2JXTA

Solution structure of 50s ribosomal protein lx from methanobacterium thermoautotrophicum. northeast structural genomics consortium (nesg) target tr80
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
MKMKTKIFRVKGKFLMGDKLQPFTKELNAIREEEIYERLYSEFGSKHRVPRSKVKIEEIEEISPEEVQDPVVKALVQRLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of 50S ribosomal protein LX from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein LX
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jxtA01
2LGIA 4D2KA 2I2YA 2KACA 1MI0A 3MP9A 1MHHE 1F2RC 1MPEA 1F2RI 1FD6A 2LHEA 2JZPA 1GB1A 1FCCC 2JXTA 2K0PA 2GB1A 4WH4A 2N9KA 1EM7A 2JU6X 2PLPA 2QMTA 2IGHA 2J53A 1K52A 1P7EA 1FCLA 1XCTL 5BMGA 1XF5L 1MHXA 2N9LA 2RPVA 4OZAA 3UI3A 2IGGA 1Q10A 1PGAA 4MACA 2JWUA 2LHDA 2ZW1A 3GB1A 1D4BA 2KWDA 2QSDA 5HI1A 2ONQA 1C9FA 1ZXHA 1K50A 1QKZA 2GI9A 4OZCA 1PGBA 1PGXA 4OZBA 2KN4A 4HJGE 1IBXB 2ZW0A 2PW9A 1YNTE 2IGDA 5JXVA 2LUMA 4GLSC 4IKGA 2EELA 5HFYA 1MVKA 5BMIA 1K51A 2I38A 4KGRA 2N7JA 3FILA 1KH0A 5HG2A 2PTLA 1HZ6A 1IGCA 5HHDG 2JSVX 2KDMA 2NMQA 1K53A 3V3XA 1P7FA 1XCQL 1HEZE 1IBXA 4IOIE 1GB4A 2ON8A 2RMMA 1JMLA 2KQ4X 1IGDA 4HKZE 5BMHA 2OEDA 4KGTA 3FILB 4KGSA 2J52A 1UWXA 1YMHE 1HZ5A
chains in the Genus database with same CATH superfamily
2WU2B 1WH3A 3PTFC 4HXDA 4TQ1A 2I2YA 1F0ZA 1MHHE 2G4SA 4XGAB 3W1SC 2INCC 2WX0A 4RF1A 2JY6A 1LXDA 2HJ8A 1N5WA 2KFJA 1X1MA 4AWJA 2JPHA 2DENB 3HM6X 3ZNGC 2IDYA 4MDKE 4EZLA 3VDZA 1SE2A 4BKGA 2JRIB 3T8MA 1XT9B 1I42A 1RLFA 4ZRJA 3U2SC 3PRMB 2B76B 5IO9A 4JGHB 1L0YB 4GDKB 5G5GA 1MG4A 3PREA 2WXJA 3BZDB 3TJPA 4PT5A 2KLCA 3NUHB 1JWBD 2J0JA 2INNE 3GE3C 1K50A 1ZDVA 4WQMA 4YTPB 2JT4B 4DHJD 2GBRA 3AU4A 5EDSA 2IZVB 3DDCB 1BUIC 3EA6A 5JXVA 2L05A 3AULA 5IOIA 3L16A 2IO3B 2AX5A 4MSMB 2KLGA 3VXWA 4BOSC 2BVCA 2WDQB 1VLBA 3RZFA 2MH7A 2NS5A 3Q14C 3CSTA 1V8CA 5TR5A 3HVDA 4LNFA 4PYZA 3P4SB 1V5OA 4N6EB 3ZQ4A 3VRBB 1XLNA 4WJPA 4W9JA 1SE3A 2CS4A 2OEDA 3ZXRA 2JZ3B 1J19A 4EE2A 2CU1A 2KVRA 4IM3A 2VZKD 4EZKA 3DBHI 2BWES 2C7MB 4AJYB 2KACA 2DNFA 2L76A 1N61A 3TEXA 5J17A 2KMAA 1VR9A 4ZRPA 2J0MA 1TIFA 1XLPA 1EM7A 1L0XB 4WIPA 3RNFC 5AEKB 2MJEA 2VZKB 4RM8A 4II2B 1UF0A 1ZW7A 2L7RA 1SF0A 4HDQA 3N1YC 1V49A 4I6LB 4C56C 3NG0A 1C4AA 2K5PA 1SIJA 5HI1A 2LRUA 1TJEA 1KJTA 5LLIA 3VAWA 4KX6B 2GI9A 2ICIA 2L8JA 3UQBA 2KD0A 1L5PA 2K39A 2JXXA 2N1VA 2M0AA 2CJNA 4ANUA 3PRZA 1FXAA 3AU5A 4QAYA 1KF6B 3Q3MC 1L7YA 1RYJA 2L0FA 4KKJA 4XDDA 1PDXA 2OOBB 3SDLC 1UZXB 2KWUB 5HHDG 5IAAC 1WR6E 4YSZB 3V6EB 4ZRKA 3DBHB 3P63A 1KM7A 1JQ4A 3OWEB 3MC8A 1YJJA 1JW9D 2ACZB 3H6NA 2ZVNA 2PE9A 3A9JA 3DBRB 2C7NB 5DCNA 4CO7A 1E7PB 2MW5A 5LXHA 3ZJVA 1FM0D 3RCZA 3N1XC 1L2NA 3H1UA 2XN9C 2KFKA 3TEZA 2WYQA 1I35A 2MSED 1WZ3A 2SAKA 2E3TA 5C3JB 2K0PA 3ZDTA 3PV1A 1DYQA 4GU2A 3W1YA 1I4GA 3IVFA 5D6JB 1L4DB 2NPTA 4DK5A 3PHXB 3DVNV 2INDC 3C19A 3SEBA 4ZYNA 1MHXA 1TY2A 1UBIA 4FN2A 5JHBA 4BAXA 3ETRA 4XWTA 1Q10A 4MACA 2JWUA 2KWDA 1QOFA 1IUEA 1KRHA 3ZGZA 2ONQA 1CZPA 4YXDB 3U4EG 4UDUC 2PEAA 4HWIB 1YX6B 1PUTA 2GLSA 3H8HA 2V3PA 5MPOA 3P4RB 1DGJA 2QILA 1SIFA 4H2AA 3A9KA 1V80A 2IGDA 4IKGA 3ML8A 1ZP0B 5BMIA 2I38A 2JRHA 1D6EC 3WCQA 1J7AA 2Y3AA 1XQQA 5D2MB 3O65B 2OJWA 1WMHB 3ZDMC 3AH7A 4RGNA 4N9F4 2JYTA 1QT9A 3Q8CA 2KQ4X 3EGRA 3R2IA 4B6WA 3JSVA 1FXTB 1C76A 4JQWC 3HM3A 1ET9A 2PVGC 2WNMA 1WRDB 2BS2B 4FXCA 2KT7A 3ML9A 3VTUA 2ZCBA 4DDGD 4DXFA 3T9LA 2WXMA 1D5XC 3ZNID 3OAWA 4YSYB 1SJHD 1UGMA 2BYFA 3RT3B 2QMTA 3RNEC 2J53A 1QQRA 3SHQA 1QOBA 4E3CA 1QZEA 4KZCA 4HK2A 2WDTB 2K6DB 3APCA 4REZA 4B95A 4I6NB 3MTNB 4HEA1 2QSDA 4M0WB 3HRDD 4B0MA 4ZRQA 2IO1B 3T3NA 3PZ7A 3PVLA 4A3OA 3SFEB 5FKAC 1PFDA 3D32A 3I3TB 2UWQA 3KYCD 3LB8C 2YEPF 3JYUA 2EELA 3VRAB 2D3AA 1P0RA 1T3QA 2V4IB 3OG5A 3ZO5B 2KKCA 2N9PC 5C2TB 1HZ6A 4M02A 2MP2B 4URKA 1T5XD 5EE9A 3I63C 3W9CB 1ZKHA 3GP7A 1TS5A 3IAS1 3A4RA 5JH5C 2K8CA 1FNUA 3AE8B 2DLBA 4HVBA 3TBLD 2KFKB 2RPQA 4WWPA 1WR1A 3Q8BA 4LJOB 4MH8A 1YOVB 1RFAA 2V3NA 3U30A 2G4DB 1DOIA 2K1FA 3B2FA 4NPNA 2WXIA 3Q6BA 3U7ZA 2Q5WD 1WM2A 4E74A 2C7HA 1HQRD 4XE0A 5AUKA 1GB1A 1FCCC 2JXTA 4X57B 4XC2A 2BTEA 2KNBA 2LVOA 1T0YA 2LJIA 1TYGB 2PLPA 4MJSA 3LDZE 1Q5WB 2WDVB 4M00A 1NEKB 2RGFA 1I4XA 3EFCA 1KOTA 5D3DA 4WQOB 4OZAA 1KLVA 3MC9A 2GBKA 1R4NB 3PRPB 2RDGA 1D4BA 2NPTB 4IG7B 4NQKE 3TL5A 2GRIA 1YN5A 4NY0A 2CKHB 4WWNA 3ALBA 1C9FA 1UH6A 4MGIE 3KWVA 3OLMD 2EKIA 3DVGY 3L13A 1E8ZA 1ESFA 3DBRI 1ACCA 1YIWA 2ZNVC 4YL8A 3EHVA 1SB3C 2AQ1B 4KVGB 2LASA 3N3KB 3APDA 2TSSA 4XDCA 1J7CA 2KMMA 2KOXA 2N9XA 3BVGA 5T8IA 3ZNHB 4DHJB 1B9RA 4EEWA 2PVOD 4WJQA 2KDBA 1GG3A 1LQBA 2BGFA 1XCQL 2ZVOA 3K9OB 1WXSA 4MEMA 3JW0X 4ARIA 1UBQA 1JMLA 3BYYB 1RRBA 2KXJA 4DQOC 1IGDA 2Z59B 3I57A 2LVPA 2LRWA 4FJYA 4BKTA 1H8CA 2ZPNA 1WGKA 4II3B 2KX3A 4JWUC 3H7SA 4PS7A 1E9MA 1M4VA 3I9V1 4OVZA 4F7ZA 1R4MB 4HRSA 4JLCA 5H92C 4JPSA 4YT0B 4GN1A 1J8CA 3MHSD 1F2RI 2DAFA 2MBBB 2WX1A 1OFFA 1EF1A 3GZNB 1JALA 4DHZE 2N9KA 3UGBB 3QARA 3DPDA 3APFA 2LD9A 2LUEA 4IUMB 4K3BA 1FCLA 4IWQA 1HE8A 4K3CA 2NBWB 3IAM1 5E6OA 2QJLA 1ZOYB 1N60A 2RPVA 3VVWB 3NS1A 1V86A 3HVZA 3A9KB 4MSQB 3RNGC 3V60A 5FK9C 3M95A 2K6QA 1WXQA 2EMSA 1KLUD 2K3UA 4EUTA 4JX1C 3ZXVA 3AMZA 1V2YA 2KN4A 4NJ7A 4HLEA 1ZPSA 3NVWA 3IXSA 5BO4B 3FKYA 4GDLA 1OGWA 5KHQA 3KYDD 5E6PA 5GMVA 1V5TA 1MVKA 2AL6A 2DZMA 2G9HD 3H7PB 3Q2AC 1FXIA 1OQQA 