2JYTA

Human granulin c, isomer 1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
VPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granulin-5
publication title Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00396 Granulin Granulin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.500 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jytA00
2JYTA 2JYEA
chains in the Genus database with same CATH superfamily
5D3DA 4K7UA 2ZVNA 1V2YA 2WP9B 4EZKA 3TEYA 2GOWA 3IHPC 2PVGC 1WH3A 1L0XB 3SEBA 3A9KA 1T0YA 3Q8BA 4OZBA 3RN9C 3L54A 4O1NA 2BW2A 1VCBA 5CTRC 3LXFA 3RZFA 2IPKD 4M0WA 1LM8B 2KTRA 3U8ZA 2EMSA 3ALBA 2PPHA 1I4XA 4R3DA 1HZ6A 2L0FA 4CO7A 2IGHA 4FLHA 2WXMA 1Z5SB 4GB9A 4TKNA 1IUEA 1H4RA 3QK0A 3T9LA 5AZGA 1P7FA 2GBMA 3DBSA 2YVCA 4EZJA 5KHOA 1Q5WB 1D5ZC 2L00B 1STEA 4BVUC 3KYCD 4BAXA 3QC8B 1TKGA 4F1SA 2CHWA 2KANA 1WGHA 2KMMA 3DHGC 2PW9A 5L95C 1JWBD 4YXDB 1MG4A 4EFOA 2KAJA 1QLBB 1DYQA 1FD6A 1JWSD 4GU2A 4G3XB 3RNBC 5J18A 4GMVA 4JIOU 4HDQA 2WXIA 3AMZA 4IUMB 1F9JA 4HJKA 2BYFA 2MBQA 4RM8A 1WSPA 2LHEA 4WJPA 2M4NA 4C7ZA 2KFJA 2KVZA 4OVZA 5DPRA 3W2DA 1JWUD 4A9AA 3CIRB 2IZVB 4B95A 1BMLC 4IM0A 3MFGA 1OQYA 4F8CB 3GS2A 4MGKE 1C4CA 2KOXA 3X0WA 4BKSA 2IO2B 4FADA 1V8CA 1ZKHA 1J8CA 2JWZA 1VDVA 3SFEB 3DOWA 4WWPA 2WXQA 4W9IA 5IP4D 1SIJA 4C4VB 1I4QA 2ZNVB 4A20A 3ZNID 1N5XA 2IYDB 3Q3FA 4YL8A 4HLEA 4NAWA 3HUIA 4BOSC 3QQ8B 4IM2A 5BMHA 4US8A 3Q6BA 1AWDA 1SB3C 1WFYA 2DYOA 2KC1A 1WX8A 1UBIA 1UWXA 2KN5A 2DYMA 2BB5A 2MHJA 4AP4C 4AS1A 4IWPA 2J52A 3X23A 4W9FA 1WE6A 3K9OB 1P1AA 1E8XA 1LO5D 3Q8EA 5EE3A 4ANUA 4IDIA 1FIQA 2L76A 3HVDA 4K3CA 5TSSA 1ACCA 4AJWA 1L2NA 1GOZA 1SSNA 2WDVB 3RNAC 1A5RA 2G4DB 2NCNA 2KQ4X 4YTMB 1UGJA 3FILA 3VDZA 3WAMA 1NI2A 3N9YC 3U2SC 4DHJD 2OHFA 1NI3A 3GZNB 1OEYA 2KZRA 3B2FA 1GG3A 4S0RA 5D94A 1MPEA 2SEBD 2G4SA 1ENFA 2CHXA 5G5GA 1E7UA 2GLSA 3TEWA 4DXAB 2AQ2B 2W3SA 1MHXA 1XLPA 4KX6B 2L8JA 3OWEB 4EUTA 4KGSA 1TGZB 5TR5A 3DBHB 2RPVA 3N1ZC 2MEKA 1MI0A 3RD2A 2MP2B 4DHZE 3PRPB 2ASQA 1QQRA 3I63C 1VZ8A 5FK9C 3H7SA 1WRDB 1VLBA 4MDKE 3RUIB 3WANA 2ON8A 2JX5A 2INCC 1OEYJ 3VAWA 3AE5B 2LFIA 4IWQA 3PZDA 1D4BA 2LGIA 1I42A 4TQ1A 4MSMB 3AE8B 3NRZA 5BYQA 2WXJA 3W5UB 4HCNB 2AQ1B 4XE0A 4WH4A 2L83A 4NJCA 2I1JA 3A33B 1RWSA 3DWMA 3IAM1 5C2TB 3IAS1 2IBIB 2DBYA 2WU5B 3AN1A 4XDDA 2DAFA 4I6PA 4DQOC 2KTFA 4KKIA 1L4ZB 1ZXHA 4F7ZA 1HZ5A 2GBNA 3VXWA 3KWLA 1N61A 4C4VA 5LNK1 3S2AA 1JWAD 3VQIA 4NY0A 4A3PA 4JWUC 4YSXB 3KW5B 4C7YA 3CMMB 4X57B 1TBEA 2RDBC 1N62A 4KSLC 1UD7A 1YJJA 1WGKA 1HXYD 3NOBA 1WGGA 4KZ0A 4G11A 1FO4A 3WCQA 1FCCC 2EMTA 3N1XC 2REXA 2GBKA 1TY0A 4EEWA 2FIFA 2XBBC 4M02A 2XN9C 4GXBA 1MG8A 4RGTA 1UGMA 4N9F4 2LUMA 5HHDG 4YTPB 3IT6B 3NZSA 1FPYA 1QOGA 4AWJA 3AEFB 2BGFA 2CJOA 1U4AA 2O6VB 3PHXB 2RGFA 4PK1A 2XNAC 4K7SA 2ONQA 2ZNVC 4BBNC 2M1MA 2WX1A 3NVVA 2FUHB 3ZVVA 2IY1B 2KVRA 3EGRA 3V3XA 5CHFA 2KWDA 1EF1A 3E9SA 1ZPSA 2KD0A 3PHWB 4ACFA 3OLMD 1N5WA 2MSED 2FIDA 1XEEA 1Q0WB 3AV8A 3HVZA 2KX3A 4ARCA 1B1ZA 4B0MA 1QOAA 4RFBA 1K8RB 2LJIA 1ZUD2 1RFKA 2N9XA 2NBVB 2RSUA 1L0VB 4NJ6A 1UH6A 4WWMA 1JALA 1NVID 3U7ZA 3QHTA 2KDEB 2N9EB 4XGAB 4ZRIA 2BBCA 1KLVA 1FRRA 3BVZA 2WNMA 1PUTA 1ROEA 2NBUA 5FR6A 2QSDA 3SR6A 3NJTA 3Q14C 2MJDA 4LJPB 3UIPB 4HRSA 1CK1A 4YSZB 3IT4B 1MVKA 1IBXB 1FFUA 2MQJA 1HTQA 1OQQA 2EKIA 5J2RA 2RD0A 1WM3A 3P63A 3CF6E 2LASA 2J0MA 2G9HD 2WDTB 2OJRA 1C1YB 4XWWA 4NJ7A 1UF0A 1E90A 3PV1A 1VZ7A 1ZW7A 1E0ZA 1TZOA 2BF8B 3WALA 2JY6A 5EDSA 3VFKA 1VZ6A 3SHQA 1FM0D 4YSYB 2MBBB 2V3NA 3RNGC 3J9CA 3HHMA 2JZZA 3ZTCA 2D3BA 4DWFA 3NS8A 3IBEA 1NYQA 4MSQB 4W9DA 1ESFA 5BYSA 2LRWA 2BWES 2QDFA 2WGSA 1RAXA 1NDDA 2N1VA 2D3GA 4MJSA 5E6PA 1EF5A 1K53A 4W9CA 2MCNB 1WGDA 5BMIA 2GMIC 3VHTC 3V60A 4MELA 4USAA 3KUDB 2IY0B 2BS4B 4PT5A 5DPSA 1WRIA 3Q3NC 1JRUA 2O6VA 3LB8C 2RMMA 4WJQA 1ZE3D 5CHVC 1PDXA 3H1UA 1GJZA 3AE6B 1N6ZA 2KXJA 1IGCA 1CZPA 3BK2A 3QCAA 