2JXNA

Solution structure of s. cerevisiae pdcd5-like protein ymr074cp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
MDPELQCIRECRLAQLKNNSGGTNGDRNSGANNGGGENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YMR074C
publication title Solution Structure and Dynamics of S. cerevisiae PDCD5-like Protein Ymr074cp Determined by Heteronuclear NMR Spectroscopy
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2jxnA01
2JXNA 2FH0A 1EIJA 2K6BA 2CRUA
chains in the Genus database with same CATH superfamily
1NV8A 4L8RC 3U6LA 3K9PA 2K0BX 5ITQA 2CRUA 1N78A 4LJ5A 3UMMA 3K9OA 3QYEA 1PJTA 3M7GA 3EIEA 4IBIA 4RKUF 5EP4A 3R8FA 1PM5A 2UU9M 4LF6M 3FD9A 2HAKA 1Z59A 1DO2A 3FUXA 4X62M 1TGUA 1OIZA 1D2NA 4LJ7A 3HJ8A 1L2CA 3ZC7B 2QENA 4R71A 4DUYM 2DAIA 2KEBA 2XH9A 4DV3M 3KP1E 1TDHA 4MGHA 1R2ZA 3T15A 5ITTA 3SAWA 2BJVA 2CWBA 4B7FA 3KOZE 1XWIA 4FCVA 5FTMA 1Z5AA 4XK8F 4LG2A 1EIJA 4IBJA 1J5EM 4GKJM 4F2LA 2XSZD 3Q8XA 3B9PA 3CF6E 4YY3M 2UXCM 3SATA 2ZM6M 2HHHM 3I4VA 2KRUA 2OQ4A 1KFVA 2C98A 1TH2A 1GABA 4LJ9A 2Y20A 4LF8M 2F5PA 1QDRA 4B3RM 1T6OA 1N33M 2O5RA 3L29A 1QZEA 2QNJA 1HQCA 2XGNA 3AJIB 4LJ6A 3WHKA 4KHPM 3AFHA 4AKIA 1QAOA 4Z8XA 1IQPA 1JR3D 2YQZA 3GQ3A 1OJLA 3UZUA 3LCVB 4NRWA 2DZLA 5E26A 1GJSA 5EXPA 2FNAA 2X8AA 1BVSA 1G59A 1IXSA 1QQWA 2DXIA 1WXQA 2WSFF 1L8QA 3HHXA 2LVOC 3AL0C 2EO2A 2DNAA 2KDLA 3UGJA 3AKZA 1OFHA 2JZ1A 1ZQ9A 2K47A 4LCBA 1K82A 1N32M 1OAIA 4LRSA 1SXJE 3J81S 1EFUB 3KOYE 5JI2E 1GL6A 1DGBA 1Q3CA 1W5TA 2LVAA 2UUCM 4D82A 4DR1M 3UK6A 1A5TA 3J80S 2VQFM 4LFCM 2Y0QA 3BOSA 2WSCF 3FUUA 2WZJA 4JI8M 2FFJA 2QHOB 2G5GX 4MGIE 1RU3A 2R18A 2Z8YM 4PCZA 3GQ5A 5GKNA 3NBIA 3J7AS 2JZ0A 2KNZA 3C3DA 3U6QA 4M0WA 3VK8A 4OW0A 2QBYA 1XXHB 4FCWA 1G41A 2KNVA 4MM3B 2VQEM 1UFZA 2R65A 1K3XA 4X65M 3ZQJA 3SHFA 3D8BA 3U60A 2LBCA 1NVMA 2J7OA 1OKSA 3FRHA 4RF0A 1J09A 4JI0M 3PXGA 1ZAEA 4G4QA 4B3TM 3GLGA 1D0MA 1NO1A 3PFIA 2MROB 3GRRA 3KOXE 3RE8A 1XNRM 3GRVA 3SHGB 2DHRA 5E6JA 2DZNB 5ITUA 3AOEC 2NQ8C 1VG5A 2L4FA 3GO8A 2FOIC 1R5LA 3SFZA 3JR5A 4LGYA 4G4OA 4REZA 2JY8A 4LFAM 1MX0A 4HL4A 2RKOA 4PD2A 