 4O3RA 8ICPA 7ICJA 4P0PB 1N5XA 2W9CA 4BXOA 3BQ2A 4FO6A 4Y2YA 3AL0B 4YP3A 3JPRA 1T7PA 1L8LA 5KNIA 3C2LA 5E79U 4UAUA 2E8PA 3TFSA 2K8CB 1PZNA 4ECXA 2G08A 5KFSA 4J9LA 1UA1A 1KW4A 2HVHA 3TANA 1SWVA 2IBKA 3RJEA 2KOBA 4Y2TA 2JH7A 5IILA 2AQ4A 1X2IA 5KT5A 2ZTDA 2FPMA 2IMWP 3M9OB 1JMSA 2HOIA 5L1JA 4YCXA 4UB1A 3IHQB 1UQVA 1RYUA 2XICA 4RQ7A 3QZ8A 1FO4A 2KFNA 5KFYA 4F50A 5ALRA 5AM3A 3B0XA 4PGXA 3LWMA 4B9LA 4UBBA 4YMMA 1HIWA 4EZ6A 4B9UA 2BHNA 3QU7A 1IXRA 4ICAA 3T5KA 3T3FA 3PX4A 4R8UA 1RDFA 5JTIA 3BQ0A 8ICOA 4DF8A 4IRDA 4YQWA 2KSOB 2OXOA 4AP9A 5ALSA 3G6VA 2W03A 4I2CA 4DQPA 3RR8A 2ODGA 3WK5A 2YY6A 1NK7A 3IDWA 3M6ZA 4DLGA 2GO7A 4KLLA 1PK1A 1QQ5A 4QWCA 3OSNA 4O0IA 5KFNA 2ZUBA 2H3ZA 1ZXIA 3M8RA 5DKWA 4O3QA 2HHTA 3M6KA 5KFWA 5AI0A 1CUKA 5CP2A 4P0QB 2WHEA 3GQCA 4F2RA 4PJ0U 4RQ8A 1WWVA 2YX8A 3D2QA 1X9MA 4ECUA 2WF5A 3VCBA 2QARA 5J2CA 1YZ7A 4DOAA 1QSSA 4NLBA 7ICFA 3C1YA 1HEKA 3JPTA 1FIQA 3SV4A 4BUGA 5GTIU 4AYBF 3HKZC 5J8YC 5ALHA 1JI7A 1M6YA 1V9PA 1X66A 4I2AA 3BS7A 3AN1A 4OJOA 2PMZF 3C5GA 2BPGA 2LI6A 4CF4A 4QW9A 2IOFA 4QW8A 5ALUA 4ZH4A 1WUDA 5J2GA 3CYMA 5KFMA 1SV0A 3RJFA 4YFKA 3QU4A 4FZMA 1ZQCA 7ICLA 4QZBA 4O3MA 2KKVA 1ZQLA 5DLGA 4RNMA 4TUSA 2LM4A 3SQIA 2HI0A 3EWAA 3TFRA 4M9LA 1X9WA 2R8GA 3TACB 4XQ8A 4ECZA 1ZD2P 4I28A 4QWBA 3LWLA 3RH4A 2QB0B 3M7DA 1PK1B 3Q8PB 4USAA 2HHSA 2VKQA 4CF3A 1KQQA 5AI4A 1QTMA 3GV5B 4WJ3B 1ZQEA 2QLTA 2PFOA 4PZNA 4KLHA 3TKAA 3KHHA 4DL6A 4Z6FA 5CWRA 3QE9Y 2I1QA 1VLBA 8ICQA 4F93B 4K4IA 3LVVA 1ZETA 3HPOA 8ICZA 2E1FA 1S97A 2HHVA 2C2RA 1J2NA 1N56A 2AGOA 2ZIVB 3K4GA 2AGPA 3U26A 4KX3A 1ZQAA 3K1RB 7ICNA 2JZBA 5DQIA 1B43A 5B66U 2H5XA 1WCNA 4KN4A 4EBEA 4JV2A 2MUTB 5CA7A 3KTQA 3F2DA 4TUPA 1LB2B 5KT4A 2KIWA 1QSLA 1C20A 2PI5A 4J9RA 2KG5A 3KOOA 2Y0SF 3Q8QB 4Y2XA 2F2AB 5AKJA 4U6PA 4DWIA 5KFJA 4P2HA 3CW2C 2RQ5A 2BCVA 2WF9A 3A0HU 4UATA 2FE9A 5L1IA 1NK8A 3D2SA 4RQ0A 5AK4A 2QB0A 3IP4B 3H7IA 1KTQA 5EE0A 5KFGA 2DF4B 3MFIA 4Q45A 4GIBA 4MHVA 2MU2A 1ZQSA 3QXGA 1SXEA 1QQ6A 2P6UA 3KKAA 2CXYA 2DPIA 9ICSA 2JXJA 2KHVA 5ALEA 3I28A 4FS2A 4DLEA 1RXVA 2OWOA 4B9NA 2HW3A 4KMUA 5AKYA 4F4WA 4NJ8A 3ZI4A 2OCEA 3M9MB 5ALVA 4YR0A 3M1YA 4DOCA 3GV7B 2ASDA 9ICCA 1A6SA 2R8JA 2KD1A 4DSEA 7ICQA 3NTUA 3N4MB 2C22A 4MFAA 3M8SA 3PW2A 4PL2A 2OHFA 2EZZA 5ALXA 3BZKA 1XSNA 5HHIA 1KN5A 2VA3A 2YTUA 2E8NA 4YR3A 3OJUA 3GDXA 4XRHA 5DB8A 4PGQA 1ZQIA 1LKYB 4YR2A 5T14A 3RFAA 1BPBA 5DBAA 5KFHA 3FC4A 3J81j 2JZBB 4NXZA 2NRXA 1QLNA 3GU3A 4OJ5A 3FAHA 5BPCA 1U47A 5TZVA 1ED1A 3H4DA 5J0PA 3HX0A 4QZCA 5AM2A 1V97A 1PUZA 1WWUA 2G07A 2ISPA 8ICHA 8ICTA 2YMQA 1PK3A 3GV8B 1N62A 2GOLA 1ECWA 3TADC 5AKEA 4ED8A 4QZEA 3M9NB 4ED6A 3ZDAA 4M9HA 2YB4A 2HMXA 3DDHA 3CNHA 1N60A 3MC1A 2PI4A 1ZYQA 4UW9A 1NKBA 4HYKA 1J97A 3GILA 2FPKA 3ZDBA 