2JXTA

Solution structure of 50s ribosomal protein lx from methanobacterium thermoautotrophicum. northeast structural genomics consortium (nesg) target tr80
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
MKMKTKIFRVKGKFLMGDKLQPFTKELNAIREEEIYERLYSEFGSKHRVPRSKVKIEEIEEISPEEVQDPVVKALVQRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein LX
publication title Solution structure of 50S ribosomal protein LX from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Ribosomal protein
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jxtA01
3FILA 1PGBA 4IOIE 1K52A 1HZ6A 3GB1A 4KGRA 2KQ4X 2ON8A 4OZAA 2NMQA 4OZCA 5HG2A 1MHHE 2GB1A 4HKZE 5HI1A 1UWXA 5HFYA 1FCCC 1QKZA 1ZXHA 2LUMA 1P7FA 1IBXA 1FCLA 1JMLA 2QSDA 1K51A 3V3XA 1MPEA 2KACA 1K53A 2JWUA 2RPVA 2N9LA 1KH0A 2PW9A 2PLPA 2OEDA 1IGDA 2IGHA 2N7JA 1FD6A 2LHDA 1MI0A 1GB4A 3UI3A 5BMHA 4WH4A 4KGTA 1F2RC 3FILB 5BMIA 4MACA 1F2RI 4HJGE 2K0PA 1XF5L 4KGSA 4GLSC 2JXTA 1IGCA 2QMTA 2LHEA 1PGAA 1PGXA 2JSVX 2JZPA 2ONQA 2ZW0A 1GB1A 1MVKA 2PTLA 2J53A 1HEZE 2N9KA 2KDMA 1YMHE 1MHXA 2KWDA 2EELA 1YNTE 2ZW1A 2GI9A 1P7EA 1D4BA 2IGGA 2I38A 1HZ5A 1XCTL 1XCQL 2IGDA 4D2KA 1C9FA 5BMGA 1Q10A 2RMMA 1K50A 2JU6X 4OZBA 2I2YA 5HHDG 2LGIA 1IBXB 5JXVA 2J52A 3MP9A 1EM7A 4IKGA 2KN4A
chains in the Genus database with same CATH superfamily
2ZJDA 4OVVA 3H6NA 3URYA 1GC7A 3ZIMA 1AYFA 4NPNA 1I4GA 3EA6A 1WE7A 2H89B 3KH0A 2J4XA 5E6PA 3CF6E 3T3OA 4OHJA 4A20A 3H1UA 4QAYA 4UDUC 2KWVB 4H2AA 5HFYA 1QKZA 5G5HA 3PV1A 2BYVE 3V05A 5L83A 1C78A 2PLPA 4DXAB 3OWEB 1F1HA 2WX1A 4EKUA 1LXDA 2ACZB 1WXAA 4FJZA 1SE3A 1GJZA 4DHJD 1QOGA 3B0AA 4MACA 3PZ8A 3ZGZA 3DVGY 4ARCA 4MH0E 3L13A 1UUPA 4HCPB 3V60A 4G3XB 4TQ1A 4NQLB 4B9KA 2JX5A 3QJZA 2GLSA 2EMSA 5J2RA 4AWJA 1BUIC 4WJNA 4WJOA 1G6JA 1VCBA 3ALBA 1YMHE 2DNFA 1JWSD 1YIWA 4BKSD 5JHAA 1T0YA 3TCAA 2W82A 1XCQL 4D2KA 4AP4C 1Q10A 2JU6X 2M0AA 4K3CA 5JXVA 1NYQA 2J52A 4IM3A 4A8XC 2JWZA 2GOWA 2K9XA 1FMAD 3I3TB 4YTMB 2IPKD 3HVDA 1EO6A 1TY2A 3P63A 4CQNA 2LGDA 4L1BA 1QOFA 4ZHOA 5HG2A 2MQJA 2KDEB 3AU5A 1V6EA 1UWXA 2DWQA 2AEHA 3PLUA 3PPAA 3ZO5B 2LUMA 2RPQA 3NHEB 5G5GA 2IY0B 4FJYA 3ONSA 3V3XA 4W9IA 3PZDA 4DQOC 2KJHB 3CWIA 2KHWB 2N7EA 1IGDA 2PE6B 4I6NB 2XK5A 4GU2A 3EC8A 2RGFA 1UZXB 4GN1A 4MDKE 4JX1C 4ZDVA 2K39A 3W5UB 2PPHA 5C23A 2EMTA 1SIFA 4N6EB 1WMHB 4GLSC 4NJ6A 2AL6A 3VUWA 2QMTA 2RD0A 3A9KB 3PHXB 1T3QA 1N5XA 4ICUA 3BWUD 1E7UA 1SXTA 1UWMA 1PFDA 3AE8B 1MVKA 4DDGD 5C1ZA 2KQSA 2LWPA 2LZ6A 3MHSD 4G0NB 2D3BA 2JRIB 2KDBA 2K6DB 5CHFA 3IFWB 4E71A 2LVQA 4GOCA 3RNFC 2NCNA 4NJCA 2YEPF 4YTPB 1N61A 4OVUA 2RMMA 2MBQA 4IW0A 3MP9A 4MH8A 3KYCD 3WCQA 5J17A 5MPOA 4CYEA 4DK5A 1M94A 2M1MA 1ZKHA 1V97A 2OOBB 1QOBA 1C4CA 1FNWA 4IWOA 2ZNVC 1OQQA 1UGJA 1ZPSA 1ZXIA 2KC2A 2VZKB 1TS4A 3A1QA 1EUVB 1KF6B 1HXYD 1STEA 5HI1A 4LNNA 3ECIA 1ZP0B 2YVCA 1WGHA 3AH7A 2W9NA 3Q69A 1I35A 1I4HA 4WURA 3TUOA 1S1QB 3BY4B 4FN2A 4NAWA 1GPXA 2BS3B 1C76A 1C3TA 3IBEA 1R7SA 4BAXA 3MJ5A 1RWSA 2M56B 3TEWA 2KLCA 3LXFA 2FCNA 3BVZA 2N9EB 3NVWA 1KM7A 4WH4A 3AEFB 4C7ZA 4AJWA 4ANUA 1TTNA 4RGTA 1WJUA 3AE7B 4XE0A 5CHWA 1R4MI 1ET6A 5D6JB 1N63A 2LHEA 4F1SA 2N9XA 3A9JA 3DPDA 1WGGA 3APCA 1UNSA 2KAJA 4GDLB 3HK0A 4WIPA 2K3UA 2MRPA 5J18A 4XDCA 2KDMA 4LLGM 1UD7A 3JVZX 2NBUA 3PSEB 1IPGA 3AE5B 3BINA 5FR3A 3VH4B 1YJIA 1Y56A 3W9CB 3GZNI 1SEBD 2DHZA 3AE2B 4ICVA 2KFKB 1VD2A 3GP7A 2AYOB 4OZBA 4DWFA 1GG3A 2V9HA 3LYYA 1IP9A 3RPFC 4KX6B 2Y5CA 3AE4B 1K52A 3QA8A 1EU4A 5KHQA 2D5GA 1WFYA 3AE6B 2D11A 3FC4A 3JW0X 3P4QB 4AJYB 1WYGA 3ENEA 3WA0A 2HTHA 4A6QA 2N1WA 4M0WA 1FCCC 3RCZA 3VUYA 1IBXA 2C7HA 3MHZA 5JZEB 3DWMA 3BYYB 4RNAA 4XC2A 5EDSA 2IZVB 3KUCB 4W9HA 2BGFA 2KDFB 3DWGC 4GDKB 1ENFA 2K22A 1YN4A 4AQ7A 1KFYB 3CSTA 4E3CA 3ABVB 3RZFA 3MC8A 3TIXA 1B1ZA 2K0PA 3Q3OC 2MH7A 2LFIA 4LTUA 1RFAA 4MM3A 3ZNHB 1FXAA 2RDBC 4PYZA 3VTUA 1WXVA 3AI5A 3DBSA 2LJIA 3RD2A 4BFRA 4ACFA 2MA9B 5D3IB 1PYWD 2O6VA 3K9OB 2N9KA 2M4NA 5HKHA 2J0JA 2NTSA 1WF9A 2MP2A 4HVBA 4C4VA 3L0WB 3WIMA 3BVGA 2AL3A 3P42A 2OJWA 2I1JA 3KWVA 2MSED 2WU5B 4YT0B 2MLBA 1RM6C 1SJED 2PJHA 4W9GA 2XBBC 1JWUD 3DVGX 3LDZE 4S0RA 2BF8B 1SBBB 2LGIA 3HHMA 5D7GA 3Q2AC 1N6ZA 3BIID 1PGBA 5DPWA 2PMVA 2CU1A 1H8CA 1TKGA 4OZAA 4XWWA 2L52A 1FEHA 1TKEA 2RDGA 4KIKB 3DCGA 2JYTA 2WDTB 4NY0A 4ZRIA 2Q5WD 2CHZA 2BKRB 1JMLA 3AEAB 1D6EC 1MPEA 1P1AA 2C7MB 3U7DA 2K8BA 3RZWC 1SE2A 2M19A 3W5VB 2Z59B 4P1CC 1FD6A 2HTME 4IWPA 3R66C 2IY1B 1N5WA 2LJ5A 1J7AA 3OAWA 2C9WB 4C56C 2KYWA 1FFVA 2ZNVB 2BYTA 3B1LX 2WXFA 4Q2JA 2AQ1B 4C7YA 3ZXVA 2L8JA 4K7WA 3ZKJC 2HJ8A 2DBYA 3SHQA 1C4PA 2JVCA 3DOWA 1YX6B 2NTTA 3TJPA 1V49A 2FIFA 2PEAA 4P16A 1YJ1A 3IAS1 2TSSA 4DXGA 1AWDA 2AQ2B 2LUEA 2X38A 1EWCA 2LGSA 1GC6A 3Q8FA 4II2B 1TS3A 1VZ8A 3L17A 2L0FA 3WALA 3TEYA 2NR2A 3GS2A 2UYZB 5BMGA 2BS4B 4BBNF 3AEBB 3R8BA 3L4PA 4A9AA 3J9CA 4CHKA 3DBHI 2KLGA 1WH3A 5BYQA 3B08A 3ZXRA 3H7PB 3QCAA 4B0MA 1JALA 3ZDMC 1GOZA 2MJDA 3GB1A 1L6VA 4YWGG 1U4AA 2C7NB 2MJEA 1E8YA 4GIVA 1KRHA 2LVOA 3Q14C 2A5UA 3X23A 5H92C 4RM9A 3VUXA 1R4NB 3ZNID 4HROA 3CSFA 3VVWB 3SU8X 2WXOA 2MX2A 3VHTC 3AM9A 3BK1A 1TT5B 3ZNZB 1KH0A 2PW9A 1WJ4A 3I63C 4RM8A 1TKYA 3AULA 4W9JA 4J6IA 3PREA 3SD5A 3NOBA 4YSYB 2XNAC 3AN1A 4FJVB 1XXGA 5TSSA 1GB4A 1L6UA 4KGTA 5DPSA 2INCC 4W9DA 3I57A 4II3B 2QEJC 1D3ZA 3NRZA 4JWUC 1RLFA 1ZDXA 1F0ZA 4BVUC 