1C7YA 3VDUA 2DWNA 1JB0F 3U61A 4DR5M 5DFLA 3A98B 3J27B 1VEJA 3GLFE 4Y28F 2B3TA 2CHGA 2L2DA 2BWEA 2MJ5B 2WSEF 4G4RA 1L2BA 3T1HM 4QOZC 1VEKA 1R2YA 2MR9A 3JR4A 3RGSA 2O25A 1GL7A 2G3QA 2HCBA 2LVPC 2LHGA 3QYBA 2JXNA 3F92A 3GRYA 4DBGB 1KSFX 1XB2B 4I4LA 4RF1A 2J5YA 1IFYA 5DYIA 5KPRA 3E21A 5EXTA 5FTLA 1NY5A 2K9DA 4IBKA 4G4NA 1QYRA 2CV0A 1GO5A 2DI0A 3E46A 3T1YM 1SXJA 2P5TA 3HHWA 5KQ8A 1IM2A 1GKIA 2KA6B 3U6OA 1OAOC 1Q02A 1R7RA 1TDZA 4GHAA 3B7ZA 2LVQD 2H5XA 4IJEA 1XNQM 3K92A 3PNVA 4QHSA 3A46A 3GLIE 3SBJA 1TR8A 2KXEA 1HT2E 1NJFA 3GRUA 2RGOA 4DR3M 3SAUA 1QDTA 3LMMA 3SMPA 4AKGA 2XFTA 3FUVA 3NWLA 4XGIA 4JI2M 2BJWA 3MJ5A 4G3OA 5EXXA 2D7GA 4P17A 3U6PA 5BR8M 4FWDA 5BPVA 1DGHA 1OTRA 2AHMA 2C9CA 2X4AA 2Y0TA 3K2LA 3K8ZA 2ZTCA 4PT5A 4BLCA 3U6EA 1QUTA 2CUZA 1S3SA 2FS1A 2XEPA 3HJSA 2QBYB 3VKGA 1H6UA 1TH3A 2I7PA 3FKEA 3GPUA 2UUBM 4LFBM 1IN8A 4NSOB 3SASA 2RGHA 4TUWA 5IZ7D 2EA0A 3TWMA 4NXMM 3IECA 2LTUA 3ZH9B 2EKFA 3FTEA 5F3WA 3RGPA 2Z7JA 2LH0A 1ZMUA 3KS4A 3VKHA 3GLGB 3M6AA 4KO8A 1ORYB 3HU1A 5EP1A 4R3DA 5ITYA 2DZOB 3DZDA 3L26A 2YNMD 4GC9A 1IBLM 3I51A 4QHTA 4G6ZA 4DUZM 1PRBA 1WGNA 2I7NA 2CFOA 4YHHM 4DR4M 2CE7A 2X49A 3A45A 5KPZA 3I4YA 2A5YB 4OVZA 4B7HA 4DV7M 1MN3A 1QAQA 2GQFA 3AV0A 4QOSA 1FNNA 5L8RF 3RFWA 5KQDA 2Q2EB 1PJSA 3TWKA 3I01M 4LF5M 1IBKM 4NXNM 1EE8A 2VIIA 3DFZA 2XF3A 2APLA 3SC3A 1NHWC 2QPAA 2HKJA 4GC5A 3KW6A 5FTJA 4DV1M 3FTDA 1XC8A 2K6BA 4CIZA 5ITXE 3GLHA 5EXSA 4R7GA 2ZAMA 4K0KM 4B7GA 2DWMA 4GH9A 2ERCA 3PNYA 4LZJA 1WIVA 2ZANA 4DV5M 3DOAA 7CATA 3U6CA 4I81A 2HWJA 5FLXS 2Y21A 3GLIA 1D0LA 3HX3A 5LMNM 2F5SA 3L28A 1HNZM 2L7IA 4GMQA 4UN2B 1V33A 1LTMA 1I4WA 2OO9A 3MHVC 1E9SA 2EJSA 1ZMWA 1N34M 4A3VB 3HWSA 2GNOA 2Z4SA 3LCUA 2C5RA 2LVNC 3L25A 1PGYA 4M9ZA 1N77A 4I8OA 1HR0M 4OU7A 4XBOA 4GITA 4B3SM 3B89A 5EP3A 4X64M 2VDBB 1E32A 1LV7A 1KYIA 4FD2A 2QQ8A 1TTEA 2R44A 2XZUA 5KPTA 3NBXX 3U5ZA 1IN5A 3FYDA 4IBGA 1G71A 1YSYA 4CHTB 1NHGC 2C96A 4BBAA 1XXHE 5EJCA 2UUAM 1Z6TA 1IN4A 2FE8A 4D81A 4IBEA 4LRTA 2KNAA 2YFQA 1Q39A 2R4EA 2R46A 4NRVA 1IY0A 2V6ZM 1E9RA 3FUTA 2L6OA 4QNRA 4AG5A 2JNHA 