2JXNA

Solution structure of s. cerevisiae pdcd5-like protein ymr074cp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'MDPELQCIRECRLAQLKNNSGGTNGDRNSGANNGGGENSAPVGAAIANFLEPQALERLSRVALVRRDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YMR074C
publication title Solution Structure and Dynamics of S. cerevisiae PDCD5-like Protein Ymr074cp Determined by Heteronuclear NMR Spectroscopy
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.140 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 PDCD5-like 2jxnA01
2FH0A 1EIJA 2CRUA 2K6BA 2JXNA
chains in the Genus database with same CATH superfamily
2F4VM 2CE7A 3KXEC 1HQCA 3SAWA 4B3RM 4OVZA 2CUZA 2HCBA 1L2BA 4D80A 1XWIA 3FUVA 3KSXA 4YY3M 2DHRA 1N78A 4P16A 3C9PA 1G3IA 2KZSA 4FCTA 7CATA 2F5OA 3W0FA 1YE9A 2QP9X 1G59A 3EIHA 2KA6B 1N34M 5JI2E 4CISA 1A5TA 4DR1M 1IY2A 1XHBA 3ILKA 4WURA 2ZTDA 2I7PA 2V1CA 1OAOC 2VDBB 4RF0A 5FTKA 1T43A 3LQRA 3HHXA 2LVOC 2QNJA 2CHVA 2CP8A 2OOBA 4OU7A 3K9OA 3L27A 1IQPA 3T1HM 1WHCA 3SYLA 1YSYA 3UMMA 5IT9S 3L29A 1IBLM 4IBBA 4AKIA 4Z6YA 4DR7M 2LHGA 2GNOA 3J2PB 4BBAA 1VDLA 1QUSA 4PCZA 4GIPA 5IZ7D 1GL6A 2XF3A 3CF0A 3D8LA 5FTMA 5JI3E 3KVWA 1GKIA 1Q39A 3M7GA 4EIWA 3I04M 3HHYA 5ITYA 1IN6A 3BBZA 2J5YA 1IXSA 4L15A 3UJNA 4REZA 3M0EA 3HY5A 4LRTA 2CHQA 1IBKM 4Y28F 2CV0A 1OIZA 3LCUA 1DGFA 1IY1A 2K9DA 5DNYA 3J7AS 1TF0B 5F3WA 4II7A 4LGYA 2CFOA 3BOSA 1XXHA 1XNQM 3ZH9B 3VKHA 3AL0C 1HNZM 3U60B 2Q2EB 4DBGB 2YFQA 1Z5BA 2DENA 2XFSA 4ITQA 1OTRA 1LTMA 3HJSA 3VK7A 5DFLA 3F92A 3J81S 1G41A 1D0MA 5KPZA 2RKOA 1PJTA 3UK6A 3VDUA 4DV7M 3U6DA 1TDZA 1QAQA 3FTDA 5LMUM 1L1TA 1WR1B 3FUUA 1DGHB 3B9PA 2UUBM 2R0IA 1SXJC 2KNVA 2MH8A 3KS4A 4L6V6 4L16A 1DO0A 2R6FA 3E21A 1XC8A 2KDLA 2ZAOA 3GRRA 4F1IA 1JB0F 5IWAM 3PNYA 1XXHE 2VF7A 1MN3A 3A46A 1GJSA 3AFHA 4HL4A 2Y20A 1GABA 2ZANA 1GL7A 3I51A 3MK6A 2KRKA 1UFZA 1EFUB 2LH0A 3KOZE 4KODA 4IBEA 3VKGA 3DFZA 4Z8XA 2XEPA 2J7NA 3FD9A 1PJIA 2DXIA 3IHPA 2F5QA 1MU5A 3SATA 5EP2A 2X49A 5EP4A 3I4YA 4QHSA 2LBCA 1KFVA 3U6MA 4R7GA 3MHVC 3SHGB 3LVWA 1NY5A 3SARA 4DR6M 4NXMM 1W5TA 4MGHA 3CTWB 