1XLQA 2K8BA 4N58A 2X8XX 1D6EC 3AXCA 4ARIA 3UGBB 1WMHB 2PE9A 4GN1A 1E6EB 3EFCA 3SD5A 4IWOA 4K3BA 1WE7A 3I9V1 4L23A 3OG5A 1P0RA 3JVZX 1UBQA 2QILA 4MGZE 3ZKJC 4P1BC 5GMVA 2LGDA 5G5HA 1E8WA 2VH1A 2MBHA 1KRHA 3H6NA 2NPTB 2MJ3A 4NZLB 3AE1B 1WXAA 3APDA 1IBXA 2WDQB 3ZJTA 3PSEB 3TBLD 1CQVA 3TSSA 1I7HA 2I38A 3GE8C 3NHEB 1AYFA 2DENB 4W9KA 4JWSC 1C77A 2VRRB 3FILB 3L4PA 1CJEA 2K8HA 1V1OA 5KHQA 3SFDB 4ASWC 1WXSA 4MT5A 4YWGG 1SE9A 3N30A 1KF6B 3ZJUA 4DK5A 2K22A 4BKGA 2CS4A 1IP9A 3PTFC 4RM9A 2KQ7A 3MP9A 4ZRPA 1QKZA 2JQRB 1WWTA 3P4PB 3EUB2 1F0ZA 3QX1A 2XEWA 4ZHPA 3PZ7A 4RGOS 1TS4A 3A4SC 3PPAA 4B9KA 1D5MC 4ZYNA 1XLNA 3JSVB 3APFA 5C1ZA 3M63B 3ETRA 5BYRA 4N6EB 1KFYB 2RR9A 2MW5A 3AH7A 4BBNF 4DXGA 4E74A 4DDID 3RNEC 2UU7A 1WJNA 4TUUA 4ANWA 4WJOA 3WA0A 1TKYA 1QZEA 1WJ6A 2N7JA 3APCA 2ZVOA 5EE1A 2WXGA 1YNTE 1WYGA 5AEKB 1WXMA 1GPXA 2W55A 2IO3B 1JW9D 3L10B 2HE7A 1I4HA 2QIEB 2J7QB 4LCDE 1AW7A 2GBRA 4CQNA 2WXRA 3AULA 1QT9A 1YQBA 2MLBA 1MFWA 2X38A 4TSSA 2FCNA 3UF8A 5T8IA 1WMHA 3GZNI 2EKEC 3DBRB 1P9DU 4PS8A 2JF5A 1XCTL 1L5PA 4W9JA 2KWCA 3B9JA 1YJIA 1L6UA 3A9JB 1SE2A 3R2TA 2JXTA 4HVBA 2PVOD 3PLUA 3VR9B 4TV3A 4OZAA 2BT6A 2KK8A 2NBWB 1I4PA 1TKEA 3KVFB 4FULA 3PT2B 3UIOB 1GNUA 4HDOA 3P4RB 3DCGA 2NPTA 2Q5WD 1GB4A 2DHZA 4ITKA 4IG7B 4PYUA 2VZKB 1ZDXA 2CR5A 4URKA 3NZ3A 2CU3A 4W9EA 2DNFA 2LJ5A 4CYEA 1ISNA 2NVUI 3AU4A 4J6IA 2AQ3B 4W9GA 4HJGE 2R2OA 2G3QB 3ZNZB 4LDTB 2DZJA 5D3IB 4LNKA 1JCKB 3ZGZA 2K0PA 2Z59B 4AJYB 3BVGA 3DWGC 1Q10A 1KJTA 2V4IB 1ET6A 4ANXA 1EO6A 2CHZA 4BKSD 1WX7A 2C7HA 3OJ4B 1YQ4B 2UWQA 2C7NB 2GBJA 3KUCB 1UNSA 4G0NB 2QCZA 4NPNA 2NMQA 2KDBA 2BKRB 4FA6A 2D3AA 2INDC 3NY5A 3JSVA 1EWYC 2KWVB 4E71A 3FC4A 5IOIA 1L6VA 4G50A 1F52A 4HPMB 2KO3A 4A90A 3MHSD 3MJWA 5EE9A 2JZPA 4WAAA 3ZIMA 1QOFA 3NS1A 3AE4B 3QA8A 3P4QB 3PREA 2KX0A 4OVUA 3GE3C 1YQ3B 1SGHA 4IM3A 2M56B 4MH0E 1TS3A 2PEAA 3ZXRA 1V5TA 1CMXB 1SEBD 2HTHA 4I6LB 2BB6A 3AM9A 3V62A 4GDLA 1E9MA 2MX2A 3U30A 1FXIA 4JGHB 1J19A 1LXDA 2H88B 3BVMA 3BIID 2DZKA 4XZ4A 2JWUA 2LGYA 2I2YA 3HRDD 1T3QA 4EKUA 2W9NA 1FNUA 3RT3B 1I35A 1HE8A 3RMKC 2DZIA 2ZPNA 1SE4A 2DYBA 3GB1A 2G1EA 1OGWA 3AB5A 1WM2A 2JT4B 2BYTA 3O13A 3A9JA 4DXFA 3VUXA 3PZ8A 1R4MB 2BS2B 2BQQA 1X1MA 5E6JA 2N1WA 4MJSB 2KT7A 5C23A 1IGDA 5JH5C 1WF9A 2M0XA 1WX9A 2CU1A 1L7YA 3WAPA 3W1SA 4LNNA 2W54A 2BYEA 2ZW1A 2LEKA 5LLIA 2D5GA 1E7PB 3R7QA 3V6EB 3HK0A 5E6NA 4KGTA 4GGQA 1Z2MA 4MH8A 3TUOA 4W9HA 1SBBB 2LD9A 3ZQ4A 1E7VA 2OEDA 1WGRA 2J42A 1RLFA 1N63A 4LNFA 3IXSA 4KIKA 3H9DA 3MJ5A 2MH7A 2J0KA 4EOYA 4MGYE 2LHDA 1R4NB 1JROA 3T3OA 2LRUA 3PRZA 2JVCA 1IPGA 2AX5A 2K8CA 2LZ6A 1PGBA 1SIFA 1TY2A 2J53A 5AZHA 4XYCA 5HFYA 4IOIE 4JE3B 1VJKA 4RMAA 2LXCA 5L83A 2AEHA 3ENEA 3NUHB 4REZA 2NTTA 4BFRA 4JQWC 3RI7C 1SJED 3ZDTA 1JWMD 2DX5B 2NTSA 3KH0A 3VVWB 2DZMA 3ZDMC 4WWOA 5BMGA 3VH4B 1KOTA 3QARA 5CX3A 3HM6X 4C56C 2H89B 4HXDA 3DDCB 2KNBA 4KDIC 3VRBB 1TZ1A 1YOVB 4HKQA 1J7BA 4JPSA 2ZJDA 1TS5A 5LXIB 1WR6E 4HPPA 1QF6A 4BKTA 1SE3A 4CHKA 3ZTDA 1HQRD 5E6OA 2BVCA 4XWTA 1C9FA 2D07B 2PLPA 4J3OD 1S3SG 4KVGB 4MACA 3VTUA 4KDLB 4TQ0A 1UWMA 2E6XA 4II2B 2JRHA 3AEAB 2BPSA 3QAQA 2JZ3B 4PYZA 1YMHE 2BTEA 2BKFA 3IG3A 4OW0A 3P42A 5JZEB 2LUEA 4JLCA 3W5VB 3EHVA 4C80A 4ANVA 3QJZA 1Y56A 1TTNA 1B9RA 4WJNA 3H7PB 2RPQA 3ECIA 3ZO5B 3N3KB 4P7IA 1T0QC 2N9LA 1P98A 2L7RA 2MJEA 2L0TA 2DWQA 4WURA 1T5XD 2TSSA 4EZLA 4QAYA 3EECA 2N7DA 5G55A 1NYRA 1E8ZA 2M17A 2AL6A 4ICUA 1ZP0B 3M3JA 2LXAA 1N60A 2WLBA 1WJ4A 4HPLB 3K9PB 4FN2A 4RGNA 3PS6A 1F2RC 1OFFA 3MC0B 2ZW0A 2J0JA 2PJHA 5D2MB 4WIPA 4OZCA 4LTUA 2FAZA 2XK5A 1C4PA 2V9HA 3L17A 4PS7A 5DPWA 1OQRA 3VTVA 4XDCA 2LGSA 2QEJC 1V80A 4P6VF 1EM7A 1PGAA 5G2NA 3V6CB 3U4EG 3KQ4A 4D2KA 1VR9A 3M62B 2WXFA 2QMTA 3MTNB 4FJVB 5J17A 2KFKB 4YTNB 2YEPB 1E10A 1ZGUB 2KLGA 1V9JA 2JU6X 2ZCCA 4RGMA 1V81A 4ZYSA 4RH6A 3AE9B 3N20C 3Q69A 1TS2A 1GC6A 3DBLB 3W9CB 1KLUD 1WJUA 1WXVA 