4A55A 2JSVX 1I4QA 1YN3A 2A4ZA 3AXCA 1WJUA 2PKOA 2CJOA 2D11A 1WFYA 4ZYSA 3TCAA 4M01A 2MA9B 4KSKC 2HJ1A 2IO2B 2MP2A 1J7BA 3DOWA 2IJ0A 2BYEA 2L00B 1WJNA 2WHIA 3X23A 1C3TA 2WXGA 1YQ3B 2ZNVB 1C4PA 5G5HA 1T0RC 1YD8U 4EFOA 3VTWA 3PLUA 1MG8A 4NZLB 1QF6A 1UWMA 2MX2A 2LGXA 1JRPA 3BINA 3DHIC 1JWMD 1TBEA 2FE8A 5LNK1 1MI0A 3QAQA 4XX5A 2MCNB 3Q69A 2VH2A 1CQVA 1GJZA 2LVQA 4RFBA 3Q8AA 3AM9A 1WGGA 3W2DA 1PYWD 4L1BA 4WWOA 2KN5A 3RUIB 2BB6A 2RDBC 3WAOA 2KC1A 2HTME 2LXCA 2C5LC 1LFDA 3ZRFA 1E7VA 2R61A 2D3GA 3W1SA 2KVZA 4L2YA 2WXRA 4B0EA 2LGYA 4MGYE 4YTMB 3L10B 4ZRIA 4HJGE 4FLHA 3E56A 1UGJA 2MWSB 3DVNU 3OJ3A 2YLMA 3URYA 1WGRA 3EFUA 2D3CA 1OQYA 4OVVA 2KTFA 2BQQA 4A6QA 1XD3B 5C1ZA 3TIXA 4KIKB 2BBCA 3N9YC 2O6VD 3W5VB 4BKSD 2R2QA 3AE3B 1FNWA 4KSLC 1BXTA 1ZDXA 2G1EA 4LNNA 3M3JA 1SGHA 2N1WA 4AQ7A 1IBXA 1FEHA 3PS6A 3P42A 4ASWC 1IP9A 1WI0A 4MH0E 2PMVA 4NJ6A 4EOYA 1C1YB 4BBNF 5BMHA 2H89B 1QILA 3LXFA 4IM2A 3AECB 2FCNA 3AEGB 3QJZA 4RGMA 4BBNC 2BPSA 2O6VB 3NRZA 5L95C 3MJWA 5E6NA 1T0SC 1VZ7A 1RWSA 3M63B 1WX7A 4GMVA 3IG3A 3VUXA 1YJIA 3ZNZB 3GOEA 3Q3FA 3VHTC 2IO0B 2BYVE 2V4LA 2HDEA 1WY8A 1YN4A 1WE7A 4A3PA 3QHTA 1MJDA 2NTTA 3V6CB 4HROA 1NI3A 3WAPA 1NYRA 4KV2A 3UIPB 3CMMB 2M19A 2CHZA 3BY4B 1VZ8A 2KTRA 4PS8A 2JYEA 3P4PB 3DHHC 2W9NA 3QC8B 1V1PA 1B1ZA 1XLOA 3ECIA 4YSXB 2JWZA 1SXTA 2R2OA 1LO5D 3BK1A 4C00A 4PS3A 2D10A 3H7PA 2EKEC 2N4FA 1IYFA 4ZOHC 4A8XC 4DXAB 2PW9A 2AQ3B 2GBNA 2M17A 4CYEA 2NTSA 4K81A 3NVZA 2BKRB 2WXOA 2KWCA 3ABVB 1FFUA 4WURA 5IP4D 1VRAB 5G2NA 2BKFA 4WAFA 2RSUA 4XYCA 1L0VB 4G0NB 1P7FA 4RH6A 3W5UB 2AYOB 1R7SA 1RFKA 2JF5A 2ON8A 1KTKA 4E71A 1I4PA 2A5UA 4CHKA 1TKEA 3L08A 3QA8A 1C77A 3FILB 1S3SG 3NOBA 2MQJA 2MLBA 3CWIA 1P3QU 1WRIA 4W9FA 3AEEB 1EUVB 2BS4B 3NJTA 1FD6A 4LNOA 4NJCA 4GIVA 2KYWA 2N9EB 5IA7A 1AYFA 3ONSA 2JU6X 1K8RB 2PE6B 1U4AA 1P7EA 1GNUA 3C8YA 3BK2A 1XF5L 5EE3A 2PJHA 4FADA 3RULA 2WQYB 3SD5A 2KWVB 5FR3A 2MJ3A 3IHPC 2ZW1A 3DBSA 4YTNB 1XXGA 5CTRC 1DOYA 1UELA 2LJ5A 4ZHOA 3M62B 4DHZB 1OTRB 2MBEA 3QCAA 4GXBA 2EMTA 4G50A 2DYOA 2V9HA 5I4DA 1RAXA 2IBIB 2Z8LA 1ROEA 2N7DA 2AWTA 4P7IA 5AUIA 3VR9B 1V81A 4DWFA 4J3OD 4N59A 2MBQA 1RM6C 4JE3B 2IY1B 1Z5SB 4RMAA 4OVUA 2GOWA 3QQ8B 3PLVA 5DPTA 2K8BA 4MM3B 3QX1A 1GUAB 3KUCB 3AB5A 2LI5A 4AOFA 3HHMA 3VH3B 3IT6B 1TKGA 3AE2B 4GGQA 1GC6A 1R4MI 4KGTA 4KGSA 4OHJA 4W9CA 1T6BX 4G11A 4FHKA 3HK0A 1HZ5A 2W54A 1HXYD 3BIID 2DZJA 3ZVVA 2J7QB 1MPEA 1OEYA 5DPSA 3ENEA 2O2VB 1GAQB 1SE4A 1OEYJ 2K8HA 3WALA 3MC0B 3WA0A 1WWTA 2MBOA 4C80A 3A4SC 3VTVA 2KX0A 4GSWA 1WSPA 2KTRB 4TSSA 3NHEB 2FCSA 4LTUA 1P98A 4HKQA 2WXLA 1ZE3D 1L6UA 3GB1A 3KLSX 4ANVA 3WIMA 2UU7A 1JWAD 2LGSA 4KIKA 1UNSA 1NBFC 1XLQA 2WS3B 5GXGB 1ZXHA 2MBHA 1WXAA 4US9A 5AZFA 1C78A 1CJEA 2QC8A 3RPFC 1IPGA 2LFIA 4HCNB 1QLBB 1AARA 2AL3A 1KLGD 1FRDA 3ZTDA 2FCMA 1FO4A 4HJKA 4K7SA 4DDID 3JSVB 3A33B 2W82A 1JRUA 4KZ0A 1NENB 4MGKE 2V3SA 2BT6A 2NBUA 1YQBA 2W3RA 3Q3OC 4KDLB 1L4ZB 3NZUA 3B08A 3S2AA 4C4VA 2DYBA 2XNAC 2N7EA 4FJZA 4TUUA 1JROA 2KO3A 5EE0A 3ZKJC 3TSSA 5DPRA 1F52A 4US8A 3N1ZC 4D2KA 4JIOU 3KQ4A 3RN9C 1WZ0A 3MP9A 4L23A 2VRRB 4TMAB 5D94A 2GB1A 3WAMA 1S1QB 3NZ3A 3VUWA 4ITKA 3C0RB 3BVMA 4HCPB 2FBWB 1WXMA 1NDDA 3WANA 2CR5A 5BMGA 3B0AA 2KDEB 3V62A 2M8SA 1OQRA 5BYSA 2RR9A 3NZSA 5TSSA 3LYYA 2L0TA 4W9DA 1E8XA 2L3ZA 3VH4B 1CK1A 1E90A 3DWMA 2KJ6A 4W9KA 2D2QA 3BVZA 1AWDA 3UINB 2KANA 4B9KA 1PGBA 1PGXA 4LCDE 2KHWB 1LGRA 5L83A 4LNKA 2QIEB 3L54A 2FIFA 2ASQA 5CHVC 4RNAA 3B2GA 3HIZA 4YWGG 1FNVA 3NY5A 4JL9A 4KGRA 2WP9B 1KH0A 4BZAA 1TY0A 3QK0A 1Z2MA 3AE4B 1VJKA 2ZEQA 2L83A 1FRRA 4IOIE 3VR8B 2D07B 3AE1B 3GZNI 4A9AA 4XZ4A 3DWGC 2M0XA 1WIAA 2Y5BB 1E6EB 3AEDB 4KKIA 4ACFA 1FMAD 1UWXA 3B1LX 1G6JA 2KDIA 1YMHE 3GS2A 3KVFB 4IC7B 2N0SB 3ZTCA 3TEYA 2DAJA 2OJRA 3E9SA 3FC4A 2J42A 3L0WB 4TQ0A 4TV3A 2WXKA 1WE6A 3AE5B 3ZW3A 2GMIC 2LHEA 4Q2JA 1I4RA 4NAWB 3SR6A 1Q1OA 2K9XA 5CHFA 4DBGA 2WXHA 2MJDA 4S17A 1I7HA 5J18A 1ZGUB 3R3MA 4EZJA 4CQNA 2KC2A 1K52A 3BYTB 1XCTL 4S0RA 1WF9A 2Y5PA 1NYQA 1ZXIA 2AEHA 2ZCCA 4EKUA 4M8NA 2WDRB 3RFZB 4K7WA 1VD2A 2HTHA 2LHDA 4F1SA 5BYQA 2CU3A 4NQLB 4W9LA 4PK1A 4LK0M 3QIJA 4AS1A 1DOXA 2LZ6A 4NNJB 2AQ2B 3PSEB 1EU4A 3PZDA 4MT5A 4HPMB 3CIRB 4MM3A 2LMCA 1WGDA 5HFYA 3H9DA 2Z0EB 1HA5A 1K51A 1V6EA 2L1AA 2N7JA 3KH0A 5HG2A 4A20A 2DBYA 2XK5B 1L6VA 2NVUI 2RD0A 2IPKD 4IDIA 2KMCA 4ICUA 3P4QB 4A90A 1WGHA 4ANWA 3Q3NC 5KHOA 2C9WB 3SU8X 5E6JA 2KAJA 3TUOA 4KDIC 2XBBC 3NS8A 5DPWA 1TZ1A 3N32A 3IFWB 2W3SA 3ZIMA 1NVID 5H8YE 4BVUC 2KJRA 2BW2A 1VCBA 3P2BA 1F2RC 1SEBD 5G55A 4ICVA 1D3ZA 1Y8RC 1EWCA 3ZUNA 3VQIA 4RM9A 2KK8A 2BB5A 3BWUD 3IBEA 4J6IA 4HDOA 3ZLZA 5AZHA 3RNCC 4NAMA 3GE8C 3MFGA 4WWMA 4AUQC 4IW0A 1SBBB 3UI3A 3A1QA 2ZZPB 2DZKA 3KUDB 4GB9A 4MELA 2QDFA 5JHAA 2KQSA 4C7YA 3Q3JA 5IN7A 4PYUA 3KW5B 1V97A 2LEKA 2FCQA 3RZWC 4WJOA 2L32A 4RF0A 2Y5CA 4M8MA 4M0WA 3RYTA 1MFWA 2K22A 1PQSA 2IYDB 4C4VB 3DBLI 2G45B 2FAZA 2L52A 5FR6A 2V0GA 1E8WA 2HE7A 1IGCA 2K25A 1ZUD2 2KDMA 2E6XA 3VFKA 3PPAA 1ET6A 2NR2A 5CHWA 5D7GA 3V05A 1HTOA 5D3IB 3AE7B 3UQAA 3J9CA 2FUG1 2DWQA 1V9JA 1FIQA 2G3QB 2LWPA 4NAWA 4P16A 2WXQA 3PHWB 3EECA 2FNJB 1UD7A 1ISNA 4FA6A 2LGIA 3CSFA 1AN8A 1N62A 1SE9A 4JWSC 4RGOS 4FBJB 1R4NI 3UIOB 2JX5A 2J0KA 3RD2A 3SFDB 3UF8A 3IT4B 2WXFA 3B9JA 3RNBC 3R7RA 1WM3A 4RGTA 2XEWA 2DYMA 2GBJA 3AE9B 4LLGM 