4JI1M 1XNRM 2R4EA 1R2ZA 4OW0A 4AKGA 1R4GA 2JY6B 3A98B 4M0WA 3U6EA 1QZMA 3KDSE 1IXRC 2DAKA 3HU1A 4X62M 2LWXA 3GRUA 1C1KA 4B7HA 4M9SA 2UUAM 3U6LA 1K3WA 4LJ7A 2JNHA 4GRIA 3VK8A 3LQQA 2CV2A 1F4IA 2OQ4A 3FTFA 1N33M 3SFZA 1EIJA 2CRUA 1HNXM 5EXTA 4P17A 1MX0A 3D8BA 3Q8XA 4QOZC 1Z5CA 1SXJB 5BPVA 2BJWA 4AKHA 2FH0A 4RNAA 3MJ5A 4NL4H 4TUWA 2RGHA 2YNMD 3WHKA 3FUTA 5ITXA 4LFBM 2K6BA 4GITA 3L28A 1JQJC 3SMSA 5FSWA 2CWBA 3HU2A 2CV1A 3K1JA 1K3XA 2BJVA 2VF8A 2LTUA 1S3SA 1QZEA 3I4VA 2QSFX 3ZQJA 1ZV1A 1L2CA 3QWLA 2LXEA 4LJ6A 4L78A 1XMQM 4M0DA 2VQFM 2UU9M 4F2LA 4DR4M 2KNAA 4X66M 4G4NA 4GHLA 4I5SA 5BR8M 4ZPXA 1IN7A 3K8ZA 1ZMWA 1OKSA 2AHMA 4G3OA 2KEBA 3M6AA 1NO1A 4B7FA 3E46A 2Z3XA 1KYIA 3TPZA 4LRSA 3DOAA 3RGSA 3GPUA 1DV0A 1TH4A 4MB7A 3T38A 4B08A 2JY8A 2L7IA 2DZOB 2X8AA 1RU3A 4L4UA 3GLIB 2J7OA 1V33A 1IFYA 4AI6A 5EXSA 3PXGA 4IBJA 5ITXE 5FTJA 1L1ZA 4JI7M 1R6BX 1IN8A 3FRHA 1AIPC 2RGOA 2Y21A 5DYGA 1N77A 3LW5F 3KW6A 3PNVA 1Y8GA 1MJGM 2DAGA 4CJ6A 1T3TA 2FS1A 2ZTCA 4LJ8A 4G4QA 1NHGC 2C9CA 4XK8F 3U5ZB 2G5GX 3OTOM 2D7EA 3AKZA 4WW0A 4ANRA 1T6OA 1CUKA 3FE3A 2M60A 3GLGB 3L2AA 2DAMA 4XBOA 3LCVB 4B3TM 3AOEA 3WHLA 4GKJM 2C98A 4LJAA 3GLFA 3AV0A 3B7ZA 3L26A 1PM5A 2G3QA 3SC3A 3B89A 2EKFA 2XLJA 2KRUA 1NNJA 4IBFA 1UM8A 3AOGA 1J5EM 3C3DA 4MM3B 4MGYE 3GP1A 4LF6M 2JXNA 2N35A 2ERCA 4JI3M 1OFIA 1YUBA 3KP0E 1HT1E 1Q02A 4I8OA 1QDTA 2MGWA 4FW9A 4QNRA 2R45A 3FUXA 3E9SA 1HJPA 2QENA 4NRVA 4PD2A 4JI6M 4FCWA 2LVPC 3HX3A 5ITTA 5EXXA 4I4LA 3FKEA 3VDPA 2KW0A 3R9XB 4FCVA 4KLNA 5ITRA 3Q8GA 2WSFF 2MR9A 2D7GA 1E94E 3SAUA 2JY5A 5FTNA 4CHTB 3GLFE 2WSEF 3A42A 1TGUA 1E9RA 3QYEA 1V34A 4HLQA 3NBIA 2QZ4A 4LCBA 4OVZB 2DZNB 4GKKM 4X65M 1IY0A 4NOOB 3KOWE 3GQ4A 3H4JA 3IECA 4AZFA 2JY7A 4D81A 2JUJA 4FD2A 2HHHM 3SBJA 4DUYM 2JP7A 3PFIA 1OFHA 1WXQA 4DV1M 3CGWA 1X37A 1VEJA 2QQ8A 5KQ8A 1FNNA 3B7NA 4GH9A 3R8FA 1I4WA 1OIPA 1VEGA 2XGNA 3H4MA 4NSRA 3DA1A 4JI0M 4G6ZA 4BLCA 4FWGA 4MGZE 2L6OA 1J7KA 1OQYA 1YLAA 4LF8M 3SYKA 1E9SA 5C1BA 4B3SM 4JI5M 4JV5M 1QQWA 2HWJA 2KZUA 1QVRA 3PVSA 3TWKA 3CF2A 3SMPA 3U5ZA 2LHCA 4OX9M 1D2NA 2Y0TA 4PDIA 3FTEA 