3AEBB 2Z8LA 3ONSA 2N9KA 3VRAB 2I1KA 1GB1A 1V1PA 3D32A 2IGDA 3CSTA 2CJNA 2YLMA 3TCAA 4EE2A 3P1MA 4BZAA 4YT0B 2K5PA 1ZDVA 2CKHB 1F77A 4K7WA 3IFWB 2O6VD 2VH2A 1BT0A 4H2AA 2MBOA 3FAHA 4HWIB 2K3UA 2FUG1 1LQBA 1H8CA 4PS3A 2ZEQA 4GLSC 3NZUA 1C76A 4A8XC 1KM7A 4S17A 2JUOA 3BYYB 3R3MA 3PLVA 3DBRI 4KZCA 1VD2A 3U7DA 3KYDD 3MC8A 3H7PA 5GXGB 1NENB 4KGRA 1NBFC 2PMVA 1M94A 1PFDA 4AOFA 2JRIB 2HJ8A 3H8HA 1J0GA 4ICVA 4FXCA 1J7CA 2HTME 2KKCA 2MBEA 3DHIC 2Y5PA 2K1FA 5EE0A 2KJHB 1M4VA 3P2BA 1WY8A 3Q8AA 3RZWC 4GDLB 1DGJA 2BWFA 3WAOA 2KDFB 1QILA 2DLBA 1JMLA 2WU2B 4Q2JA 2V1YA 4A55A 3SDLC 2QHOA 1NEKB 3SU8X 3L0WB 3VH3B 3FKYA 3R8BA 4UDUC 1S1QB 4HK2A 2LGXA 2W3RA 3T8MA 2WWZA 4WQOB 1ZXIA 4HEA1 3RCZA 1V6EA 3QIJA 4II3B 2K9XA 4MGIE 2C60A 1MHHE 1SXTA 2KFKA 1E5WA 3DVGX 1FEHA 2WXPA 3UI3A 2OOBB 3ZXVA 4RF1A 2MWSB 2NR2A 4IC7B 4FHJA 3DBHI 3I57A 4A6QA 2Z0EB 1BUIC 3KWVA 3B08A 3MC9A 5I4DA 3ZRCA 5H8YE 1JRPA 4HCPB 3JYUA 4P16A 3Q8CA 1IYFA 1V49A 4US9A 2UYZB 2FBWB 1KH0A 1D3ZA 4ZRQA 1KTKA 1RFAA 4RNAA 2GB1A 4A3OA 5DPTA 2GI9A 3U52E 3DVNV 1DOXA 4FBJB 3AEEB 2IJ0A 2R2QA 3OAWA 4LK0M 1SJHD 1C3TA 3ML8A 2INPE 4M8NA 1E8YA 5D6JB 5HI1A 3BY4B 3VR8B 1I4RA 4KIKB 2ACZB 3C8YA 1YN4A 2JPHA 4DHZB 2WXOA 3KLSX 3DVGY 4E3CA 2HD5B 2Y3AA 4W9LA 2Z0DB 3TEZA 3ZLZA 3PRMB 3RULA 2NS5A 3T3NA 3IVFA 2KLCA 3TMPB 1YX5B 2O2VB 3HIZA 2W82A 4GOCA 1HA5A 2C7MB 2KACA 2R61A 2KN4A 3E56A 1F2RI 1FXTB 2J4XA 2M0AA 2JSVX 4RF0A 2WDRB 1R7SA 1YX6B 2WXHA 2BS3B 1C4AA 2D3CA 3V61A 1C78A 1R4MI 4GIVA 1WYWB 2KC2A 2IDYA 3ZUNA 1PGXA 1V97A 3BINA 1T0SC 4DBGA 2M8SA 2M19A 1WI0A 3Q3JA 4M00A 5LXHA 2ZZPB 3EA6A 5FKAC 4WQMA 2L05A 3LYYA 3Q2AC 3NVWA 1WGYA 2MA9B 3Q3OC 2A4ZA 2IGGA 3GOEA 5DCNA 2N9PC 2LVQA 3BK1A 4JX1C 4K81A 3ML9A 1GC7A 2LVOA 3EC8A 3W1YA 3TEXA 3UQBA 2LVPA 3KUZA 3Q8FA 2L3ZA 1L0YB 2RDHA 2WS3B 2D11A 2KDIA 3NG0A 3PO0A 2ZPYA 3DPDA 3L08A 3VUYA 3L16A 1T0RC 4B0EA 1R4NI 1YN3A 4NAMA 1WXQA 3PVLA 1WZ3A 2D10A 1WR1A 1J7AA 1FFVA 4LNIA 3GP7A 1TJEA 2BYVE 2B3AA 1XF5L 5D7GA 5FR3A 2FCMA 2KMAA 4K1RB 4MEMA 2D2QA 1D5XC 4HKZE 1YN5A 4M01A 3R7RA 1L4DB 2HJ1A 1K52A 1LGRA 3L13A 2KMCA 5H92C 4ZOHC 1AARA 3BZDB 4FJZA 1F1HA 5IAAC 2QC8A 3I5JC 2Y5CA 1WIAA 2L32A 2OJWA 4JL9A 1I4GA 1P3QU 1RYJA 2EELA 3JW0X 3B2GA 2PTLA 1KLGD 5JHBA 1WZ0A 5CHWA 3N32A 3HM3A 4MM3B 3R2IA 2FCQA 2XK5B 1XO3A 2FE8A 1QOBA 2WHIA 3AECB 2A5UA 3Q3MC 1ZOYB 2AL3A 4GDKB 3RNCC 2K39A 3C0RB 3DHHC 3EFUA 3WIMA 2PIAA 2IO0B 3A1QB 5HG2A 4ZDVA 2SAKA 1HEZE 4NNJB 4DDGD 3RYTA 2O2VA 2DAJA 2JXXA 4FHKA 3W1SC 5JHAA 3AE7B 2V0GA 3NVZA 3O65B 1JQ4A 3A4RA 1SF0A 3NVYA 3LDZE 1RM6C 3DVNU 4WAFA 2AYOB 3B1LX 1FNWA 2AWTA 1Y8RC 2E3TA 2HDEA 1V86A 5HKHA 1XD3B 1XLOA 2JYTA 5IN7A 2MP2A 4B6WA 4I6NB 1V1PB 2FCSA 3CWIA 3BWUD 1FRDA 2INNE 2KJ6A 1FNVA 3URYA 4M8MA 2G45B 1YJ1A 3M95A 4NQLB 2ZCBA 4XX5A 2VZKD 4KSKC 5C3JB 2C9WB 2WQYB 3A9KB 1XCQL 4L2YA 1FCLA 2C5LC 1UELA 5IO9A 3UINB 3TJPA 3AEGB 2V3SA 4HROA 4P1CC 2KQSA 3I3TB 3B0AA 4AUQC 4L1BA 3AEDB 3ABVB 4LDTD 4M0WB 4LLGM 5AUKA 2K25A 2KTRB 1EU3A 1FMAD 2WXKA 4KKJA 1Q1OA 3P4SB 4NQKE 3V05A 4RCOA 2KJRA 2PKOA 4KV2A 3ZW3A 5AUIA 4IW0A 1DOIA 4OVVA 1OTRB 1G6JA 4C00A 2KWUB 3AE2B 1FXAA 3RNFC 1UZXB 2FNJB 4LNOA 2KYWA 2LWPA 2L1AA 1T6BX 2Y5BB 4IKGA 2QJLA 3QWZB 2K6DB 1DOYA 1K51A 2B76B 4XC2A 2RDGA 2LI5A 3DBLI 3BYTB 3N1YC 2PE6B 2WYQA 4TMAB 2YEPF 2KHWB 2WX0A 4WWNA 1PYWD 2N0SB 3PGEA 3RPFC 3LJ3A 1PQSA 4AQ7A 5JXVA 1LFDA 1C79A 3R66C 4LJOB 1BXTA 2L52A 1TIFA 4MM3A 2WXLA 1A70A 3AE3B 1RRBA 4FJYA 1XXGA 3ZYYX 5IA7A 3C19A 2V4LA 2V3PA 5AZFA 2GRIA 4BOZB 4DHJB 4GDKA 4ZRKA 1TYGB 1MJDA 3TIXA 1HTOA 3A1QA 1TT5B 2LMCA 3ZNHB 5IKCM 1EWCA 3MHZA 5BO4B 2IO1B 5MPOA 2KDMA 1EUVB 3AI5A 1P7EA 1XQQA 3CSFA 1YIWA 3TL5A 3DQVA 3ZNGC 4ZRJA 4ZHOA 1YD8U 2ICIA 3VUWA 3VTWA 3ZRFA 1GUAB 4NAWB 1AN8A 3OJ3A 1GAQB 1UUPA 2N4FA 4N59A 3AU5A 1ET9A 3RFZB 1EU4A 2JYEA 1V5OA 2WXNA 3UQAA 1VRAB 4GSWA 4OHJA 2K6QA 2N7EA 1XT9B 1K50A 3ZJVA 2MRPA