3GE8C 3L54A 2D2QA 2PVGC 1C77A 2WP9B 4FHKA 3ML9A 2IO3B 2M17A 4WAFA 3DVNV 4WWMA 3KYDD 4MGKE 2KO3A 1WYWB 1SB3C 1R4NI 2WNMA 1WMHA 3APFA 3NS1A 2FCMA 1QZEA 1NI2A 4RFBA 5AEKB 3LJ3A 1XCTL 3A9KA 1XO3A 1CK1A 2QHOA 4PS8A 4DBGA 2WQYB 5C2TB 1SIJA 1EF1A 2HDEA 5DPRA 1VZ6A 4ZYSA 1E5WA 3FILA 2L1AA 3P4RB 4NNJB 1Y8RC 4ZRQA 3PO0A 2NBVB 3BZDB 4GB9A 4ITKA 2KANA 4MJSB 3RN9C 2KT7A 2ICIA 4TUUA 4KSKC 2G9HD 1V81A 1V8CA 1VDVA 4HWIB 1YD8U 3JSVB 4WAAA 5D94A 2YLMA 3AMZA 3RNBC 1TGZB 2DYMA 2C5LC 1OEYJ 2KDIA 3PTFC 1DOYA 2BT6A 2DX5B 3ZJTA 4RCOA 1T5XD 5EE9A 2E3TA 4PYUA 3RNGC 1WGYA 2KVZA 3I9V1 2KWCA 3UF8A 2D07B 3UI3A 4KSLC 3RUIB 4YSXB 2ZPNA 5BMIA 4OW0A 1TS5A 2FAZA 1RAXA 3ZTCA 1WX9A 1NVID 1SJHD 3U8ZA 2V3NA 5E6NA 1KTKA 2SEBD 4HPLB 1PQSA 4DDID 3T9LA 3KUZA 4JGHB 3M3JA 2WXIA 1L7YA 5EE0A 4DHJB 2H88B 2ZCCA 2E6XA 3OLMD 3PGEA 2GI9A 1FM0D 3VDZA 2HJ1A 1WXQA 1D4BA 1KOTA 1WGRA 2IO0B 3L08A 4RMAA 1L0YB 1IUEA 1FRRA 4FLHA 4YL8A 1WX8A 4GDLA 4BBNC 4GMVA 4GXBA 3HM6X 2QDFA 2V3SA 2KN4A 1OQRA 1WGKA 2JZ3B 1TIFA 3PRPB 4TMAB 4IOIE 3PVLA 3VTVA 2L32A 2LVPA 2CKHB 4KGRA 1E7VA 4KZCA 2G1EA 1MG4A 3T8MA 4NQKE 2OHFA 4XYCA 3VTWA 3WAOA 3P1MA 1MHHE 2REXA 4ANXA 1R4MB 5EE3A 2KFKA 3P2BA 2JXXA 2WS3B 3SFDB 1E6EB 2KD0A 2KFJA 4K7UA 3R7QA 1WZ0A 1K51A 4EZJA 4IM0A 1H4RA 1UBQA 2V4LA 1CQVA 1F9JA 3NS8A 2LASA 1L4DB 4NAMA 1JWMD 3DHIC 3AECB 2GBMA 3Q3NC 5H8YE 1SF0A 5BMHA 4WQOB 3GZNB 3N20C 3UGBB 1I4QA 3R3MA 3ZRCA 2DYOA 2JF5A 2GBRA 2J42A 3VXWA 4HDQA 3H8HA 1PGXA 1XQQA 2NS5A 1L0XB 2W3SA 1OQYA 2W55A 4F7ZA 2BYFA 4HDOA 2J0KA 1JROA 4B6WA 3ETRA 3UIOB 4GDKA 1N60A 3N32A 2WXRA 4F8CB 1D5ZC 3ZW3A 4EFOA 4EE2A 1QF6A 3H7SA 2LRUA 2IO1B 2LEKA 4TKNA 4XDDA 4AUQC 3RNCC 5LXHA 5IP4D 1JRUA 1Z2MA 1OGWA 2AX5A 4G50A 1WR1A 1WY8A 1DOXA 4IKGA 2JPHA 1UH6A 3LB8C 4A3PA 3UIPB 4W9KA 3IHPC 4ZYNA 3U2SC 2B3AA 2MEKA 5GMVA 3PRZA 4PS3A 5JH5C 1T0RC 1CZPA 2HD5B 2L05A 1FCLA 4HCNB 3RI7C 4LJPB 4L23A 1YQBA 2MJ3A 1K53A 1LFDA 1WSPA 2OEDA 2DAJA 3KWLA 4ZRKA 2KQ7A 2IGHA 3RMKC 3UQAA 2O2VB 1YQ4B 2DLBA 3W1SC 4BOSC 1P0RA 1LQBA 1V5TA 4LNOA 2BTEA 5KHOA 2ZZPB 4KIKA 1FO4A 3JYUA 2OJRA 5IN7A 5L95C 4M8NA 2R2QA 2KJRA 3M95A 4MELA 3PT2B 1HTOA 3BVMA 1QT9A 3RULA 2MBHA 2WLBA 3S2AA 2J53A 1FXTB 1VR9A 2XN9C 1XLPA 4MGIE 2K8HA 2N1VA 1V1PB 1YQ3B 1J0GA 4MT5A 5IO9A 3D32A 1D5XC 3QC8B 3M62B 1I7HA 3AEGB 4FADA 4WWNA 2PE9A 1B9RA 3AEDB 3NG0A 1FPYA 5IAAC 1A70A 1XLNA 5LXIB 3DVNU 1XLQA 3IG3A 2MWSB 3NVYA 4LNKA 4KVGB 4E74A 4LCDE 2O6VD 2FUHB 3TEXA 1I4XA 2NPTB 2W3RA 3OJ3A 3DBRB 2JY6A 3NJTA 2Z8LA 3UQBA 2KTRB 1I4RA 1RFKA 1KLVA 1MG8A 4HKQA 1ZXHA 4W9EA 4XWTA 3BK2A 5AZHA 3H7PA 2VH2A 4W9CA 3SFEB 1L2NA 1NEKB 3QAQA 3Q8CA 2C60A 4LDTD 4A55A 1I4PA 1FXIA 2MHJA 4MEMA 4JPSA 3EUB2 2JUOA 4P1BC 3ZDTA 2EKIA 2N7DA 2PVOD 1DYQA 4NZLB 2WYQA 1A5RA 3ZRFA 3GOEA 3WAMA 3CIRB 2Y5BB 3DBHB 4W9FA 1NBFC 3A33B 2DZMA 1J7CA 2QIEB 1L5PA 2JRHA 2R2OA 3VRAB 1UBIA 4RF1A 3RNAC 3W2DA 3OJ4B 1RYJA 5LNK1 3DBRI 3P4SB 2EELA 1YNTE 2ZW1A 1L4ZB 1P98A 3RT3B 4O1NA 3ZQ4A 1BMLC 1N62A 3V62A 5CTRC 3QIJA 4K1RB 2LI5A 1WR6E 2X8XX 2DAFA 4G11A 4JQWC 4IC7B 1KLUD 2J7QB 2KOXA 3PZ7A 4MM3B 1F52A 1ZDVA 1ZOYB 2L76A 5IA7A 4KZ0A 3L16A 1KLGD 1CMXB 4REZA 2ON8A 2NMQA 3EHVA 1V9JA 3IVFA 2V3PA 5E6OA 3HUIA 4JWSC 4EZLA 3KLSX 3AE9B 1E8XA 2WXLA 1E10A 3NVVA 4R3DA 1S3SG 4IWQA 1FNUA 2RR9A 1LGRA 3N3KB 5IOIA 2BBCA 2V4IB 3RYTA 4MSQB 4P7IA 1E7PB 3TMPB 3MFGA 3EFCA 3MC9A 3DBLB 4N9F4 2R61A 1GNUA 4BOZB 3N1XC 3VAWA 4N58A 2VH1A 2CR5A 1HTQA 2BW2A 1F2RC 2MBEA 4HJGE 1I42A 1UELA 1WZ3A 4US8A 4IDIA 1WM3A 1XD3B 3TEZA 2BPSA 3SDLC 2DZKA 1V80A 4RGOS 2LXCA 5BYSA 2PTLA 1E0ZA 3ZNGC 1Q5WB 2BVCA 4YSZB 3Q8EA 3V6CB 5AZGA 3MJWA 4EZKA 2KWUB 2D3GA 4FA6A 3E9SA 2K8CA 1ISNA 1HZ5A 2KZRA 4YXDB 1FIQA 4IUMB 5HHDG 4XX5A 2K25A 2EKEC 1QQRA 1WJNA 1WRIA 3DBLI 3E56A 1EM7A 3QK0A 1XLOA 2W54A 3EFUA 2ZCBA 1HE8A 1HZ6A 4LNIA 3ZTDA 2ZEQA 5D2MB 4HLEA 2LXAA 1J19A 1MJDA 1SGHA 3QX1A 4ZOHC 5FKAC 4TSSA 1FNVA 3W1YA 2IYDB 4IG7B 2KMAA 2KTFA 2ZVNA 3IT6B 1P3QU 2KKCA 2PKOA 3I5JC 3R2TA 4JLCA 5D3DA 5TR5A 2LGXA 2BB5A 2L3ZA 1ZE3D 3N30A 4BKSA 4KKJA 2G4DB 1X1MA 3R2IA 3ZJVA 1ESFA 1AW7A 1HQRD 1LO5D 1OFFA 1XF5L 2XEWA 2WXJA 2YEPB 2JXTA 1IGCA 2FBWB 2HE7A 5EE1A 2ZVOA 4WQMA 4AS1A 2UU7A 2WXQA 4LJOB 1JCKB 2WXPA 5IKCM 2BKFA 1GAQB 1Q0WB 3Q3MC 3VH3B 1V2YA 1C4AA 1WGDA 3EECA 2SAKA 2VZKD 3AU4A 2I38A 4LK0M 3AEEB 3QHTA 3Q3JA 5BYRA 2FIDA 1YX5B 4BZAA 2IGDA 5CHVC 1PDXA 4CO7A 4I6PA 2I2YA 2DZJA 4K3BA 2N0SB 5FR6A 1JWBD 2MBBB 1QLBB 4EUTA 1YJJA 2CJOA 1EU3A 2BS2B 1TZOA 3FAHA 1WIAA 3U4EG 2MBOA 4FXCA 3WANA 4HRSA 4BKTA 2ZPYA 3R7RA 2KQ4X 2Y3AA 2LMCA 1SE9A 1V86A 1VJKA 1C79A 3V61A 1WE6A 3ZLZA 1NENB 1XEEA 1HA5A 3P4PB 3B9JA 2N9LA 3SEBA 4ANVA 3AE1B 4S17A 4ARIA 2BQQA 2L83A 2RDHA 4HXDA 4RGMA 1WXMA 3GE3C 4LNFA 4HPMB 3FILB 5DCNA 4WJQA 2K6QA 3PHWB 3NZSA 2G3QB 3Q3FA 3VQIA 4M8MA 2UWQA 1GUAB 1VRAB 2WDRB 1UGMA 2O2VA 3A4SC 4YTNB 3TBLD 4HK2A 2KK8A 4B0EA 3V6EB 4JL9A 1C1YB 1Q1OA 3H9DA 1MHXA 1KJTA 4XGAB 4DXFA 2QC8A 2INNE 2GMIC 2IGGA 2IBIB 1E8WA 3WAPA 3C19A 1WWTA 2NVUI 4URKA 4HJKA 2RSUA 2CJNA 4N59A 4HEA1 4KDLB 5DPTA 3AXCA 2N4FA 3L10B 4DHZE 4ZHPA 1LM8B 1OTRB 3T3NA 4M00A 2QILA 3CMMB 4OVZA 3VFKA 4IM2A 2XK5B 1FFUA 3HVZA 2LD9A 4OZCA 1V1PA 4MGZE 2WXGA 3EGRA 4WWPA 2GB1A 2WHIA 4HKZE 2VRRB 3Q6BA 2NBWB 2A4ZA 3PLVA 2QSDA 2WU2B 5G55A 3HM3A 2N9PC 2KACA 3QWZB 1RRBA 4XZ4A 2AQ3B 1CJEA 