1XB2B 1N36M 2DWZB 5H37D 1LV7A 4R3DA 3J80S 1SG9A 1C7YA 3KS8A 1TH3A 1NJFA 4GHAA 1QUTA 4FVMA 1W5SA 2Z8YM 3K92A 4DR2M 1WGLA 1NHWC 2DWNA 2P5TA 2JZ0A 3GLHB 2I7NA 4GC9A 2DKLA 1WGNA 2FFJA 1NY6A 2ZAMA 3HWSA 3U60A 2V6ZM 3TWLA 3K9PA 3U6SA 2DHYA 3VFDA 4QOSA 2RRUA 3IG8A 2LNHC 1KSFX 2L7HA 1XXHB 2FNAA 1IN5A 2DAIA 1J09A 1NJGA 1G4AE 1Z5AA 3UGJA 4GC5A 2C99A 1DGHA 2C96A 3U61B 4UN2B 1IN4A 3AJIB 4QHTA 4BB9A 4DR5M 1PRBA 2NQ8C 4M9ZA 5GKNA 3HHZA 1Z6TA 5EJCA 2FOIC 3NWLA 2L2DA 1EE8A 2Y0QA 4LF4M 1PJQA 3FUWA 3QYBA 3QAUA 2A5YB 2W82A 2UUCM 2L09A 1D0LA 1D0KA 5L8RF 2APLA 3HGIA 3RGPA 4JYAM 1GVNA 5LMNM 1GJTA 1IXZA 1XMOM 2F5NA 1E32A 1I94M 1NNUC 2Z4SA 3SASA 3CF6E 3J27B 4G4OA 2DWMA 3TWMA 2CHGA 1ORYB 2HKJA 4LF5M 4CGYB 3L25A 2UXCM 1HNWM 4PDGA 3NBXX 4A3VB 1K82A 2WZJA 2K0BX 4IBGA 1L8QA 2BWEA 4GEWA 5ITUA 4YHHM 4XGIA 4GMQA 4JI4M 3GPXA 4MGIE 3W0LB 3U6PA 3ZCBB 2H5XA 4NC6A 1ZAEA 2XZFA 2OOAA 2QHOB 4AG5A 3FYCA 5KO3A 3KOXE 1ZMVA 1NV9A 1H6UA 2EO2A 4G4RA 3HU3A 5A2QS 1IBMM 4IBCA 4W5WA 1NSFA 3B7QA 2OPFA 1OJLA 3W67A 4MH0E 2K47A 4LG2A 4R71A 2H1RA 3SHFA 2VQEM 3U6OA 1ZMUA 2HAKA 1QANA 2DZLA 2EKKA 2QBYB 3DZDA 3MMPA 2O01F 2DAEA 1QAOA 3C58A 3GPYA 1VDDA 1VEKA 5FLXS 1N32M 3A45A 2LVQD 1WIVA 4IJFA 3GLHA 4NSOB 4LJ5A 1SXJD 1SXJA 2R62A 3FTCA 1FJGM 1QAMA 2GQFA 2Z4RA 4DV3M 2V1UA 2KXEA 3GQ3A 2DNAA 4WP2A 3V76A 2F5SA 3RFWA 4PT5A 4DV0M 4S12A 5KPRA 2R46A 2XFTA 2ZBKB 5E26A 2Z7JA 2ZM6M 4DV5M 1VQ1A 2D7HA 3HZJA 1R7RA 4Q7JA 3TQSA 8CATA 1JR3A 1JR3D 1TDHA 2EUCA 1NVMA 3HJ8A 3AOEC 5ITQA 2OO9A 4LZZA 2B3TA 2HL7A 4JI2M 4I81A 4QNMA 4AQYM 1G8PA 2L4EA 2EJSA 4MGKE 4RKUF 3U61A 4KHPM 4DV6M 4LY6A 4M9XA 3KSJA 3JR4A 2KHHA 2C5RA 4LJ9A 4CIZA 4LF9M 4HEOA 1DO2A 3E4RA 4LJ4A 2JZ1A 3SAVA 3K2LA 3RE8A 4IIWA 3FYDA 2JA2A 2F5PA 1Z59A 3T15A 1ZQ9A 3HHWA 1G71A 1TR8A 4NXNM 3GLHE 2C9OA 2VIIA 1SXJE 3HJQA 3IG5A 4FWDA 4JXJA 4LZJA 1HR0M 2R18A 3ZC7B 5KPTA 5EQTA 3GLIA 3THGA 2KNZA 2UXBM 2MROB 3B74A 2R65A 3C3EA 4DR3M 2L4FA 4LGMA 3GQ5A 1P3QQ 4D82A 4IBIA 2FE8A 3GRYA 2LVNC 4IBKA 4K0KM 3TE6A 1JR3E 1HT2E 1Q3BA 1TTEA 2X4AA 3KP1E 1GLNA 2O5RA 2R4JA 1L2DA 2BWBA 1GO5A 2CEAA 2XSZA 