chains in the Genus database with same CATH topology
1SE4A 5D3DA 4XWWA 2WP9B 3GB1A 5I4DA 2G1EA 5H8YE 1JRPA 3TEYA 3AB5A 4P16A 3Q8CA 2PVGC 2BYTA 1L0XB 3O13A 3SEBA 4DXFA 4US9A 3PZ8A 2FBWB 1KH0A 1VZ7A 1E0ZA 1TZOA 3Q8BA 2BS2B 4ZRQA 1KTKA 4OZBA 4O1NA 4RNAA 5E6JA 2GB1A 2BW2A 2GI9A 3U52E 1VZ6A 1DOXA 1FM0D 3AEEB 2IJ0A 3LXFA 1IGDA 4YSYB 2V3NA 4LK0M 2IPKD 4M0WA 1SJHD 3J9CA 2INPE 5HI1A 3W1SA 3VR8B 1NYQA 1I4RA 1ESFA 5BYSA 2W54A 2ZW1A 2ACZB 1I4XA 2LEKA 4R3DA 1HZ6A 3C8YA 1YN4A 2WXOA 2D5GA 1E7PB 2IGHA 3KLSX 2WXMA 1K53A 4KGTA 1IUEA 4MH8A 2Y3AA 3TUOA 3TEZA 1P7FA 1SBBB 3ZQ4A 2OEDA 3T3NA 5BMIA 2J42A 1N63A 3IXSA 2W82A 4USAA 3MJ5A 2BS4B 2MH7A 4PT5A 1HA5A 1WRIA 2KACA 2KN4A 2R61A 1D5ZC 3E56A 1STEA 2LHDA 1TKGA 1F2RI 2J4XA 2M0AA 2KMMA 2JSVX 3LB8C 4RF0A 2PW9A 2RMMA 1JROA 3T3OA 1JWBD 4YXDB 1ZE3D 2WDRB 1R7SA 2KAJA 2WXHA 2AX5A 1QLBB 1DYQA 1FD6A 1PDXA 2BS3B 1PGBA 1C4AA 1JWSD 1TY2A 1C78A 2J53A 3AE6B 2IDYA 5HFYA 4IOIE 1PGXA 1IGCA 1V97A 4JE3B 1VJKA 1CZPA 2WXIA 3AMZA 2M19A 3BK2A 1WSPA 1XLQA 2LHEA 3NUHB 4REZA 4N58A 2NTTA 3EA6A 4C7ZA 5FKAC 4WQMA 1D6EC 1SJED 4OVZA 3LYYA 3W2DA 3NVWA 4ARIA 1JWUD 4A9AA 1JWMD 3CIRB 2NTSA 1BMLC 1E6EB 3MFGA 2IGGA 3GS2A 1C4CA 3BK1A 5BMGA 3I9V1 4JX1C 4L23A 4C56C 2H89B 3TEXA 1V8CA 1VDVA 3Q8FA 3SFEB 2QILA 2WXQA 1L0YB 1SIJA 2RDHA 2WS3B 1I4QA 5G5HA 3PO0A 1N5XA 3VRBB 4HKQA 1J7BA 1KRHA 4JPSA 1TS5A 2MJ3A 4NZLB 3HUIA 1QF6A 3AE1B 1SE3A 5BMHA 4B0EA 4US8A 1AWDA 1IBXA 2WDQB 1HQRD 1YN3A 4XWTA 1SB3C 1C9FA 4NAMA 1WXQA 2DYOA 2PLPA 3ZJTA 4J3OD 1CQVA 1J7AA 4MACA 1FFVA 3GP7A 1TJEA 3TSSA 1I7HA 2I38A 1UWMA 1XF5L 2E6XA 1UWXA 5D7GA 4TQ0A 5FR3A 2DYMA 2BB5A 3AEAB 1AYFA 4AS1A 4JWSC 1C77A 1D5XC 1YMHE 1YN5A 2J52A 3FILB 3L4PA 4HKZE 2BTEA 1CJEA 1L4DB 1V1OA 4OW0A 3P42A 3SFDB 3W5VB 4MT5A 1K52A 1LO5D 4C80A 3Q8EA 5H92C 4YWGG 4ZOHC 5EE3A 1KF6B 3BZDB 3ZJUA 2K22A 4IDIA 1FIQA 1Y56A 3HVDA 1B9RA 5TSSA 3MP9A 4ZRPA 1ACCA 1QKZA 2JQRB 1GOZA 1SSNA 1WWTA 2WDVB 2Y5CA 3P4PB 2L32A 2N9LA 2KQ4X 3EUB2 4YTMB 1F0ZA 1UGJA 3FILA 2MJEA 4ZHPA 2DWQA 3PZ7A 4WURA 1I4GA 3N9YC 1T5XD 4RGOS 2TSSA 1TS4A 1RYJA 2EELA 3U2SC 2OHFA 3B2GA 2PTLA 1D5MC 1NI3A 1KLGD 3B2FA 4MM3B 1XLNA 3R2IA 1XO3A 2FE8A 1QOBA 1NYRA 3AECB 1ZOYB 1MPEA 2SEBD 1ENFA 3ETRA 5G5GA 1ZP0B 4GDKB 5BYRA 3TEWA 1N60A 4N6EB 1KFYB 2AQ2B 2W3SA 2WLBA 1MHXA 1XLPA 2PIAA 3AH7A 4KX6B 3OWEB 5HG2A 4KGSA 4RGNA 4DXGA 2SAKA 1F2RC 1HEZE 2RPVA 1OFFA 3MC0B 2ZW0A 2MEKA 4OZCA 4WIPA 4LTUA 1MI0A 1TKYA 2N7JA 3AE7B 2V0GA 1C4PA 3NVZA 5EE1A 1QQRA 2WXGA 1JQ4A 1OQRA 1SF0A 1VZ8A 3NVYA 5FK9C 1YNTE 1RM6C 1WYGA 4XDCA 4WAFA 1VLBA 2QEJC 2ON8A 1FNWA 2JX5A 4P6VF 1GPXA 1EM7A 2W55A 1PGAA 2E3TA 2HDEA 3KQ4A 3U4EG 4D2KA 1JW9D 1VR9A 1XLOA 2WXFA 2QMTA 1I4HA 2QIEB 2JYTA 1AW7A 4YTNB 2YEPB 4CQNA 1V1PB 2WXRA 2LFIA 3AE5B 3CWIA 1E10A 3BWUD 1FRDA 1D4BA 2INNE 1QT9A 2JU6X 2LGIA 4RGMA 4TQ1A 2X38A 4ZYSA 1FNVA 4RH6A 4TSSA 3URYA 3AE8B 3AE9B 3NRZA 5BYQA 2WXJA 3W5UB 5T8IA 2AQ1B 3Q69A 1TS2A 4XE0A 4WH4A 2L83A 3W9CB 1KLUD 4NJCA 3AEBB 2Z8LA 1XCTL 1L5PA 2VZKD 5C3JB 2N9KA 1RWSA 3DWMA 3IAM1 5C2TB 3IAS1 3VRAB 2WQYB 3B9JA 1YJIA 2DBYA 1L6UA 1GB1A 1SE2A 2WU5B 3R2TA 3AN1A 4XDDA 2JXTA 1V1PA 2IGDA 2PVOD 1XCQL 4L2YA 4DQOC 2CJNA 4KKIA 3VR9B 1L4ZB 1ZXHA 2BT6A 4OZAA 1HZ5A 1FCLA 4EE2A 1I4PA 3P1MA 3KWLA 1TKEA 3AEGB 4HROA 1N61A 5LNK1 1JWAD 4L1BA 3VQIA 3AEDB 3ABVB 4YT0B 2K5PA 4LLGM 1ZDVA 4JWUC 3P4RB 4YSXB 5AUKA 4C7YA 1F77A 2Q5WD 1EU3A 1FMAD 1GB4A 4ITKA 4H2AA 2WXKA 4KKJA 3P4SB 3V05A 4RCOA 3FAHA 1N62A 2PKOA 2VZKB 1ZDXA 1YJJA 1WGKA 1HXYD 2K3UA 2FUG1 3NZ3A 2CU3A 5AUIA 1DOIA 1FO4A 3WCQA 1FCCC 1TY0A 3AE2B 1FXAA 4GLSC 1C76A 2AQ3B 4HJGE 2XN9C 4A8XC 2L1AA 1T6BX 4IKGA 2QJLA 4RGTA 3BYYB 2LUMA 1DOYA 1K51A 2B76B 5D3IB 5HHDG 4YTPB 1JCKB 3IT6B 1QOGA 2RDGA 3ZGZA 3BYTB 2K0PA 3AEFB 2CJOA 4TMAB 2YEPF 5GXGB 3BVGA 3DWGC 1Q10A 1NENB 2V4IB 1ET6A 4KGRA 2XNAC 2ONQA 2PMVA 1PYWD 1PFDA 2N0SB 3RPFC 1YQ4B 