3IAM1 2JQRB 3M63B 2BYEA 1XT9B 4TV3A 4C80A 2N7JA 2M0XA 2CHWA 3N1YC 4WWOA 3X0WA 1WM2A 3ZJUA 1MI0A 2NPTA 2MCNB 4A90A 3UINB 1F2RI 2KTRA 2KN5A 3N9YC 2INPE 3IT4B 3AE3B 4GGQA 2WXNA 2KMCA 2LGYA 3PRMB 5AUIA 2IO2B 1ZGUB 2FCSA 2KNBA 3N1ZC 2BWES 4GSWA 3DQVA 2WXMA 2ONQA 3Q8AA 2AWTA 5G2NA 1D5MC 1SE4A 2CHXA 4J3OD 3TL5A 2FCQA 5LLIA 1BXTA 3ZYYX 3RNEC 2GBKA 1YN5A 1P7EA 1ZUD2 5T8IA 4PK1A 1WJ6A 2CS4A 1TY0A 3A1QB 1Z5SB 3B2GA 2L00B 3VR8B 1K8RB 3MC0B 3DHGC 4ZRPA 2G4SA 2K1FA 3FKYA 1TZ1A 4NAWB 2I1KA 1ZW7A 2G45B 2ASQA 5BO4B 3ZVVA 2FNJB 5AZFA 4JIOU 4B95A 2MW5A 1VZ7A 1WX7A 4JE3B 1JRPA 4WJPA 4HPPA 5CX3A 4EEWA 1WI0A 4FHJA 3U7ZA 1M4VA 1DOIA 2JT4B 1VLBA 2QJLA 3A9JB 1UF0A 3C8YA 4KDIC 2JYEA 1TJEA 2D3CA 2WXKA 3DDCB 1EWYC 1F77A 4KKIA 4ZRJA 1AN8A 4USAA 4ASWC 3AB5A 3Q8BA 3B2FA 3DHHC 4MSMB 2DENB 1QOAA 4EOYA 2WDVB 2Z0EB 1NI3A 2L0TA 2JSVX 1TYGB 3KQ4A 3HRDD 2D10A 3C0RB 4A3OA 1BT0A 4X57B 2Z0DB 3PS6A 1T0QC 5E6JA 3QQ8B 3ZUNA 2KWDA 3HIZA 2WX0A 4C00A 3KVFB 3NZ3A 2KX0A 1EF5A 4I6LB 2GBNA 1IYFA 4FULA 1C9FA 1DGJA 4M0WB 1TS2A 2DZIA 4TQ0A 4M02A 3U30A 1E9MA 1IBXB 4MGYE 4PS7A 4FBJB 2JZZA 4W9LA 2BB6A 1E8ZA 3KUDB 1PUTA 2KC1A 5FK9C 1T6BX 1JQ4A 3NUHB 2DYBA 3A4RA 1MFWA 2BWFA 4PT5A 3U52E 3W1SA 3NZUA 3MTNB 1OEYA 4RH6A 5AUKA 1AARA 2V0GA 1NDDA 3QARA 4K7SA 5JHBA 2K5PA 1P7FA 2WWZA 1ROEA 2JWUA 2RPVA 2KVRA 4P6VF 2L7RA 1T0SC 3APDA 4ANWA 1E90A 2O6VB 1QILA 3NY5A 3O13A 1J7BA 2FUG1 2WDQB 2LHDA 2KXJA 3BYTB 2WXHA 1WRDB 4L2YA 2CU3A 2MP2B 2QCZA 4C4VB 2PIAA 3NVZA 2FE8A 4KGSA 1V1OA 2V1YA 3O65B 5I4DA 1SSNA 1PGAA 1L0VB 1FRDA 3VRBB 1WXSA 2IDYA 1J8CA 2JZPA 3SR6A 4MJSA 2ZW0A 1GB1A 2IJ0A 4DHZB 5C3JB 4LDTB 4RF0A 1HEZE 4US9A 4KV2A 5GXGB 1JWAD 1YOVB 2Y5PA 3JSVA 2LRWA 3KW5B 2INDC 1YN3A 4RGNA 4BKGA 3IXSA 4NJ7A 2KX3A 2D3AA 3ML8A 3VR9B 3OG5A 1ET9A 2KJ6A 4AOFA 1JW9D 3K9PB 2GRIA 2B76B 2WGSA 4M01A 2KMMA 3TSSA 2M8SA 3AV8A 1K50A 2GBJA 1NYRA 3RFZB 1P9DU 2J0MA 1ACCA 1TBEA 4K81A 1V5OA
chains in the Genus database with same CATH topology
3LB8C 3U4EG 1PGBA 3URYA 4FXCA 1AYFA 4HRSA 1I4GA 2PMVA 3EA6A 2KQ4X 2H89B 1TKGA 2Y3AA 2J4XA 4OZAA 3U2SC 4XWWA 2LMCA 2L52A 1FEHA 1TKEA 2RDGA 2MEKA 1VJKA 3T3OA 4OHJA 1CZPA 2JYTA 4UDUC 4H2AA 2Q5WD 1QKZA 1C79A 5HFYA 5G5HA 1NENB 1XEEA 1FCLA 1JMLA 3AEAB 1HA5A 3V05A 4L23A 1D6EC 1MPEA 2MJ3A 3P4PB 1K53A 3B9JA 2N9LA 3SEBA 1SE2A 3AE1B 1C78A 1TZOA 1WSPA 2PLPA 2OEDA 3KWLA 3OWEB 2M19A 3W5VB 4ARIA 2IGHA 1FD6A 2HTME 2L83A 1YQ4B 2DLBA 2RDHA 2ACZB 1N5WA 4RGMA 1J7AA 2BTEA 1SE3A 3FILB 4C56C 1FO4A 1QOGA 4MACA 1FFVA 2BYTA 3PZ8A 2WXFA 4Q2JA 2AQ1B 3ZGZA 4ARCA 4C7YA 1UUPA 4TQ1A 3VQIA 2DBYA 2JX5A 3BVMA 1C4PA 1VRAB 1QT9A 2WDRB 2WLBA 1BUIC 2NTTA 2J53A 4YTNB 4B0EA 1VR9A 4P16A 3IAS1 2TSSA 2XN9C 1YMHE 1MHXA 4DXGA 1AWDA 2AQ2B 1XLPA 4DXFA 2X38A 1JWSD 1EWCA 3Q8FA 1TS3A 2INNE 1VZ8A 1V1PB 1YQ3B 2IGGA 4MT5A 1D5XC 2W82A 1XCQL 3TEYA 1I7HA 3AEGB 4D2KA 3GS2A 1B9RA 5BMGA 1Q10A 2BS4B 1WWTA 3AEDB 2JU6X 2M0AA 3AEBB 1A70A 5JXVA 1NYQA 1XLNA 2CJNA 2J52A 4HEA1 4N59A 3R8BA 3L4PA 4A8XC 1XLQA 4A9AA 3J9CA 5BYQA 2K9XA 1FMAD 4YTMB 3NVYA 2IPKD 4B0MA 4ZHPA 3T3NA 1JALA 2QILA 1GOZA 2MJDA 4OVZA 3HVDA 3GB1A 1L6VA 3TEXA 4YWGG 1TY2A 1I4XA 3P63A 4CQNA 2MJEA 1FFUA 2W3RA 3HVZA 1KRHA 1QOFA 4L1BA 4OZCA 4ZHOA 1V1PA 5HG2A 2WXGA 3EGRA 5H92C 2Z8LA 2GB1A 4HKZE 4HROA 1I4RA 1RFKA 1UWXA 2DWQA 4HKQA 1ZXHA 2LUMA 2WXOA 5G5GA 4XWTA 2QSDA 2WU2B 3AM9A 3BK2A 3BK1A 3V3XA 2KACA 2AQ3B 1KH0A 2PW9A 3SFEB 1CJEA 3IAM1 4DQOC 1NEKB 2JQRB 3CWIA 1TKYA 3Q8CA 1IGDA 4A55A 2N7JA 4C80A 1I4PA 4YSYB 1FXIA 2XNAC 3AN1A 3ZJUA 1MI0A 1XXGA 5TSSA 1GB4A 4JPSA 3EUB2 4A90A 1L6UA 4KGTA 4JX1C 2EKIA 3I57A 1F2RI 3W5UB 2PVOD 2QEJC 3N9YC 3NRZA 1DYQA 4N6EB 2INPE 3IT4B 3AE3B 4GLSC 4NZLB 2WXNA 2QMTA 5AUIA 4JWUC 1ZDXA 1T3QA 3CIRB 2WXMA 1N5XA 3BWUD 1F0ZA 1UWMA 1SXTA 2ONQA 1PFDA 3Q8AA 3AE8B 1MVKA 2PVGC 1J7CA 1D5MC 1L5PA 1SE4A 2QIEB 3VRAB 1C77A 4J3OD 4RF1A 2WP9B 3W2DA 1RYJA 5LNK1 1BXTA 4WAFA 3P4SB 4WWMA 2EELA 1YNTE 3ZYYX 1SB3C 2ZW1A 1L4ZB 4O1NA 2WNMA 1YN5A 1P7EA 1ZUD2 3NS1A 3ZQ4A 1BMLC 1N62A 4RFBA 4NJCA 1XCTL 5T8IA 2YEPF 1TY0A 4YTPB 1N61A 2RMMA 1XO3A 1CK1A 2WQYB 3B2GA 1KLUD 3VR8B 5C2TB 3PZ7A 1SIJA 3MC0B 3MP9A 4MH8A 4MM3B 4ZRPA 3WCQA 1ZOYB 1ZDVA 2HDEA 1VZ6A 4NAWB 4ZYSA 5MPOA 3FILA 2L1AA 3P4RB 1KLGD 4ZRQA 3PO0A 1V97A 1QOBA 3BZDB 1C4CA 4ITKA 1FNWA 4REZA 1VZ7A 4JE3B 1JRPA 2ON8A 1OQQA 1UGJA 1ZPSA 2NMQA 2ICIA 2G9HD 2V3PA 1ZXIA 2VZKB 1V8CA 1VDVA 3HUIA 4JWSC 1TS4A 3KLSX 3AE9B 2WXLA 1E10A 3NVVA 4R3DA 5HI1A 1KF6B 1HXYD 1STEA 3U7ZA 1M4VA 3AMZA 1FNUA 1ZP0B 1DOIA 2DYMA 3AH7A 2BBCA 2V4IB 3Q69A 1VLBA 1DOYA 1I4HA 2QJLA 2BT6A 3ZJTA 4RCOA 1E7PB 4WURA 3TUOA 1T5XD 3MFGA 5EE9A 2E3TA 3C8YA 1GPXA 2BS3B 1C76A 2JYEA 1R7SA 1TJEA 2R61A 3MJ5A 1RWSA 2M56B 2WXKA 3TEWA 3I9V1 3LXFA 4N58A 3BVZA 1EWYC 1F77A 3UI3A 4KKIA 3NVWA 4WH4A 2BW2A 1AN8A 3AEFB 4YSXB 4USAA 1F2RC 5BMIA 3AB5A 3Q8BA 3B2FA 4OW0A 4HJGE 1TS5A 4C7ZA 4US8A 4RGTA 3AE7B 1QOAA 4XE0A 1ET6A 4IDIA 2WDVB 1N63A 2LHEA 1NI3A 3TEZA 1UNSA 1NVID 2JSVX 1TYGB 2KAJA 3KQ4A 3HRDD 4GDLB 1SJHD 4WIPA 2V3NA 2K3UA 1KTKA 4RGOS 5BYSA 2SEBD 4XDCA 2PTLA 1E0ZA 4YSZB 2KDMA 5E6JA 4LLGM 3Q8EA 2WXIA 3AE5B 5FR3A 2KWDA 5EE0A 1YJIA 2H88B 3NZ3A 2E6XA 1Y56A 3W9CB 2GI9A 1FM0D 3E9SA 1SEBD 1WXQA 1D4BA 3AE2B 1HZ5A 1L0YB 1IUEA 1FRRA 4YXDB 1FIQA 1DGJA 1C9FA 1TS2A 3GP7A 4OZBA 4TQ0A 1E9MA 5HHDG 3LYYA 