8ICLA 1MQ2A 1NOMA 2BQ3A 4DSIA 1NK0A 4KLTA 4IS7A 3C23A 1FEZA 5IIKA 2D6FC 2WF8A 1K5OA 5J0TA 3MDAA 3ISBA 5B5EU 4BGDA 1Z4OA 5ALLA 2KZZA 3C28A 4DEZA 1S5LU 3OTQA 2XY5A 4UB3A 4Y2QA 4YXJA 2KVCA 5KFOA 4I2DA 3WKDA 2KJ5A 4YD2A 1TAQA 4PPXA 4I2BA 4DS5A 4YG2A 1T3QA 3WK9A 1BPDA 3CP8A 5J0SA 2Q4TA 2JH1A 1ZQTA 4RQ4A 1NZPA 4UBCA 5L1KA 1KKXA 4Y2SA 3MBYA 3TQ1A 2WFAA 1L5UA 5KFAA 9ICLA 1RYRA 2ZIVA 3ICXA 3KZXA 3RJIA 2FLPA 5J0YA 5EWFA 3PZPA 5ALDA 4KLJA 3B0YA 1SB3C 1A0PA 5EE9A 1SL1A 2DFLA 2W9BA 3KHLA 4E0DA 1BPXA 2QB1A 2KVSA 2ZJ8A 7ICUA 5KFUA 4GXIA 2KZ3A 4JWNA 5KFFA 4US8A 4DOBA 5F9LA 4NM1A 4LVSA 3QU2A 4IC9A 4Y2JA 5AI5A 2HBKA 4HAIA 2KNJA 4RQNA 4Z6CA 5ALFA 2NO5A 4TQRA 1Y88A 3EUB2 2F76X 4UB4A 3AUOA 2YMLA 3SR6A 3GFKB 2H3IA 5CHGA 1T8EA 4F5OA 4MF2A 3C2KA 2W8LA 5J2JA 2B0CA 1BPZA 3TI0A 4NL9A 2Q0ZX 4DL3A 1S8OA 4RPZA 3BQ1A 2XIDA 4NLGA 4NLKA 4C8LA 3RB6A 3T79A 3E58A 3MDCA 2KJ9A 1Q3UA 2HBLA 4IQWA 4JV0A 2J6SA 2LPEA 2DL0A 2N1RA 3C21A 5AM0A 4IL6U 1KSPA 4ELUA 2E8MA 5AI8A 3IG8A 4UAYA 2BCSA 4DQIA 3Q8SB 2CPRA 2JEJA 3BZCA 5KFTA 3NRZA 2IOFK 4UASA 1KRPA 5JRTA 3ETLA 2J6UA 3AEVA 5KG0A 2E8OA 3H40A 3PX6A 2F1IA 4C7ZA 4UAVA 2MSNA 4P4PA 5J2EA 3T5HA 3UM9A 4ACOA 1BNOA 8ICBA 2C28A 3PX0A 2NRWA 2AXTU 2ES6A 3C29A 1XS9D 5ALWA 2XGPA 4QZDA 4Q8EA 3NVYA 3MR6A 4C8KA 4IQUA 3QNMA 3Q8LA 1GO3F
chains in the Genus database with same CATH topology
5K4LA 2EH9A 2JRZA 5CEHA 1C20A 2KK0A 1RYUA 2LM1A 1KKXA 4LJXA 2RQ5A 2CXYA 2YQEA 1KQQA 2OEHA 2EQYA 2LI6A 2JXJA 1KN5A 1IG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4L A;  2EH9 A;  2JRZ A;  5CEH A;  1C20 A;  2KK0 A;  1RYU A;  2LM1 A;  1KKX A;  4LJX A;  2RQ5 A;  2CXY A;  2YQE A;  1KQQ A;  2OEH A;  2EQY A;  2LI6 A;  2JXJ A;  1KN5 A;  1IG6 A; 
#chains in the Genus database with same CATH topology
 3KZI U;  4QZA A;  1U9L A;  1KLN A;  3FYH A;  1NNL A;  5ALK A;  1UPH A;  3PW0 A;  3H8W A;  2ASJ A;  2KEY A;  2MUT A;  1L3S A;  3KD3 A;  1TE2 A;  3C2M A;  2FDR A;  4BDP A;  4C8M A;  2VJ5 A;  4JWM A;  1TV9 A;  1KBU A;  4DFJ A;  3RF9 A;  1O08 A;  2LKY A;  4R65 A;  3WK8 A;  4O3P A;  8ICF A;  4RNO A;  5J0W A;  2I6X A;  3N28 A;  4EEN A;  4KLU A;  5ALG A;  4CDG A;  4ECS A;  2OH2 A;  2C2D A;  4DFK A;  3E2E A;  2HOQ A;  2ZXH A;  3CRX A;  1RPL A;  5AHX A;  1JXL A;  2CRX A;  8ICU A;  4O3N A;  2LM1 A;  1XO1 A;  9ICV A;  2LMR A;  4NWI A;  1D8L A;  3TAD A;  1ZQG A;  9ICM A;  3ZDC A;  9ICW A;  2PMZ C;  4KLO A;  5KFB A;  1T4G A;  2FJ6 A;  2RRD A;  1UCV A;  1QSY A;  1NK4 A;  1AQ6 A;  3WKE A;  1A77 A;  3UPQ A;  3WK7 A;  1X9X A;  2VJ4 A;  1UT8 A;  1ZQP A;  8ICE A;  2RHF A;  5KFR A;  1SGG A;  2ALZ A;  2HDO A;  2BCQ A;  2F3N A;  4JUZ A;  3IV6 A;  2ZTE A;  1L8O A;  1KDH A;  4J9Q A;  3JPN A;  5AK6 A;  