2JXNA

Solution structure of s. cerevisiae pdcd5-like protein ymr074cp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'MDPELQCIRECRLAQLKNNSGGTNGDRNSGANNGGGENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YMR074C
molecule tags Unknown function
source organism Saccharomyces cerevisiae
publication title Solution Structure and Dynamics of S. cerevisiae PDCD5-like Protein Ymr074cp Determined by Heteronuclear NMR Spectroscopy
rcsb
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2jxnA01
2CRUA 1EIJA 2JXNA 2K6BA 2FH0A
chains in the Genus database with same CATH superfamily
2VQEM 2Y20A 1N75A 2E5LM 2DVWB 3J2PB 4FW9A 4RKUF 4ZPXA 4IIWA 3HZJA 4QNRA 4JI7M 4LZZA 2MR9A 1QUTA 3HHXA 1IY0A 5ITTA 1XXHE 1SXJC 2CHVA 2Z8YM 3SYKA 1DGHB 2DAEA 4M9ZA 3VDUA 3GLGA 4DV5M 1PJJA 2UUBM 4LFBM 1NNUC 2OPFA 2LHCA 4GMQA 3RFWA 3AJIB 1VDLA 1XHBA 4IBJA 1G8PA 2VF8A 1VEJA 3GQ3A 1L1TA 1HT2E 1SG9A 2DHRA 2V1UA 4LRTA 4JV5M 2X4AA 2EUCA 1QDRA 2JUJA 4IBGA 1HNXM 1IXZA 3GLFE 1NV8A 3L25A 2H5XA 1GVNA 1MU5A 3TWLA 1L1ZA 3KSXA 3U6LA 3IECA 2RGOA 4ANRA 4KO8A 4L6V6 4JI5M 1QZEA 3ZH9B 3VKGA 2XGNA 1KSFX 3GRVA 2HCBA 5BR8M 5GKNA 3K9OA 1PJSA 2LNHC 1NNJA 2HL7A 2Z4RA 2LXEA 1N78A 2UXCM 1HQYE 1Z5CA 1HNWM 3MK6A 4KODA 4AW4A 1XNQM 2XZFA 1DGGA 3VDPA 5DFLA 2NQ8C 4MGIE 2CRUA 1TDHA 1G3IA 4KT0F 2L4FA 3HKPA 3KW6A 4WW0A 3GQ5A 3PNYA 2FE8A 1SXJB 4QHTA 1HJPA 2V1CA 3T15A 1Q3BA 1C7YA 2R4JA 1E9SA 4NL4H 2J7OA 1YE9A 3KOYE 4JI0M 2F5SA 2R18A 3SATA 1QAQA 2A5YB 2DZNB 3M7GA 3LVVA 1AUAA 4IBCA 3HJQA 7CATA 2O01F 1MJGM 2HKJA 2UXDM 1C1KA 2L4EA 1AIPC 2VDBB 1JR3A 3U6CA 3SAVA 3J7AS 3GQ4A 3B9PA 2K0BX 4CISA 5C18A 2QENA 1IY2A 1Y8GA 1OIPA 4FWDA 3HWSA 4G4RA 4W5WA 3GP1A 3BOSA 3CF0A 3E46A 2DZLA 3PFIA 1VDDA 2HHHM 4FWHA 3UGJA 2KZSA 3GPUA 3QYEA 3SMSA 4NXMM 2KEBA 2OOAA 4IBKA 3W0FA 2LVNC 1J09A 1OAOC 1IN4A 2EKFA 8CATA 1OTRA 4QOZC 4GITA 1NHWC 3V76A 5KO3A 2R46A 3BXWA 1YSYA 3C9PA 3KP0E 2CHQA 1D2NA 1VQ1A 4LFCM 1PJTA 1WIVA 4LGYA 3TE6A 2OQ4A 3AOGA 4Q7JA 3SAWA 2QP9X 4IBEA 3A98B 1TR8A 2L7IA 1QZMA 2APLA 3GLHB 4IBFA 4OU7A 3SHGB 4DV7M 4LF8M 3HU2A 3ILKA 1I94M 