1IBXB 1QQRA 2BB6A 1WRIA 3RPFC 3E56A 1EM7A 1PUTA 2KN4A 4KX6B 5FK9C 1OQRA 1T6BX 1WGKA 1JQ4A 1XLOA 4TMAB 2W54A 2Y5CA 4IOIE 3AE4B 1K52A 2L32A 3NUHB 1HZ6A 4PT5A 4KGRA 1EU4A 2G1EA 3U52E 3W1SA 2D5GA 3AE6B 4RH6A 3FC4A 2OHFA 5AUKA 4ZOHC 5FKAC 3P1MA 1MHHE 3P4QB 2V0GA 1WYGA 4TSSA 5EE3A 1FNVA 4A6QA 4M0WA 2WS3B 1FCCC 2K5PA 3SFDB 1E6EB 1P7FA 1IBXA 3IT6B 3MHZA 1ROEA 1K51A 3DWMA 3BYYB 2PKOA 4RNAA 1CQVA 2JWUA 2RPVA 4P6VF 3R2TA 3DWGC 5D3DA 1L4DB 4NAMA 1QILA 1JWMD 3O13A 1J7BA 3AECB 2FUG1 4GDKB 2BB5A 1ENFA 2WDQB 2LHDA 3BYTB 1ZE3D 5H8YE 1SF0A 2K22A 2WXHA 1YN4A 4KKJA 1KFYB 4L2YA 5BMHA 4AQ7A 2CU3A 3R2IA 3ABVB 3ZJVA 1ESFA 1AW7A 1HQRD 2PIAA 1I4QA 3NVZA 1LO5D 2DYOA 1B1ZA 2FE8A 2K0PA 1OFFA 2MH7A 1XF5L 2LFIA 2J42A 4LTUA 2WXJA 4KGSA 2YEPB 1V1OA 2JXTA 1IGCA 5I4DA 1FXAA 2FBWB 1SSNA 1PGAA 3H8HA 5EE1A 4WQMA 1PGXA 1L0VB 1FRDA 4AS1A 2LJIA 3VRBB 2IDYA 1L0XB 2W3SA 2JZPA 3SR6A 2WXQA 2W55A 2ZW0A 1GB1A 5D3IB 1JCKB 2IJ0A 5C3JB 1PYWD 2WXPA 1JROA 4RF0A 1HEZE 3ETRA 2N9KA 4US9A 1N60A 5GXGB 2WXRA 1JWAD 2NTSA 1D5ZC 2Y5PA 1GAQB 4EE2A 1QF6A 3BVGA 1YN3A 3P42A 4RGNA 3IXSA 1C4AA 3KWVA 2SAKA 3VR9B 2WU5B 2VZKD 4YT0B 2I38A 4LK0M 1ET9A 3AEEB 2LEKA 1RM6C 1SJED 1JW9D 5BYRA 2GRIA 2B76B 2IGDA 2KMMA 4XDDA 1PDXA 3TSSA 1JWUD 3AV8A 1K50A 1NYRA 3RFZB 2I2YA 1SBBB 2LGIA 2N0SB 1JWBD 1QLBB 1ACCA 1YJJA 5D7GA 2CJOA 2AX5A 3BIID 1DOXA 4IKGA 1EU3A 2BS2B 3FAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIL A;  1PGB A;  4IOI E;  1K52 A;  1HZ6 A;  3GB1 A;  4KGR A;  2KQ4 X;  2ON8 A;  4OZA A;  2NMQ A;  4OZC A;  5HG2 A;  1MHH E;  2GB1 A;  4HKZ E;  5HI1 A;  1UWX A;  5HFY A;  1FCC C;  1QKZ A;  1ZXH A;  2LUM A;  1P7F A;  1IBX A;  1FCL A;  1JML A;  2QSD A;  1K51 A;  3V3X A;  1MPE A;  2KAC A;  1K53 A;  2JWU A;  2RPV A;  2N9L A;  1KH0 A;  2PW9 A;  2PLP A;  2OED A;  1IGD A;  2IGH A;  2N7J A;  1FD6 A;  2LHD A;  1MI0 A;  1GB4 A;  3UI3 A;  5BMH A;  4WH4 A;  4KGT A;  1F2R C;  3FIL B;  5BMI A;  4MAC A;  1F2R I;  4HJG E;  2K0P A;  1XF5 L;  4KGS A;  4GLS C;  2JXT A;  1IGC A;  2QMT A;  2LHE A;  1PGA A;  1PGX A;  2JSV X;  2JZP A;  2ONQ A;  2ZW0 A;  1GB1 A;  1MVK A;  2PTL A;  2J53 A;  1HEZ E;  2N9K A;  2KDM A;  1YMH E;  1MHX A;  2KWD A;  2EEL A;  1YNT E;  2ZW1 A;  2GI9 A;  1P7E A;  1D4B A;  2IGG A;  2I38 A;  1HZ5 A;  1XCT L;  1XCQ L;  2IGD A;  4D2K A;  1C9F A;  5BMG A;  1Q10 A;  2RMM A;  1K50 A;  2JU6 X;  4OZB A;  2I2Y A;  5HHD G;  2LGI A;  1IBX B;  5JXV A;  2J52 A;  3MP9 A;  1EM7 A;  4IKG A;  2KN4 A; 
#chains in the Genus database with same CATH topology
 2ZJD A;  4OVV A;  3H6N A;  3URY A;  1GC7 A;  3ZIM A;  1AYF A;  4NPN A;  1I4G A;  3EA6 A;  1WE7 A;  2H89 B;  3KH0 A;  2J4X A;  5E6P A;  3CF6 E;  3T3O A;  4OHJ A;  4A20 A;  3H1U A;  4QAY A;  4UDU C;  2KWV B;  4H2A A;  5HFY A;  1QKZ A;  5G5H A;  3PV1 A;  2BYV E;  3V05 A;  5L83 A;  1C78 A;  2PLP A;  4DXA B;  3OWE B;  1F1H A;  2WX1 A;  4EKU A;  1LXD A;  2ACZ B;  1WXA A;  4FJZ A;  1SE3 A;  1GJZ A;  4DHJ D;  1QOG A;  3B0A A;  4MAC A;  3PZ8 A;  3ZGZ A;  3DVG Y;  4ARC A;  4MH0 E;  3L13 A;  1UUP A;  4HCP B;  3V60 A;  4G3X B;  4TQ1 A;  4NQL B;  4B9K A;  2JX5 A;  3QJZ A;  2GLS A;  2EMS A;  5J2R A;  4AWJ A;  1BUI C;  4WJN A;  4WJO A;  1G6J A;  1VCB A;  3ALB A;  1YMH E;  2DNF A;  1JWS D;  1YIW A;  4BKS D;  5JHA A;  1T0Y A;  3TCA A;  2W82 A;  1XCQ L;  4D2K A;  4AP4 C;  1Q10 A;  2JU6 X;  2M0A A;  4K3C A;  5JXV A;  1NYQ A;  2J52 A;  4IM3 A;  4A8X C;  2JWZ A;  2GOW A;  2K9X A;  1FMA D;  3I3T B;  4YTM B;  2IPK D;  3HVD A;  1EO6 A;  1TY2 A;  3P63 A;  4CQN A;  2LGD A;  4L1B A;  1QOF A;  4ZHO A;  5HG2 A;  2MQJ A;  2KDE B;  3AU5 A;  1V6E A;  1UWX A;  2DWQ A;  2AEH A;  3PLU A;  3PPA A;  3ZO5 B;  2LUM A;  2RPQ A;  3NHE B;  5G5G A;  2IY0 B;  4FJY A;  3ONS A;  3V3X A;  4W9I A;  3PZD A;  4DQO C;  2KJH B;  3CWI A;  2KHW B;  2N7E A;  1IGD A;  2PE6 B;  4I6N B;  2XK5 A;  4GU2 A;  3EC8 A;  2RGF A;  1UZX B;  4GN1 A;  4MDK E;  4JX1 C;  4ZDV A;  2K39 A;  3W5U B;  2PPH A;  5C23 A;  2EMT A;  1SIF A;  4N6E B;  1WMH B;  4GLS C;  4NJ6 A;  2AL6 A;  3VUW A;  2QMT A;  2RD0 A;  3A9K B;  3PHX B;  1T3Q A;  1N5X A;  4ICU A;  3BWU D;  1E7U A;  1SXT A;  1UWM A;  1PFD A;  3AE8 B;  1MVK A;  4DDG D;  5C1Z A;  2KQS A;  2LWP A;  2LZ6 A;  3MHS D;  4G0N B;  2D3B A;  2JRI B;  2KDB A;  2K6D B;  5CHF A;  3IFW B;  4E71 A;  2LVQ A;  4GOC A;  3RNF C;  2NCN A;  4NJC A;  2YEP F;  4YTP B;  1N61 A;  4OVU A;  2RMM A;  2MBQ A;  4IW0 A;  3MP9 A;  4MH8 A;  3KYC D;  3WCQ A;  5J17 A;  5MPO A;  4CYE A;  4DK5 A;  1M94 A;  2M1M A;  1ZKH A;  1V97 A;  2OOB B;  1QOB A;  1C4C A;  1FNW A;  4IWO A;  2ZNV C;  1OQQ A;  1UGJ A;  1ZPS A;  1ZXI A;  2KC2 A;  2VZK B;  1TS4 A;  3A1Q A;  1EUV B;  1KF6 B;  1HXY D;  1STE A;  5HI1 A;  4LNN A;  3ECI A;  1ZP0 B;  2YVC A;  1WGH A;  3AH7 A;  2W9N A;  3Q69 A;  1I35 A;  1I4H A;  4WUR A;  3TUO A;  1S1Q B;  3BY4 B;  4FN2 A;  4NAW A;  1GPX A;  2BS3 B;  1C76 A;  1C3T A;  3IBE A;  1R7S A;  4BAX A;  3MJ5 A;  1RWS A;  2M56 B;  3TEW A;  2KLC A;  3LXF A;  2FCN A;  3BVZ A;  2N9E B;  3NVW A;  1KM7 A;  4WH4 A;  3AEF B;  4C7Z A;  4AJW A;  4ANU A;  1TTN A;  4RGT A;  1WJU A;  3AE7 B;  4XE0 A;  5CHW A;  1R4M I;  1ET6 A;  5D6J B;  1N63 A;  2LHE A;  4F1S A;  2N9X A;  3A9J A;  3DPD A;  1WGG A;  3APC