1L1TA 5DNYA 3LQQA 1N75A 2EKKA 4IBCA 4NSRA 5FTNA 5LMUM 3WHLA 1L2DA 3QAUA 1OIPA 2BWBA 1V92A 4FVMA 1PJJA 2KHHA 4L4UA 4M9XA 2FH0A 4JI4M 1XMOM 1IY1A 3J2PB 1NJGA 3KVWA 1WJ7A 2QZ4A 4WP2A 2ZBKB 3B7QA 4CISA 4FWGA 2DHYA 1IXSB 1SG9A 1QZMA 4LF7M 8CATA 3BXWA 2JY7A 2XFSA 3VK7A 3FYCA 3AOEA 3ILKA 3LW5F 3T6PA 2CHVA 1NY6A 2JA2A 2Z3XA 1V34A 3GLHB 4EIWA 1GVNA 1DGGA 1VDDA 2UXBM 3SYKA 4IBBA 3HGIA 4LJAA 5IREB 4WW0A 2DWZB 1HJPA 3KP0E 4NOOB 1R6BX 4LY6A 3JAMS 2W82A 4W5WA 3A42A 4MGYE 4M0DA 4LF9M 1E94E 2HL7A 1J7KA 2O01F 3M0EA 4DR2M 1G3IA 1QVRA 2DAKA 2JY5A 2ZTDA 1DV0A 2QCUA 2ZAOA 5IT9S 3LQRA 4HLQA 3H4JA 2E5LM 2JWSA 3KDSE 4NC6A 3TPZA 4LGMA 3Q8GA 4IIWA 2JP7A 3U6MA 3W0LB 4JI1M 3FTFA 1ZV1A 2QSFX 1VEGA 3FTCA 1JR3E 4GKKM 4JI7M 3U60B 4AZFA 2XLJA 2MGWA 4PDGA 4L16A 1L1ZA 3OTOM 2OPFA 1Z5CA 3CF2A 3FRIA 2DWLA 4DR7M 3QWLA 5C1BA 4FW9A 4ITQA 2CV2A 5FTKA 1XXHA 2DVWB 4AQYM 3U6DA 3FUWA 3GQ4A 2R4JA 3BBZA 3W0FA 3U5ZB 4IBFA 1P3QQ 4F1IA 3KS8A 1R4GA 2M5ZA 3T38A 3TWLA 5JI3E 2DAGA 2DAEA 2F5NA 2F4VM 4PDIA 1ZMVA 3VFDA 3R9XB 3GLFA 2F5OA 3MMPA 3B74A 2LNHC 4L6V6 3U61B 4MGKE 2JUJA 2MH8A 3GLGE 5H37D 1YE9A 3AOGA 2CP8A 2XZFA 3KSJA 5IWAM 2L4EA 1NV9A 2LXEA 4DR6M 4S12A 4B08A 4DV0M 1DO0A 4GRIA 3LVWA 3B7NA 1QANA 3I04M 4IJFA 4Z6YA 1JQJC 1HQYE 1C1KA 3PVSA 3C58A 2KW0A 3HY5A 4JYAM 1PJQA 5DYGA 1XHBA 3HJQA 4ANRA 4KLNA 3GP1A 1MU5A 1K3WA 3VLFB 3FE3A 1SXJB 3GPYA 3TL4X 5C18A 2L09A 1MJGM 2QP9X 2RRUA 3VDPA 4LZZA 4IBDA 2KZUA 2XSZA 3UJNA 3E4RA 4JI3M 4AI6A 2D7HA 4GEWA 4M9SA 3E9SA 3KSXA 3TQSA 1AIPC 1G8PA 2C9OA 2YR0A 4JXJA 4X66M 2J7NA 1QUSA 5EP2A 1YLAA 4WURA 1W5SA 1Z5BA 3D8LA 4LF4M 2V1CA 4II7A 3TE6A 3W68A 2F5QA 2UXDM 4BB9A 1DGHB 1CUKA 1PJIA 2LHCA 4LJ8A 1GJTA 1OFIA 4D80A 1JR3A 3LVVA 3HKPA 3K1JA 1Y8GA 4MH0E 4P16A 4AG6A 3L27A 2Z4RA 2VF8A 4CGYB 3U6SA 1UM8A 4HEOA 4DV6M 2CV1A 2M60A 2DKLA 4GHLA 1AUAA 1D0KA 3H4MA 3MK6A 4JI6M 3CF0A 1FJGM 3THGA 4JV5M 2OOAA 3HHZA 4AKHA 1NNUC 4L78A 1QAMA 2L7HA 4NL4H 1NNJA 5KO3A 1SXJD 4ZPXA 1DGFA 4Q7JA 1IBMM 3SMSA 1OQYA 3V76A 5A2QS 3HZJA 1F4IA 4QNMA 1T3TA 4MB7A 2JY6B 4OVZB 3HU3A 3GPXA 3GLFB 4I5SA 