2XSZD 3HKPA 4IBDA 3T1YM 4KT0F 3LVVA 2YQZA 4RF1A 2XZUA 4KO8A 4NRWA 5IREB 3J7BA 3W68A 3TL4X 1AUAA 5FTLA 3GLGA 4L8RC 4B7GA 2UXDM 4AG6A 1DGGA 1PGYA 4DUZM 1QDRA 1TH2A 2QPAA 4DV4M 3T6PA 2DVWB 3BXWA 1VG5A 1NV8A 2LVAA 4JN6A 2JWSA 2DI0A 3I01M 1N75A 1V92A 4B3MM 3KFUG 1BVSA 5DYIA 5E6JA 1HQYE 3GO8A 3GLIE 4LFAM 1PJJA 1IXSB 3U6CA 2M5ZA 2G8LA 3JR5A 4LF7M 1Q3CA 1WJ7A 1R2YA 2QBYA 5C18A 4AW4A 3GLFB 2WSCF 2BNKA 5EXPA 1R5LA 3VLFB 2O25A 3GPPA 3FRIA 2EA0A 3EIEA 3LMMA 3KOYE 4IJEA 1DGBA 1PJSA 2QCUA 2E5LM 3UZUA 3GRVA 5EP1A 3JAMS 1QYRA 2DWLA 1IM2A 4LFCM 5EP3A 3U6QA 2YR0A 5KQDA 2MJ5B 4FWHA 3GLGE 4JI8M 2R44A 4DV2M 1OAIA 2XH9A 4X64M
chains in the Genus database with same CATH topology
2FH0A 1EIJA 2CRUA 2K6BA 2JXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH0 A;  1EIJ A;  2CRU A;  2K6B A;  2JXN A; 
#chains in the Genus database with same CATH topology
 2F4V M;  2CE7 A;  3KXE C;  1HQC A;  3SAW A;  4B3R M;  4OVZ A;  2CUZ A;  2HCB A;  1L2B A;  4D80 A;  1XWI A;  3FUV A;  3KSX A;  4YY3 M;  2DHR A;  1N78 A;  4P16 A;  3C9P A;  1G3I A;  2KZS A;  4FCT A;  7CAT A;  2F5O A;  3W0F A;  1YE9 A;  2QP9 X;  1G59 A;  3EIH A;  2KA6 B;  1N34 M;  5JI2 E;  4CIS A;  1A5T A;  4DR1 M;  1IY2 A;  1XHB A;  3ILK A;  4WUR A;  2ZTD A;  2I7P A;  2V1C A;  1OAO C;  2VDB B;  4RF0 A;  5FTK A;  1T43 A;  3LQR A;  3HHX A;  2LVO C;  2QNJ A;  2CHV A;  2CP8 A;  2OOB A;  4OU7 A;  3K9O A;  3L27 A;  1IQP A;  3T1H M;  1WHC A;  3SYL A;  1YSY A;  3UMM A;  5IT9 S;  3L29 A;  1IBL M;  4IBB A;  4AKI A;  4Z6Y A;  4DR7 M;  2LHG A;  2GNO A;  3J2P B;  4BBA A;  1VDL A;  1QUS A;  4PCZ A;  4GIP A;  5IZ7 D;  1GL6 A;  2XF3 A;  3CF0 A;  3D8L A;  5FTM A;  5JI3 E;  3KVW A;  1GKI A;  1Q39 A;  3M7G A;  4EIW A;  3I04 M;  3HHY A;  5ITY A;  1IN6 A;  3BBZ A;  2J5Y A;  1IXS A;  4L15 A;  3UJN A;  4REZ A;  3M0E A;  3HY5 A;  4LRT A;  2CHQ A;  1IBK M;  4Y28 F;  2CV0 A;  1OIZ A;  3LCU A;  1DGF A;  1IY1 A;  2K9D A;  5DNY A;  3J7A S;  1TF0 B;  5F3W A;  4II7 A;  4LGY A;  2CFO A;  3BOS A;  1XXH A;  1XNQ M;  3ZH9 B;  3VKH A;  3AL0 C;  1HNZ M;  3U60 B;  