5C0Y A;  2FMS A;  2FLL A;  5AKH A;  5DG8 A;  5BOL A;  1FFU A;  1WG8 A;  3OHB A;  2HHQ A;  5DB9 A;  2A19 A;  3EYZ A;  2KN7 A;  1IM4 A;  4DL5 A;  1SKS A;  9ICJ A;  5AM5 A;  2DWQ A;  4RU9 A;  1FFV A;  3RH5 A;  2ZXI A;  3MR3 A;  1ZJM A;  1XSL A;  3HKZ F;  1IIP A;  2LBO A;  2NRZ A;  2XCP A;  4OO1 J;  1HUO A;  3ORY A;  4FBT A;  5KFL A;  3HP6 A;  5J2I A;  5K4L A;  2ZJA A;  9ICO A;  2E1E A;  3AM9 A;  5AIA A;  5DB6 A;  3KKA C;  5J0X A;  4A8E A;  4Q43 A;  4B9V A;  4M9G A;  1ZQO A;  1ZJN A;  3QU9 A;  2H3F A;  1V38 A;  4ECY A;  1U45 A;  2FMP A;  1TAU A;  4RUC A;  2PFN A;  1ZQQ A;  1ZQH A;  5J2D A;  1N48 A;  1EXN A;  4PHP A;  1NKC A;  1U49 A;  4GC7 A;  1X40 A;  3H4B A;  2AH5 A;  2F8L A;  3FM9 A;  4NM2 A;  3G6Y A;  1D9D A;  2L5Y A;  4F71 A;  5KT3 A;  2EAM A;  1XNS A;  4KMO B;  1ARO P;  1KFD A;  5J2F A;  1QH9 A;  1SKR A;  1SZP A;  1LV5 A;  4M9J A;  3Q8K A;  2JMG A;  4I2H A;  1ZRN A;  2BQU A;  1ZQX A;  2R8K A;  4CNQ A;  4Y2P A;  4EX6 A;  5DDY A;  2AHO B;  4K4H A;  3EPI A;  5CB1 A;  1K1Q A;  1TVA A;  2A1J B;  3RJG A;  1SWW A;  2AQ0 A;  8ICC A;  5F3X B;  3OSP A;  1KFS A;  2W9C B;  4BXO B;  2R8I A;  5AKZ A;  3EPG A;  2DUY A;  4CGZ A;  4XUS A;  5KFQ A;  2OM6 A;  4EYI B;  3H0R B;  3V6H A;  3OHA A;  1RYS A;  3RRH A;  5DQH A;  4C0Z A;  1KEJ A;  4ED3 A;  1QQ7 A;  1TK5 A;  1YT3 A;  4KN7 A;  3V7K A;  3RRG A;  1X42 A;  3DV9 A;  4YMN A;  5AK5 A;  3NRW A;  5KG3 A;  5KFE A;  3LVW A;  4UB5 A;  4JB3 A;  2P66 A;  1NI3 A;  4B9M A;  4ED0 A;  3V7L A;  5BOM A;  1F5S A;  1F44 A;  1ZQU A;  4ZOH C;  3ONN A;  2KIC A;  1JUD A;  2W3S A;  5DG9 A;  4KLS A;  2ZIU B;  2VIX A;  2NV3 A;  2R8H A;  4DQQ A;  2KTQ A;  5J0R A;  1XU4 A;  4YMO A;  1ZQK A;  4OJP A;  4DCC A;  4YVZ A;  4QZG A;  4TUR A;  2EDU A;  4YN4 A;  1N2X A;  2BZF A;  3N7P D;  5TIS U;  5D4B A;  5L9X A;  1X6J A;  9ICT A;  4XA5 A;  1DGS A;  1Z3E B;  4QJF B;  9ICP A;  2Y1I A;  3PSF A;  1J2M A;  5AKK A;  4R63 A;  4U7C A;  4TQS A;  4J9P A;  4ECV A;  4US9 A;  4O3S A;  2W8K A;  4DL7 A;  4I27 A;  3PV8 A;  4PGY A;  5EWE A;  2WAQ C;  4M6W B;  5CRX A;  7ICV A;  2V4Q A;  1COO A;  5KFC A;  3H8M A;  1D9F A;  2LHT A;  4NV0 A;  2AJQ A;  2BCU A;  5IIJ A;  2EAP A;  5G5G A;  2A1J A;  2P6R A;  2PFP A;  4K4G A;  7ICR A;  2K4E A;  3B9J A;  3UMB A;  1L7N A;  8ICW A;  4B9T A;  2IA6 A;  4G9B A;  3V6J A;  3GIK A;  4IRC A;  4DF4 A;  2H3V A;  1L7P A;  2XC9 A;  4J9O A;  1ZQB A;  4PZO A;  5H2F U;  1RM6 C;  4GC6 A;  3H0M B;  4FS1 A;  5DG7 A;  3K1Z A;  5IIO A;  1Z00 A;  3D6J A;  1VJ5 A;  5KL8 B;  2W3R A;  2B6G A;  3KHR A;  8ICV A;  3GIM A;  4Z6D A;  1K1S A;  4RQ2 A;  3JPQ A;  2K4I A;  3PVX A;  2ZIX A;  5KFX A;  4MFF A;  2YB1 A;  3MGH A;  3ISD A;  1KFT A;  5J0Q A;  