1WHCA 2CHQA 3ZCBB 1N36M 1VDLA 2OOBA 3W67A 1WR1B 3IG8A 1HNWM 1NSFA 1T43A 1SXJC 2D7EA 3SAVA 1XMQM 3KXEC 4KT0F 1Q3BA 2DAMA 2EUCA 2LWXA 3IHPA 3J7BA 1IN7A 2VF7A 5ITXA 1IXRC 1YUBA 5ITRA 1G4AE 1WGLA 4LJ4A 4RNAA 2V1UA 2R6FA 3SARA 3EIHA 3HU2A 4AW4A 3C3EA 1IY2A 1HNXM 1I94M 2R0IA 2R62A 3HHYA 2BNKA 4L15A 1VQ1A 4GIPA 3C9PA 2G8LA 3SYLA 4DV4M 4B3MM 3L2AA 2R45A 4FCTA 3GLIB 2KRKA 4FWHA 2CEAA 4CJ6A 2H1RA 3CGWA 3CTWB 3KOWE 3GLHE 1X37A 2DENA 1IXZA 1IN6A 4KODA 1TF0B 3KFUG 2C99A 3IG5A 4JI5M 1GLNA 3DA1A 4DV2M 4OX9M 2KZSA 1HT1E 4MGZE 5EQTA 2N35A 1TH4A 4JN6A 3GPPA 5FSWA
chains in the Genus database with same CATH topology
2JXNA 2FH0A 1EIJA 2K6BA 2CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXN A;  2FH0 A;  1EIJ A;  2K6B A;  2CRU A; 
#chains in the Genus database with same CATH topology
 1NV8 A;  4L8R C;  3U6L A;  3K9P A;  2K0B X;  5ITQ A;  2CRU A;  1N78 A;  4LJ5 A;  3UMM A;  3K9O A;  3QYE A;  1PJT A;  3M7G A;  3EIE A;  4IBI A;  4RKU F;  5EP4 A;  3R8F A;  1PM5 A;  2UU9 M;  4LF6 M;  3FD9 A;  2HAK A;  1Z59 A;  1DO2 A;  3FUX A;  4X62 M;  1TGU A;  1OIZ A;  1D2N A;  4LJ7 A;  3HJ8 A;  1L2C A;  3ZC7 B;  2QEN A;  4R71 A;  4DUY M;  2DAI A;  2KEB A;  2XH9 A;  4DV3 M;  3KP1 E;  1TDH A;  4MGH A;  1R2Z A;  3T15 A;  5ITT A;  3SAW A;  2BJV A;  2CWB A;  4B7F A;  3KOZ E;  1XWI A;  4FCV A;  5FTM A;  1Z5A A;  4XK8 F;  4LG2 A;  1EIJ A;  4IBJ A;  1J5E M;  4GKJ M;  4F2L A;  2XSZ D;  3Q8X A;  3B9P A;  3CF6 E;  4YY3 M;  2UXC M;  3SAT A;  2ZM6 M;  2HHH M;  3I4V A;  2KRU A;  2OQ4 A;  1KFV A;  2C98 A;  1TH2 A;  1GAB A;  4LJ9 A;  2Y20 A;  4LF8 M;  2F5P A;  1QDR A;  4B3R M;  1T6O A;  1N33 M;  2O5R A;  3L29 A;  1QZE A;  2QNJ A;  1HQC A;  2XGN A;  3AJI B;  4LJ6 A;  3WHK A;  4KHP M;  3AFH A;  4AKI A;  1QAO A;  4Z8X A;  1IQP A;  1JR3 D;  2YQZ A;  3GQ3 A;  1OJL A;  3UZU A;  3LCV B;  4NRW A;  2DZL A;  5E26 A;  1GJS A;  5EXP A;  2FNA A;  2X8A A;  1BVS A;  1G59 A;  1IXS A;  1QQW A;  2DXI A;  1WXQ A;  2WSF F;  1L8Q A;  3HHX A;  2LVO C;  3AL0 C;  2EO2 A;  2DNA A;  2KDL A;  3UGJ A;  3AKZ A;  1OFH