4AQ7A 3NVVA 5JXVA 1UNSA 3H8HA 1C79A 2NMQA 3EGRA 3V3XA 1BXTA 4FXCA 1J7CA 2HTME 2KWDA 2L52A 2Y5PA 3E9SA 1ZPSA 5EE0A 2WXLA 1A70A 3AE3B 1M4VA 1N5WA 1XXGA 3Q8AA 3ZYYX 4GDLB 1DGJA 1XEEA 1EWYC 2V3PA 3AV8A 3FC4A 3HVZA 2GRIA 4ARCA 1B1ZA 1L6VA 1QILA 2DLBA 4B0MA 1QOAA 4RFBA 2LJIA 1JMLA 1ZUD2 4A90A 1TYGB 2WU2B 4Q2JA 1RFKA 5EE9A 2JZPA 1QOFA 3NS1A 2LMCA 3AE4B 1EWCA 3MHZA 3P4QB 1L0VB 4A55A 5MPOA 1YQ3B 2KDMA 2M56B 4WWMA 1JALA 1TS3A 1P7EA 1NVID 3U7ZA 1NEKB 1SEBD 2BB6A 3AM9A 3R8BA 1E9MA 2BBCA 4UDUC 1FRRA 3BVZA 2W3RA 1FXIA 2WNMA 1PUTA 4ZHOA 1ROEA 1ZXIA 4HEA1 2ICIA 2QSDA 3SR6A 2H88B 3BVMA 3BIID 2MJDA 4NAWB 2JWUA 2K9XA 2I2YA 4HRSA 1CK1A 3HRDD 1MHHE 3IT4B 1AN8A 1MVKA 1T3QA 4YSZB 1IBXB 1SXTA 1FFUA 1GAQB 1UUPA 4N59A 1FEHA 1ET9A 1FNUA 3RFZB 1EU4A 2JYEA 1OQQA 2EKIA 2WXPA 2WXNA 3UI3A 4RF1A 1VRAB 4OHJA 3P63A 1K50A 3I57A 4A6QA 3ZJVA 1BUIC 3KWVA 2G9HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYT A;  2JYE A; 
#chains in the Genus database with same CATH topology
 5D3D A;  4K7U A;  2ZVN A;  1V2Y A;  2WP9 B;  4EZK A;  3TEY A;  2GOW A;  3IHP C;  2PVG C;  1WH3 A;  1L0X B;  3SEB A;  3A9K A;  1T0Y A;  3Q8B A;  4OZB A;  3RN9 C;  3L54 A;  4O1N A;  2BW2 A;  1VCB A;  5CTR C;  3LXF A;  3RZF A;  2IPK D;  4M0W A;  1LM8 B;  2KTR A;  3U8Z A;  2EMS A;  3ALB A;  2PPH A;  1I4X A;  4R3D A;  1HZ6 A;  2L0F A;  4CO7 A;  2IGH A;  4FLH A;  2WXM A;  1Z5S B;  4GB9 A;  4TKN A;  1IUE A;  1H4R A;  3QK0 A;  3T9L A;  5AZG A;  1P7F A;  2GBM A;  3DBS A;  2YVC A;  4EZJ A;  5KHO A;  1Q5W B;  1D5Z C;  2L00 B;  1STE A;  4BVU C;  3KYC D;  4BAX A;  3QC8 B;  1TKG A;  4F1S A;  2CHW A;  2KAN A;  1WGH A;  2KMM A;  3DHG C;  2PW9 A;  5L95 C;  1JWB D;  4YXD B;  1MG4 A;  4EFO A;  2KAJ A;  1QLB B;  1DYQ A;  1FD6 A;  1JWS D;  4GU2 A;  4G3X B;  3RNB C;  5J18 A;  4GMV A;  4JIO U;  4HDQ A;  2WXI A;  3AMZ A;  4IUM B;  1F9J A;  4HJK A;  2BYF A;  2MBQ A;  4RM8 A;  1WSP A;  2LHE A;  4WJP A;  2M4N A;  4C7Z A;  2KFJ A;  2KVZ A;  4OVZ A;  5DPR A;  3W2D A;  1JWU D;  4A9A A;  3CIR B;  2IZV B;  4B95 A;  1BML C;  4IM0 A;  3MFG A;  1OQY A;  4F8C B;  3GS2 A;  4MGK E;  1C4C A;  2KOX A;  3X0W A;  4BKS A;  2IO2 B;  4FAD A;  1V8C A;  1ZKH A;  1J8C A;  2JWZ A;  1VDV A;  3SFE B;  3DOW A;  4WWP A;  2WXQ A;  4W9I A;  5IP4 D;  1SIJ A;  4C4V B;  1I4Q A;  2ZNV B;  4A20 A;  3ZNI D;  1N5X A;  2IYD B;  3Q3F A;  4YL8 A;  4HLE A;  4NAW A;  3HUI A;  4BOS C;  3QQ8 B;  4IM2 A;  5BMH A;  4US8 A;  3Q6B A;  1AWD A;  1SB3 C;  1WFY A;  2DYO A;  2KC1 A;  1WX8 A;  1UBI A;  1UWX A;  2KN5 A;  2DYM A;  2BB5 A;  2MHJ A;  4AP4 C;  4AS1 A;  4IWP A;  2J52 A;  3X23 A;  4W9F A;  1WE6 A;  3K9O B;  1P1A A;  1E8X A;  1LO5 D;  3Q8E A;  5EE3 A;  4ANU A;  4IDI A;  1FIQ A;  2L76 A;  3HVD A;  4K3C A;  5TSS A;  1ACC A;  4AJW A;  1L2N A;  1GOZ A;  1SSN A;  2WDV B;  3RNA C;  1A5R A;  2G4D B;  2NCN A;  2KQ4 X;  4YTM B;  1UGJ A;  3FIL A;  3VDZ A;  3WAM A;  1NI2 A;  3N9Y C;  3U2S C;  4DHJ D;  2OHF A;  1NI3 A;  3GZN B;  1OEY A;  2KZR A;  3B2F A;  1GG3 A;  4S0R A;  5D94 A;  1MPE A;  2SEB D;  2G4S A;  1ENF A;  2CHX A;  5G5G A;  1E7U A;  2GLS A;  3TEW A;  4DXA B;  2AQ2 B;  2W3S A;  1MHX A;  1XLP A;  4KX6 B;  2L8J A;  3OWE B;  4EUT A;  4KGS A;  1TGZ B;  5TR5 A;  3DBH B;  2RPV A;  3N1Z C;  2MEK A;  1MI0 A;  3RD2 A;  2MP2 B;  4DHZ E;  3PRP B;  2ASQ A;  1QQR A;  3I63 C;  1VZ8 A;  5FK9 C;  3H7S A;  1WRD B;  1VLB A;  4MDK E;  3RUI B;  3WAN A;  2ON8 A;  2JX5 A;  2INC C;  1OEY J;  3VAW A;  3AE5 B;  2LFI A;  4IWQ A;  3PZD A;  1D4B A;  2LGI A;  1I42 A;  4TQ1 A;  4MSM B;  3AE8 B;  3NRZ A;  5BYQ A;  2WXJ A;  3W5U B;  4HCN B;  2AQ1 B;  4XE0 A;  4WH4 A;  2L83 A;  4NJC A;  2I1J A;  3A33 B;  1RWS A;  3DWM A;  3IAM 1;  5C2T B;  3IAS 1;  2IBI B;  2DBY A;  2WU5 B;  3AN1 A;  4XDD A;  2DAF A;  4I6P A;  4DQO C;  2KTF A;  4KKI A;  1L4Z B;  1ZXH