3F5E A;  3UMG A;  4DSL A;  1Q46 A;  3AU6 A;  2W04 A;  3H0L B;  2HBM A;  3QX7 A;  3AQF A;  1S76 D;  2ZJ5 A;  3ED5 A;  4PHD A;  1F0M A;  2BDU A;  4M04 A;  2IHM A;  5ALN A;  4I2I A;  2HHX A;  2IOH A;  1S10 A;  3NUQ A;  5KG6 A;  2ZUD A;  4B6J A;  4F4Z A;  4MEX A;  1PVR A;  4R8U B;  2ZIU A;  1MSW D;  3C1Z A;  5DGB A;  2W43 A;  4X5V A;  3F5A A;  3L4P A;  4BX9 C;  2DBY A;  1ZQY A;  5III A;  4O5E A;  4KX5 A;  2JV3 A;  3BQT A;  1SZH A;  4RQ3 A;  1SIJ A;  2RDI A;  4KLE A;  2LYH A;  1N63 A;  4C4T A;  5ALM A;  4MF8 A;  4EBD A;  2D8C A;  2YN4 A;  3NVZ A;  2WF7 A;  5KT7 A;  1LKY A;  3MR2 A;  5KL1 B;  3HJE A;  3PR4 A;  2AU0 A;  2ESE A;  4C8N A;  2GH1 A;  2BQR A;  3PST A;  5DBB A;  3MAB A;  5GTH U;  2PKE A;  3QU5 A;  1A76 A;  4PH5 A;  3SYZ A;  4P0P A;  5IIN A;  4DSJ A;  2F1H A;  1PVP A;  3PO4 A;  2JHD A;  4I29 A;  4J9S A;  7ICH A;  3O0F A;  5HMM A;  1D8Y A;  1ZQN A;  9ICB A;  4EYH B;  3RBE A;  4EEL A;  3NS1 A;  4DSK A;  1SL2 A;  2K8A A;  4DQR A;  3TAR A;  5DQG A;  1BPY A;  3SEI A;  8ICS A;  2CN1 A;  2YMM A;  4UB2 A;  3BS5 B;  1UA0 A;  3KFU F;  1DGJ A;  1XC9 A;  9ICF A;  1Z1B A;  2FPL A;  5L1L A;  2XVT A;  5KFP A;  5CJ7 A;  9ICN A;  4R64 A;  1COK A;  3D2N A;  5KAI U;  3QUT A;  5J29 A;  1Z1V A;  8ICN A;  3THV A;  2KE7 A;  3EW9 A;  3V72 A;  2HBJ A;  4CCH A;  1SKW A;  2WB1 F;  2BGW A;  1P7D A;  3TAQ A;  3E0F A;  3QEB Z;  4F5Q A;  4F5R A;  3TAP A;  5JU5 A;  5ALJ A;  1YZ6 A;  3LYS A;  4UB6 U;  5ALQ A;  8ICI A;  3WKB A;  2ATL A;  3RB0 A;  4QZ8 A;  2V4R A;  1NJW A;  1VDV A;  5ALZ A;  3ZDD A;  3S6J A;  3GZF A;  4KLM A;  5KTQ A;  1MA7 A;  2QAR B;  2KP7 A;  3WK4 A;  7ICE A;  2MAX A;  2WB1 C;  5IIM A;  2WF6 A;  3OPX A;  1S77 D;  8ICM A;  4Y2R A;  5L1M A;  5DB7 A;  4DO9 A;  1D8B A;  4GXJ A;  5AKI A;  2M9N A;  2RLT A;  2BPC A;  4F5N A;  4OJL A;  1UHU A;  4RT2 A;  4DFP A;  4FFD A;  5KFK A;  4DQS A;  1ZQD A;  2BDP A;  5J2K A;  3Q8R B;  2EH9 A;  3ZDE A;  2HVI A;  5AM4 A;  4C7Y A;  3MR5 A;  3BDP A;  9ICR A;  4O5C A;  5AI6 A;  1ZQR A;  3QYP A;  4MFC A;  2RP5 A;  5JUM A;  2WTF A;  3F2C A;  2A1A A;  2NRV A;  1T94 A;  3HWT A;  4Y2V A;  4J9N A;  2G5H B;  3QUQ A;  5HP4 A;  5ALY A;  3AQE A;  3LK9 A;  2QKQ A;  3I1Y A;  4I2F A;  1JXE A;  5KT6 A;  4MEY A;  3RAX A;  4EX7 A;  1NK5 A;  4CE6 A;  2HHU A;  4RPX A;  4QNL A;  3PNC A;  1B0X A;  3UQ2 A;  4NL9 C;  3NGD A;  9ICQ A;  1ZRM A;  2JRZ A;  1JRP A;  3MFH A;  1TAM A;  2VA8 A;  1JN3 A;  2W9M A;  2K8B B;  5KG7 A;  3SI8 A;  1ZD3 A;  4IQV A;  4PHE A;  1ZQM A;  5KAF U;  4EEY A;  2E5S A;  1U4B A;  3OGU A;  3RB3 A;  9ICH A;  4DL2 A;  5HR6 A;  4Q8F A;  7ICK A;  3QZ7 A;  2ZTC A;  3R9K A;  4F5P A;  9ICK A;  4LZG A;  3PY8 A;  2XI9 A;  4RQ5 A;  2XO7 A;  