A;  1UNS A;  2KAJ A;  4GDL B;  3HK0 A;  4WIP A;  2K3U A;  2MRP A;  5J18 A;  4XDC A;  2KDM A;  4LLG M;  1UD7 A;  3JVZ X;  2NBU A;  3PSE B;  1IPG A;  3AE5 B;  3BIN A;  5FR3 A;  3VH4 B;  1YJI A;  1Y56 A;  3W9C B;  3GZN I;  1SEB D;  2DHZ A;  3AE2 B;  4ICV A;  2KFK B;  1VD2 A;  3GP7 A;  2AYO B;  4OZB A;  4DWF A;  1GG3 A;  2V9H A;  3LYY A;  1IP9 A;  3RPF C;  4KX6 B;  2Y5C A;  3AE4 B;  1K52 A;  3QA8 A;  1EU4 A;  5KHQ A;  2D5G A;  1WFY A;  3AE6 B;  2D11 A;  3FC4 A;  3JW0 X;  3P4Q B;  4AJY B;  1WYG A;  3ENE A;  3WA0 A;  2HTH A;  4A6Q A;  2N1W A;  4M0W A;  1FCC C;  3RCZ A;  3VUY A;  1IBX A;  2C7H A;  3MHZ A;  5JZE B;  3DWM A;  3BYY B;  4RNA A;  4XC2 A;  5EDS A;  2IZV B;  3KUC B;  4W9H A;  2BGF A;  2KDF B;  3DWG C;  4GDK B;  1ENF A;  2K22 A;  1YN4 A;  4AQ7 A;  1KFY B;  3CST A;  4E3C A;  3ABV B;  3RZF A;  3MC8 A;  3TIX A;  1B1Z A;  2K0P A;  3Q3O C;  2MH7 A;  2LFI A;  4LTU A;  1RFA A;  4MM3 A;  3ZNH B;  1FXA A;  2RDB C;  4PYZ A;  3VTU A;  1WXV A;  3AI5 A;  3DBS A;  2LJI A;  3RD2 A;  4BFR A;  4ACF A;  2MA9 B;  5D3I B;  1PYW D;  2O6V A;  3K9O B;  2N9K A;  2M4N A;  5HKH A;  2J0J A;  2NTS A;  1WF9 A;  2MP2 A;  4HVB A;  4C4V A;  3L0W B;  3WIM A;  3BVG A;  2AL3 A;  3P42 A;  2OJW A;  2I1J A;  3KWV A;  2MSE D;  2WU5 B;  4YT0 B;  2MLB A;  1RM6 C;  1SJE D;  2PJH A;  4W9G A;  2XBB C;  1JWU D;  3DVG X;  3LDZ E;  4S0R A;  2BF8 B;  1SBB B;  2LGI A;  3HHM A;  5D7G A;  3Q2A C;  1N6Z A;  3BII D;  1PGB A;  5DPW A;  2PMV A;  2CU1 A;  1H8C A;  1TKG A;  4OZA A;  4XWW A;  2L52 A;  1FEH A;  1TKE A;  2RDG A;  4KIK B;  3DCG A;  2JYT A;  2WDT B;  4NY0 A;  4ZRI A;  2Q5W D;  2CHZ A;  2BKR B;  1JML A;  3AEA B;  1D6E C;  1MPE A;  1P1A A;  2C7M B;  3U7D A;  2K8B A;  3RZW C;  1SE2 A;  2M19 A;  3W5V B;  2Z59 B;  4P1C C;  1FD6 A;  2HTM E;  4IWP A;  3R66 C;  2IY1 B;  1N5W A;  2LJ5 A;  1J7A A;  3OAW A;  2C9W B;  4C56 C;  2KYW A;  1FFV A;  2ZNV B;  2BYT A;  3B1L X;  2WXF A;  4Q2J A;  2AQ1 B;  4C7Y A;  3ZXV A;  2L8J A;  4K7W A;  3ZKJ C;  2HJ8 A;  2DBY A;  3SHQ A;  1C4P A;  2JVC A;  3DOW A;  1YX6 B;  2NTT A;  3TJP A;  1V49 A;  2FIF A;  2PEA A;  4P16 A;  1YJ1 A;  3IAS 1;  2TSS A;  4DXG A;  1AWD A;  2AQ2 B;  2LUE A;  2X38 A;  1EWC A;  2LGS A;  1GC6 A;  3Q8F A;  4II2 B;  1TS3 A;  1VZ8 A;  3L17 A;  2L0F A;  3WAL A;  3TEY A;  2NR2 A;  3GS2 A;  2UYZ B;  5BMG A;  2BS4 B;  4BBN F;  3AEB B;  3R8B A;  3L4P A;  4A9A A;  3J9C A;  4CHK A;  3DBH I;  2KLG A;  1WH3 A;  5BYQ A;  3B08 A;  3ZXR A;  3H7P B;  3QCA A;  4B0M A;  1JAL A;  3ZDM C;  1GOZ A;  2MJD A;  3GB1 A;  1L6V A;  4YWG G;  1U4A A;  2C7N B;  2MJE A;  1E8Y A;  4GIV A;  1KRH A;  2LVO A;  3Q14 C;  2A5U A;  3X23 A;  5H92 C;  4RM9 A;  3VUX A;  1R4N B;  3ZNI D;  4HRO A;  3CSF A;  3VVW B;  3SU8 X;  2WXO A;  2MX2 A;  3VHT C;  3AM9 A;  3BK1 A;  1TT5 B;  3ZNZ B;  1KH0 A;  2PW9 A;  1WJ4 A;  3I63 C;  4RM8 A;  1TKY A;  3AUL A;  4W9J A;  4J6I A;  3PRE A;  3SD5 A;  3NOB A;  4YSY B;  2XNA C;  3AN1 A;  4FJV B;  1XXG A;  5TSS A;  1GB4 A;  1L6U A;  4KGT A;  5DPS A;  2INC C;  4W9D A;  3I57 A;  4II3 B;  2QEJ C;  1D3Z A;  3NRZ A;  4JWU C;  1RLF A;  1ZDX A;  1F0Z A;  4BVU C;  3GE8 C;  3L54 A;  2D2Q A;  2PVG C;  1C77 A;  2WP9 B;  4FHK A;  3ML9 A;  2IO3 B;  2M17 A;  4WAF A;  3DVN V;  4WWM A;  3KYD D;  4MGK E;  2KO3 A;  1WYW B;  1SB3 C;  1R4N I;  2WNM A;  1WMH A;  3APF A;  3NS1 A;  2FCM A;  1QZE A;  1NI2 A;  4RFB A;  5AEK B;  3LJ3 A;  1XCT L;  3A9K A;  1XO3 A;  1CK1 A;  2QHO A;  4PS8 A;  4DBG A;  2WQY B;  5C2T B;  1SIJ A;  1EF1 A;  2HDE A;  5DPR A;  1VZ6 A;  4ZYS A;  1E5W A;  3FIL A;  2L1A A;  3P4R B;  4NNJ B;  1Y8R C;  4ZRQ A;  3PO0 A;  2NBV B;  3BZD B;  4GB9 A;  4ITK A;  2KAN A;  4MJS B;  3RN9 C;  2KT7 A;  2ICI A;  4TUU A;  4KSK C;  2G9H D;  1V81 A;  1V8C A;  1VDV A;  4HWI B;  1YD8 U;  3JSV B;  4WAA A;  5D94 A;  2YLM A;  3AMZ A;  3RNB C;  1TGZ B;  2DYM A;  2C5L C;  1OEY J;  2KDI A;  3PTF C;  1DOY A;  2BT6 A;  2DX5 B;  3ZJT A;  4RCO A;  1T5X D;  5EE9 A;  2E3T A;  4PYU A;  3RNG C;  1WGY A;  2KVZ A;  3I9V 1;  2KWC A;  3UF8 A;  2D07 B;  3UI3 A;  4KSL C;  3RUI B;  4YSX B;  2ZPN A;  5BMI A;  4OW0 A;  1TS5 A;  2FAZ A;  1RAX A;  3ZTC A;  1WX9 A;  1NVI D;  1SJH D;  3U8Z A;  2V3N A;  5E6N A;  1KTK A;  2SEB D;  4HPL B;  1PQS A;  4DDI D;  3T9L A;  3KUZ A;  4JGH B;  3M3J A;  2WXI A;  1L7Y A;  5EE0 A;  4DHJ B;  2H88 B;  2ZCC A;  2E6X A;  3OLM D;  3PGE A;  2GI9 A;  1FM0 D;  3VDZ A;  2HJ1 A;  1WXQ A;  1D4B A;  1KOT A;  1WGR A;  2IO0 B;  3L08 A;  4RMA A;  1L0Y B;  1IUE A;  1FRR A;  4FLH A;  4YL8 A;  1WX8 A;  4GDL A;  4BBN C;  4GMV A;  4GXB A;  3HM6 X;  2QDF A;  2V3S A;  2KN4 A;  1OQR A;  1WGK A;  2JZ3 B;  1TIF A;  3PRP B;  4TMA B;  4IOI E;  3PVL A;  3VTV A;  2L32 A;  2LVP A;  2CKH B;  4KGR A;  1E7V A;  4KZC A;  2G1E A;  1MG4 A;  3T8M A;  4NQK E;  2OHF A;  4XYC A;  3VTW A;  3WAO A;  3P1M A;  1MHH E;  2REX A;  4ANX A;  1R4M B;  5EE3 A;  2KFK A;  3P2B A;  2JXX A;  2WS3 B;  3SFD B;  1E6E B;  2KD0 A;  2KFJ A;  4K7U A;  3R7Q A;  1WZ0 A;  1K51 A;  4EZJ A;  4IM0 A;  1H4R A;  1UBQ A;  2V4L A;  1CQV A;  1F9J A;  3NS8 A;  2LAS A;  1L4D B;  4NAM A;  1JWM D;  3DHI C;  3AEC B;  2GBM A;  3Q3N C;  5H8Y E;  1SF0 A;  5BMH A;  4WQO B;  3GZN B;  3N20 C;  3UGB