1IN7A 3FUUA 3WHLA 1NJFA 2FS1A 4AKIA 4NSRA 2XSZA 5DYIA 2QBYB 4CIZA 4MGZE 3PNVA 5EJCA 3E4RA 4GHAA 4REZA 2GNOA 4DV6M 2HAKA 1T6OA 3I01M 3AV0A 4KLNA 2HWJA 4BB9A 4B7HA 4B3SM 4IBDA 3RGSA 4L16A 3CGWA 3KDSE 2UXBM 4EIWA 3SYLA 4MGHA 4FCTA 2K9DA 3GLHA 3GPPA 1ORYB 2F5QA 4X65M 3FYDA 4R3DA 3R9XB 2WSFF 3L29A 2ZAMA 3KXEC 3U6MA 1TDZA 1IY1A 4M9XA 4LGMA 1FNNA 2KRUA 1XNRM 4MM3B 1L2BA 1W5SA 3L2AA 2F5PA 5KPTA 1NO1A 1QANA 1R2ZA 1R7RA 3HJSA 1QAMA 1IXRC 2DHYA 2DKLA 1VEGA 2QCUA 4JI8M 3GLIE 3FE3A 5EQTA 1XB2B 3KFUG 3EIHA 2JWSA 2I7NA 2JY7A 2JZ0A 4MH0E 2Y0QA 3QAUA 4LJ5A 4G4OA 1OAIA 2UUAM 3T1HM 4LJ4A 3FTEA 1D0MA 4R71A 3EIEA 3FUXA 2R45A 4IJFA 3AOEA 2JY5A 3SC3A 3GLFA 3U6OA 4AKHA 2DWZB 3LMMA 2R0IA 3NBIA 4L8RC 2CHGA 3LW5F 3AL0C 4I8OA 4DV3M 2X8AA 3DOAA 5EXSA 3U6PA 3J80S 2R65A 1N36M 1K3WA 1XXHB 3FRIA 3MMPA 4X66M 4NOOB 1QVRA 1NJGA 2X49A 1GKIA 3SASA 2BJWA 4CJ6A 1PRBA 4LJ9A 2R62A 3CTWB 4DBGB 5JI3E 5L8RF 4X64M 1IFYA 2XH9A 4OX9M 4TUWA 3NBXX 2DZOB 4X62M 4AG5A 4DR2M 3U6QA 4DUYM 3CF2A 1IQPA 3D8LA 5DYGA 3TWKA 1WJ7A 2LVAA 3GRUA 1XXHA 3L27A 1QUSA 1ZAEA 3A42A 1GABA 2KDLA 2JNHA 2RRUA 4P17A 3GLFB 4D82A 1TGUA 1GJTA 2EKKA 4FCVA 4GRIA 3VK7A 1MN3A 3HHWA 4D80A 1OJLA 1QYRA 2ZTDA 4DV4M 4NRWA 4HL4A 5C1BA 1TF0B 5ITRA 1KFVA 3KOXE 4MGYE 5KQ8A 3H4MA 2R44A 3U5ZB 3F92A 2Z4SA 1G41A 4IJEA 4PCZA 1Z59A 5IREB 4D81A 3U61B 5F3WA 2DWLA 1WR1B 2L7HA 1S3SA 4L4UA 2QZ4A 4B3TM 3IG5A 4DR6M 3FUWA 2FH0A 4F2LA 4PD2A 2XLJA 2DAMA 4M0WA 2DXIA 2XSZD 3DA1A 1WGNA 2BNKA 3TL4X 2XZUA 2GQFA 4GHLA 4GKJM 3NWLA 4L78A 4DR4M 2C98A 4JI1M 3VKHA 2DENA 3W67A 4LY6A 2KW0A 1P3QQ 3FTCA 5ITXE 2LBCA 4FVMA 4KHPM 2P5TA 3LQRA 1Z5BA 1SXJE 1IBMM 2BWEA 1IN5A 4LJ6A 2KNVA 4DV0M 1LV7A 2WSEF 2Z3XA 3FUTA 5FTJA 4LF7M 2DWMA 2EJSA 2C99A 2YR0A 5ITUA 3HX3A 3W0LB 3K1JA 2L6OA 4GC5A 1DO0A 1V92A 3K92A 4PT5A 3K9PA 3U6SA 3FRHA 4UN2B 1V34A 2R4EA 3B7NA 4XGIA 4GEWA 1J7KA 3GPYA 4DR3M 3GLGE 1CUKA 4QOSA 4I4LA 2LWXA 3D8BA 5LMUM 4WURA 4PDGA 3MHVC 2M5ZA 3VLFB 4JN6A 2D7EA 2B3TA 4G6ZA 4B08A 4HLQA 3PXGA 4GIPA 3SMPA 1HR0M 3FTDA 3SHFA 3QYBA 5EXTA 4PDIA 5FLXS 4AI6A 2F5NA 3HHZA 3Q8XA 1KYIA 