1ZQ1 C;  2ASL A;  3IM1 A;  4QZ9 A;  2R18 A;  2GLE A;  2VAN A;  3JPO A;  1SV4 A;  4DFD A;  1SV0 C;  5KFV A;  1RZT A;  5J0O A;  1NK9 A;  2M0N A;  3AMZ A;  4RQM A;  5ALT A;  4F3O A;  3SMV A;  2H3Q A;  2B21 A;  5J2B A;  2DGZ A;  1N5W A;  4PHA A;  4Q44 A;  2G06 A;  2HSZ A;  9ICX A;  4P4M A;  4I2G A;  4EEK A;  2OEH A;  4C4S A;  4JMU A;  3SV3 A;  3V7J A;  1BVS A;  5KFZ A;  5C5J A;  3KHG A;  3KBB A;  9ICE A;  5HHH A;  2UVV A;  4RNN A;  7ICI A;  2F77 X;  7ICP A;  3GIJ A;  4BJQ A;  3BQ7 A;  2MA1 A;  1WCL A;  1NJZ A;  3RJK A;  1TK0 A;  2BKE A;  3OJS A;  9ICU A;  1XWL A;  3UMC A;  2Y1J A;  2D3D A;  4KLD A;  4M6W A;  4FBU A;  4IRK A;  2UVW A;  1XSP A;  1Z00 B;  2DPJ A;  3I76 A;  2ZG6 A;  4NLN A;  5EWG A;  3NVV A;  1IG6 A;  2Y0S C;  1TFR A;  1OXJ A;  3HT3 A;  4QWA A;  3HRD D;  4M0A A;  1S0O A;  2ZIX B;  4IQT A;  4ELT A;  3GII A;  3SEN A;  2YMP A;  3SAF A;  4YXM A;  2F8K A;  4RUA A;  1Z19 A;  4ECW A;  1ZQZ A;  4GXK A;  1ZD5 A;  2W9A A;  4FZN A;  4ELV A;  5J2A A;  2J6T A;  2KK0 A;  2LYA A;  4RQ6 A;  4Y2U A;  3RJH A;  5EE3 A;  3Q8M A;  1NKE A;  4RZR A;  2JEF A;  2DQN B;  1X6I A;  2K89 A;  4RPY A;  2I9G A;  4JV1 A;  4KTQ A;  3BS5 A;  1TK8 A;  4LZD A;  5ALO A;  4P0Q A;  1C7Y A;  3SZ2 A;  4F4Y A;  2W54 A;  1TKD A;  1OW5 A;  5AM1 A;  5AKL A;  3SD7 A;  1BPE A;  1SL0 A;  3MGV A;  1WYG A;  3RH6 A;  5AK3 A;  3WKC A;  2EZY A;  1S9F A;  3UXO A;  1DK2 A;  3PMN A;  4C8O A;  4KIT B;  2PXI A;  5D49 A;  2P35 A;  5D46 A;  4YD1 A;  2K4H A;  4NLZ A;  2PFQ A;  1Z4N A;  1KL9 A;  1PVQ A;  4BWM A;  2AGQ A;  4M2Y A;  1DK3 A;  3HIL A;  1MN8 A;  2KKP A;  2KV2 A;  4CRX A;  1ZQJ A;  1U48 A;  4OJ6 A;  4UAR A;  3F53 A;  3VC8 A;  5AIC A;  2NO4 A;  5ALI A;  4C4R A;  3N7R C;  2DKZ A;  4C80 A;  1NZB A;  9ICA A;  4F92 B;  1UT5 A;  1B22 A;  4IR1 A;  3WU2 U;  1NJX A;  3K75 D;  3H8S A;  5EE1 A;  3JPS A;  5J2H A;  1Q3V A;  3H8J A;  3UXP A;  3RJJ A;  4P4O A;  4EBC A;  1QCK A;  4QZI A;  3AU2 A;  4TUQ A;  2EAN A;  3IRU A;  5DGA A;  3PSI A;  4DFM A;  5KG4 A;  2XY6 A;  3WKA A;  9ICI A;  1RXW A;  2HHW A;  2G0A A;  3N7S C;  1L7M A;  2JGA A;  4ECT A;  5AI9 A;  1ZQW A;  4O9M A;  2K60 A;  4QIW F;  5HR7 A;  1S0V A;  1BNP A;  4I2E A;  1RQN A;  3NVW A;  5FP0 A;  3PML A;  4GLX A;  8ICJ A;  4R66 A;  4JK1 A;  3RBD A;  2BCR A;  2Y9T A;  3PR5 B;  2XCA A;  4AYB C;  4ECQ A;  5DBC A;  3RTV A;  3IG5 A;  2KSO A;  1L3U A;  1V85 A;  1HUZ A;  3L3F X;  3V6K A;  2OYY A;  2Z7J A;  5ALP A;  5HML A;  5KFD A;  4M9N A;  3ETR A;  5KT2 A;  2JR5 A;  1RG6 A;  1NJY A;  2NRT A;  1MC8 A;  2KMD A;  2HCF A;  1ZOL A;  1BGX T;  5F9N A;  5KG1 A;  4UB8 U;  5DLF A;  1X9S A;  9ICG A;  7ICS A;  3PW4 A;  2ZUC A;  3PW5 A;  5CEH A;  2EZX A;  1DXS A;  