2Q2E B;  4DBG B;  2YFQ A;  1Z5B A;  2DEN A;  2XFS A;  4ITQ A;  1OTR A;  1LTM A;  3HJS A;  3VK7 A;  5DFL A;  3F92 A;  3J81 S;  1G41 A;  1D0M A;  5KPZ A;  2RKO A;  1PJT A;  3UK6 A;  3VDU A;  4DV7 M;  3U6D A;  1TDZ A;  1QAQ A;  3FTD A;  5LMU M;  1L1T A;  1WR1 B;  3FUU A;  1DGH B;  3B9P A;  2UUB M;  2R0I A;  1SXJ C;  2KNV A;  2MH8 A;  3KS4 A;  4L6V 6;  4L16 A;  1DO0 A;  2R6F A;  3E21 A;  1XC8 A;  2KDL A;  2ZAO A;  3GRR A;  4F1I A;  1JB0 F;  5IWA M;  3PNY A;  1XXH E;  2VF7 A;  1MN3 A;  3A46 A;  1GJS A;  3AFH A;  4HL4 A;  2Y20 A;  1GAB A;  2ZAN A;  1GL7 A;  3I51 A;  3MK6 A;  2KRK A;  1UFZ A;  1EFU B;  2LH0 A;  3KOZ E;  4KOD A;  4IBE A;  3VKG A;  3DFZ A;  4Z8X A;  2XEP A;  2J7N A;  3FD9 A;  1PJI A;  2DXI A;  3IHP A;  2F5Q A;  1MU5 A;  3SAT A;  5EP2 A;  2X49 A;  5EP4 A;  3I4Y A;  4QHS A;  2LBC A;  1KFV A;  3U6M A;  4R7G A;  3MHV C;  3SHG B;  3LVW A;  1NY5 A;  3SAR A;  4DR6 M;  4NXM M;  1W5T A;  4MGH A;  3CTW B;  4JI1 M;  1XNR M;  2R4E A;  1R2Z A;  4OW0 A;  4AKG A;  1R4G A;  2JY6 B;  3A98 B;  4M0W A;  3U6E A;  1QZM A;  3KDS E;  1IXR C;  2DAK A;  3HU1 A;  4X62 M;  2LWX A;  3GRU A;  1C1K A;  4B7H A;  4M9S A;  2UUA M;  3U6L A;  1K3W A;  4LJ7 A;  2JNH A;  4GRI A;  3VK8 A;  3LQQ A;  2CV2 A;  1F4I A;  2OQ4 A;  3FTF A;  1N33 M;  3SFZ A;  1EIJ A;  2CRU A;  1HNX M;  5EXT A;  4P17 A;  1MX0 A;  3D8B A;  3Q8X A;  4QOZ C;  1Z5C A;  1SXJ B;  5BPV A;  2BJW A;  4AKH A;  2FH0 A;  4RNA A;  3MJ5 A;  4NL4 H;  4TUW A;  2RGH A;  2YNM D;  3WHK A;  3FUT A;  5ITX A;  4LFB M;  2K6B A;  4GIT A;  3L28 A;  1JQJ C;  3SMS A;  5FSW A;  2CWB A;  3HU2 A;  2CV1 A;  3K1J A;  1K3X A;  2BJV A;  2VF8 A;  2LTU A;  1S3S A;  1QZE A;  3I4V A;  2QSF X;  3ZQJ A;  1ZV1 A;  1L2C A;  3QWL A;  2LXE A;  4LJ6 A;  4L78 A;  1XMQ M;  4M0D A;  2VQF M;  2UU9 M;  4F2L A;  4DR4 M;  2KNA A;  4X66 M;  4G4N A;  4GHL A;  4I5S A;  5BR8 M;  4ZPX A;  1IN7 A;  3K8Z A;  1ZMW A;  1OKS A;  2AHM A;  4G3O A;  2KEB A;  3M6A A;  1NO1 A;  4B7F A;  3E46 A;  2Z3X A;  1KYI A;  3TPZ A;  4LRS A;  3DOA A;  3RGS A;  3GPU A;  1DV0 A;  1TH4 A;  