A;  2JZ1 A;  1ZQ9 A;  2K47 A;  4LCB A;  1K82 A;  1N32 M;  1OAI A;  4LRS A;  1SXJ E;  3J81 S;  1EFU B;  3KOY E;  5JI2 E;  1GL6 A;  1DGB A;  1Q3C A;  1W5T A;  2LVA A;  2UUC M;  4D82 A;  4DR1 M;  3UK6 A;  1A5T A;  3J80 S;  2VQF M;  4LFC M;  2Y0Q A;  3BOS A;  2WSC F;  3FUU A;  2WZJ A;  4JI8 M;  2FFJ A;  2QHO B;  2G5G X;  4MGI E;  1RU3 A;  2R18 A;  2Z8Y M;  4PCZ A;  3GQ5 A;  5GKN A;  3NBI A;  3J7A S;  2JZ0 A;  2KNZ A;  3C3D A;  3U6Q A;  4M0W A;  3VK8 A;  4OW0 A;  2QBY A;  1XXH B;  4FCW A;  1G41 A;  2KNV A;  4MM3 B;  2VQE M;  1UFZ A;  2R65 A;  1K3X A;  4X65 M;  3ZQJ A;  3SHF A;  3D8B A;  3U60 A;  2LBC A;  1NVM A;  2J7O A;  1OKS A;  3FRH A;  4RF0 A;  1J09 A;  4JI0 M;  3PXG A;  1ZAE A;  4G4Q A;  4B3T M;  3GLG A;  1D0M A;  1NO1 A;  3PFI A;  2MRO B;  3GRR A;  3KOX E;  3RE8 A;  1XNR M;  3GRV A;  3SHG B;  2DHR A;  5E6J A;  2DZN B;  5ITU A;  3AOE C;  2NQ8 C;  1VG5 A;  2L4F A;  3GO8 A;  2FOI C;  1R5L A;  3SFZ A;  3JR5 A;  4LGY A;  4G4O A;  4REZ A;  2JY8 A;  4LFA M;  1MX0 A;  4HL4 A;  2RKO A;  4PD2 A;  1C7Y A;  3VDU A;  2DWN A;  1JB0 F;  3U61 A;  4DR5 M;  5DFL A;  3A98 B;  3J27 B;  1VEJ A;  3GLF E;  4Y28 F;  2B3T A;  2CHG A;  2L2D A;  2BWE A;  2MJ5 B;  2WSE F;  4G4R A;  1L2B A;  3T1H M;  4QOZ C;  1VEK A;  1R2Y A;  2MR9 A;  3JR4 A;  3RGS A;  2O25 A;  1GL7 A;  2G3Q A;  2HCB A;  2LVP C;  2LHG A;  3QYB A;  2JXN A;  3F92 A;  3GRY A;  4DBG B;  1KSF X;  1XB2 B;  4I4L A;  4RF1 A;  2J5Y A;  1IFY A;  5DYI A;  5KPR A;  3E21 A;  5EXT A;  5FTL A;  1NY5 A;  2K9D A;  4IBK A;  4G4N A;  1QYR A;  2CV0 A;  1GO5 A;  2DI0 A;  3E46 A;  3T1Y M;  1SXJ A;  2P5T A;  3HHW A;  5KQ8 A;  1IM2 A;  1GKI A;  2KA6 B;  3U6O A;  1OAO C;  1Q02 A;  1R7R A;  1TDZ A;  4GHA A;  3B7Z A;  2LVQ D;  2H5X A;  4IJE A;  1XNQ M;  3K92 A;  3PNV A;  4QHS A;  3A46 A;  3GLI E;  3SBJ A;  1TR8 A;  2KXE A;  1HT2 E;  1NJF A;  3GRU A;  2RGO A;  4DR3 M;  3SAU A;  1QDT A;  3LMM A;  3SMP A;  4AKG A;  2XFT A;  3FUV A;  3NWL A;  4XGI A;  4JI2 M;  2BJW A;  3MJ5 A;  4G3O A;  5EXX A;  2D7G A;  4P17 A;  3U6P A;  5BR8 M;  