B;  1I4Q A;  3R3M A;  3ZRC A;  2DYO A;  2JF5 A;  2GBR A;  2J42 A;  3VXW A;  4HDQ A;  3H8H A;  1PGX A;  1XQQ A;  2NS5 A;  1L0X B;  2W3S A;  1OQY A;  2W55 A;  4F7Z A;  2BYF A;  4HDO A;  2J0K A;  1JRO A;  4B6W A;  3ETR A;  3UIO B;  4GDK A;  1N60 A;  3N32 A;  2WXR A;  4F8C B;  1D5Z C;  3ZW3 A;  4EFO A;  4EE2 A;  1QF6 A;  3H7S A;  2LRU A;  2IO1 B;  2LEK A;  4TKN A;  4XDD A;  4AUQ C;  3RNC C;  5LXH A;  5IP4 D;  1JRU A;  1Z2M A;  1OGW A;  2AX5 A;  4G50 A;  1WR1 A;  1WY8 A;  1DOX A;  4IKG A;  2JPH A;  1UH6 A;  3LB8 C;  4A3P A;  3UIP B;  4W9K A;  3IHP C;  4ZYN A;  3U2S C;  2B3A A;  2MEK A;  5GMV A;  3PRZ A;  4PS3 A;  5JH5 C;  1T0R C;  1CZP A;  2HD5 B;  2L05 A;  1FCL A;  4HCN B;  3RI7 C;  4LJP B;  4L23 A;  1YQB A;  2MJ3 A;  1K53 A;  1LFD A;  1WSP A;  2OED A;  2DAJ A;  3KWL A;  4ZRK A;  2KQ7 A;  2IGH A;  3RMK C;  3UQA A;  2O2V B;  1YQ4 B;  2DLB A;  3W1S C;  4BOS C;  1P0R A;  1LQB A;  1V5T A;  4LNO A;  2BTE A;  5KHO A;  2ZZP B;  4KIK A;  1FO4 A;  3JYU A;  2OJR A;  5IN7 A;  5L95 C;  4M8N A;  2R2Q A;  2KJR A;  3M95 A;  4MEL A;  3PT2 B;  1HTO A;  3BVM A;  1QT9 A;  3RUL A;  2MBH A;  2WLB A;  3S2A A;  2J53 A;  1FXT B;  1VR9 A;  2XN9 C;  1XLP A;  4MGI E;  2K8H A;  2N1V A;  1V1P B;  1YQ3 B;  1J0G A;  4MT5 A;  5IO9 A;  3D32 A;  1D5X C;  3QC8 B;  3M62 B;  1I7H A;  3AEG B;  4FAD A;  4WWN A;  2PE9 A;  1B9R A;  3AED B;  3NG0 A;  1FPY A;  5IAA C;  1A70 A;  1XLN A;  5LXI B;  3DVN U;  1XLQ A;  3IG3 A;  2MWS B;  3NVY A;  4LNK A;  4KVG B;  4E74 A;  4LCD E;  2O6V D;  2FUH B;  3TEX A;  1I4X A;  2NPT B;  2W3R A;  3OJ3 A;  3DBR B;  2JY6 A;  3NJT A;  2Z8L A;  3UQB A;  2KTR B;  1I4R A;  1RFK A;  1KLV A;  1MG8 A;  4HKQ A;  1ZXH A;  4W9E A;  4XWT A;  3BK2 A;  5AZH A;  3H7P A;  2VH2 A;  4W9C A;  3SFE B;  1L2N A;  1NEK B;  3QAQ A;  3Q8C A;  2C60 A;  4LDT D;  4A55 A;  1I4P A;  1FXI A;  2MHJ A;  4MEM A;  4JPS A;  3EUB 2;  2JUO A;  4P1B C;  3ZDT A;  2EKI A;  2N7D A;  2PVO D;  1DYQ A;  4NZL B;  2WYQ A;  1A5R A;  3ZRF A;  3GOE A;  3WAM A;  3CIR B;  2Y5B B;  3DBH B;  4W9F A;  1NBF C;  3A33 B;  2DZM A;  1J7C A;  2QIE B;  1L5P A;  2JRH A;  2R2O A;  3VRA B;  1UBI A;  4RF1 A;  3RNA C;  3W2D A;  3OJ4 B;  1RYJ A;  5LNK 1;  3DBR I;  3P4S B;  2EEL A;  1YNT E;  2ZW1 A;  1L4Z B;  1P98 A;  3RT3 B;  4O1N A;  3ZQ4 A;  1BML C;  1N62 A;  3V62 A;  5CTR C;  3QIJ A;  4K1R B;  2LI5 A;  1WR6 E;  2X8X X;  2DAF A;  4G11 A;  4JQW C;  4IC7 B;  1KLU D;  2J7Q B;  2KOX A;  3PZ7 A;  4MM3 B;  1F52 A;  1ZDV A;  1ZOY B;  2L76 A;  5IA7 A;  4KZ0 A;  3L16 A;  1KLG D;  1CMX B;  4REZ A;  2ON8 A;  2NMQ A;  3EHV A;  1V9J A;  3IVF A;  2V3P A;  5E6O A;  3HUI A;  4JWS C;  4EZL A;  3KLS X;  3AE9 B;  1E8X A;  2WXL A;  1E10 A;  3NVV A;  4R3D A;  1S3S G;  4IWQ A;  1FNU A;  2RR9 A;  1LGR A;  3N3K B;  5IOI A;  2BBC A;  2V4I B;  3RYT A;  4MSQ B;  4P7I A;  1E7P B;  3TMP B;  3MFG A;  3EFC A;  3MC9 A;  3DBL B;  4N9F 4;  2R61 A;  1GNU A;  4BOZ B;  3N1X C;  3VAW A;  4N58 A;  2VH1 A;  2CR5 A;  1HTQ A;  2BW2 A;  1F2R C;  2MBE A;  4HJG E;  1I42 A;  1UEL A;  1WZ3 A;  4US8 A;  4IDI A;  1WM3 A;  1XD3 B;  3TEZ A;  2BPS A;  3SDL C;  2DZK A;  1V80 A;  4RGO S;  2LXC A;  5BYS A;  2PTL A;  1E0Z A;  3ZNG C;  1Q5W B;  2BVC A;  4YSZ B;  3Q8E A;  3V6C B;  5AZG A;  3MJW A;  4EZK A;  2KWU B;  2D3G A;  4FA6 A;  3E9S A;  2K8C A;  1ISN A;  1HZ5 A;  2KZR A;  4YXD B;  1FIQ A;  4IUM B;  5HHD G;  4XX5 A;  2K25 A;  2EKE C;  1QQR A;  1WJN A;  1WRI A;  3DBL I;  3E56 A;  1EM7 A;  3QK0 A;  1XLO A;  2W54 A;  3EFU A;  2ZCB A;  1HE8 A;  1HZ6 A;  4LNI A;  3ZTD A;  2ZEQ A;  5D2M B;  4HLE A;  2LXA A;  1J19 A;  1MJD A;  1SGH A;  3QX1 A;  4ZOH C;  5FKA C;  4TSS A;  1FNV A;  3W1Y A;  2IYD B;  4IG7 B;  2KMA A;  2KTF A;  2ZVN A;  3IT6 B;  1P3Q U;  2KKC A;  2PKO A;  3I5J C;  3R2T A;  4JLC A;  5D3D A;  5TR5 A;  2LGX A;  2BB5 A;  2L3Z A;  1ZE3 D;  3N30 A;  4BKS A;  4KKJ A;  2G4D B;  1X1M A;  3R2I A;  3ZJV A;  1ESF A;  1AW7 A;  1HQR D;  1LO5 D;  1OFF A;  1XF5 L;  2XEW A;  2WXJ A;  2YEP B;  2JXT A;  1IGC A;  2FBW B;  2HE7 A;  5EE1 A;  2ZVO A;  4WQM A;  4AS1 A;  2UU7 A;  2WXQ A;  4LJO B;  1JCK B;  2WXP A;  5IKC M;  2BKF A;  1GAQ B;  1Q0W B;  3Q3M C;  3VH3 B;  1V2Y A;  1C4A A;  1WGD A;  3EEC A;  2SAK A;  2VZK D;  3AU4 A;  2I38 A;  4LK0 M;  3AEE B;  3QHT A;  3Q3J A;  5BYR A;  2FID A;  1YX5 B;  4BZA A;  2IGD A;  5CHV C;  1PDX A;  4CO7 A;  4I6P A;  2I2Y A;  2DZJ A;  4K3B A;  2N0S B;  5FR6 A;  1JWB D;  2MBB B;  1QLB B;  4EUT A;  1YJJ A;  2CJO A;  1EU3 A;  2BS2 B;  1TZO A;  3FAH A;  1WIA A;  3U4E G;  2MBO A;  4FXC A;  3WAN A;  4HRS A;  4BKT A;  2ZPY A;  3R7R A;  2KQ4 X;  2Y3A A;  2LMC A;  1SE9 A;  1V86 A;  1VJK A;  1C79 A;  3V61 A;  1WE6 A;  3ZLZ A;  1NEN B;  1XEE A;  1HA5 A;  3P4P B;  3B9J A;  2N9L A;  3SEB A;  4ANV A;  3AE1 B;  4S17 A;  4ARI A;  2BQQ A;  2L83 A;  2RDH A;  4HXD A;  4RGM A;  1WXM A;  3GE3 C;  4LNF A;  4HPM B;  3FIL B;  5DCN A;  4WJQ A;  2K6Q A;  3PHW B;  3NZS A;  2G3Q B;  3Q3F A;  3VQI A;  4M8M A;  2UWQ A;  1GUA B;  1VRA B;  2WDR B;  1UGM A;  2O2V A;  3A4S C;  4YTN B;  3TBL D;  4HK2 A;  2KK8 A;  4B0E A;  3V6E B;  4JL9 A;  1C1Y B;  1Q1O A;  3H9D A;  1MHX A;  1KJT A;  4XGA B;  4DXF A;  2QC8 A;  2INN E;  2GMI C;  2IGG A;  2IBI B;  