4MB7 A;  3T38 A;  4B08 A;  2JY8 A;  2L7I A;  2DZO B;  2X8A A;  1RU3 A;  4L4U A;  3GLI B;  2J7O A;  1V33 A;  1IFY A;  4AI6 A;  5EXS A;  3PXG A;  4IBJ A;  5ITX E;  5FTJ A;  1L1Z A;  4JI7 M;  1R6B X;  1IN8 A;  3FRH A;  1AIP C;  2RGO A;  2Y21 A;  5DYG A;  1N77 A;  3LW5 F;  3KW6 A;  3PNV A;  1Y8G A;  1MJG M;  2DAG A;  4CJ6 A;  1T3T A;  2FS1 A;  2ZTC A;  4LJ8 A;  4G4Q A;  1NHG C;  2C9C A;  4XK8 F;  3U5Z B;  2G5G X;  3OTO M;  2D7E A;  3AKZ A;  4WW0 A;  4ANR A;  1T6O A;  1CUK A;  3FE3 A;  2M60 A;  3GLG B;  3L2A A;  2DAM A;  4XBO A;  3LCV B;  4B3T M;  3AOE A;  3WHL A;  4GKJ M;  2C98 A;  4LJA A;  3GLF A;  3AV0 A;  3B7Z A;  3L26 A;  1PM5 A;  2G3Q A;  3SC3 A;  3B89 A;  2EKF A;  2XLJ A;  2KRU A;  1NNJ A;  4IBF A;  1UM8 A;  3AOG A;  1J5E M;  3C3D A;  4MM3 B;  4MGY E;  3GP1 A;  4LF6 M;  2JXN A;  2N35 A;  2ERC A;  4JI3 M;  1OFI A;  1YUB A;  3KP0 E;  1HT1 E;  1Q02 A;  4I8O A;  1QDT A;  2MGW A;  4FW9 A;  4QNR A;  2R45 A;  3FUX A;  3E9S A;  1HJP A;  2QEN A;  4NRV A;  4PD2 A;  4JI6 M;  4FCW A;  2LVP C;  3HX3 A;  5ITT A;  5EXX A;  4I4L A;  3FKE A;  3VDP A;  2KW0 A;  3R9X B;  4FCV A;  4KLN A;  5ITR A;  3Q8G A;  2WSF F;  2MR9 A;  2D7G A;  1E94 E;  3SAU A;  2JY5 A;  5FTN A;  4CHT B;  3GLF E;  2WSE F;  3A42 A;  1TGU A;  1E9R A;  3QYE A;  1V34 A;  4HLQ A;  3NBI A;  2QZ4 A;  4LCB A;  4OVZ B;  2DZN B;  4GKK M;  4X65 M;  1IY0 A;  4NOO B;  3KOW E;  3GQ4 A;  3H4J A;  3IEC A;  4AZF A;  2JY7 A;  4D81 A;  2JUJ A;  4FD2 A;  2HHH M;  3SBJ A;  4DUY M;  2JP7 A;  3PFI A;  1OFH A;  1WXQ A;  4DV1 M;  3CGW A;  1X37 A;  1VEJ A;  2QQ8 A;  5KQ8 A;  1FNN A;  3B7N A;  4GH9 A;  3R8F A;  1I4W A;  1OIP A;  1VEG A;  2XGN A;  3H4M A;  4NSR A;  3DA1 A;  4JI0 M;  4G6Z A;  4BLC A;  4FWG A;  4MGZ E;  2L6O A;  1J7K A;  1OQY A;  1YLA A;  4LF8 M;  3SYK A;  1E9S A;  5C1B A;  4B3S M;  4JI5 M;  4JV5 M;  1QQW A;  2HWJ A;  2KZU A;  1QVR A;  3PVS A;  3TWK A;  3CF2 A;  3SMP A;  3U5Z A;  2LHC A;  4OX9 M;  1D2N A;  2Y0T A;  4PDI A;  3FTE A;  1XB2 B;  1N36 M;  2DWZ B;  5H37 D;  1LV7 A;  4R3D A;  3J80 S;  1SG9 A;  1C7Y