4FWD A;  5BPV A;  1DGH A;  1OTR A;  2AHM A;  2C9C A;  2X4A A;  2Y0T A;  3K2L A;  3K8Z A;  2ZTC A;  4PT5 A;  4BLC A;  3U6E A;  1QUT A;  2CUZ A;  1S3S A;  2FS1 A;  2XEP A;  3HJS A;  2QBY B;  3VKG A;  1H6U A;  1TH3 A;  2I7P A;  3FKE A;  3GPU A;  2UUB M;  4LFB M;  1IN8 A;  4NSO B;  3SAS A;  2RGH A;  4TUW A;  5IZ7 D;  2EA0 A;  3TWM A;  4NXM M;  3IEC A;  2LTU A;  3ZH9 B;  2EKF A;  3FTE A;  5F3W A;  3RGP A;  2Z7J A;  2LH0 A;  1ZMU A;  3KS4 A;  3VKH A;  3GLG B;  3M6A A;  4KO8 A;  1ORY B;  3HU1 A;  5EP1 A;  4R3D A;  5ITY A;  2DZO B;  3DZD A;  3L26 A;  2YNM D;  4GC9 A;  1IBL M;  3I51 A;  4QHT A;  4G6Z A;  4DUZ M;  1PRB A;  1WGN A;  2I7N A;  2CFO A;  4YHH M;  4DR4 M;  2CE7 A;  2X49 A;  3A45 A;  5KPZ A;  3I4Y A;  2A5Y B;  4OVZ A;  4B7H A;  4DV7 M;  1MN3 A;  1QAQ A;  2GQF A;  3AV0 A;  4QOS A;  1FNN A;  5L8R F;  3RFW A;  5KQD A;  2Q2E B;  1PJS A;  3TWK A;  3I01 M;  4LF5 M;  1IBK M;  4NXN M;  1EE8 A;  2VII A;  3DFZ A;  2XF3 A;  2APL A;  3SC3 A;  1NHW C;  2QPA A;  2HKJ A;  4GC5 A;  3KW6 A;  5FTJ A;  4DV1 M;  3FTD A;  1XC8 A;  2K6B A;  4CIZ A;  5ITX E;  3GLH A;  5EXS A;  4R7G A;  2ZAM A;  4K0K M;  4B7G A;  2DWM A;  4GH9 A;  2ERC A;  3PNY A;  4LZJ A;  1WIV A;  2ZAN A;  4DV5 M;  3DOA A;  7CAT A;  3U6C A;  4I81 A;  2HWJ A;  5FLX S;  2Y21 A;  3GLI A;  1D0L A;  3HX3 A;  5LMN M;  2F5S A;  3L28 A;  1HNZ M;  2L7I A;  4GMQ A;  4UN2 B;  1V33 A;  1LTM A;  1I4W A;  2OO9 A;  3MHV C;  1E9S A;  2EJS A;  1ZMW A;  1N34 M;  4A3V B;  3HWS A;  2GNO A;  2Z4S A;  3LCU A;  2C5R A;  2LVN C;  3L25 A;  1PGY A;  4M9Z A;  1N77 A;  4I8O A;  1HR0 M;  4OU7 A;  4XBO A;  4GIT A;  4B3S M;  3B89 A;  5EP3 A;  4X64 M;  2VDB B;  1E32 A;  1LV7 A;  1KYI A;  4FD2 A;  2QQ8 A;  1TTE A;  2R44 A;  2XZU A;  5KPT A;  3NBX X;  3U5Z A;  1IN5 A;  3FYD A;  4IBG A;  1G71 A;  1YSY A;  4CHT B;  1NHG C;  2C96 A;  4BBA A;  1XXH E;  5EJC A;  2UUA M;  1Z6T A;  1IN4 A;  2FE8 A;  4D81 A;  4IBE A;  4LRT A;  2KNA A;  2YFQ A;  1Q39 A;  2R4E A;  2R46 A;  4NRV A;  1IY0 A;  2V6Z M;  1E9R A;  3FUT A;  2L6O A;  4QNR A;  