4UAW A;  5G5H A;  4UQG A;  2BPF A;  3T5J A;  4LJX A;  8ICG A;  3QEA Z;  2DKX A;  2WAQ F;  3L5K A;  2VA2 A;  5KG5 A;  4B9S A;  4KLQ A;  2UVU A;  3QUB A;  2MRL A;  4O5K A;  4ECR A;  2A3V A;  4QZF A;  4F4K A;  2ISO A;  4J9K A;  1IV8 A;  1JAL A;  1JRO A;  4DS4 A;  3NAS A;  2IHN A;  7ICT A;  3C5F A;  1CEZ A;  2F1J A;  1O03 A;  3PW7 A;  4RQ1 A;  4I2J A;  3HW8 A;  2JEI A;  8ICK A;  1DOQ A;  8ICR A;  2EAO A;  4DL4 A;  3RB4 A;  1L3T A;  3JPP A;  3DEE A;  4PL1 A;  2BR0 A;  4J03 A;  4CF5 A;  2KZM A;  1L7O A;  2FMQ A;  3F2B A;  2C2E A;  4O3O A;  4F4X A;  4EZ9 A;  1B4F A;  3FDS A;  3RAQ A;  4Z6E A;  1SXD A;  4OCZ A;  1ZQV A;  3LDA A;  2KHQ A;  3SAH A;  8ICX A;  2RDJ A;  2XGQ A;  3EZ5 A;  7ICG A;  1CRX A;  1LVH A;  3T5L A;  4IR9 A;  2G5I B;  4DSF A;  5EOZ A;  1MQ3 A;  4F8R A;  1URJ A;  2XY7 A;  2FLN A;  1H38 A;  3BJY A;  2V9W A;  5J8Y A;  5KG2 A;  2HOF A;  1HJP A;  3PSP A;  5J0U A;  4G3I A;  1T3N A;  4NLC A;  2FI1 A;  5AKG A;  2KIV A;  5A0L A;  5AIB A;  2G09 A;  3ZD8 A;  1S0M A;  1JX4 A;  2UVR A;  1NK6 A;  2JEG A;  4J9M A;  2W7O A;  4RT3 A;  2W11 A;  3A0B U;  4M47 A;  1Q8K A;  2Y9U A;  4F2S A;  3UQ0 A;  1ZQF A;  3QUC A;  1N61 A;  4UAZ A;  2LYB A;  3RR7 A;  2ZIW B;  3IN5 A;  2ZIW A;  3ALR A;  4F91 B;  1L6N A;  4FE3 A;  7ICO A;  4QWE A;  1XO0 A;  2YQE A;  2W55 A;  3ZD9 A;  4KLF A;  8ICA A;  5DDM A;  4FZL A;  3UXN A;  5HNK A;  2NYV A;  2O6K A;  2W9B B;  2GWS A;  1L3V A;  1DRG A;  4ED7 A;  5AKX A;  1JIH A;  4QIW C;  4OD0 A;  4BWJ A;  1ZD4 A;  2K4P A;  5CR0 A;  4F72 A;  2KJ8 A;  2W7P A;  3MGI A;  1OUQ A;  3SAG A;  1CI4 A;  8ICY A;  4KLI A;  4ED1 A;  3N97 B;  5KFI A;  4QZH A;  3PO5 A;  4NY8 A;  2F44 A;  4QWD A;  4GFJ A;  1S0N A;  3ISC A;  7ICM A;  3WK6 A;  2E3T A;  2I5H A;  4KLG A;  2EQY A;  1RQL A;  3G6X A;  4ED2 A;  2KFZ A;  4O3R A;  8ICP A;  7ICJ A;  4P0P B;  1N5X A;  2W9C A;  4BXO A;  3BQ2 A;  4FO6 A;  4Y2Y A;  3AL0 B;  4YP3 A;  3JPR A;  1T7P A;  1L8L A;  5KNI A;  3C2L A;  5E79 U;  4UAU A;  2E8P A;  3TFS A;  2K8C B;  1PZN A;  4ECX A;  2G08 A;  5KFS A;  4J9L A;  1UA1 A;  1KW4 A;  2HVH A;  3TAN A;  1SWV A;  2IBK A;  3RJE A;  2KOB A;  4Y2T A;  2JH7 A;  5IIL A;  2AQ4 A;  1X2I A;  5KT5 A;  2ZTD A;  2FPM A;  2IMW P;  3M9O B;  1JMS A;  2HOI A;  5L1J A;  4YCX A;  4UB1 A;  3IHQ B;  1UQV A;  1RYU A;  2XIC A;  4RQ7 A;  3QZ8 A;  1FO4 A;  2KFN A;  5KFY A;  4F50 A;  5ALR A;  5AM3 A;  3B0X A;  4PGX A;  3LWM A;  4B9L A;  4UBB A;  4YMM A;  1HIW A;  4EZ6 A;  4B9U A;  2BHN A;  3QU7 A;  1IXR A;  4ICA A;  3T5K A;  3T3F A;  3PX4 A;  4R8U A;  1RDF A;  5JTI A;  3BQ0 A;  8ICO A;  4DF8 A;  4IRD A;  4YQW A;  2KSO B;  2OXO A;  4AP9 A;  5ALS A;  3G6V A;  2W03 A;  4I2C A;  4DQP A;  3RR8 A;  