4B7FA 2LVOC 3E21A 3UK6A 1G71A 1XMOM 3SAUA 3H4JA 3GRRA 1H6UA 2XFTA 3KS4A 3JAMS 3JR4A 2CE7A 1GJSA 3KOWE 1OKSA 1R5LA 2UUCM 3VFDA 4JI6M 1TH3A 2ZANA 3IG8A 2D7GA 1MX0A 1NV9A 1PM5A 4LJ7A 4M9SA 3VK8A 5EP2A 4RF0A 5KQDA 4WP2A 4JI3M 2JZ1A 2FOIC 2KHHA 3CF6E 1XC8A 2ZTCA 3KS8A 4BBAA 1JR3E 3QWLA 4M0DA 2ERCA 2M60A 3DFZA 2CFOA 1IN8A 5EP3A 2KA6B 3KOZE 3MJ5A 4LJ8A 1QDTA 2Z7JA 5H37D 2YFQA 5E26A 1R6BX 4HEOA 4DV1M 4LF6M 1YUBA 3SBJA 1WHCA 1OFHA 1EIJA 4I5SA 2EA0A 3RE8A 2D7HA 4YHHM 2C5RA 1K82A 1IBKM 2UU9M 3KVWA 4LCBA 2FNAA 3A46A 4FWGA 2YNMD 1XMQM 2ZAOA 3I4VA 2CV2A 2QBYA 1SXJA 1WXQA 2DAKA 3GRYA 2ZM6M 3T1YM 2LHGA 1JR3D 2CV1A 1UM8A 4LG2A 3THGA 4G4QA 2MROB 4OW0A 4OVZA 2CV0A 1DV0A 1G59A 3HHYA 2W82A 2VIIA 1NY6A 2QNJA 4R7GA 2L2DA 5ITYA 2KXEA 2XEPA 1IXSB 2BJVA 2C96A 2Y21A 5DNYA 4DUZM 1K3XA 4JI4M 3FTFA 4NSOB 3GLIB 3LQQA 3B89A 2QPAA 3C58A 4DR1M 3ZCBB 2CP8A 4JXJA 1N34M 1BVSA 1R4GA 1GL7A 1IXSA 2BWBA 2MH8A 3AOEC 4LF4M 5E6JA 5IWAM 4LRSA 3J81S 2JY6B 2OOBA 1G4AE 4RF1A 4DR5M 1E9RA 1E32A 3WHKA 1PGYA 2H1RA 2C9OA 3LCVB 2LVQD 1NSFA 2JP7A 2OO9A 3B7ZA 4LJAA 2JA2A 4MB7A 4Z6YA 4DR7M 3C3DA 2JXNA 4XBOA 2J5YA 1NHGC 1NY5A 1OFIA 4NC6A 5FTNA 3L26A 3T6PA 3SFZA 2VQFM 2LTUA 3I4YA 4MGKE 3HY5A 3T38A 1TH2A 1EE8A 4LZJA 3LVWA 4Z8XA 3U6DA 1L2CA 5EXXA 2V6ZM 2KRKA 4AQYM 4GH9A 4LFAM 1JB0F 2AHMA 3AFHA 3PVSA 2MJ5B 2N35A 1Q39A 2MGWA 2K47A 3FD9A 1D0LA 1T43A 1IM2A 3K8ZA 3M6AA 2VF7A 3TWMA 2JY8A 1JQJC 1N33M 3HJ8A 4IBIA 4S12A 1F4IA 5FTKA 3TPZA 2G8LA 2QHOB 1TH4A 4QHSA 4LF9M 4BLCA 5FSWA 1HQCA 1ZV1A 4GC9A 1EFUB 1Q02A 1J5EM 2ZBKB 3B7QA 3W68A 1L2DA 1TTEA 2J7NA 3UJNA 1ZQ9A 2G5GX 2RGHA 3J7BA 1ZMWA 4CGYB 3J27B 3BBZA 1YLAA 2DAGA 2O5RA 4NXNM 3LCUA 1QAOA 4JI2M 1RU3A 2EO2A 1OIZA 2C9CA 4YY3M 1VG5A 1ZMVA 2WZJA 2YQZA 2DNAA 5KPZA 3GLIA 2KNZA 3RGPA 4GKKM 1X37A 2K6BA 3HU3A 4B3MM 3B74A 4II7A 3U60B 4B7GA 5ITQA 5IZ7D 3HGIA 2R6FA 3KSJA 4FD2A 2KNAA 4A3VB 1DGBA 3U6EA 4OVZB 4AG6A 4P16A 4AKGA 1GO5A 2XFSA 4ITQA 2O25A 3FUVA 2CEAA 4Y28F 2LVPC 2XF3A 4G4NA 3GLHE 3UZUA 3R8FA 2KZUA 3A45A 3FKEA 1Z6TA 3E9SA 3AKZA 5FTMA 5KPRA 3DZDA 1D0KA 3HU1A 2CUZA 5EXPA 2LH0A 