4AG5 A;  2JNH A;  1L1T A;  5DNY A;  3LQQ A;  1N75 A;  2EKK A;  4IBC A;  4NSR A;  5FTN A;  5LMU M;  3WHL A;  1L2D A;  3QAU A;  1OIP A;  2BWB A;  1V92 A;  4FVM A;  1PJJ A;  2KHH A;  4L4U A;  4M9X A;  2FH0 A;  4JI4 M;  1XMO M;  1IY1 A;  3J2P B;  1NJG A;  3KVW A;  1WJ7 A;  2QZ4 A;  4WP2 A;  2ZBK B;  3B7Q A;  4CIS A;  4FWG A;  2DHY A;  1IXS B;  1SG9 A;  1QZM A;  4LF7 M;  8CAT A;  3BXW A;  2JY7 A;  2XFS A;  3VK7 A;  3FYC A;  3AOE A;  3ILK A;  3LW5 F;  3T6P A;  2CHV A;  1NY6 A;  2JA2 A;  2Z3X A;  1V34 A;  3GLH B;  4EIW A;  1GVN A;  1DGG A;  1VDD A;  2UXB M;  3SYK A;  4IBB A;  3HGI A;  4LJA A;  5IRE B;  4WW0 A;  2DWZ B;  1HJP A;  3KP0 E;  4NOO B;  1R6B X;  4LY6 A;  3JAM S;  2W82 A;  4W5W A;  3A42 A;  4MGY E;  4M0D A;  4LF9 M;  1E94 E;  2HL7 A;  1J7K A;  2O01 F;  3M0E A;  4DR2 M;  1G3I A;  1QVR A;  2DAK A;  2JY5 A;  2ZTD A;  1DV0 A;  2QCU A;  2ZAO A;  5IT9 S;  3LQR A;  4HLQ A;  3H4J A;  2E5L M;  2JWS A;  3KDS E;  4NC6 A;  3TPZ A;  4LGM A;  3Q8G A;  4IIW A;  2JP7 A;  3U6M A;  3W0L B;  4JI1 M;  3FTF A;  1ZV1 A;  2QSF X;  1VEG A;  3FTC A;  1JR3 E;  4GKK M;  4JI7 M;  3U60 B;  4AZF A;  2XLJ A;  2MGW A;  4PDG A;  4L16 A;  1L1Z A;  3OTO M;  2OPF A;  1Z5C A;  3CF2 A;  3FRI A;  2DWL A;  4DR7 M;  3QWL A;  5C1B A;  4FW9 A;  4ITQ A;  2CV2 A;  5FTK A;  1XXH A;  2DVW B;  4AQY M;  3U6D A;  3FUW A;  3GQ4 A;  2R4J A;  3BBZ A;  3W0F A;  3U5Z B;  4IBF A;  1P3Q Q;  4F1I A;  3KS8 A;  1R4G A;  2M5Z A;  3T38 A;  3TWL A;  5JI3 E;  2DAG A;  2DAE A;  2F5N A;  2F4V M;  4PDI A;  1ZMV A;  3VFD A;  3R9X B;  3GLF A;  2F5O A;  3MMP A;  3B74 A;  2LNH C;  4L6V 6;  3U61 B;  4MGK E;  2JUJ A;  2MH8 A;  3GLG E;  5H37 D;  1YE9 A;  3AOG A;  2CP8 A;  2XZF A;  3KSJ A;  5IWA M;  2L4E A;  1NV9 A;  2LXE A;  4DR6 M;  4S12 A;  4B08 A;  4DV0 M;  1DO0 A;  4GRI A;  3LVW A;  3B7N A;  1QAN A;  3I04 M;  4IJF A;  4Z6Y A;  1JQJ C;  1HQY E;  1C1K A;  3PVS A;  3C58 A;  2KW0 A;  3HY5 A;  4JYA M;  1PJQ A;  5DYG A;  1XHB A;  3HJQ A;  4ANR A;  4KLN A;  3GP1 A;  1MU5 A;  1K3W A;  3VLF B;  3FE3 A;  1SXJ B;  3GPY