2ODG A;  3WK5 A;  2YY6 A;  1NK7 A;  3IDW A;  3M6Z A;  4DLG A;  2GO7 A;  4KLL A;  1PK1 A;  1QQ5 A;  4QWC A;  3OSN A;  4O0I A;  5KFN A;  2ZUB A;  2H3Z A;  1ZXI A;  3M8R A;  5DKW A;  4O3Q A;  2HHT A;  3M6K A;  5KFW A;  5AI0 A;  1CUK A;  5CP2 A;  4P0Q B;  2WHE A;  3GQC A;  4F2R A;  4PJ0 U;  4RQ8 A;  1WWV A;  2YX8 A;  3D2Q A;  1X9M A;  4ECU A;  2WF5 A;  3VCB A;  2QAR A;  5J2C A;  1YZ7 A;  4DOA A;  1QSS A;  4NLB A;  7ICF A;  3C1Y A;  1HEK A;  3JPT A;  1FIQ A;  3SV4 A;  4BUG A;  5GTI U;  4AYB F;  3HKZ C;  5J8Y C;  5ALH A;  1JI7 A;  1M6Y A;  1V9P A;  1X66 A;  4I2A A;  3BS7 A;  3AN1 A;  4OJO A;  2PMZ F;  3C5G A;  2BPG A;  2LI6 A;  4CF4 A;  4QW9 A;  2IOF A;  4QW8 A;  5ALU A;  4ZH4 A;  1WUD A;  5J2G A;  3CYM A;  5KFM A;  1SV0 A;  3RJF A;  4YFK A;  3QU4 A;  4FZM A;  1ZQC A;  7ICL A;  4QZB A;  4O3M A;  2KKV A;  1ZQL A;  5DLG A;  4RNM A;  4TUS A;  2LM4 A;  3SQI A;  2HI0 A;  3EWA A;  3TFR A;  4M9L A;  1X9W A;  2R8G A;  3TAC B;  4XQ8 A;  4ECZ A;  1ZD2 P;  4I28 A;  4QWB A;  3LWL A;  3RH4 A;  2QB0 B;  3M7D A;  1PK1 B;  3Q8P B;  4USA A;  2HHS A;  2VKQ A;  4CF3 A;  1KQQ A;  5AI4 A;  1QTM A;  3GV5 B;  4WJ3 B;  1ZQE A;  2QLT A;  2PFO A;  4PZN A;  4KLH A;  3TKA A;  3KHH A;  4DL6 A;  4Z6F A;  5CWR A;  3QE9 Y;  2I1Q A;  1VLB A;  8ICQ A;  4F93 B;  4K4I A;  3LVV A;  1ZET A;  3HPO A;  8ICZ A;  2E1F A;  1S97 A;  2HHV A;  2C2R A;  1J2N A;  1N56 A;  2AGO A;  2ZIV B;  3K4G A;  2AGP A;  3U26 A;  4KX3 A;  1ZQA A;  3K1R B;  7ICN A;  2JZB A;  5DQI A;  1B43 A;  5B66 U;  2H5X A;  1WCN A;  4KN4 A;  4EBE A;  4JV2 A;  2MUT B;  5CA7 A;  3KTQ A;  3F2D A;  4TUP A;  1LB2 B;  5KT4 A;  2KIW A;  1QSL A;  1C20 A;  2PI5 A;  4J9R A;  2KG5 A;  3KOO A;  2Y0S F;  3Q8Q B;  4Y2X A;  2F2A B;  5AKJ A;  4U6P A;  4DWI A;  5KFJ A;  4P2H A;  3CW2 C;  2RQ5 A;  2BCV A;  2WF9 A;  3A0H U;  4UAT A;  2FE9 A;  5L1I A;  1NK8 A;  3D2S A;  4RQ0 A;  5AK4 A;  2QB0 A;  3IP4 B;  3H7I A;  1KTQ A;  5EE0 A;  5KFG A;  2DF4 B;  3MFI A;  4Q45 A;  4GIB A;  4MHV A;  2MU2 A;  1ZQS A;  3QXG A;  1SXE A;  1QQ6 A;  2P6U A;  3KKA A;  2CXY A;  2DPI A;  9ICS A;  2JXJ A;  2KHV A;  5ALE A;  3I28 A;  4FS2 A;  4DLE A;  1RXV A;  2OWO A;  4B9N A;  2HW3 A;  4KMU A;  5AKY A;  4F4W A;  4NJ8 A;  3ZI4 A;  2OCE A;  3M9M B;  5ALV A;  4YR0 A;  3M1Y A;  4DOC A;  3GV7 B;  2ASD A;  9ICC A;  1A6S A;  2R8J A;  2KD1 A;  4DSE A;  7ICQ A;  3NTU A;  3N4M B;  2C22 A;  4MFA A;  3M8S A;  3PW2 A;  4PL2 A;  2OHF A;  2EZZ A;  5ALX A;  3BZK A;  1XSN A;  5HHI A;  1KN5 A;  2VA3 A;  2YTU A;  2E8N A;  4YR3 A;  3OJU A;  3GDX A;  4XRH A;  5DB8 A;  4PGQ A;  1ZQI A;  1LKY B;  4YR2 A;  5T14 A;  3RFA A;  1BPB A;  5DBA A;  5KFH A;  3FC4 A;  3J81 j;  2JZB B;  4NXZ A;  2NRX