1DGFA 5BPVA 1Q3CA 1LTMA 5EP1A 1DGHA 2WSCF 4NRVA 3GLGB 3C3EA 4G3OA 3TQSA 3GO8A 1XWIA 2I7PA 1PJIA 1T3TA 4CHTB 1GLNA 3K2LA 3ZC7B 2G3QA 1UFZA 1I4WA 1HT1E 3JR5A 5IT9S 4JYAM 4AZFA 3U60A 4I81A 3SARA 4QNMA 1ZMUA 5A2QS 2Y0TA 2QQ8A 2RKOA 3M0EA 1L8QA 1SXJD 4IBBA 1PJQA 5ITXA 1N32M 2F5OA 3I51A 3Q8GA 4FCWA 5LMNM 3I04M 1IBLM 2F4VM 2CWBA 1R2YA 1DO2A 1FJGM 1N77A 3U61A 3IHPA 1GL6A 1QQWA 5FTLA 3U5ZA 2Q2EB 4K0KM 2DAIA 2FFJA 1W5TA 2DI0A 2L09A 1HNZM 1VEKA 4F1IA 5EP4A 1E94E 1NVMA 3FYCA 4RNAA 1WGLA 3L28A 3UMMA 3OTOM 4LF5M 4DV2M 1V33A 1Z5AA 2QSFX 3ZQJA 5JI2E 4XK8F 1OQYA 3KP1E 4B3RM 1IN6A 2DWNA 1A5TA 4L15A 3GPXA
chains in the Genus database with same CATH topology
2CRUA 1EIJA 2JXNA 2K6BA 2FH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRU A;  1EIJ A;  2JXN A;  2K6B A;  2FH0 A; 
#chains in the Genus database with same CATH topology
 2VQE M;  2Y20 A;  1N75 A;  2E5L M;  2DVW B;  3J2P B;  4FW9 A;  4RKU F;  4ZPX A;  4IIW A;  3HZJ A;  4QNR A;  4JI7 M;  4LZZ A;  2MR9 A;  1QUT A;  3HHX A;  1IY0 A;  5ITT A;  1XXH E;  1SXJ C;  2CHV A;  2Z8Y M;  3SYK A;  1DGH B;  2DAE A;  4M9Z A;  3VDU A;  3GLG A;  4DV5 M;  1PJJ A;  2UUB M;  4LFB M;  1NNU C;  2OPF A;  2LHC A;  4GMQ A;  3RFW A;  3AJI B;  1VDL A;  1XHB A;  4IBJ A;  1G8P A;  2VF8 A;  1VEJ A;  3GQ3 A;  1L1T A;  1HT2 E;  1SG9 A;  2DHR A;  2V1U A;  4LRT A;  4JV5 M;  2X4A A;  2EUC A;  1QDR A;  2JUJ A;  4IBG A;  1HNX M;  1IXZ A;  3GLF E;  1NV8 A;  3L25 A;  2H5X A;  1GVN A;  1MU5 A;  3TWL A;  1L1Z A;  3KSX A;  3U6L A;  3IEC A;  2RGO A;  4ANR A;  4KO8 A;  4L6V 6;  4JI5 M;  1QZE A;  3ZH9 B;  3VKG A;  2XGN A;  1KSF X;  3GRV A;  2HCB A;  5BR8 M;  5GKN A;  3K9O A;  1PJS A;  2LNH C;  1NNJ A;  2HL7 A;  2Z4R A;  2LXE A;  1N78 A;  2UXC M;  1HQY E;  1Z5C A;  1HNW M;  3MK6 A;  4KOD A;  4AW4 A;  1XNQ M;  2XZF A;  1DGG A;  3VDP A;  5DFL A;  2NQ8 C;  4MGI E;  2CRU A;  1TDH A;  1G3I A;  4KT0 F;  2L4F A;  3HKP A;  3KW6 A;  4WW0 A;  3GQ5 A;  3PNY A;  2FE8 A;  1SXJ B;  4QHT A;  1HJP A;  2V1C A;  3T15 A;  1Q3B A;  1C7Y A;  2R4J A;  1E9S A;  4NL4 H;  2J7O