4G3XB 3AV8A 3NVYA 4DXGA 4W9GA 3L17A 5HKHA 4R3DA 2KZRA 4LDTB 4N58A 2CHWA 3TEWA 3P1MA 2MRPA 3DCGA 2I1KA 2JQRB 3RMKC 4BKSA 5J2RA 1C4CA 1Q0WB 2YEPB 3ZJTA 1VDVA 4MJSB 2WU5B 2JVCA 4FULA 2B3AA 1JWUD 1IBXB 1FFVA 2ZW0A 2FUHB 2QHOA 3EC8A 1YNTE 3FAHA 1WJ6A 4GLSC 3I5JC 5EE1A 2PTLA 1XO3A 3LJ3A 3X0WA 1H4RA 2NMQA 5BYRA 2O6VA 1E10A 1SSNA 4WAAA 2FIDA 3EUB2 2OHFA 4I6PA 3AI5A 2M1MA 2XK5A 3R2TA 1BT0A 3DVGX 4MGZE 4RCOA 3U8ZA 1GC7A 2J52A 1AW7A 1EF5A 4BFRA 1A70A 1N5XA 2YVCA 4TKNA 4IWOA 4ARCA 1KFYB 4LJPB 2DZIA 1WX8A 2WXPA 1TT5B 1WX9A 3DQVA 5CX3A 2WGSA 4BOZB 3OJ4B 2KJHB 1NI2A 4WH4A 1P1AA 2LGDA 2JUOA 3NVVA 3A1QB 3CF6E 1JCKB 1TS3A 3MHZA 1V1PB 3AEAB 2V1YA 3K9PB 3DHGC 1P9DU 1WXVA 3L4PA 1JWSD 2X8XX 1E7UA 2UYZB 3RNAC 3O13A 1QOGA 2IGGA 3R7QA 1PGAA 4LDTD 2MHJA 2QEJC 4P1BC 2H88B 3KWLA 1N6ZA 1D5ZC 1Y56A 3AE6B 1CMXB 1QKZA 4W9EA 4GDKA 4OZCA 4FJVB 2CHXA 4OZBA 3AN1A 1LM8B 2DHZA 1GPXA 2BF8B 4WJNA 3ZJUA 1TS4A 2HD5B 2NBVB 4K1RB 1TKYA 4ZDVA 3RI7C 4AP4C 3VUYA 1T0QC 2LUMA 3U7DA 3PGEA 1YQ4B 3FILA 3QWZB 3Q8EA 3KUZA 4ZHPA 2BWFA 1YX5B 3V3XA 2INPE 1WGYA 4LNIA 4P6VF 2ZPYA 2IY0B 2ZJDA 4C7ZA 1GB4A 4GDLB 2RMMA 4F8CB 2D3BA 4XWWA 2WLBA 1ENFA 1J0GA 4GOCA 4HKZE 5JZEB 2PIAA 3HUIA 4P1CC 4AJWA 2WWZA 4ANXA 2WXNA 1D5MC 4USAA 2PPHA 1WYGA 1F9JA 2BS3B 3AEFB 2NCNA 4IWPA 1F1HA 1E8YA 3A9JB 1EO6A 1N63A 2JZPA 2M56B 1TTNA 1TS2A 4W9HA 1HTQA 2MEKA 3TMPB 1I4HA 2Z0DB 3JVZX 3R8BA 1BMLC 2IGHA 5AZGA 1WYWB 2BYTA 4FHJA 1C79A 3U52E 2M4NA 2JZZA 2QCZA 1TZOA 4HPPA 4O1NA 2N9LA 1V1OA 2J4XA 4W9IA 1A5RA 2LXAA 1SJED 3T3OA 4OW0A 2I1JA 1YJ1A 3MJ5A 2DX5B 2X38A 2KDFB 3N20C 3PT2B 1E5WA 1QOAA 2SEBD 1F77A 1GOZA 4HPLB 3ZRCA 2REXA 3R66C 5IKCM 3N30A 3AEBB 3PO0A 3DBLB 1WJ4A 1K53A 2D5GA 1EWYC 1HEZE 2GBMA 1M94A 1E0ZA 4K7UA 2W55A 3PZ8A 5C23A 2O2VA 5LXIB 4IM0A 2KQ7A 2C60A 1EU3A 3ZYYX 1VZ6A 2VH1A 1UUPA 1STEA 3V61A 1XEEA 1FPYA 1TGZB 3Q8FA 2RDHA 1WMHA
chains in the Genus database with same CATH topology
2BW2A 2Q5WD 2WU2B 1WRIA 4TQ1A 2I2YA 3AEEB 2BS4B 1F0ZA 1FD6A 1HQRD 1MHHE 1F2RC 1SEBD 4XE0A 4NJCA 5AUKA 1EWCA 1GB1A 1FCCC 3VQIA 2JXTA 4RF1A 1AYFA 2BTEA 1N5WA 2BB5A 3BWUD 2LJIA 2JU6X 1TYGB 2PLPA 4NAMA 2IDYA 3MFGA 4WWMA 2WDVB 1P7EA 1NEKB 1SE2A 3C8YA 3BK2A 1XF5L 1I4XA 5EE3A 1SBBB 5D3DA 3U2SC 4OZAA 2WQYB 3UI3A 2B76B 5FR3A 2MJ3A 1L0YB 4GDKB 2RDGA 1D4BA 2ZW1A 5G5GA 4YTNB 2WXJA 2GRIA 1YN5A 3BZDB 1XXGA 4PT5A 3NUHB 1JWBD 1C9FA 1DOYA 2INNE 4ZHOA 3KWVA 1K50A 1ZDVA 4C7YA 1V97A 4WQMA 2EKIA 4YTPB 2LEKA 2DYOA 1ESFA 5I4DA 1ACCA 2Z8LA 2L32A 1ROEA 4RF0A 1BUIC 2Y5CA 3EA6A 5JXVA 1SB3C 4M0WA 2AQ1B 2K22A 5AUIA 3VR9B 2AX5A 2TSSA 4XDCA 1J7CA 2KMMA 3BVGA 2L52A 5T8IA 2V0GA 1B9RA 4J3OD 2PVOD 1VLBA 2WDQB 1IGCA 2MH7A 1ZUD2 4N59A 2KDMA 2E6XA 1V8CA 3HVDA 3P4SB 1XCQL 1ET6A 1RM6C 4JE3B 5D7GA 4N6EB 3ZQ4A 3VRBB 4ARIA 3V05A 4MM3B 1JMLA 1XLNA 3BYYB 5D3IB 3AE7B 3AB5A 3J9CA 2FUG1 4DQOC 2DWQA 1SE3A 3IT6B 1IGDA 1TKGA 3AE2B 3I57A 2OEDA 4KGTA 1FIQA 4KGSA 4OHJA 4EE2A 1WGKA 1T6BX 4P16A 2WXQA 4JWUC 1HZ5A 2W54A 2VZKD 1E9MA 1M4VA 3I9V1 1HXYD 4OVZA 3BIID 2LGIA 1AN8A 4HRSA 1N62A 4JWSC 5H92C 4JPSA 4RGOS 2KACA 4YT0B 1MPEA 1F2RI 2JX5A 3SFDB 3IT4B 2WXFA 1OFFA 3B9JA 1GAQB 1N61A 1SE4A 4RGTA 3TEXA 1VR9A 1JALA 4ZRPA 1XLPA 2N9KA 1EM7A 3MC0B 2DYMA 1L0XB 4WIPA 1WWTA 4C80A 3AE9B 4LLGM 2MJEA 1WSPA 2VZKB 4TSSA 3AV8A 1FCLA 3NVYA 4DXGA 4LTUA 3IAM1 4R3DA 2QJLA 1SF0A 1ZOYB 1N60A 2RPVA 3NS1A 4N58A 3TEWA 2WXLA 4HKQA 1ZE3D 3P1MA 3HVZA 1L6UA 4C56C 2JQRB 3GB1A 3KLSX 1C4AA 1C4CA 2K5PA 2YEPB 3ZJTA 1SIJA 5HI1A 1VDVA 1JWAD 5FK9C 1WXQA 1UNSA 1TJEA 1XLQA 1KLUD 2WS3B 2K3UA 5GXGB 4JX1C 1ZXHA 2WU5B 4KX6B 2GI9A 2ICIA 4US9A 3AMZA 1C78A 1CJEA 1L5PA 2KN4A 3RPFC 1JWUD 2LFIA 1IBXB 1ZPSA 1FFVA 3NVWA 1QLBB 2ZW0A 3IXSA 2M0AA 2CJNA 1YNTE 3FAHA 1KLGD 1FRDA 4GLSC 1FXAA 1FO4A 1KF6B 1MVKA 1RYJA 2G9HD 4KKJA 4XDDA 1FXIA 1OQQA 1PDXA 5EE1A 2PTLA 1XO3A 4A55A 5HHDG 2JSVX 1I4QA 2W82A 4YSZB 2NMQA 5BYRA 1YN3A 1E10A 1SSNA 2PKOA 2CJOA 1NENB 3P63A 3EUB2 1JQ4A 3OWEB 2OHFA 1YJJA 4ZYSA 1JW9D 2ACZB 2BT6A 2W3RA 1L4ZB 1J7BA 3R2TA 2IJ0A 1E7PB 2XNAC 5EE0A 1JROA 4RCOA 2WXGA 1YQ3B 2J52A 1C4PA 5G5HA 1AW7A 1A70A 1N5XA 3ZJVA 1FM0D 3TSSA 4ARCA 4US8A 1KFYB 4NZLB 1QF6A 1UWMA 4D2KA 2XN9C 1JRPA 3TEZA 3KQ4A 1JWMD 2WXPA 2FE8A 5LNK1 1MI0A 3MP9A 4L23A 2SAKA 2E3TA 5C3JB 3Q69A 4TMAB 2K0PA 2GB1A 3NZ3A 4WH4A 1CQVA 1DYQA 4ITKA 3NVVA 3BVMA 1I4GA 1JCKB 4RFBA 1TS3A 3MHZA 1V1PB 3Q8AA 1L4DB 2FBWB 3AEAB 3AM9A 3W2DA 1PYWD 5BMGA 3SEBA 3L4PA 4L1BA 1MHXA 1JWSD 1OQRA 1TY2A 5BYSA 3O13A 3ETRA 1QOGA 2BB6A 4XWTA 2IGGA 1Q10A 5TSSA 3LYYA 1PGAA 4MACA 2JWUA 2HTME 2KWDA 1CK1A 1QOFA 2QEJC 1IUEA 2H88B 3KWLA 1KRHA 3ZGZA 2ONQA 1CZPA 4YXDB 2R61A 3U4EG 1D5ZC 3DWMA 3W1SA 4UDUC 1Y56A 3AE6B 3BVZA 1AWDA 4L2YA 2WXRA 4B0EA 1QKZA 4OZCA 1PGBA 1PGXA 1PUTA 4OZBA 3AN1A 4YTMB 3H8HA 2V3PA 4HJGE 3E56A 1UGJA 1GPXA 5MPOA 3ZJUA 3P4RB 2QIEB 1DGJA 1TS4A 2QILA 3URYA 4H2AA 1TKYA 2IGDA 4RNAA 3B2GA 2LUMA 4IKGA 4YWGG 1FNVA 4A6QA 1ZP0B 5BMIA 2I38A 4KGRA 1D6EC 1YQ4B 2WP9B 3FILA 2BBCA 1KH0A 3N9YC 3WCQA 1TY0A 3W5VB 3AE3B 1J7AA 1FNWA 3Q8EA 2Y3AA 1BXTA 1ZDXA 2G1EA 4ZHPA 3V3XA 2INPE 3AE4B 1VJKA 4P6VF 4AQ7A 1IBXA 2L83A 1FEHA 1FRRA 4IOIE 3AH7A 4RGNA 3VR8B 3AE1B 4C7ZA 4GDLB 1GB4A 2RMMA 2JYTA 3P42A 4A9AA 4XWWA 1QT9A 2PMVA 2WLBA 3DWGC 3Q8CA 2KQ4X 1ENFA 3AEDB 1E6EB 4KKIA 3EGRA 3R2IA 4HKZE 