A;  1QLN A;  3GU3 A;  4OJ5 A;  3FAH A;  5BPC A;  1U47 A;  5TZV A;  1ED1 A;  3H4D A;  5J0P A;  3HX0 A;  4QZC A;  5AM2 A;  1V97 A;  1PUZ A;  1WWU A;  2G07 A;  2ISP A;  8ICH A;  8ICT A;  2YMQ A;  1PK3 A;  3GV8 B;  1N62 A;  2GOL A;  1ECW A;  3TAD C;  5AKE A;  4ED8 A;  4QZE A;  3M9N B;  4ED6 A;  3ZDA A;  4M9H A;  2YB4 A;  2HMX A;  3DDH A;  3CNH A;  1N60 A;  3MC1 A;  2PI4 A;  1ZYQ A;  4UW9 A;  1NKB A;  4HYK A;  1J97 A;  3GIL A;  2FPK A;  3ZDB A;  8ICL A;  1MQ2 A;  1NOM A;  2BQ3 A;  4DSI A;  1NK0 A;  4KLT A;  4IS7 A;  3C23 A;  1FEZ A;  5IIK A;  2D6F C;  2WF8 A;  1K5O A;  5J0T A;  3MDA A;  3ISB A;  5B5E U;  4BGD A;  1Z4O A;  5ALL A;  2KZZ A;  3C28 A;  4DEZ A;  1S5L U;  3OTQ A;  2XY5 A;  4UB3 A;  4Y2Q A;  4YXJ A;  2KVC A;  5KFO A;  4I2D A;  3WKD A;  2KJ5 A;  4YD2 A;  1TAQ A;  4PPX A;  4I2B A;  4DS5 A;  4YG2 A;  1T3Q A;  3WK9 A;  1BPD A;  3CP8 A;  5J0S A;  2Q4T A;  2JH1 A;  1ZQT A;  4RQ4 A;  1NZP A;  4UBC A;  5L1K A;  1KKX A;  4Y2S A;  3MBY A;  3TQ1 A;  2WFA A;  1L5U A;  5KFA A;  9ICL A;  1RYR A;  2ZIV A;  3ICX A;  3KZX A;  3RJI A;  2FLP A;  5J0Y A;  5EWF A;  3PZP A;  5ALD A;  4KLJ A;  3B0Y A;  1SB3 C;  1A0P A;  5EE9 A;  1SL1 A;  2DFL A;  2W9B A;  3KHL A;  4E0D A;  1BPX A;  2QB1 A;  2KVS A;  2ZJ8 A;  7ICU A;  5KFU A;  4GXI A;  2KZ3 A;  4JWN A;  5KFF A;  4US8 A;  4DOB A;  5F9L A;  4NM1 A;  4LVS A;  3QU2 A;  4IC9 A;  4Y2J A;  5AI5 A;  2HBK A;  4HAI A;  2KNJ A;  4RQN A;  4Z6C A;  5ALF A;  2NO5 A;  4TQR A;  1Y88 A;  3EUB 2;  2F76 X;  4UB4 A;  3AUO A;  2YML A;  3SR6 A;  3GFK B;  2H3I A;  5CHG A;  1T8E A;  4F5O A;  4MF2 A;  3C2K A;  2W8L A;  5J2J A;  2B0C A;  1BPZ A;  3TI0 A;  4NL9 A;  2Q0Z X;  4DL3 A;  1S8O A;  4RPZ A;  3BQ1 A;  2XID A;  4NLG A;  4NLK A;  4C8L A;  3RB6 A;  3T79 A;  3E58 A;  3MDC A;  2KJ9 A;  1Q3U A;  2HBL A;  4IQW A;  4JV0 A;  2J6S A;  2LPE A;  2DL0 A;  2N1R A;  3C21 A;  5AM0 A;  4IL6 U;  1KSP A;  4ELU A;  2E8M A;  5AI8 A;  3IG8 A;  4UAY A;  2BCS A;  4DQI A;  3Q8S B;  2CPR A;  2JEJ A;  3BZC A;  5KFT A;  3NRZ A;  2IOF K;  4UAS A;  1KRP A;  5JRT A;  3ETL A;  2J6U A;  3AEV A;  5KG0 A;  2E8O A;  3H40 A;  3PX6 A;  2F1I A;  4C7Z A;  4UAV A;  2MSN A;  4P4P A;  5J2E A;  3T5H A;  3UM9 A;  4ACO A;  1BNO A;  8ICB A;  2C28 A;  3PX0 A;  2NRW A;  2AXT U;  2ES6 A;  3C29 A;  1XS9 D;  5ALW A;  2XGP A;  4QZD A;  4Q8E A;  3NVY A;  3MR6 A;  4C8K A;  4IQU A;  3QNM A;  3Q8L A;  1GO3 F; 
#chains in the Genus database with same CATH homology
 5K4L A;  2EH9 A;  2JRZ A;  5CEH A;  1C20 A;  2KK0 A;  1RYU A;  2LM1 A;  1KKX A;  4LJX A;  2RQ5 A;  2CXY A;  2YQE A;  1KQQ A;  2OEH A;  2EQY A;  2LI6 A;  2JXJ A;  1KN5 A;  1IG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...