A;  1YE9 A;  3KOY E;  4JI0 M;  2F5S A;  2R18 A;  3SAT A;  1QAQ A;  2A5Y B;  2DZN B;  3M7G A;  3LVV A;  1AUA A;  4IBC A;  3HJQ A;  7CAT A;  2O01 F;  1MJG M;  2HKJ A;  2UXD M;  1C1K A;  2L4E A;  1AIP C;  2VDB B;  1JR3 A;  3U6C A;  3SAV A;  3J7A S;  3GQ4 A;  3B9P A;  2K0B X;  4CIS A;  5C18 A;  2QEN A;  1IY2 A;  1Y8G A;  1OIP A;  4FWD A;  3HWS A;  4G4R A;  4W5W A;  3GP1 A;  3BOS A;  3CF0 A;  3E46 A;  2DZL A;  3PFI A;  1VDD A;  2HHH M;  4FWH A;  3UGJ A;  2KZS A;  3GPU A;  3QYE A;  3SMS A;  4NXM M;  2KEB A;  2OOA A;  4IBK A;  3W0F A;  2LVN C;  1J09 A;  1OAO C;  1IN4 A;  2EKF A;  8CAT A;  1OTR A;  4QOZ C;  4GIT A;  1NHW C;  3V76 A;  5KO3 A;  2R46 A;  3BXW A;  1YSY A;  3C9P A;  3KP0 E;  2CHQ A;  1D2N A;  1VQ1 A;  4LFC M;  1PJT A;  1WIV A;  4LGY A;  3TE6 A;  2OQ4 A;  3AOG A;  4Q7J A;  3SAW A;  2QP9 X;  4IBE A;  3A98 B;  1TR8 A;  2L7I A;  1QZM A;  2APL A;  3GLH B;  4IBF A;  4OU7 A;  3SHG B;  4DV7 M;  4LF8 M;  3HU2 A;  3ILK A;  1I94 M;  1IN7 A;  3FUU A;  3WHL A;  1NJF A;  2FS1 A;  4AKI A;  4NSR A;  2XSZ A;  5DYI A;  2QBY B;  4CIZ A;  4MGZ E;  3PNV A;  5EJC A;  3E4R A;  4GHA A;  4REZ A;  2GNO A;  4DV6 M;  2HAK A;  1T6O A;  3I01 M;  3AV0 A;  4KLN A;  2HWJ A;  4BB9 A;  4B7H A;  4B3S M;  4IBD A;  3RGS A;  4L16 A;  3CGW A;  3KDS E;  2UXB M;  4EIW A;  3SYL A;  4MGH A;  4FCT A;  2K9D A;  3GLH A;  3GPP A;  1ORY B;  2F5Q A;  4X65 M;  3FYD A;  4R3D A;  3R9X B;  2WSF F;  3L29 A;  2ZAM A;  3KXE C;  3U6M A;  1TDZ A;  1IY1 A;  4M9X A;  4LGM A;  1FNN A;  2KRU A;  1XNR M;  4MM3 B;  1L2B A;  1W5S A;  3L2A A;  2F5P A;  5KPT A;  1NO1 A;  1QAN A;  1R2Z A;  1R7R A;  3HJS A;  1QAM A;  1IXR C;  2DHY A;  2DKL A;  1VEG A;  2QCU A;  4JI8 M;  3GLI E;  3FE3 A;  5EQT A;  1XB2 B;  3KFU G;  3EIH A;  2JWS A;  2I7N A;  2JY7 A;  2JZ0 A;  4MH0 E;  2Y0Q A;  3QAU A;  4LJ5 A;  4G4O A;  1OAI A;  2UUA M;  3T1H M;  4LJ4 A;  3FTE A;  1D0M A;  4R71 A;  3EIE A;  3FUX A;  2R45 A;  4IJF A;  3AOE A;  2JY5 A;  3SC3 A;  3GLF A;  3U6O A;  4AKH A;  2DWZ B;  3LMM A;  2R0I A;  3NBI A;  4L8R C;  2CHG A;  3LW5 