5BMHA 2H89B 1FMAD 1QILA 3LXFA 3AECB 2PIAA 1UWXA 1C76A 3AEGB 4RGMA 1YMHE 1ET9A 2PVGC 3HUIA 2WNMA 3GS2A 3NRZA 2N0SB 1VZ7A 2BS2B 1RWSA 1D5MC 2WXNA 4USAA 3TEYA 4FXCA 1WYGA 3E9SA 1YJIA 2BS3B 2J42A 3FC4A 4TQ0A 3AEFB 2WXKA 3AE5B 2LHEA 4Q2JA 1I4RA 4NAWB 1N63A 2JZPA 4DXFA 3SR6A 2M56B 1TS2A 2WXMA 1D5XC 2K9XA 2WXHA 2MJDA 4YSYB 2HDEA 2MEKA 1SJHD 1I7HA 1I4HA 1YN4A 4CQNA 2QMTA 1BMLC 2IGHA 3R8BA 2J53A 1K52A 1QQRA 2BYTA 3BYTB 1XCTL 1QOBA 1C79A 3U52E 2Y5PA 1NYQA 1TZOA 1ZXIA 4O1NA 2NTTA 2N9LA 2WDRB 1NI3A 1V1OA 2J4XA 4HROA 1NYRA 3RFZB 4REZA 1SJED 2LHDA 2M19A 3T3OA 4OW0A 5BYQA 1VZ8A 4HEA1 2QSDA 3HRDD 2JYEA 3P4PB 4ZRQA 4B0MA 2CU3A 3MJ5A 3T3NA 1V1PA 1B1ZA 1XLOA 4YSXB 4LK0M 1SXTA 1LO5D 3PZ7A 3BK1A 3SFEB 4AS1A 1DOXA 5FKAC 1PFDA 2X38A 2AQ2B 1EU4A 4ZOHC 4A8XC 4MT5A 2PW9A 2AQ3B 3CIRB 3LB8C 2NTSA 2YEPF 1QOAA 2SEBD 3NVZA 1F77A 1GOZA 2LMCA 2EELA 5HFYA 2WXOA 3VRAB 3ABVB 1HA5A 1K51A 1T3QA 2N7JA 1FFUA 2L1AA 2V4IB 1VRAB 4WURA 3AEBB 5C2TB 3PO0A 5HG2A 2DBYA 1HZ6A 4WAFA 1L6VA 1T5XD 5EE9A 1K53A 3W9CB 3GP7A 2D5GA 1EWYC 1L0VB 1P7FA 2IPKD 1HEZE 4RH6A 1TS5A 3IAS1 4IDIA 3W5UB 1E0ZA 1R7SA 1RFKA 2ON8A 3P4QB 1KTKA 4A90A 2W55A 1FNUA 3AE8B 3PZ8A 1I4PA 2DLBA 1TKEA 5E6JA 2KAJA 3TUOA 1EU3A 3ZYYX 1C77A 1VZ6A 3FILB 3Q8BA 1UUPA 3CWIA 4MH8A 1STEA 2V3NA 1XEEA 2W3SA 1NVID 1DOIA 3Q8FA 5H8YE 3B2FA 2WXIA 2RDHA 3U7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGI A;  4D2K A;  2I2Y A;  2KAC A;  1MI0 A;  3MP9 A;  1MHH E;  1F2R C;  1MPE A;  1F2R I;  1FD6 A;  2LHE A;  2JZP A;  1GB1 A;  1FCC C;  2JXT A;  2K0P A;  2GB1 A;  4WH4 A;  2N9K A;  1EM7 A;  2JU6 X;  2PLP A;  2QMT A;  2IGH A;  2J53 A;  1K52 A;  1P7E A;  1FCL A;  1XCT L;  5BMG A;  1XF5 L;  1MHX A;  2N9L A;  2RPV A;  4OZA A;  3UI3 A;  2IGG A;  1Q10 A;  1PGA A;  4MAC A;  2JWU A;  2LHD A;  2ZW1 A;  3GB1 A;  1D4B A;  2KWD A;  2QSD A;  5HI1 A;  2ONQ A;  1C9F A;  1ZXH A;  1K50 A;  1QKZ A;  2GI9 A;  4OZC A;  1PGB A;  1PGX A;  4OZB A;  2KN4 A;  4HJG E;  1IBX B;  2ZW0 A;  2PW9 A;  1YNT E;  2IGD A;  5JXV A;  2LUM A;  4GLS C;  4IKG A;  2EEL A;  5HFY A;  1MVK A;  5BMI A;  1K51 A;  2I38 A;  4KGR A;  2N7J A;  3FIL A;  1KH0 A;  5HG2 A;  2PTL A;  1HZ6 A;  1IGC A;  5HHD G;  2JSV X;  2KDM A;  2NMQ A;  1K53 A;  3V3X A;  1P7F A;  1XCQ L;  1HEZ E;  1IBX A;  4IOI E;  1GB4 A;  2ON8 A;  2RMM A;  1JML A;  2KQ4 X;  1IGD A;  4HKZ E;  5BMH A;  2OED A;  4KGT A;  3FIL B;  4KGS A;  2J52 A;  1UWX A;  1YMH E;  1HZ5 A; 
#chains in the Genus database with same CATH topology
 2WU2 B;  1WH3 A;  3PTF C;  4HXD A;  4TQ1 A;  2I2Y A;  1F0Z A;  1MHH E;  2G4S A;  4XGA B;  3W1S C;  2INC C;  2WX0 A;  4RF1 A;  2JY6 A;  1LXD A;  2HJ8 A;  1N5W A;  2KFJ A;  1X1M A;  4AWJ A;  2JPH A;  2DEN B;  3HM6 X;  3ZNG C;  2IDY A;  4MDK E;  4EZL A;  3VDZ A;  1SE2 A;  4BKG A;  2JRI B;  3T8M A;  1XT9 B;  1I42 A;  1RLF A;  4ZRJ A;  3U2S C;  3PRM B;  2B76 B;  5IO9 A;  4JGH B;  1L0Y B;  4GDK B;  5G5G A;  1MG4 A;  3PRE A;  2WXJ A;  3BZD B;  3TJP A;  4PT5 A;  2KLC A;  3NUH B;  1JWB D;  2J0J A;  2INN E;  3GE3 C;  1K50 A;  1ZDV A;  4WQM A;  4YTP B;  2JT4 B;  4DHJ D;  2GBR A;  3AU4 A;  5EDS A;  2IZV B;  3DDC B;  1BUI C;  3EA6 A;  5JXV A;  2L05 A;  3AUL A;  5IOI A;  3L16 A;  2IO3 B;  2AX5 A;  4MSM B;  2KLG A;  3VXW A;  4BOS C;  2BVC A;  2WDQ B;  1VLB A;  3RZF A;  2MH7 A;  2NS5 A;  3Q14 C;  3CST A;  1V8C A;  5TR5 A;  3HVD A;  4LNF A;  4PYZ A;  3P4S B;  1V5O A;  4N6E B;  3ZQ4 A;  3VRB B;  1XLN A;  4WJP A;  4W9J A;  1SE3 A;  2CS4 A;  2OED A;  3ZXR A;  2JZ3 B;  1J19 A;  4EE2 A;  2CU1 A;  2KVR A;  4IM3 A;  2VZK D;  4EZK A;  3DBH I;  2BWE S;  2C7M B;  4AJY B;  2KAC A;  2DNF A;  2L76 A;  1N61 A;  3TEX A;  5J17 A;  2KMA A;  1VR9 A;  4ZRP A;  2J0M A;  1TIF A;  1XLP A;  1EM7 A;  1L0X B;  4WIP A;  3RNF C;  5AEK B;  2MJE A;  2VZK B;  4RM8 A;  4II2 B;  1UF0 A;  1ZW7 A;  2L7R A;  1SF0 A;  4HDQ A;  3N1Y C;  1V49 A;  4I6L B;  4C56 C;  3NG0 A;  1C4A A;  2K5P A;  1SIJ A;  5HI1 A;  2LRU A;  1TJE A;  1KJT A;  5LLI A;  3VAW A;  4KX6 B;  2GI9 A;  2ICI A;  2L8J A;  3UQB A;  2KD0 A;  1L5P A;  2K39 A;  2JXX A;  2N1V A;  2M0A A;  2CJN A;  4ANU A;  3PRZ A;  1FXA A;  3AU5 A;  4QAY A;  1KF6 B;  3Q3M C;  1L7Y A;  1RYJ A;  2L0F A;  4KKJ A;  4XDD A;  1PDX A;  2OOB B;  3SDL C;  1UZX B;  2KWU B;  5HHD G;  5IAA C;  1WR6 E;  4YSZ B;  3V6E B;  4ZRK A;  3DBH B;  3P63 A;  1KM7 A;  1JQ4 A;  3OWE B;  3MC8 A;  1YJJ A;  1JW9 D;  2ACZ B;  3H6N A;  2ZVN A;  2PE9 A;  3A9J A;  3DBR B;  2C7N B;  5DCN A;  4CO7 A;  1E7P B;  2MW5 A;  5LXH A;  3ZJV A;  1FM0 D;  3RCZ A;  3N1X C;  1L2N A;  3H1U A;  2XN9 C;  2KFK A;  3TEZ A;  2WYQ A;  1I35 A;  2MSE D;  1WZ3 A;  2SAK A;  2E3T A;  5C3J B;  2K0P A;  3ZDT A;  3PV1 A;  1DYQ A;  4GU2 A;  3W1Y A;  1I4G A;  3IVF A;  5D6J B;  1L4D B;  2NPT A;  4DK5 A;  3PHX B;  3DVN V;  2IND C;  3C19 A;  3SEB A;  4ZYN A;  1MHX A;  1TY2 A;  1UBI A;  4FN2 A;  5JHB A;  4BAX A;  3ETR A;  4XWT A;  1Q10 A;  4MAC A;  2JWU A;  2KWD A;  1QOF A;  1IUE A;  1KRH A;  3ZGZ A;  2ONQ A;  1CZP A;  4YXD B;  3U4E G;  4UDU C;  2PEA A;  4HWI B;  1YX6 B;  1PUT A;  2GLS A;  3H8H A;  2V3P A;  5MPO A;  3P4R B;  1DGJ A;  2QIL A;  1SIF A;  4H2A A;  3A9K A;  1V80 A;  2IGD A;  4IKG A;  3ML8 A;  1ZP0 B;  5BMI A;  2I38 A;  2JRH