A;  4F7Z A;  1HZ5 A;  2GBN A;  3VXW A;  3KWL A;  1N61 A;  4C4V A;  5LNK 1;  3S2A A;  1JWA D;  3VQI A;  4NY0 A;  4A3P A;  4JWU C;  4YSX B;  3KW5 B;  4C7Y A;  3CMM B;  4X57 B;  1TBE A;  2RDB C;  1N62 A;  4KSL C;  1UD7 A;  1YJJ A;  1WGK A;  1HXY D;  3NOB A;  1WGG A;  4KZ0 A;  4G11 A;  1FO4 A;  3WCQ A;  1FCC C;  2EMT A;  3N1X C;  2REX A;  2GBK A;  1TY0 A;  4EEW A;  2FIF A;  2XBB C;  4M02 A;  2XN9 C;  4GXB A;  1MG8 A;  4RGT A;  1UGM A;  4N9F 4;  2LUM A;  5HHD G;  4YTP B;  3IT6 B;  3NZS A;  1FPY A;  1QOG A;  4AWJ A;  3AEF B;  2BGF A;  2CJO A;  1U4A A;  2O6V B;  3PHX B;  2RGF A;  4PK1 A;  2XNA C;  4K7S A;  2ONQ A;  2ZNV C;  4BBN C;  2M1M A;  2WX1 A;  3NVV A;  2FUH B;  3ZVV A;  2IY1 B;  2KVR A;  3EGR A;  3V3X A;  5CHF A;  2KWD A;  1EF1 A;  3E9S A;  1ZPS A;  2KD0 A;  3PHW B;  4ACF A;  3OLM D;  1N5W A;  2MSE D;  2FID A;  1XEE A;  1Q0W B;  3AV8 A;  3HVZ A;  2KX3 A;  4ARC A;  1B1Z A;  4B0M A;  1QOA A;  4RFB A;  1K8R B;  2LJI A;  1ZUD 2;  1RFK A;  2N9X A;  2NBV B;  2RSU A;  1L0V B;  4NJ6 A;  1UH6 A;  4WWM A;  1JAL A;  1NVI D;  3U7Z A;  3QHT A;  2KDE B;  2N9E B;  4XGA B;  4ZRI A;  2BBC A;  1KLV A;  1FRR A;  3BVZ A;  2WNM A;  1PUT A;  1ROE A;  2NBU A;  5FR6 A;  2QSD A;  3SR6 A;  3NJT A;  3Q14 C;  2MJD A;  4LJP B;  3UIP B;  4HRS A;  1CK1 A;  4YSZ B;  3IT4 B;  1MVK A;  1IBX B;  1FFU A;  2MQJ A;  1HTQ A;  1OQQ A;  2EKI A;  5J2R A;  2RD0 A;  1WM3 A;  3P63 A;  3CF6 E;  2LAS A;  2J0M A;  2G9H D;  2WDT B;  2OJR A;  1C1Y B;  4XWW A;  4NJ7 A;  1UF0 A;  1E90 A;  3PV1 A;  1VZ7 A;  1ZW7 A;  1E0Z A;  1TZO A;  2BF8 B;  3WAL A;  2JY6 A;  5EDS A;  3VFK A;  1VZ6 A;  3SHQ A;  1FM0 D;  4YSY B;  2MBB B;  2V3N A;  3RNG C;  3J9C A;  3HHM A;  2JZZ A;  3ZTC A;  2D3B A;  4DWF A;  3NS8 A;  3IBE A;  1NYQ A;  4MSQ B;  4W9D A;  1ESF A;  5BYS A;  2LRW A;  2BWE S;  2QDF A;  2WGS A;  1RAX A;  1NDD A;  2N1V A;  2D3G A;  4MJS A;  5E6P A;  1EF5 A;  1K53 A;  4W9C A;  2MCN B;  1WGD A;  5BMI A;  2GMI C;  3VHT C;  3V60 A;  4MEL A;  4USA A;  3KUD B;  2IY0 B;  2BS4 B;  4PT5 A;  5DPS A;  1WRI A;  3Q3N C;  1JRU A;  2O6V A;  3LB8 C;  2RMM A;  4WJQ A;  1ZE3 D;  5CHV C;  1PDX A;  3H1U A;  1GJZ A;  3AE6 B;  1N6Z A;  2KXJ A;  1IGC A;  1CZP A;  3BK2 A;  3QCA A;  1XLQ A;  2K8B A;  4N58 A;  2X8X X;  1D6E C;  3AXC A;  4ARI A;  3UGB B;  1WMH B;  2PE9 A;  4GN1 A;  1E6E B;  3EFC A;  3SD5 A;  4IWO A;  4K3B A;  1WE7 A;  3I9V 1;  4L23 A;  3OG5 A;  1P0R A;  3JVZ X;  1UBQ A;  2QIL A;  4MGZ E;  3ZKJ C;  4P1B C;  5GMV A;  2LGD A;  5G5H A;  1E8W A;  2VH1 A;  2MBH A;  1KRH A;  3H6N A;  2NPT B;  2MJ3 A;  4NZL B;  3AE1 B;  1WXA A;  3APD A;  1IBX A;  2WDQ B;  3ZJT A;  3PSE B;  3TBL D;  1CQV A;  3TSS A;  1I7H A;  2I38 A;  3GE8 C;  3NHE B;  1AYF A;  2DEN B;  4W9K A;  4JWS C;  1C77 A;  2VRR B;  3FIL B;  3L4P A;  1CJE A;  2K8H A;  1V1O A;  5KHQ A;  3SFD B;  4ASW C;  1WXS A;  4MT5 A;  4YWG G;  1SE9 A;  3N30 A;  1KF6 B;  3ZJU A;  4DK5 A;  2K22 A;  4BKG A;  2CS4 A;  1IP9 A;  3PTF C;  4RM9 A;  2KQ7 A;  3MP9 A;  4ZRP A;  1QKZ A;  2JQR B;  1WWT A;  3P4P B;  3EUB 2;  1F0Z A;  3QX1 A;  2XEW A;  4ZHP A;  3PZ7 A;  4RGO S;  1TS4 A;  3A4S C;  3PPA A;  4B9K A;  1D5M C;  4ZYN A;  1XLN A;  3JSV B;  3APF A;  5C1Z A;  3M63 B;  3ETR A;  5BYR A;  4N6E B;  1KFY B;  2RR9 A;  2MW5 A;  3AH7 A;  4BBN F;  4DXG A;  4E74 A;  4DDI D;  3RNE C;  2UU7 A;  1WJN A;  4TUU A;  4ANW A;  4WJO A;  3WA0 A;  1TKY A;  1QZE A;  1WJ6 A;  2N7J A;  3APC A;  2ZVO A;  5EE1 A;  2WXG A;  1YNT E;  1WYG A;  5AEK B;  1WXM A;  1GPX A;  2W55 A;  2IO3 B;  1JW9 D;  3L10 B;  2HE7 A;  1I4H A;  2QIE B;  2J7Q B;  4LCD E;  1AW7 A;  2GBR A;  4CQN A;  2WXR A;  3AUL A;  1QT9 A;  1YQB A;  2MLB A;  1MFW A;  2X38 A;  4TSS A;  2FCN A;  3UF8 A;  5T8I A;  1WMH A;  3GZN I;  2EKE C;  3DBR B;  1P9D U;  4PS8 A;  2JF5 A;  1XCT L;  1L5P A;  4W9J