F;  3AL0 C;  4I8O A;  4DV3 M;  2X8A A;  3DOA A;  5EXS A;  3U6P A;  3J80 S;  2R65 A;  1N36 M;  1K3W A;  1XXH B;  3FRI A;  3MMP A;  4X66 M;  4NOO B;  1QVR A;  1NJG A;  2X49 A;  1GKI A;  3SAS A;  2BJW A;  4CJ6 A;  1PRB A;  4LJ9 A;  2R62 A;  3CTW B;  4DBG B;  5JI3 E;  5L8R F;  4X64 M;  1IFY A;  2XH9 A;  4OX9 M;  4TUW A;  3NBX X;  2DZO B;  4X62 M;  4AG5 A;  4DR2 M;  3U6Q A;  4DUY M;  3CF2 A;  1IQP A;  3D8L A;  5DYG A;  3TWK A;  1WJ7 A;  2LVA A;  3GRU A;  1XXH A;  3L27 A;  1QUS A;  1ZAE A;  3A42 A;  1GAB A;  2KDL A;  2JNH A;  2RRU A;  4P17 A;  3GLF B;  4D82 A;  1TGU A;  1GJT A;  2EKK A;  4FCV A;  4GRI A;  3VK7 A;  1MN3 A;  3HHW A;  4D80 A;  1OJL A;  1QYR A;  2ZTD A;  4DV4 M;  4NRW A;  4HL4 A;  5C1B A;  1TF0 B;  5ITR A;  1KFV A;  3KOX E;  4MGY E;  5KQ8 A;  3H4M A;  2R44 A;  3U5Z B;  3F92 A;  2Z4S A;  1G41 A;  4IJE A;  4PCZ A;  1Z59 A;  5IRE B;  4D81 A;  3U61 B;  5F3W A;  2DWL A;  1WR1 B;  2L7H A;  1S3S A;  4L4U A;  2QZ4 A;  4B3T M;  3IG5 A;  4DR6 M;  3FUW A;  2FH0 A;  4F2L A;  4PD2 A;  2XLJ A;  2DAM A;  4M0W A;  2DXI A;  2XSZ D;  3DA1 A;  1WGN A;  2BNK A;  3TL4 X;  2XZU A;  2GQF A;  4GHL A;  4GKJ M;  3NWL A;  4L78 A;  4DR4 M;  2C98 A;  4JI1 M;  3VKH A;  2DEN A;  3W67 A;  4LY6 A;  2KW0 A;  1P3Q Q;  3FTC A;  5ITX E;  2LBC A;  4FVM A;  4KHP M;  2P5T A;  3LQR A;  1Z5B A;  1SXJ E;  1IBM M;  2BWE A;  1IN5 A;  4LJ6 A;  2KNV A;  4DV0 M;  1LV7 A;  2WSE F;  2Z3X A;  3FUT A;  5FTJ A;  4LF7 M;  2DWM A;  2EJS A;  2C99 A;  2YR0 A;  5ITU A;  3HX3 A;  3W0L B;  3K1J A;  2L6O A;  4GC5 A;  1DO0 A;  1V92 A;  3K92 A;  4PT5 A;  3K9P A;  3U6S A;  3FRH A;  4UN2 B;  1V34 A;  2R4E A;  3B7N A;  4XGI A;  4GEW A;  1J7K A;  3GPY A;  4DR3 M;  3GLG E;  1CUK A;  4QOS A;  4I4L A;  2LWX A;  3D8B A;  5LMU M;  4WUR A;  4PDG A;  3MHV C;  2M5Z A;  3VLF B;  4JN6 A;  2D7E A;  2B3T A;  4G6Z A;  4B08 A;  4HLQ A;  3PXG A;  4GIP A;  3SMP A;  1HR0 M;  3FTD A;  3SHF A;  3QYB A;  5EXT A;  4PDI A;  5FLX S;  4AI6 A;  2F5N A;  3HHZ A;  3Q8X A;  1KYI A;  4B7F A;  2LVO C;  3E21 A;  3UK6 A;  1G71 A;  1XMO M;  