A;  1D6E C;  3WCQ A;  1J7A A;  2Y3A A;  1XQQ A;  5D2M B;  3O65 B;  2OJW A;  1WMH B;  3ZDM C;  3AH7 A;  4RGN A;  4N9F 4;  2JYT A;  1QT9 A;  3Q8C A;  2KQ4 X;  3EGR A;  3R2I A;  4B6W A;  3JSV A;  1FXT B;  1C76 A;  4JQW C;  3HM3 A;  1ET9 A;  2PVG C;  2WNM A;  1WRD B;  2BS2 B;  4FXC A;  2KT7 A;  3ML9 A;  3VTU A;  2ZCB A;  4DDG D;  4DXF A;  3T9L A;  2WXM A;  1D5X C;  3ZNI D;  3OAW A;  4YSY B;  1SJH D;  1UGM A;  2BYF A;  3RT3 B;  2QMT A;  3RNE C;  2J53 A;  1QQR A;  3SHQ A;  1QOB A;  4E3C A;  1QZE A;  4KZC A;  4HK2 A;  2WDT B;  2K6D B;  3APC A;  4REZ A;  4B95 A;  4I6N B;  3MTN B;  4HEA 1;  2QSD A;  4M0W B;  3HRD D;  4B0M A;  4ZRQ A;  2IO1 B;  3T3N A;  3PZ7 A;  3PVL A;  4A3O A;  3SFE B;  5FKA C;  1PFD A;  3D32 A;  3I3T B;  2UWQ A;  3KYC D;  3LB8 C;  2YEP F;  3JYU A;  2EEL A;  3VRA B;  2D3A A;  1P0R A;  1T3Q A;  2V4I B;  3OG5 A;  3ZO5 B;  2KKC A;  2N9P C;  5C2T B;  1HZ6 A;  4M02 A;  2MP2 B;  4URK A;  1T5X D;  5EE9 A;  3I63 C;  3W9C B;  1ZKH A;  3GP7 A;  1TS5 A;  3IAS 1;  3A4R A;  5JH5 C;  2K8C A;  1FNU A;  3AE8 B;  2DLB A;  4HVB A;  3TBL D;  2KFK B;  2RPQ A;  4WWP A;  1WR1 A;  3Q8B A;  4LJO B;  4MH8 A;  1YOV B;  1RFA A;  2V3N A;  3U30 A;  2G4D B;  1DOI A;  2K1F A;  3B2F A;  4NPN A;  2WXI A;  3Q6B A;  3U7Z A;  2Q5W D;  1WM2 A;  4E74 A;  2C7H A;  1HQR D;  4XE0 A;  5AUK A;  1GB1 A;  1FCC C;  2JXT A;  4X57 B;  4XC2 A;  2BTE A;  2KNB A;  2LVO A;  1T0Y A;  2LJI A;  1TYG B;  2PLP A;  4MJS A;  3LDZ E;  1Q5W B;  2WDV B;  4M00 A;  1NEK B;  2RGF A;  1I4X A;  3EFC A;  1KOT A;  5D3D A;  4WQO B;  4OZA A;  1KLV A;  3MC9 A;  2GBK A;  1R4N B;  3PRP B;  2RDG A;  1D4B A;  2NPT B;  4IG7 B;  4NQK E;  3TL5 A;  2GRI A;  1YN5 A;  4NY0 A;  2CKH B;  4WWN A;  3ALB A;  1C9F A;  1UH6 A;  4MGI E;  3KWV A;  3OLM D;  2EKI A;  3DVG Y;  3L13 A;  1E8Z A;  1ESF A;  3DBR I;  1ACC A;  1YIW A;  2ZNV C;  4YL8 A;  3EHV A;  1SB3 C;  2AQ1 B;  4KVG B;  2LAS A;  3N3K B;  3APD A;  2TSS A;  4XDC A;  1J7C A;  2KMM A;  2KOX A;  2N9X A;  3BVG A;  5T8I A;  3ZNH B;  4DHJ B;  1B9R A;  4EEW A;  2PVO D;  4WJQ A;  2KDB A;  1GG3 A;  1LQB A;  2BGF A;  1XCQ L;  2ZVO A;  3K9O B;  1WXS A;  4MEM A;  3JW0 X;  4ARI A;  1UBQ A;  1JML A;  3BYY B;  1RRB A;  2KXJ A;  4DQO C;  1IGD A;  2Z59 B;  3I57 A;  2LVP A;  2LRW A;  4FJY A;  4BKT A;  1H8C A;  2ZPN A;  1WGK A;  4II3 B;  2KX3 A;  4JWU C;  3H7S A;  4PS7 A;  1E9M A;  1M4V A;  3I9V 1;  4OVZ A;  4F7Z A;  1R4M B;  4HRS A;  4JLC A;  5H92 C;  4JPS A;  4YT0 B;  4GN1 A;  1J8C A;  3MHS D;  1F2R I;  2DAF A;  2MBB B;  2WX1 A;  1OFF A;  1EF1 A;  3GZN B;  1JAL A;  4DHZ E;  2N9K A;  3UGB B;  3QAR A;  3DPD A;  3APF A;  2LD9 A;  2LUE A;  4IUM B;  4K3B A;  1FCL A;  4IWQ A;  1HE8 A;  4K3C A;  2NBW B;  3IAM 1;  5E6O A;  2QJL A;  1ZOY B;  1N60 A;  2RPV A;  3VVW B;  3NS1 A;  1V86 A;  3HVZ A;  3A9K B;  4MSQ B;  3RNG C;  3V60 A;  5FK9 C;  3M95 A;  2K6Q A;  1WXQ A;  2EMS A;  1KLU D;  2K3U A;  4EUT A;  4JX1 C;  3ZXV A;  3AMZ A;  1V2Y A;  2KN4 A;  4NJ7 A;  4HLE A;  1ZPS A;  3NVW A;  3IXS A;  5BO4 B;  3FKY A;  4GDL A;  1OGW A;  5KHQ A;  3KYD D;  5E6P A;  5GMV A;  1V5T A;  1MVK A;  2AL6 A;  2DZM A;  2G9H D;  3H7P B;  3Q2A C;  1FXI A;  1OQQ A;  4A55 A;  2JSV X;  1I4Q A;  1YN3 A;  2A4Z A;  3AXC A;  1WJU A;  2PKO A;  2CJO A;  2D11 A;  1WFY A;  4ZYS A;  3TCA A;  4M01 A;  2MA9 B;  4KSK C;  2HJ1 A;  2IO2 B;  2MP2 A;  1J7B A;  3DOW A;  2IJ0 A;  2BYE A;  2L00 B;  1WJN A;  2WHI A;  3X23 A;  1C3T A;  2WXG A;  1YQ3 B;  2ZNV B;  1C4P A;  5G5H A;  1T0R C;  1YD8 U;  4EFO A;  3VTW A;  3PLU A;  1MG8 A;  4NZL B;  1QF6 A;  1UWM A;  2MX2 A;  2LGX A;  1JRP A;  3BIN A;  3DHI C;  1JWM D;  1TBE A;  2FE8 A;  5LNK 1;  1MI0 A;  3QAQ A;  4XX5 A;  2MCN B;  3Q69 A;  2VH2 A;  1CQV A;  1GJZ A;  2LVQ A;  4RFB A;  3Q8A A;  3AM9 A;  1WGG A;  3W2D A;  1PYW D;  4L1B A;  4WWO A;  2KN5 A;  3RUI B;  2BB6 A;  2RDB C;  3WAO A;  2KC1 A;  2HTM E;  2LXC A;  2C5L C;  1LFD A;  3ZRF A;  1E7V A;  2R61 A;  2D3G A;  3W1S A;  2KVZ A;  4L2Y A;  2WXR A;  4B0E A;  2LGY A;  4MGY E;  4YTM B;  3L10 B;  4ZRI A;  4HJG E;  4FLH A;  3E56 A;  1UGJ A;  2MWS B;  3DVN U;  3OJ3 A;  2YLM A;  3URY A;  1WGR A;  3EFU A;  2D3C A;  1OQY A;  4OVV A;  2KTF A;  2BQQ A;  4A6Q A;  1XD3 B;  5C1Z A;  3TIX A;  4KIK B;  2BBC A;  3N9Y C;  2O6V D;  3W5V B;  4BKS D;  2R2Q A;  3AE3 B;  1FNW A;  4KSL C;  1BXT A;  1ZDX A;  2G1E A;  4LNN A;  3M3J A;  1SGH A;  2N1W A;  4AQ7 A;  1IBX A;  1FEH A;  3PS6 A;  3P42 A;  4ASW C;  1IP9 A;  1WI0 A;  4MH0 E;  2PMV A;  4NJ6 A;  4EOY A;  1C1Y B;  4BBN F;  5BMH A;  2H89 B;  1QIL A;  3LXF A;  4IM2 A;  3AEC B;  2FCN A;  3AEG B;  3QJZ A;  4RGM A;  4BBN C;  2BPS A;  2O6V B;  3NRZ A;  5L95 C;  3MJW A;  5E6N A;  1T0S C;  1VZ7 A;  1RWS A;  3M63 B;  1WX7 A;  4GMV A;  3IG3 A;  3VUX A;  1YJI A;  3ZNZ B;  3GOE A;  3Q3F A;  3VHT C;  2IO0 B;  2BYV E;  2V4L A;  2HDE A;  1WY8 A;  1YN4 A;  1WE7 A;  4A3P A;  3QHT A;  1MJD A;  2NTT A;  3V6C B;  4HRO A;  1NI3 A;  3WAP A;  1NYR A;  4KV2 A;  3UIP B;  3CMM B;  2M19 A;  2CHZ A;  3BY4 B;  1VZ8 A;  2KTR A;  4PS8 A;  2JYE A;  3P4P B;  3DHH C;  2W9N A;  3QC8 B;  1V1P A;  1B1Z A;  1XLO A;  3ECI A;  4YSX B;  2JWZ A;  1SXT A;  2R2O A;  1LO5 D;  3BK1 A;  4C00 A;  4PS3 A;  