1E8W A;  3WAP A;  3C19 A;  1WWT A;  2NVU I;  4URK A;  4HJK A;  2RSU A;  2CJN A;  4N59 A;  4HEA 1;  4KDL B;  5DPT A;  3AXC A;  2N4F A;  3L10 B;  4DHZ E;  4ZHP A;  1LM8 B;  1OTR B;  3T3N A;  4M00 A;  2QIL A;  3CMM B;  4OVZ A;  3VFK A;  4IM2 A;  2XK5 B;  1FFU A;  3HVZ A;  2LD9 A;  4OZC A;  1V1P A;  4MGZ E;  2WXG A;  3EGR A;  4WWP A;  2GB1 A;  2WHI A;  4HKZ E;  2VRR B;  3Q6B A;  2NBW B;  2A4Z A;  3PLV A;  2QSD A;  2WU2 B;  5G55 A;  3HM3 A;  2N9P C;  2KAC A;  3QWZ B;  1RRB A;  4XZ4 A;  2AQ3 B;  1CJE A;  3IAM 1;  2JQR B;  3M63 B;  2BYE A;  1XT9 B;  4TV3 A;  4C80 A;  2N7J A;  2M0X A;  2CHW A;  3N1Y C;  4WWO A;  3X0W A;  1WM2 A;  3ZJU A;  1MI0 A;  2NPT A;  2MCN B;  4A90 A;  3UIN B;  1F2R I;  2KTR A;  2KN5 A;  3N9Y C;  2INP E;  3IT4 B;  3AE3 B;  4GGQ A;  2WXN A;  2KMC A;  2LGY A;  3PRM B;  5AUI A;  2IO2 B;  1ZGU B;  2FCS A;  2KNB A;  3N1Z C;  2BWE S;  4GSW A;  3DQV A;  2WXM A;  2ONQ A;  3Q8A A;  2AWT A;  5G2N A;  1D5M C;  1SE4 A;  2CHX A;  4J3O D;  3TL5 A;  2FCQ A;  5LLI A;  1BXT A;  3ZYY X;  3RNE C;  2GBK A;  1YN5 A;  1P7E A;  1ZUD 2;  5T8I A;  4PK1 A;  1WJ6 A;  2CS4 A;  1TY0 A;  3A1Q B;  1Z5S B;  3B2G A;  2L00 B;  3VR8 B;  1K8R B;  3MC0 B;  3DHG C;  4ZRP A;  2G4S A;  2K1F A;  3FKY A;  1TZ1 A;  4NAW B;  2I1K A;  1ZW7 A;  2G45 B;  2ASQ A;  5BO4 B;  3ZVV A;  2FNJ B;  5AZF A;  4JIO U;  4B95 A;  2MW5 A;  1VZ7 A;  1WX7 A;  4JE3 B;  1JRP A;  4WJP A;  4HPP A;  5CX3 A;  4EEW A;  1WI0 A;  4FHJ A;  3U7Z A;  1M4V A;  1DOI A;  2JT4 B;  1VLB A;  2QJL A;  3A9J B;  1UF0 A;  3C8Y A;  4KDI C;  2JYE A;  1TJE A;  2D3C A;  2WXK A;  3DDC B;  1EWY C;  1F77 A;  4KKI A;  4ZRJ A;  1AN8 A;  4USA A;  4ASW C;  3AB5 A;  3Q8B A;  3B2F A;  3DHH C;  4MSM B;  2DEN B;  1QOA A;  4EOY A;  2WDV B;  2Z0E B;  1NI3 A;  2L0T A;  2JSV X;  1TYG B;  3KQ4 A;  3HRD D;  2D10 A;  3C0R B;  4A3O A;  1BT0 A;  4X57 B;  2Z0D B;  3PS6 A;  1T0Q C;  5E6J A;  3QQ8 B;  3ZUN A;  2KWD A;  3HIZ A;  2WX0 A;  4C00 A;  3KVF B;  3NZ3 A;  2KX0 A;  1EF5 A;  4I6L B;  2GBN A;  1IYF A;  4FUL A;  1C9F A;  1DGJ A;  4M0W B;  1TS2 A;  2DZI A;  4TQ0 A;  4M02 A;  3U30 A;  1E9M A;  1IBX B;  4MGY E;  4PS7 A;  4FBJ B;  2JZZ A;  4W9L A;  2BB6 A;  1E8Z A;  3KUD B;  1PUT A;  2KC1 A;  5FK9 C;  1T6B X;  1JQ4 A;  3NUH B;  2DYB A;  3A4R A;  1MFW A;  2BWF A;  4PT5 A;  3U52 E;  3W1S A;  3NZU A;  3MTN B;  1OEY A;  4RH6 A;  5AUK A;  1AAR A;  2V0G A;  1NDD A;  3QAR A;  4K7S A;  5JHB A;  2K5P A;  1P7F A;  2WWZ A;  1ROE A;  2JWU A;  2RPV A;  2KVR A;  4P6V F;  2L7R A;  1T0S C;  3APD A;  4ANW A;  1E90 A;  2O6V B;  1QIL A;  3NY5 A;  3O13 A;  1J7B A;  2FUG 1;  2WDQ B;  2LHD A;  2KXJ A;  3BYT B;  2WXH A;  1WRD B;  4L2Y A;  2CU3 A;  2MP2 B;  2QCZ A;  4C4V B;  2PIA A;  3NVZ A;  2FE8 A;  4KGS A;  1V1O A;  2V1Y A;  3O65 B;  5I4D A;  1SSN A;  1PGA A;  1L0V B;  1FRD A;  3VRB B;  1WXS A;  2IDY A;  1J8C A;  2JZP A;  3SR6 A;  4MJS A;  2ZW0 A;  1GB1 A;  2IJ0 A;  4DHZ B;  5C3J B;  4LDT B;  4RF0 A;  1HEZ E;  4US9 A;  4KV2 A;  5GXG B;  1JWA D;  1YOV B;  2Y5P A;  3JSV A;  2LRW A;  3KW5 B;  2IND C;  1YN3 A;  4RGN A;  4BKG A;  3IXS A;  4NJ7 A;  2KX3 A;  2D3A A;  3ML8 A;  3VR9 B;  3OG5 A;  1ET9 A;  2KJ6 A;  4AOF A;  1JW9 D;  3K9P B;  2GRI A;  2B76 B;  2WGS A;  4M01 A;  2KMM A;  3TSS A;  2M8S A;  3AV8 A;  1K50 A;  2GBJ A;  1NYR A;  3RFZ B;  1P9D U;  2J0M A;  1ACC A;  1TBE A;  4K81 A;  1V5O A; 
#chains in the Genus database with same CATH homology
 3LB8 C;  3U4E G;  1PGB A;  3URY A;  4FXC A;  1AYF A;  4HRS A;  1I4G A;  2PMV A;  3EA6 A;  2KQ4 X;  2H89 B;  1TKG A;  2Y3A A;  2J4X A;  4OZA A;  3U2S C;  4XWW A;  2LMC A;  2L52 A;  1FEH A;  1TKE A;  2RDG A;  2MEK A;  1VJK A;  3T3O A;  4OHJ A;  1CZP A;  2JYT A;  4UDU C;  4H2A A;  2Q5W D;  1QKZ A;  1C79 A;  5HFY A;  5G5H A;  1NEN B;  1XEE A;  1FCL A;  1JML A;  3AEA B;  1HA5 A;  3V05 A;  4L23 A;  1D6E C;  1MPE A;  2MJ3 A;  3P4P B;  1K53 A;  3B9J A;  2N9L A;  3SEB A;  1SE2 A;  3AE1 B;  1C78 A;  1TZO A;  1WSP A;  2PLP A;  2OED A;  3KWL A;  3OWE B;  2M19 A;  3W5V B;  4ARI A;  2IGH A;  1FD6 A;  2HTM E;  2L83 A;  1YQ4 B;  2DLB A;  2RDH A;  2ACZ B;  1N5W A;  4RGM A;  1J7A A;  2BTE A;  1SE3 A;  3FIL B;  4C56 C;  1FO4 A;  1QOG A;  4MAC A;  1FFV A;  2BYT A;  3PZ8 A;  2WXF A;  4Q2J A;  2AQ1 B;  3ZGZ A;  4ARC A;  4C7Y A;  1UUP A;  4TQ1 A;  3VQI A;  2DBY A;  2JX5 A;  3BVM A;  1C4P A;  1VRA B;  1QT9 A;  2WDR B;  2WLB A;  1BUI C;  2NTT A;  2J53 A;  4YTN B;  4B0E A;  1VR9 A;  4P16 A;  3IAS 1;  2TSS A;  2XN9 C;  1YMH E;  1MHX A;  4DXG A;  1AWD A;  2AQ2 B;  1XLP A;  4DXF A;  2X38 A;  1JWS D;  1EWC A;  3Q8F A;  1TS3 A;  2INN E;  1VZ8 A;  1V1P B;  1YQ3 B;  2IGG A;  4MT5 A;  1D5X C;  2W82 A;  1XCQ L;  3TEY A;  1I7H A;  3AEG B;  4D2K A;  3GS2 A;  1B9R A;  5BMG A;  1Q10 A;  2BS4 B;  1WWT A;  3AED B;  2JU6 X;  2M0A A;  3AEB B;  1A70 A;  5JXV A;  1NYQ A;  1XLN A;  2CJN A;  2J52 A;  4HEA 1;  4N59 A;  3R8B A;  3L4P A;  4A8X C;  1XLQ A;  4A9A A;  3J9C A;  5BYQ A;  2K9X A;  1FMA D;  4YTM B;  3NVY A;  2IPK D;  4B0M A;  4ZHP A;  3T3N A;  1JAL A;  2QIL A;  1GOZ A;  2MJD A;  4OVZ A;  3HVD A;  3GB1 A;  1L6V A;  3TEX A;  4YWG G;  1TY2 A;  1I4X A;  3P63 A;  4CQN A;  2MJE A;  1FFU A;  2W3R A;  3HVZ A;  1KRH A;  