A;  2KWC A;  3B9J A;  1YJI A;  1L6U A;  3A9J B;  1SE2 A;  3R2T A;  2JXT A;  4HVB A;  2PVO D;  3PLU A;  3VR9 B;  4TV3 A;  4OZA A;  2BT6 A;  2KK8 A;  2NBW B;  1I4P A;  1TKE A;  3KVF B;  4FUL A;  3PT2 B;  3UIO B;  1GNU A;  4HDO A;  3P4R B;  3DCG A;  2NPT A;  2Q5W D;  1GB4 A;  2DHZ A;  4ITK A;  4IG7 B;  4PYU A;  2VZK B;  1ZDX A;  2CR5 A;  4URK A;  3NZ3 A;  2CU3 A;  4W9E A;  2DNF A;  2LJ5 A;  4CYE A;  1ISN A;  2NVU I;  3AU4 A;  4J6I A;  2AQ3 B;  4W9G A;  4HJG E;  2R2O A;  2G3Q B;  3ZNZ B;  4LDT B;  2DZJ A;  5D3I B;  4LNK A;  1JCK B;  3ZGZ A;  2K0P A;  2Z59 B;  4AJY B;  3BVG A;  3DWG C;  1Q10 A;  1KJT A;  2V4I B;  1ET6 A;  4ANX A;  1EO6 A;  2CHZ A;  4BKS D;  1WX7 A;  2C7H A;  3OJ4 B;  1YQ4 B;  2UWQ A;  2C7N B;  2GBJ A;  3KUC B;  1UNS A;  4G0N B;  2QCZ A;  4NPN A;  2NMQ A;  2KDB A;  2BKR B;  4FA6 A;  2D3A A;  2IND C;  3NY5 A;  3JSV A;  1EWY C;  2KWV B;  4E71 A;  3FC4 A;  5IOI A;  1L6V A;  4G50 A;  1F52 A;  4HPM B;  2KO3 A;  4A90 A;  3MHS D;  3MJW A;  5EE9 A;  2JZP A;  4WAA A;  3ZIM A;  1QOF A;  3NS1 A;  3AE4 B;  3QA8 A;  3P4Q B;  3PRE A;  2KX0 A;  4OVU A;  3GE3 C;  1YQ3 B;  1SGH A;  4IM3 A;  2M56 B;  4MH0 E;  1TS3 A;  2PEA A;  3ZXR A;  1V5T A;  1CMX B;  1SEB D;  2HTH A;  4I6L B;  2BB6 A;  3AM9 A;  3V62 A;  4GDL A;  1E9M A;  2MX2 A;  3U30 A;  1FXI A;  4JGH B;  1J19 A;  1LXD A;  2H88 B;  3BVM A;  3BII D;  2DZK A;  4XZ4 A;  2JWU A;  2LGY A;  2I2Y A;  3HRD D;  1T3Q A;  4EKU A;  2W9N A;  1FNU A;  3RT3 B;  1I35 A;  1HE8 A;  3RMK C;  2DZI A;  2ZPN A;  1SE4 A;  2DYB A;  3GB1 A;  2G1E A;  1OGW A;  3AB5 A;  1WM2 A;  2JT4 B;  2BYT A;  3O13 A;  3A9J A;  4DXF A;  3VUX A;  3PZ8 A;  1R4M B;  2BS2 B;  2BQQ A;  1X1M A;  5E6J A;  2N1W A;  4MJS B;  2KT7 A;  5C23 A;  1IGD A;  5JH5 C;  1WF9 A;  2M0X A;  1WX9 A;  2CU1 A;  1L7Y A;  3WAP A;  3W1S A;  4LNN A;  2W54 A;  2BYE A;  2ZW1 A;  2LEK A;  5LLI A;  2D5G A;  1E7P B;  3R7Q A;  3V6E B;  3HK0 A;  5E6N A;  4KGT A;  4GGQ A;  1Z2M A;  4MH8 A;  3TUO A;  4W9H A;  1SBB B;  2LD9 A;  3ZQ4 A;  1E7V A;  2OED A;  1WGR A;  2J42 A;  1RLF A;  1N63 A;  4LNF A;  3IXS A;  4KIK A;  3H9D A;  3MJ5 A;  2MH7 A;  2J0K A;  4EOY A;  4MGY E;  2LHD A;  1R4N B;  1JRO A;  3T3O A;  2LRU A;  3PRZ A;  2JVC A;  1IPG A;  2AX5 A;  2K8C A;  2LZ6 A;  1PGB A;  1SIF A;  1TY2 A;  2J53 A;  5AZH A;  4XYC A;  5HFY A;  4IOI E;  4JE3 B;  1VJK A;  4RMA A;  2LXC A;  5L83 A;  2AEH A;  3ENE A;  3NUH B;  4REZ A;  2NTT A;  4BFR A;  4JQW C;  3RI7 C;  1SJE D;  3ZDT A;  1JWM D;  2DX5 B;  2NTS A;  3KH0 A;  3VVW B;  2DZM A;  3ZDM C;  4WWO A;  5BMG A;  3VH4 B;  1KOT A;  3QAR A;  5CX3 A;  3HM6 X;  4C56 C;  2H89 B;  4HXD A;  3DDC B;  2KNB A;  4KDI C;  3VRB B;  1TZ1 A;  1YOV B;  4HKQ A;  1J7B A;  4JPS A;  2ZJD A;  1TS5 A;  5LXI B;  1WR6 E;  4HPP A;  1QF6 A;  4BKT A;  1SE3 A;  4CHK A;  3ZTD A;  1HQR D;  5E6O A;  2BVC A;  4XWT A;  1C9F A;  2D07 B;  2PLP A;  4J3O D;  1S3S G;  4KVG B;  4MAC A;  3VTU A;  4KDL B;  4TQ0 A;  1UWM A;  2E6X A;  4II2 B;  2JRH A;  3AEA B;  2BPS A;  3QAQ A;  2JZ3 B;  4PYZ A;  1YMH E;  2BTE A;  2BKF A;  3IG3 A;  4OW0 A;  3P42 A;  5JZE B;  2LUE A;  4JLC A;  3W5V B;  3EHV A;  4C80 A;  4ANV A;  3QJZ A;  1Y56 A;  1TTN A;  1B9R A;  4WJN A;  3H7P B;  2RPQ A;  3ECI A;  3ZO5 B;  3N3K B;  4P7I A;  1T0Q C;  2N9L A;  1P98 A;  2L7R A;  2MJE A;  2L0T A;  2DWQ A;  4WUR A;  1T5X D;  2TSS A;  4EZL A;  4QAY A;  3EEC A;  2N7D A;  5G55 A;  1NYR A;  1E8Z A;  2M17 A;  2AL6 A;  4ICU A;  1ZP0 B;  3M3J A;  2LXA A;  1N60 A;  2WLB A;  1WJ4 A;  4HPL B;  3K9P B;  4FN2 A;  4RGN A;  3PS6 A;  1F2R C;  1OFF A;  3MC0 B;  2ZW0 A;  2J0J A;  2PJH A;  5D2M B;  4WIP A;  4OZC A;  4LTU A;  2FAZ A;  2XK5 A;  1C4P A;  2V9H A;  3L17 A;  4PS7 A;  5DPW A;  1OQR A;  3VTV A;  4XDC A;  2LGS A;  2QEJ C;  1V80 A;  4P6V F;  1EM7 A;  1PGA A;  5G2N A;  