2D10 A;  3H7P A;  2EKE C;  2N4F A;  1IYF A;  4ZOH C;  4A8X C;  4DXA B;  2PW9 A;  2AQ3 B;  2GBN A;  2M17 A;  4CYE A;  2NTS A;  4K81 A;  3NVZ A;  2BKR B;  2WXO A;  2KWC A;  3ABV B;  1FFU A;  4WUR A;  5IP4 D;  1VRA B;  5G2N A;  2BKF A;  4WAF A;  2RSU A;  4XYC A;  1L0V B;  4G0N B;  1P7F A;  4RH6 A;  3W5U B;  2AYO B;  1R7S A;  1RFK A;  2JF5 A;  2ON8 A;  1KTK A;  4E71 A;  1I4P A;  2A5U A;  4CHK A;  1TKE A;  3L08 A;  3QA8 A;  1C77 A;  3FIL B;  1S3S G;  3NOB A;  2MQJ A;  2MLB A;  3CWI A;  1P3Q U;  1WRI A;  4W9F A;  3AEE B;  1EUV B;  2BS4 B;  3NJT A;  1FD6 A;  4LNO A;  4NJC A;  4GIV A;  2KYW A;  2N9E B;  5IA7 A;  1AYF A;  3ONS A;  2JU6 X;  1K8R B;  2PE6 B;  1U4A A;  1P7E A;  1GNU A;  3C8Y A;  3BK2 A;  1XF5 L;  5EE3 A;  2PJH A;  4FAD A;  3RUL A;  2WQY B;  3SD5 A;  2KWV B;  5FR3 A;  2MJ3 A;  3IHP C;  2ZW1 A;  3DBS A;  4YTN B;  1XXG A;  5CTR C;  1DOY A;  1UEL A;  2LJ5 A;  4ZHO A;  3M62 B;  4DHZ B;  1OTR B;  2MBE A;  3QCA A;  4GXB A;  2EMT A;  4G50 A;  2DYO A;  2V9H A;  5I4D A;  1RAX A;  2IBI B;  2Z8L A;  1ROE A;  2N7D A;  2AWT A;  4P7I A;  5AUI A;  3VR9 B;  1V81 A;  4DWF A;  4J3O D;  4N59 A;  2MBQ A;  1RM6 C;  4JE3 B;  2IY1 B;  1Z5S B;  4RMA A;  4OVU A;  2GOW A;  3QQ8 B;  3PLV A;  5DPT A;  2K8B A;  4MM3 B;  3QX1 A;  1GUA B;  3KUC B;  3AB5 A;  2LI5 A;  4AOF A;  3HHM A;  3VH3 B;  3IT6 B;  1TKG A;  3AE2 B;  4GGQ A;  1GC6 A;  1R4M I;  4KGT A;  4KGS A;  4OHJ A;  4W9C A;  1T6B X;  4G11 A;  4FHK A;  3HK0 A;  1HZ5 A;  2W54 A;  1HXY D;  3BII D;  2DZJ A;  3ZVV A;  2J7Q B;  1MPE A;  1OEY A;  5DPS A;  3ENE A;  2O2V B;  1GAQ B;  1SE4 A;  1OEY J;  2K8H A;  3WAL A;  3MC0 B;  3WA0 A;  1WWT A;  2MBO A;  4C80 A;  3A4S C;  3VTV A;  2KX0 A;  4GSW A;  1WSP A;  2KTR B;  4TSS A;  3NHE B;  2FCS A;  4LTU A;  1P98 A;  4HKQ A;  2WXL A;  1ZE3 D;  1L6U A;  3GB1 A;  3KLS X;  4ANV A;  3WIM A;  2UU7 A;  1JWA D;  2LGS A;  4KIK A;  1UNS A;  1NBF C;  1XLQ A;  2WS3 B;  5GXG B;  1ZXH A;  2MBH A;  1WXA A;  4US9 A;  5AZF A;  1C78 A;  1CJE A;  2QC8 A;  3RPF C;  1IPG A;  2LFI A;  4HCN B;  1QLB B;  1AAR A;  2AL3 A;  1KLG D;  1FRD A;  3ZTD A;  2FCM A;  1FO4 A;  4HJK A;  4K7S A;  4DDI D;  3JSV B;  3A33 B;  2W82 A;  1JRU A;  4KZ0 A;  1NEN B;  4MGK E;  2V3S A;  2BT6 A;  2NBU A;  1YQB A;  2W3R A;  3Q3O C;  4KDL B;  1L4Z B;  3NZU A;  3B08 A;  3S2A A;  4C4V A;  2DYB A;  2XNA C;  2N7E A;  4FJZ A;  4TUU A;  1JRO A;  2KO3 A;  5EE0 A;  3ZKJ C;  3TSS A;  5DPR A;  1F52 A;  4US8 A;  3N1Z C;  4D2K A;  4JIO U;  3KQ4 A;  3RN9 C;  1WZ0 A;  3MP9 A;  4L23 A;  2VRR B;  4TMA B;  5D94 A;  2GB1 A;  3WAM A;  1S1Q B;  3NZ3 A;  3VUW A;  4ITK A;  3C0R B;  3BVM A;  4HCP B;  2FBW B;  1WXM A;  1NDD A;  3WAN A;  2CR5 A;  5BMG A;  3B0A A;  2KDE B;  3V62 A;  2M8S A;  1OQR A;  5BYS A;  2RR9 A;  3NZS A;  5TSS A;  3LYY A;  2L0T A;  4W9D A;  1E8X A;  2L3Z A;  3VH4 B;  1CK1 A;  1E90 A;  3DWM A;  2KJ6 A;  4W9K A;  2D2Q A;  3BVZ A;  1AWD A;  3UIN B;  2KAN A;  4B9K A;  1PGB A;  1PGX A;  4LCD E;  2KHW B;  1LGR A;  5L83 A;  4LNK A;  2QIE B;  3L54 A;  2FIF A;  2ASQ A;  5CHV C;  4RNA A;  3B2G A;  3HIZ A;  4YWG G;  1FNV A;  3NY5 A;  4JL9 A;  4KGR A;  2WP9 B;  1KH0 A;  4BZA A;  1TY0 A;  3QK0 A;  1Z2M A;  3AE4 B;  1VJK A;  2ZEQ A;  2L83 A;  1FRR A;  4IOI E;  3VR8 B;  2D07 B;  3AE1 B;  3GZN I;  4A9A A;  4XZ4 A;  3DWG C;  2M0X A;  1WIA A;  2Y5B B;  1E6E B;  3AED B;  4KKI A;  4ACF A;  1FMA D;  1UWX A;  3B1L X;  1G6J A;  2KDI A;  1YMH E;  3GS2 A;  3KVF B;  4IC7 B;  2N0S B;  3ZTC A;  3TEY A;  2DAJ A;  2OJR A;  3E9S A;  3FC4 A;  2J42 A;  3L0W B;  4TQ0 A;  4TV3 A;  2WXK A;  1WE6 A;  3AE5 B;  3ZW3 A;  2GMI C;  2LHE A;  4Q2J A;  1I4R A;  4NAW B;  3SR6 A;  1Q1O A;  2K9X A;  5CHF A;  4DBG A;  2WXH A;  2MJD A;  4S17 A;  1I7H A;  5J18 A;  1ZGU B;  3R3M A;  4EZJ A;  4CQN A;  2KC2 A;  1K52 A;  3BYT B;  1XCT L;  4S0R A;  1WF9 A;  2Y5P A;  1NYQ A;  1ZXI A;  2AEH A;  2ZCC A;  4EKU A;  4M8N A;  2WDR B;  3RFZ B;  4K7W A;  1VD2 A;  2HTH A;  2LHD A;  4F1S A;  5BYQ A;  2CU3 A;  4NQL B;  4W9L A;  4PK1 A;  4LK0 M;  3QIJ A;  4AS1 A;  1DOX A;  2LZ6 A;  4NNJ B;  2AQ2 B;  3PSE B;  1EU4 A;  3PZD A;  4MT5 A;  4HPM B;  3CIR B;  4MM3 A;  2LMC A;  1WGD A;  5HFY A;  3H9D A;  2Z0E B;  1HA5 A;  1K51 A;  1V6E A;  2L1A A;  2N7J A;  3KH0 A;  5HG2 A;  4A20 A;  2DBY A;  2XK5 B;  1L6V A;  2NVU I;  2RD0 A;  2IPK D;  4IDI A;  2KMC A;  4ICU A;  3P4Q B;  4A90 A;  1WGH A;  4ANW A;  3Q3N C;  5KHO A;  2C9W B;  3SU8 X;  5E6J A;  2KAJ A;  3TUO A;  4KDI C;  2XBB C;  3NS8 A;  5DPW A;  1TZ1 A;  3N32 A;  3IFW B;  2W3S A;  3ZIM A;  1NVI D;  5H8Y E;  4BVU C;  2KJR A;  2BW2 A;  1VCB A;  3P2B A;  1F2R C;  1SEB D;  5G55 A;  4ICV A;  1D3Z A;  1Y8R C;  1EWC A;  3ZUN A;  3VQI A;  4RM9 A;  2KK8 A;  2BB5 A;  3BWU D;  3IBE A;  4J6I A;  4HDO A;  3ZLZ A;  5AZH A;  3RNC C;  4NAM A;  3GE8 C;  3MFG A;  4WWM A;  4AUQ C;  4IW0 A;  1SBB B;  3UI3 A;  3A1Q A;  2ZZP B;  2DZK A;  3KUD B;  4GB9 A;  4MEL A;  2QDF A;  5JHA A;  2KQS A;  4C7Y A;  3Q3J A;  5IN7 A;  4PYU A;  3KW5 B;  1V97 A;  2LEK A;  2FCQ A;  3RZW C;  4WJO A;  2L32 A;  4RF0 A;  2Y5C A;  4M8M A;  4M0W A;  3RYT A;  1MFW A;  2K22 A;  1PQS A;  2IYD B;  4C4V B;  3DBL I;  2G45 B;  2FAZ A;  2L52 A;  5FR6 A;  2V0G