1QOF A;  4L1B A;  4OZC A;  4ZHO A;  1V1P A;  5HG2 A;  2WXG A;  3EGR A;  5H92 C;  2Z8L A;  2GB1 A;  4HKZ E;  4HRO A;  1I4R A;  1RFK A;  1UWX A;  2DWQ A;  4HKQ A;  1ZXH A;  2LUM A;  2WXO A;  5G5G A;  4XWT A;  2QSD A;  2WU2 B;  3AM9 A;  3BK2 A;  3BK1 A;  3V3X A;  2KAC A;  2AQ3 B;  1KH0 A;  2PW9 A;  3SFE B;  1CJE A;  3IAM 1;  4DQO C;  1NEK B;  2JQR B;  3CWI A;  1TKY A;  3Q8C A;  1IGD A;  4A55 A;  2N7J A;  4C80 A;  1I4P A;  4YSY B;  1FXI A;  2XNA C;  3AN1 A;  3ZJU A;  1MI0 A;  1XXG A;  5TSS A;  1GB4 A;  4JPS A;  3EUB 2;  4A90 A;  1L6U A;  4KGT A;  4JX1 C;  2EKI A;  3I57 A;  1F2R I;  3W5U B;  2PVO D;  2QEJ C;  3N9Y C;  3NRZ A;  1DYQ A;  4N6E B;  2INP E;  3IT4 B;  3AE3 B;  4GLS C;  4NZL B;  2WXN A;  2QMT A;  5AUI A;  4JWU C;  1ZDX A;  1T3Q A;  3CIR B;  2WXM A;  1N5X A;  3BWU D;  1F0Z A;  1UWM A;  1SXT A;  2ONQ A;  1PFD A;  3Q8A A;  3AE8 B;  1MVK A;  2PVG C;  1J7C A;  1D5M C;  1L5P A;  1SE4 A;  2QIE B;  3VRA B;  1C77 A;  4J3O D;  4RF1 A;  2WP9 B;  3W2D A;  1RYJ A;  5LNK 1;  1BXT A;  4WAF A;  3P4S B;  4WWM A;  2EEL A;  1YNT E;  3ZYY X;  1SB3 C;  2ZW1 A;  1L4Z B;  4O1N A;  2WNM A;  1YN5 A;  1P7E A;  1ZUD 2;  3NS1 A;  3ZQ4 A;  1BML C;  1N62 A;  4RFB A;  4NJC A;  1XCT L;  5T8I A;  2YEP F;  1TY0 A;  4YTP B;  1N61 A;  2RMM A;  1XO3 A;  1CK1 A;  2WQY B;  3B2G A;  1KLU D;  3VR8 B;  5C2T B;  3PZ7 A;  1SIJ A;  3MC0 B;  3MP9 A;  4MH8 A;  4MM3 B;  4ZRP A;  3WCQ A;  1ZOY B;  1ZDV A;  2HDE A;  1VZ6 A;  4NAW B;  4ZYS A;  5MPO A;  3FIL A;  2L1A A;  3P4R B;  1KLG D;  4ZRQ A;  3PO0 A;  1V97 A;  1QOB A;  3BZD B;  1C4C A;  4ITK A;  1FNW A;  4REZ A;  1VZ7 A;  4JE3 B;  1JRP A;  2ON8 A;  1OQQ A;  1UGJ A;  1ZPS A;  2NMQ A;  2ICI A;  2G9H D;  2V3P A;  1ZXI A;  2VZK B;  1V8C A;  1VDV A;  3HUI A;  4JWS C;  1TS4 A;  3KLS X;  3AE9 B;  2WXL A;  1E10 A;  3NVV A;  4R3D A;  5HI1 A;  1KF6 B;  1HXY D;  1STE A;  3U7Z A;  1M4V A;  3AMZ A;  1FNU A;  1ZP0 B;  1DOI A;  2DYM A;  3AH7 A;  2BBC A;  2V4I B;  3Q69 A;  1VLB A;  1DOY A;  1I4H A;  2QJL A;  2BT6 A;  3ZJT A;  4RCO A;  1E7P B;  4WUR A;  3TUO A;  1T5X D;  3MFG A;  5EE9 A;  2E3T A;  3C8Y A;  1GPX A;  2BS3 B;  1C76 A;  2JYE A;  1R7S A;  1TJE A;  2R61 A;  3MJ5 A;  1RWS A;  2M56 B;  2WXK A;  3TEW A;  3I9V 1;  3LXF A;  4N58 A;  3BVZ A;  1EWY C;  1F77 A;  3UI3 A;  4KKI A;  3NVW A;  4WH4 A;  2BW2 A;  1AN8 A;  3AEF B;  4YSX B;  4USA A;  1F2R C;  5BMI A;  3AB5 A;  3Q8B A;  3B2F A;  4OW0 A;  4HJG E;  1TS5 A;  4C7Z A;  4US8 A;  4RGT A;  3AE7 B;  1QOA A;  4XE0 A;  1ET6 A;  4IDI A;  2WDV B;  1N63 A;  2LHE A;  1NI3 A;  3TEZ A;  1UNS A;  1NVI D;  2JSV X;  1TYG B;  2KAJ A;  3KQ4 A;  3HRD D;  4GDL B;  1SJH D;  4WIP A;  2V3N A;  2K3U A;  1KTK A;  4RGO S;  5BYS A;  2SEB D;  4XDC A;  2PTL A;  1E0Z A;  4YSZ B;  2KDM A;  5E6J A;  4LLG M;  3Q8E A;  2WXI A;  3AE5 B;  5FR3 A;  2KWD A;  5EE0 A;  1YJI A;  2H88 B;  3NZ3 A;  2E6X A;  1Y56 A;  3W9C B;  2GI9 A;  1FM0 D;  3E9S A;  1SEB D;  1WXQ A;  1D4B A;  3AE2 B;  1HZ5 A;  1L0Y B;  1IUE A;  1FRR A;  4YXD B;  1FIQ A;  1DGJ A;  1C9F A;  1TS2 A;  3GP7 A;  4OZB A;  4TQ0 A;  1E9M A;  5HHD G;  3LYY A;  1IBX B;  1QQR A;  2BB6 A;  1WRI A;  3RPF C;  3E56 A;  1EM7 A;  1PUT A;  2KN4 A;  4KX6 B;  5FK9 C;  1OQR A;  1T6B X;  1WGK A;  1JQ4 A;  1XLO A;  4TMA B;  2W54 A;  2Y5C A;  4IOI E;  3AE4 B;  1K52 A;  2L32 A;  3NUH B;  1HZ6 A;  4PT5 A;  4KGR A;  1EU4 A;  2G1E A;  3U52 E;  3W1S A;  2D5G A;  3AE6 B;  4RH6 A;  3FC4 A;  2OHF A;  5AUK A;  4ZOH C;  5FKA C;  3P1M A;  1MHH E;  3P4Q B;  2V0G A;  1WYG A;  4TSS A;  5EE3 A;  1FNV A;  4A6Q A;  4M0W A;  2WS3 B;  1FCC C;  2K5P A;  3SFD B;  1E6E B;  1P7F A;  1IBX A;  3IT6 B;  3MHZ A;  1ROE A;  1K51 A;  3DWM A;  3BYY B;  2PKO A;  4RNA A;  1CQV A;  2JWU A;  2RPV A;  4P6V F;  3R2T A;  3DWG C;  5D3D A;  1L4D B;  4NAM A;  1QIL A;  1JWM D;  3O13 A;  1J7B A;  3AEC B;  2FUG 1;  4GDK B;  2BB5 A;  1ENF A;  2WDQ B;  2LHD A;  3BYT B;  1ZE3 D;  5H8Y E;  1SF0 A;  2K22 A;  2WXH A;  1YN4 A;  4KKJ A;  1KFY B;  4L2Y A;  5BMH A;  4AQ7 A;  2CU3 A;  3R2I A;  3ABV B;  3ZJV A;  1ESF A;  1AW7 A;  1HQR D;  2PIA A;  1I4Q A;  3NVZ A;  1LO5 D;  2DYO A;  1B1Z A;  2FE8 A;  2K0P A;  1OFF A;  2MH7 A;  1XF5 L;  2LFI A;  2J42 A;  4LTU A;  2WXJ A;  4KGS A;  2YEP B;  1V1O A;  2JXT A;  1IGC A;  5I4D A;  1FXA A;  2FBW B;  1SSN A;  1PGA A;  3H8H A;  5EE1 A;  4WQM A;  1PGX A;  1L0V B;  1FRD A;  4AS1 A;  2LJI A;  3VRB B;  2IDY A;  1L0X B;  2W3S A;  2JZP A;  3SR6 A;  2WXQ A;  2W55 A;  2ZW0 A;  1GB1 A;  5D3I B;  1JCK B;  2IJ0 A;  5C3J B;  1PYW D;  2WXP A;  1JRO A;  4RF0 A;  1HEZ E;  3ETR A;  2N9K A;  4US9 A;  1N60 A;  5GXG B;  2WXR A;  1JWA D;  2NTS A;  1D5Z C;  2Y5P A;  1GAQ B;  4EE2 A;  1QF6 A;  3BVG A;  1YN3 A;  3P42 A;  4RGN A;  3IXS A;  1C4A A;  3KWV A;  2SAK A;  3VR9 B;  2WU5 B;  2VZK D;  4YT0 B;  2I38 A;  4LK0 M;  1ET9 A;  3AEE B;  2LEK A;  1RM6 C;  1SJE D;  1JW9 D;  5BYR A;  2GRI A;  2B76 B;  2IGD A;  2KMM A;  4XDD A;  1PDX A;  3TSS A;  1JWU D;  3AV8 A;  1K50 A;  1NYR A;  3RFZ B;  2I2Y A;  1SBB B;  2LGI A;  2N0S B;  1JWB D;  1QLB B;  1ACC A;  1YJJ A;  5D7G A;  2CJO A;  2AX5 A;  3BII D;  1DOX A;  4IKG A;  1EU3 A;  2BS2 B;  3FAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...