A;  3KS8 A;  1TH3 A;  1NJF A;  4GHA A;  1QUT A;  4FVM A;  1W5S A;  2Z8Y M;  3K92 A;  4DR2 M;  1WGL A;  1NHW C;  2DWN A;  2P5T A;  2JZ0 A;  3GLH B;  2I7N A;  4GC9 A;  2DKL A;  1WGN A;  2FFJ A;  1NY6 A;  2ZAM A;  3HWS A;  3U60 A;  2V6Z M;  3TWL A;  3K9P A;  3U6S A;  2DHY A;  3VFD A;  4QOS A;  2RRU A;  3IG8 A;  2LNH C;  1KSF X;  2L7H A;  1XXH B;  2FNA A;  1IN5 A;  2DAI A;  1J09 A;  1NJG A;  1G4A E;  1Z5A A;  3UGJ A;  4GC5 A;  2C99 A;  1DGH A;  2C96 A;  3U61 B;  4UN2 B;  1IN4 A;  3AJI B;  4QHT A;  4BB9 A;  4DR5 M;  1PRB A;  2NQ8 C;  4M9Z A;  5GKN A;  3HHZ A;  1Z6T A;  5EJC A;  2FOI C;  3NWL A;  2L2D A;  1EE8 A;  2Y0Q A;  4LF4 M;  1PJQ A;  3FUW A;  3QYB A;  3QAU A;  2A5Y B;  2W82 A;  2UUC M;  2L09 A;  1D0L A;  1D0K A;  5L8R F;  2APL A;  3HGI A;  3RGP A;  4JYA M;  1GVN A;  5LMN M;  1GJT A;  1IXZ A;  1XMO M;  2F5N A;  1E32 A;  1I94 M;  1NNU C;  2Z4S A;  3SAS A;  3CF6 E;  3J27 B;  4G4O A;  2DWM A;  3TWM A;  2CHG A;  1ORY B;  2HKJ A;  4LF5 M;  4CGY B;  3L25 A;  2UXC M;  1HNW M;  4PDG A;  3NBX X;  4A3V B;  1K82 A;  2WZJ A;  2K0B X;  4IBG A;  1L8Q A;  2BWE A;  4GEW A;  5ITU A;  4YHH M;  4XGI A;  4GMQ A;  4JI4 M;  3GPX A;  4MGI E;  3W0L B;  3U6P A;  3ZCB B;  2H5X A;  4NC6 A;  1ZAE A;  2XZF A;  2OOA A;  2QHO B;  4AG5 A;  3FYC A;  5KO3 A;  3KOX E;  1ZMV A;  1NV9 A;  1H6U A;  2EO2 A;  4G4R A;  3HU3 A;  5A2Q S;  1IBM M;  4IBC A;  4W5W A;  1NSF A;  3B7Q A;  2OPF A;  1OJL A;  3W67 A;  4MH0 E;  2K47 A;  4LG2 A;  4R71 A;  2H1R A;  3SHF A;  2VQE M;  3U6O A;  1ZMU A;  2HAK A;  1QAN A;  2DZL A;  2EKK A;  2QBY B;  3DZD A;  3MMP A;  2O01 F;  2DAE A;  1QAO A;  3C58 A;  3GPY A;  1VDD A;  1VEK A;  5FLX S;  1N32 M;  3A45 A;  2LVQ D;  1WIV A;  4IJF A;  3GLH A;  4NSO B;  4LJ5 A;  1SXJ D;  1SXJ A;  2R62 A;  3FTC A;  1FJG M;  1QAM A;  2GQF A;  2Z4R A;  4DV3 M;  2V1U A;  2KXE A;  3GQ3 A;  2DNA A;  4WP2 A;  3V76 A;  2F5S A;  3RFW A;  4PT5 A;  4DV0 M;  4S12 A;  5KPR A;  2R46 A;  2XFT A;  2ZBK B;  5E26 A;  2Z7J A;  2ZM6 M;  4DV5 M;  1VQ1 A;  2D7H A;  3HZJ A;  1R7R A;  4Q7J A;  3TQS A;  