A;  1E8W A;  2HE7 A;  1IGC A;  2K25 A;  1ZUD 2;  2KDM A;  2E6X A;  3VFK A;  3PPA A;  1ET6 A;  2NR2 A;  5CHW A;  5D7G A;  3V05 A;  1HTO A;  5D3I B;  3AE7 B;  3UQA A;  3J9C A;  2FUG 1;  2DWQ A;  1V9J A;  1FIQ A;  2G3Q B;  2LWP A;  4NAW A;  4P16 A;  2WXQ A;  3PHW B;  3EEC A;  2FNJ B;  1UD7 A;  1ISN A;  4FA6 A;  2LGI A;  3CSF A;  1AN8 A;  1N62 A;  1SE9 A;  4JWS C;  4RGO S;  4FBJ B;  1R4N I;  3UIO B;  2JX5 A;  2J0K A;  3RD2 A;  3SFD B;  3UF8 A;  3IT4 B;  2WXF A;  3B9J A;  3RNB C;  3R7R A;  1WM3 A;  4RGT A;  2XEW A;  2DYM A;  2GBJ A;  3AE9 B;  4LLG M;  4G3X B;  3AV8 A;  3NVY A;  4DXG A;  4W9G A;  3L17 A;  5HKH A;  4R3D A;  2KZR A;  4LDT B;  4N58 A;  2CHW A;  3TEW A;  3P1M A;  2MRP A;  3DCG A;  2I1K A;  2JQR B;  3RMK C;  4BKS A;  5J2R A;  1C4C A;  1Q0W B;  2YEP B;  3ZJT A;  1VDV A;  4MJS B;  2WU5 B;  2JVC A;  4FUL A;  2B3A A;  1JWU D;  1IBX B;  1FFV A;  2ZW0 A;  2FUH B;  2QHO A;  3EC8 A;  1YNT E;  3FAH A;  1WJ6 A;  4GLS C;  3I5J C;  5EE1 A;  2PTL A;  1XO3 A;  3LJ3 A;  3X0W A;  1H4R A;  2NMQ A;  5BYR A;  2O6V A;  1E10 A;  1SSN A;  4WAA A;  2FID A;  3EUB 2;  2OHF A;  4I6P A;  3AI5 A;  2M1M A;  2XK5 A;  3R2T A;  1BT0 A;  3DVG X;  4MGZ E;  4RCO A;  3U8Z A;  1GC7 A;  2J52 A;  1AW7 A;  1EF5 A;  4BFR A;  1A70 A;  1N5X A;  2YVC A;  4TKN A;  4IWO A;  4ARC A;  1KFY B;  4LJP B;  2DZI A;  1WX8 A;  2WXP A;  1TT5 B;  1WX9 A;  3DQV A;  5CX3 A;  2WGS A;  4BOZ B;  3OJ4 B;  2KJH B;  1NI2 A;  4WH4 A;  1P1A A;  2LGD A;  2JUO A;  3NVV A;  3A1Q B;  3CF6 E;  1JCK B;  1TS3 A;  3MHZ A;  1V1P B;  3AEA B;  2V1Y A;  3K9P B;  3DHG C;  1P9D U;  1WXV A;  3L4P A;  1JWS D;  2X8X X;  1E7U A;  2UYZ B;  3RNA C;  3O13 A;  1QOG A;  2IGG A;  3R7Q A;  1PGA A;  4LDT D;  2MHJ A;  2QEJ C;  4P1B C;  2H88 B;  3KWL A;  1N6Z A;  1D5Z C;  1Y56 A;  3AE6 B;  1CMX B;  1QKZ A;  4W9E A;  4GDK A;  4OZC A;  4FJV B;  2CHX A;  4OZB A;  3AN1 A;  1LM8 B;  2DHZ A;  1GPX A;  2BF8 B;  4WJN A;  3ZJU A;  1TS4 A;  2HD5 B;  2NBV B;  4K1R B;  1TKY A;  4ZDV A;  3RI7 C;  4AP4 C;  3VUY A;  1T0Q C;  2LUM A;  3U7D A;  3PGE A;  1YQ4 B;  3FIL A;  3QWZ B;  3Q8E A;  3KUZ A;  4ZHP A;  2BWF A;  1YX5 B;  3V3X A;  2INP E;  1WGY A;  4LNI A;  4P6V F;  2ZPY A;  2IY0 B;  2ZJD A;  4C7Z A;  1GB4 A;  4GDL B;  2RMM A;  4F8C B;  2D3B A;  4XWW A;  2WLB A;  1ENF A;  1J0G A;  4GOC A;  4HKZ E;  5JZE B;  2PIA A;  3HUI A;  4P1C C;  4AJW A;  2WWZ A;  4ANX A;  2WXN A;  1D5M C;  4USA A;  2PPH A;  1WYG A;  1F9J A;  2BS3 B;  3AEF B;  2NCN A;  4IWP A;  1F1H A;  1E8Y A;  3A9J B;  1EO6 A;  1N63 A;  2JZP A;  2M56 B;  1TTN A;  1TS2 A;  4W9H A;  1HTQ A;  2MEK A;  3TMP B;  1I4H A;  2Z0D B;  3JVZ X;  3R8B A;  1BML C;  2IGH A;  5AZG A;  1WYW B;  2BYT A;  4FHJ A;  1C79 A;  3U52 E;  2M4N A;  2JZZ A;  2QCZ A;  1TZO A;  4HPP A;  4O1N A;  2N9L A;  1V1O A;  2J4X A;  4W9I A;  1A5R A;  2LXA A;  1SJE D;  3T3O A;  4OW0 A;  2I1J A;  1YJ1 A;  3MJ5 A;  2DX5 B;  2X38 A;  2KDF B;  3N20 C;  3PT2 B;  1E5W A;  1QOA A;  2SEB D;  1F77 A;  1GOZ A;  4HPL B;  3ZRC A;  2REX A;  3R66 C;  5IKC M;  3N30 A;  3AEB B;  3PO0 A;  3DBL B;  1WJ4 A;  1K53 A;  2D5G A;  1EWY C;  1HEZ E;  2GBM A;  1M94 A;  1E0Z A;  4K7U A;  2W55 A;  3PZ8 A;  5C23 A;  2O2V A;  5LXI B;  4IM0 A;  2KQ7 A;  2C60 A;  1EU3 A;  3ZYY X;  1VZ6 A;  2VH1 A;  1UUP A;  1STE A;  3V61 A;  1XEE A;  1FPY A;  1TGZ B;  3Q8F A;  2RDH A;  1WMH A; 
#chains in the Genus database with same CATH homology
 2BW2 A;  2Q5W D;  2WU2 B;  1WRI A;  4TQ1 A;  2I2Y A;  3AEE B;  2BS4 B;  1F0Z A;  1FD6 A;  1HQR D;  1MHH E;  1F2R C;  1SEB D;  4XE0 A;  4NJC A;  5AUK A;  1EWC A;  1GB1 A;  1FCC C;  3VQI A;  2JXT A;  4RF1 A;  1AYF A;  2BTE A;  1N5W A;  2BB5 A;  3BWU D;  2LJI A;  2JU6 X;  1TYG B;  2PLP A;  4NAM A;  2IDY A;  3MFG A;  4WWM A;  2WDV B;  1P7E A;  1NEK B;  1SE2 A;  3C8Y A;  3BK2 A;  1XF5 L;  1I4X A;  5EE3 A;  1SBB B;  5D3D A;  3U2S C;  4OZA A;  2WQY B;  3UI3 A;  2B76 B;  5FR3 A;  2MJ3 A;  1L0Y B;  4GDK B;  2RDG A;  1D4B A;  2ZW1 A;  5G5G A;  4YTN B;  2WXJ A;  2GRI A;  1YN5 A;  3BZD B;  1XXG A;  4PT5 A;  3NUH B;  1JWB D;  1C9F A;  1DOY A;  2INN E;  4ZHO A;  3KWV A;  1K50 A;  1ZDV A;  4C7Y A;  1V97 A;  4WQM A;  2EKI A;  4YTP B;  2LEK A;  2DYO A;  1ESF A;  5I4D A;  1ACC A;  2Z8L A;  2L32 A;  1ROE A;  4RF0 A;  1BUI C;  2Y5C A;  3EA6 A;  5JXV A;  1SB3 C;  4M0W A;  2AQ1 B;  2K22 A;  5AUI A;  3VR9 B;  2AX5 A;  2TSS A;  4XDC A;  1J7C A;  2KMM A;  3BVG A;  2L52 A;  5T8I A;  2V0G A;  1B9R A;  4J3O D;  2PVO D;  1VLB A;  2WDQ B;  1IGC A;  2MH7 A;  1ZUD 2;  4N59 A;  2KDM A;  2E6X A;  1V8C A;  3HVD A;  3P4S B;  1XCQ L;  1ET6 A;  1RM6 C;  4JE3 B;  5D7G A;  4N6E B;  3ZQ4 A;  3VRB B;  4ARI A;  3V05 A;  4MM3 B;  1JML A;  1XLN A;  3BYY B;  5D3I B;  3AE7 B;  3AB5 A;  3J9C A;  2FUG 1;  4DQO C;  2DWQ A;  1SE3 A;  3IT6 B;  1IGD A;  1TKG A;  3AE2 B;  3I57 A;  2OED A;  4KGT A;  1FIQ A;  4KGS A;  4OHJ A;  4EE2 A;  1WGK A;  1T6B X;  4P16 A;  2WXQ A;  4JWU C;  1HZ5 A;  2W54 A;  2VZK D;  1E9M A;  1M4V A;  3I9V 1;  1HXY D;  4OVZ A;  3BII D;  2LGI A;  1AN8 A;  4HRS A;  1N62 A;  4JWS C;  5H92 C;  4JPS A;  4RGO S;  2KAC A;  4YT0 B;  1MPE A;  1F2R I;  2JX5 A;  3SFD B;  3IT4 B;  2WXF A;  1OFF A;  3B9J A;  1GAQ B;  1N61 A;  