3SAU A;  3H4J A;  3GRR A;  1H6U A;  2XFT A;  3KS4 A;  3JAM S;  3JR4 A;  2CE7 A;  1GJS A;  3KOW E;  1OKS A;  1R5L A;  2UUC M;  3VFD A;  4JI6 M;  1TH3 A;  2ZAN A;  3IG8 A;  2D7G A;  1MX0 A;  1NV9 A;  1PM5 A;  4LJ7 A;  4M9S A;  3VK8 A;  5EP2 A;  4RF0 A;  5KQD A;  4WP2 A;  4JI3 M;  2JZ1 A;  2FOI C;  2KHH A;  3CF6 E;  1XC8 A;  2ZTC A;  3KS8 A;  4BBA A;  1JR3 E;  3QWL A;  4M0D A;  2ERC A;  2M60 A;  3DFZ A;  2CFO A;  1IN8 A;  5EP3 A;  2KA6 B;  3KOZ E;  3MJ5 A;  4LJ8 A;  1QDT A;  2Z7J A;  5H37 D;  2YFQ A;  5E26 A;  1R6B X;  4HEO A;  4DV1 M;  4LF6 M;  1YUB A;  3SBJ A;  1WHC A;  1OFH A;  1EIJ A;  4I5S A;  2EA0 A;  3RE8 A;  2D7H A;  4YHH M;  2C5R A;  1K82 A;  1IBK M;  2UU9 M;  3KVW A;  4LCB A;  2FNA A;  3A46 A;  4FWG A;  2YNM D;  1XMQ M;  2ZAO A;  3I4V A;  2CV2 A;  2QBY A;  1SXJ A;  1WXQ A;  2DAK A;  3GRY A;  2ZM6 M;  3T1Y M;  2LHG A;  1JR3 D;  2CV1 A;  1UM8 A;  4LG2 A;  3THG A;  4G4Q A;  2MRO B;  4OW0 A;  4OVZ A;  2CV0 A;  1DV0 A;  1G59 A;  3HHY A;  2W82 A;  2VII A;  1NY6 A;  2QNJ A;  4R7G A;  2L2D A;  5ITY A;  2KXE A;  2XEP A;  1IXS B;  2BJV A;  2C96 A;  2Y21 A;  5DNY A;  4DUZ M;  1K3X A;  4JI4 M;  3FTF A;  4NSO B;  3GLI B;  3LQQ A;  3B89 A;  2QPA A;  3C58 A;  4DR1 M;  3ZCB B;  2CP8 A;  4JXJ A;  1N34 M;  1BVS A;  1R4G A;  1GL7 A;  1IXS A;  2BWB A;  2MH8 A;  3AOE C;  4LF4 M;  5E6J A;  5IWA M;  4LRS A;  3J81 S;  2JY6 B;  2OOB A;  1G4A E;  4RF1 A;  4DR5 M;  1E9R A;  1E32 A;  3WHK A;  1PGY A;  2H1R A;  2C9O A;  3LCV B;  2LVQ D;  1NSF A;  2JP7 A;  2OO9 A;  3B7Z A;  4LJA A;  2JA2 A;  4MB7 A;  4Z6Y A;  4DR7 M;  3C3D A;  2JXN A;  4XBO A;  2J5Y A;  1NHG C;  1NY5 A;  1OFI A;  4NC6 A;  5FTN A;  3L26 A;  3T6P A;  3SFZ A;  2VQF M;  2LTU A;  3I4Y A;  4MGK E;  3HY5 A;  3T38 A;  1TH2 A;  1EE8 A;  4LZJ A;  3LVW A;  4Z8X A;  3U6D A;  1L2C A;  5EXX A;  2V6Z M;  2KRK A;  4AQY M;  4GH9 A;  4LFA M;  1JB0 F;  2AHM A;  3AFH A;  3PVS A;  2MJ5 B;  2N35 A;  1Q39 A;  2MGW A;  2K47 A;  3FD9 A;  1D0L A;  1T43 A;  1IM2 A;  3K8Z A;  3M6A A;  2VF7 A;  3TWM A;  2JY8 A;  1JQJ C;  1N33 M;  3HJ8 