8CAT A;  1JR3 A;  1JR3 D;  1TDH A;  2EUC A;  1NVM A;  3HJ8 A;  3AOE C;  5ITQ A;  2OO9 A;  4LZZ A;  2B3T A;  2HL7 A;  4JI2 M;  4I81 A;  4QNM A;  4AQY M;  1G8P A;  2L4E A;  2EJS A;  4MGK E;  4RKU F;  3U61 A;  4KHP M;  4DV6 M;  4LY6 A;  4M9X A;  3KSJ A;  3JR4 A;  2KHH A;  2C5R A;  4LJ9 A;  4CIZ A;  4LF9 M;  4HEO A;  1DO2 A;  3E4R A;  4LJ4 A;  2JZ1 A;  3SAV A;  3K2L A;  3RE8 A;  4IIW A;  3FYD A;  2JA2 A;  2F5P A;  1Z59 A;  3T15 A;  1ZQ9 A;  3HHW A;  1G71 A;  1TR8 A;  4NXN M;  3GLH E;  2C9O A;  2VII A;  1SXJ E;  3HJQ A;  3IG5 A;  4FWD A;  4JXJ A;  4LZJ A;  1HR0 M;  2R18 A;  3ZC7 B;  5KPT A;  5EQT A;  3GLI A;  3THG A;  2KNZ A;  2UXB M;  2MRO B;  3B74 A;  2R65 A;  3C3E A;  4DR3 M;  2L4F A;  4LGM A;  3GQ5 A;  1P3Q Q;  4D82 A;  4IBI A;  2FE8 A;  3GRY A;  2LVN C;  4IBK A;  4K0K M;  3TE6 A;  1JR3 E;  1HT2 E;  1Q3B A;  1TTE A;  2X4A A;  3KP1 E;  1GLN A;  2O5R A;  2R4J A;  1L2D A;  2BWB A;  1GO5 A;  2CEA A;  2XSZ A;  2XSZ D;  3HKP A;  4IBD A;  3T1Y M;  4KT0 F;  3LVV A;  2YQZ A;  4RF1 A;  2XZU A;  4KO8 A;  4NRW A;  5IRE B;  3J7B A;  3W68 A;  3TL4 X;  1AUA A;  5FTL A;  3GLG A;  4L8R C;  4B7G A;  2UXD M;  4AG6 A;  1DGG A;  1PGY A;  4DUZ M;  1QDR A;  1TH2 A;  2QPA A;  4DV4 M;  3T6P A;  2DVW B;  3BXW A;  1VG5 A;  1NV8 A;  2LVA A;  4JN6 A;  2JWS A;  2DI0 A;  3I01 M;  1N75 A;  1V92 A;  4B3M M;  3KFU G;  1BVS A;  5DYI A;  5E6J A;  1HQY E;  3GO8 A;  3GLI E;  4LFA M;  1PJJ A;  1IXS B;  3U6C A;  2M5Z A;  2G8L A;  3JR5 A;  4LF7 M;  1Q3C A;  1WJ7 A;  1R2Y A;  2QBY A;  5C18 A;  4AW4 A;  3GLF B;  2WSC F;  2BNK A;  5EXP A;  1R5L A;  3VLF B;  2O25 A;  3GPP A;  3FRI A;  2EA0 A;  3EIE A;  3LMM A;  3KOY E;  4IJE A;  1DGB A;  1PJS A;  2QCU A;  2E5L M;  3UZU A;  3GRV A;  5EP1 A;  3JAM S;  1QYR A;  2DWL A;  1IM2 A;  4LFC M;  5EP3 A;  3U6Q A;  2YR0 A;  5KQD A;  2MJ5 B;  4FWH A;  3GLG E;  4JI8 M;  2R44 A;  4DV2 M;  1OAI A;  2XH9 A;  4X64 M; 
#chains in the Genus database with same CATH homology
 2FH0 A;  1EIJ A;  2CRU A;  2K6B A;  2JXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...