A;  3TL4 X;  5C18 A;  2L09 A;  1MJG M;  2QP9 X;  2RRU A;  3VDP A;  4LZZ A;  4IBD A;  2KZU A;  2XSZ A;  3UJN A;  3E4R A;  4JI3 M;  4AI6 A;  2D7H A;  4GEW A;  4M9S A;  3E9S A;  3KSX A;  3TQS A;  1AIP C;  1G8P A;  2C9O A;  2YR0 A;  4JXJ A;  4X66 M;  2J7N A;  1QUS A;  5EP2 A;  1YLA A;  4WUR A;  1W5S A;  1Z5B A;  3D8L A;  4LF4 M;  2V1C A;  4II7 A;  3TE6 A;  3W68 A;  2F5Q A;  2UXD M;  4BB9 A;  1DGH B;  1CUK A;  1PJI A;  2LHC A;  4LJ8 A;  1GJT A;  1OFI A;  4D80 A;  1JR3 A;  3LVV A;  3HKP A;  3K1J A;  1Y8G A;  4MH0 E;  4P16 A;  4AG6 A;  3L27 A;  2Z4R A;  2VF8 A;  4CGY B;  3U6S A;  1UM8 A;  4HEO A;  4DV6 M;  2CV1 A;  2M60 A;  2DKL A;  4GHL A;  1AUA A;  1D0K A;  3H4M A;  3MK6 A;  4JI6 M;  3CF0 A;  1FJG M;  3THG A;  4JV5 M;  2OOA A;  3HHZ A;  4AKH A;  1NNU C;  4L78 A;  1QAM A;  2L7H A;  4NL4 H;  1NNJ A;  5KO3 A;  1SXJ D;  4ZPX A;  1DGF A;  4Q7J A;  1IBM M;  3SMS A;  1OQY A;  3V76 A;  5A2Q S;  3HZJ A;  1F4I A;  4QNM A;  1T3T A;  4MB7 A;  2JY6 B;  4OVZ B;  3HU3 A;  3GPX A;  3GLF B;  4I5S A;  1WHC A;  2CHQ A;  3ZCB B;  1N36 M;  1VDL A;  2OOB A;  3W67 A;  1WR1 B;  3IG8 A;  1HNW M;  1NSF A;  1T43 A;  1SXJ C;  2D7E A;  3SAV A;  1XMQ M;  3KXE C;  4KT0 F;  1Q3B A;  2DAM A;  2EUC A;  2LWX A;  3IHP A;  3J7B A;  1IN7 A;  2VF7 A;  5ITX A;  1IXR C;  1YUB A;  5ITR A;  1G4A E;  1WGL A;  4LJ4 A;  4RNA A;  2V1U A;  2R6F A;  3SAR A;  3EIH A;  3HU2 A;  4AW4 A;  3C3E A;  1IY2 A;  1HNX M;  1I94 M;  2R0I A;  2R62 A;  3HHY A;  2BNK A;  4L15 A;  1VQ1 A;  4GIP A;  3C9P A;  2G8L A;  3SYL A;  4DV4 M;  4B3M M;  3L2A A;  2R45 A;  4FCT A;  3GLI B;  2KRK A;  4FWH A;  2CEA A;  4CJ6 A;  2H1R A;  3CGW A;  3CTW B;  3KOW E;  3GLH E;  1X37 A;  2DEN A;  1IXZ A;  1IN6 A;  4KOD A;  1TF0 B;  3KFU G;  2C99 A;  3IG5 A;  4JI5 M;  1GLN A;  3DA1 A;  4DV2 M;  4OX9 M;  2KZS A;  1HT1 E;  4MGZ E;  5EQT A;  2N35 A;  1TH4 A;  4JN6 A;  3GPP A;  5FSW A; 
#chains in the Genus database with same CATH homology
 2JXN A;  2FH0 A;  1EIJ A;  2K6B A;  2CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...