1SE4 A;  4RGT A;  3TEX A;  1VR9 A;  1JAL A;  4ZRP A;  1XLP A;  2N9K A;  1EM7 A;  3MC0 B;  2DYM A;  1L0X B;  4WIP A;  1WWT A;  4C80 A;  3AE9 B;  4LLG M;  2MJE A;  1WSP A;  2VZK B;  4TSS A;  3AV8 A;  1FCL A;  3NVY A;  4DXG A;  4LTU A;  3IAM 1;  4R3D A;  2QJL A;  1SF0 A;  1ZOY B;  1N60 A;  2RPV A;  3NS1 A;  4N58 A;  3TEW A;  2WXL A;  4HKQ A;  1ZE3 D;  3P1M A;  3HVZ A;  1L6U A;  4C56 C;  2JQR B;  3GB1 A;  3KLS X;  1C4A A;  1C4C A;  2K5P A;  2YEP B;  3ZJT A;  1SIJ A;  5HI1 A;  1VDV A;  1JWA D;  5FK9 C;  1WXQ A;  1UNS A;  1TJE A;  1XLQ A;  1KLU D;  2WS3 B;  2K3U A;  5GXG B;  4JX1 C;  1ZXH A;  2WU5 B;  4KX6 B;  2GI9 A;  2ICI A;  4US9 A;  3AMZ A;  1C78 A;  1CJE A;  1L5P A;  2KN4 A;  3RPF C;  1JWU D;  2LFI A;  1IBX B;  1ZPS A;  1FFV A;  3NVW A;  1QLB B;  2ZW0 A;  3IXS A;  2M0A A;  2CJN A;  1YNT E;  3FAH A;  1KLG D;  1FRD A;  4GLS C;  1FXA A;  1FO4 A;  1KF6 B;  1MVK A;  1RYJ A;  2G9H D;  4KKJ A;  4XDD A;  1FXI A;  1OQQ A;  1PDX A;  5EE1 A;  2PTL A;  1XO3 A;  4A55 A;  5HHD G;  2JSV X;  1I4Q A;  2W82 A;  4YSZ B;  2NMQ A;  5BYR A;  1YN3 A;  1E10 A;  1SSN A;  2PKO A;  2CJO A;  1NEN B;  3P63 A;  3EUB 2;  1JQ4 A;  3OWE B;  2OHF A;  1YJJ A;  4ZYS A;  1JW9 D;  2ACZ B;  2BT6 A;  2W3R A;  1L4Z B;  1J7B A;  3R2T A;  2IJ0 A;  1E7P B;  2XNA C;  5EE0 A;  1JRO A;  4RCO A;  2WXG A;  1YQ3 B;  2J52 A;  1C4P A;  5G5H A;  1AW7 A;  1A70 A;  1N5X A;  3ZJV A;  1FM0 D;  3TSS A;  4ARC A;  4US8 A;  1KFY B;  4NZL B;  1QF6 A;  1UWM A;  4D2K A;  2XN9 C;  1JRP A;  3TEZ A;  3KQ4 A;  1JWM D;  2WXP A;  2FE8 A;  5LNK 1;  1MI0 A;  3MP9 A;  4L23 A;  2SAK A;  2E3T A;  5C3J B;  3Q69 A;  4TMA B;  2K0P A;  2GB1 A;  3NZ3 A;  4WH4 A;  1CQV A;  1DYQ A;  4ITK A;  3NVV A;  3BVM A;  1I4G A;  1JCK B;  4RFB A;  1TS3 A;  3MHZ A;  1V1P B;  3Q8A A;  1L4D B;  2FBW B;  3AEA B;  3AM9 A;  3W2D A;  1PYW D;  5BMG A;  3SEB A;  3L4P A;  4L1B A;  1MHX A;  1JWS D;  1OQR A;  1TY2 A;  5BYS A;  3O13 A;  3ETR A;  1QOG A;  2BB6 A;  4XWT A;  2IGG A;  1Q10 A;  5TSS A;  3LYY A;  1PGA A;  4MAC A;  2JWU A;  2HTM E;  2KWD A;  1CK1 A;  1QOF A;  2QEJ C;  1IUE A;  2H88 B;  3KWL A;  1KRH A;  3ZGZ A;  2ONQ A;  1CZP A;  4YXD B;  2R61 A;  3U4E G;  1D5Z C;  3DWM A;  3W1S A;  4UDU C;  1Y56 A;  3AE6 B;  3BVZ A;  1AWD A;  4L2Y A;  2WXR A;  4B0E A;  1QKZ A;  4OZC A;  1PGB A;  1PGX A;  1PUT A;  4OZB A;  3AN1 A;  4YTM B;  3H8H A;  2V3P A;  4HJG E;  3E56 A;  1UGJ A;  1GPX A;  5MPO A;  3ZJU A;  3P4R B;  2QIE B;  1DGJ A;  1TS4 A;  2QIL A;  3URY A;  4H2A A;  1TKY A;  2IGD A;  4RNA A;  3B2G A;  2LUM A;  4IKG A;  4YWG G;  1FNV A;  4A6Q A;  1ZP0 B;  5BMI A;  2I38 A;  4KGR A;  1D6E C;  1YQ4 B;  2WP9 B;  3FIL A;  2BBC A;  1KH0 A;  3N9Y C;  3WCQ A;  1TY0 A;  3W5V B;  3AE3 B;  1J7A A;  1FNW A;  3Q8E A;  2Y3A A;  1BXT A;  1ZDX A;  2G1E A;  4ZHP A;  3V3X A;  2INP E;  3AE4 B;  1VJK A;  4P6V F;  4AQ7 A;  1IBX A;  2L83 A;  1FEH A;  1FRR A;  4IOI E;  3AH7 A;  4RGN A;  3VR8 B;  3AE1 B;  4C7Z A;  4GDL B;  1GB4 A;  2RMM A;  2JYT A;  3P42 A;  4A9A A;  4XWW A;  1QT9 A;  2PMV A;  2WLB A;  3DWG C;  3Q8C A;  2KQ4 X;  1ENF A;  3AED B;  1E6E B;  4KKI A;  3EGR A;  3R2I A;  4HKZ E;  5BMH A;  2H89 B;  1FMA D;  1QIL A;  3LXF A;  3AEC B;  2PIA A;  1UWX A;  1C76 A;  3AEG B;  4RGM A;  1YMH E;  1ET9 A;  2PVG C;  3HUI A;  2WNM A;  3GS2 A;  3NRZ A;  2N0S B;  1VZ7 A;  2BS2 B;  1RWS A;  1D5M C;  2WXN A;  4USA A;  3TEY A;  4FXC A;  1WYG A;  3E9S A;  1YJI A;  2BS3 B;  2J42 A;  3FC4 A;  4TQ0 A;  3AEF B;  2WXK A;  3AE5 B;  2LHE A;  4Q2J A;  1I4R A;  4NAW B;  1N63 A;  2JZP A;  4DXF A;  3SR6 A;  2M56 B;  1TS2 A;  2WXM A;  1D5X C;  2K9X A;  2WXH A;  2MJD A;  4YSY B;  2HDE A;  2MEK A;  1SJH D;  1I7H A;  1I4H A;  1YN4 A;  4CQN A;  2QMT A;  1BML C;  2IGH A;  3R8B A;  2J53 A;  1K52 A;  1QQR A;  2BYT A;  3BYT B;  1XCT L;  1QOB A;  1C79 A;  3U52 E;  2Y5P A;  1NYQ A;  1TZO A;  1ZXI A;  4O1N A;  2NTT A;  2N9L A;  2WDR B;  1NI3 A;  1V1O A;  2J4X A;  4HRO A;  1NYR A;  3RFZ B;  4REZ A;  1SJE D;  2LHD A;  2M19 A;  3T3O A;  4OW0 A;  5BYQ A;  1VZ8 A;  4HEA 1;  2QSD A;  3HRD D;  2JYE A;  3P4P B;  4ZRQ A;  4B0M A;  2CU3 A;  3MJ5 A;  3T3N A;  1V1P A;  1B1Z A;  1XLO A;  4YSX B;  4LK0 M;  1SXT A;  1LO5 D;  3PZ7 A;  3BK1 A;  3SFE B;  4AS1 A;  1DOX A;  5FKA C;  1PFD A;  2X38 A;  2AQ2 B;  1EU4 A;  4ZOH C;  4A8X C;  4MT5 A;  2PW9 A;  2AQ3 B;  3CIR B;  3LB8 C;  2NTS A;  2YEP F;  1QOA A;  2SEB D;  3NVZ A;  1F77 A;  1GOZ A;  2LMC A;  2EEL A;  5HFY A;  2WXO A;  3VRA B;  3ABV B;  1HA5 A;  1K51 A;  1T3Q A;  2N7J A;  1FFU A;  2L1A A;  2V4I B;  1VRA B;  4WUR A;  3AEB B;  5C2T B;  3PO0 A;  5HG2 A;  2DBY A;  1HZ6 A;  4WAF A;  1L6V A;  1T5X D;  5EE9 A;  1K53 A;  3W9C B;  3GP7 A;  2D5G A;  1EWY C;  1L0V B;  1P7F A;  2IPK D;  1HEZ E;  4RH6 A;  1TS5 A;  3IAS 1;  4IDI A;  3W5U B;  1E0Z A;  1R7S A;  1RFK A;  2ON8 A;  3P4Q B;  1KTK A;  4A90 A;  2W55 A;  1FNU A;  3AE8 B;  3PZ8 A;  1I4P A;  2DLB A;  1TKE A;  5E6J A;  2KAJ A;  3TUO A;  1EU3 A;  3ZYY X;  1C77 A;  1VZ6 A;  3FIL B;  3Q8B A;  1UUP A;  3CWI A;  4MH8 A;  1STE A;  2V3N A;  1XEE A;  2W3S A;  1NVI D;  1DOI A;  3Q8F A;  5H8Y E;  3B2F A;  2WXI A;  2RDH A;  3U7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...