A;  4IBI A;  4S12 A;  1F4I A;  5FTK A;  3TPZ A;  2G8L A;  2QHO B;  1TH4 A;  4QHS A;  4LF9 M;  4BLC A;  5FSW A;  1HQC A;  1ZV1 A;  4GC9 A;  1EFU B;  1Q02 A;  1J5E M;  2ZBK B;  3B7Q A;  3W68 A;  1L2D A;  1TTE A;  2J7N A;  3UJN A;  1ZQ9 A;  2G5G X;  2RGH A;  3J7B A;  1ZMW A;  4CGY B;  3J27 B;  3BBZ A;  1YLA A;  2DAG A;  2O5R A;  4NXN M;  3LCU A;  1QAO A;  4JI2 M;  1RU3 A;  2EO2 A;  1OIZ A;  2C9C A;  4YY3 M;  1VG5 A;  1ZMV A;  2WZJ A;  2YQZ A;  2DNA A;  5KPZ A;  3GLI A;  2KNZ A;  3RGP A;  4GKK M;  1X37 A;  2K6B A;  3HU3 A;  4B3M M;  3B74 A;  4II7 A;  3U60 B;  4B7G A;  5ITQ A;  5IZ7 D;  3HGI A;  2R6F A;  3KSJ A;  4FD2 A;  2KNA A;  4A3V B;  1DGB A;  3U6E A;  4OVZ B;  4AG6 A;  4P16 A;  4AKG A;  1GO5 A;  2XFS A;  4ITQ A;  2O25 A;  3FUV A;  2CEA A;  4Y28 F;  2LVP C;  2XF3 A;  4G4N A;  3GLH E;  3UZU A;  3R8F A;  2KZU A;  3A45 A;  3FKE A;  1Z6T A;  3E9S A;  3AKZ A;  5FTM A;  5KPR A;  3DZD A;  1D0K A;  3HU1 A;  2CUZ A;  5EXP A;  2LH0 A;  1DGF A;  5BPV A;  1Q3C A;  1LTM A;  5EP1 A;  1DGH A;  2WSC F;  4NRV A;  3GLG B;  3C3E A;  4G3O A;  3TQS A;  3GO8 A;  1XWI A;  2I7P A;  1PJI A;  1T3T A;  4CHT B;  1GLN A;  3K2L A;  3ZC7 B;  2G3Q A;  1UFZ A;  1I4W A;  1HT1 E;  3JR5 A;  5IT9 S;  4JYA M;  4AZF A;  3U60 A;  4I81 A;  3SAR A;  4QNM A;  1ZMU A;  5A2Q S;  2Y0T A;  2QQ8 A;  2RKO A;  3M0E A;  1L8Q A;  1SXJ D;  4IBB A;  1PJQ A;  5ITX A;  1N32 M;  2F5O A;  3I51 A;  3Q8G A;  4FCW A;  5LMN M;  3I04 M;  1IBL M;  2F4V M;  2CWB A;  1R2Y A;  1DO2 A;  1FJG M;  1N77 A;  3U61 A;  3IHP A;  1GL6 A;  1QQW A;  5FTL A;  3U5Z A;  2Q2E B;  4K0K M;  2DAI A;  2FFJ A;  1W5T A;  2DI0 A;  2L09 A;  1HNZ M;  1VEK A;  4F1I A;  5EP4 A;  1E94 E;  1NVM A;  3FYC A;  4RNA A;  1WGL A;  3L28 A;  3UMM A;  3OTO M;  4LF5 M;  4DV2 M;  1V33 A;  1Z5A A;  2QSF X;  3ZQJ A;  5JI2 E;  4XK8 F;  1OQY A;  3KP1 E;  4B3R M;  1IN6 A;  2DWN A;  1A5T A;  4L15 A;  3GPX A; 
#chains in the Genus database with same CATH homology
 2CRU A;  1EIJ A;  2JXN A;  2K6B A;  2FH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...