3V6C B;  3U4E G;  3KQ4 A;  4D2K A;  1VR9 A;  3M62 B;  2WXF A;  2QMT A;  3MTN B;  4FJV B;  5J17 A;  2KFK B;  4YTN B;  2YEP B;  1E10 A;  1ZGU B;  2KLG A;  1V9J A;  2JU6 X;  2ZCC A;  4RGM A;  1V81 A;  4ZYS A;  4RH6 A;  3AE9 B;  3N20 C;  3Q69 A;  1TS2 A;  1GC6 A;  3DBL B;  3W9C B;  1KLU D;  1WJU A;  1WXV A;  3AEB B;  2Z8L A;  3ONS A;  2N9K A;  3VRA B;  2I1K A;  1GB1 A;  1V1P A;  3D32 A;  2IGD A;  3CST A;  2CJN A;  2YLM A;  3TCA A;  4EE2 A;  3P1M A;  4BZA A;  4YT0 B;  2K5P A;  1ZDV A;  2CKH B;  1F77 A;  4K7W A;  3IFW B;  2O6V D;  2VH2 A;  1BT0 A;  4H2A A;  2MBO A;  3FAH A;  4HWI B;  2K3U A;  2FUG 1;  1LQB A;  1H8C A;  4PS3 A;  2ZEQ A;  4GLS C;  3NZU A;  1C76 A;  4A8X C;  1KM7 A;  4S17 A;  2JUO A;  3BYY B;  3R3M A;  3PLV A;  3DBR I;  4KZC A;  1VD2 A;  3U7D A;  3KYD D;  3MC8 A;  3H7P A;  5GXG B;  1NEN B;  4KGR A;  1NBF C;  2PMV A;  1M94 A;  1PFD A;  4AOF A;  2JRI B;  2HJ8 A;  3H8H A;  1J0G A;  4ICV A;  4FXC A;  1J7C A;  2HTM E;  2KKC A;  2MBE A;  3DHI C;  2Y5P A;  2K1F A;  5EE0 A;  2KJH B;  1M4V A;  3P2B A;  1WY8 A;  3Q8A A;  3RZW C;  4GDL B;  1DGJ A;  2BWF A;  3WAO A;  2KDF B;  1QIL A;  2DLB A;  1JML A;  2WU2 B;  4Q2J A;  2V1Y A;  4A55 A;  3SDL C;  2QHO A;  1NEK B;  3SU8 X;  3L0W B;  3VH3 B;  3FKY A;  3R8B A;  4UDU C;  1S1Q B;  4HK2 A;  2LGX A;  2W3R A;  3T8M A;  2WWZ A;  4WQO B;  1ZXI A;  4HEA 1;  3RCZ A;  1V6E A;  3QIJ A;  4II3 B;  2K9X A;  4MGI E;  2C60 A;  1MHH E;  1SXT A;  2KFK A;  1E5W A;  3DVG X;  1FEH A;  2WXP A;  3UI3 A;  2OOB B;  3ZXV A;  4RF1 A;  2MWS B;  2NR2 A;  4IC7 B;  4FHJ A;  3DBH I;  3I57 A;  4A6Q A;  2Z0E B;  1BUI C;  3KWV A;  3B08 A;  3MC9 A;  5I4D A;  3ZRC A;  5H8Y E;  1JRP A;  4HCP B;  3JYU A;  4P16 A;  3Q8C A;  1IYF A;  1V49 A;  4US9 A;  2UYZ B;  2FBW B;  1KH0 A;  1D3Z A;  4ZRQ A;  1KTK A;  1RFA A;  4RNA A;  2GB1 A;  4A3O A;  5DPT A;  2GI9 A;  3U52 E;  3DVN V;  1DOX A;  4FBJ B;  3AEE B;  2IJ0 A;  2R2Q A;  3OAW A;  4LK0 M;  1SJH D;  1C3T A;  3ML8 A;  2INP E;  4M8N A;  1E8Y A;  5D6J B;  5HI1 A;  3BY4 B;  3VR8 B;  1I4R A;  4KIK B;  2ACZ B;  3C8Y A;  1YN4 A;  2JPH A;  4DHZ B;  2WXO A;  3KLS X;  3DVG Y;  4E3C A;  2HD5 B;  2Y3A A;  4W9L A;  2Z0D B;  3TEZ A;  3ZLZ A;  3PRM B;  3RUL A;  2NS5 A;  3T3N A;  3IVF A;  2KLC A;  3TMP B;  1YX5 B;  2O2V B;  3HIZ A;  2W82 A;  4GOC A;  1HA5 A;  2C7M B;  2KAC A;  2R61 A;  2KN4 A;  3E56 A;  1F2R I;  1FXT B;  2J4X A;  2M0A A;  2JSV X;  4RF0 A;  2WDR B;  1R7S A;  1YX6 B;  2WXH A;  2BS3 B;  1C4A A;  2D3C A;  3V61 A;  1C78 A;  1R4M I;  4GIV A;  1WYW B;  2KC2 A;  2IDY A;  3ZUN A;  1PGX A;  1V97 A;  3BIN A;  1T0S C;  4DBG A;  2M8S A;  2M19 A;  1WI0 A;  3Q3J A;  4M00 A;  5LXH A;  2ZZP B;  3EA6 A;  5FKA C;  4WQM A;  2L05 A;  3LYY A;  3Q2A C;  3NVW A;  1WGY A;  2MA9 B;  3Q3O C;  2A4Z A;  2IGG A;  3GOE A;  5DCN A;  2N9P C;  2LVQ A;  3BK1 A;  4JX1 C;  4K81 A;  3ML9 A;  1GC7 A;  2LVO A;  3EC8 A;  3W1Y A;  3TEX A;  3UQB A;  2LVP A;  3KUZ A;  3Q8F A;  2L3Z A;  1L0Y B;  2RDH A;  2WS3 B;  2D11 A;  2KDI A;  3NG0 A;  3PO0 A;  2ZPY A;  3DPD A;  3L08 A;  3VUY A;  3L16 A;  1T0R C;  4B0E A;  1R4N I;  1YN3 A;  4NAM A;  1WXQ A;  3PVL A;  1WZ3 A;  2D10 A;  1WR1 A;  1J7A A;  1FFV A;  4LNI A;  3GP7 A;  1TJE A;  2BYV E;  2B3A A;  1XF5 L;  5D7G A;  5FR3 A;  2FCM A;  2KMA A;  4K1R B;  4MEM A;  2D2Q A;  1D5X C;  4HKZ E;  1YN5 A;  4M01 A;  3R7R A;  1L4D B;  2HJ1 A;  1K52 A;  1LGR A;  3L13 A;  2KMC A;  5H92 C;  4ZOH C;  1AAR A;  3BZD B;  4FJZ A;  1F1H A;  5IAA C;  2QC8 A;  3I5J C;  2Y5C A;  1WIA A;  2L32 A;  2OJW A;  4JL9 A;  1I4G A;  1P3Q U;  1RYJ A;  2EEL A;  3JW0 X;  3B2G A;  2PTL A;  1KLG D;  5JHB A;  1WZ0 A;  5CHW A;  3N32 A;  3HM3 A;  4MM3 B;  3R2I A;  2FCQ A;  2XK5 B;  1XO3 A;  2FE8 A;  1QOB A;  2WHI A;  3AEC B;  2A5U A;  3Q3M C;  1ZOY B;  2AL3 A;  4GDK B;  3RNC C;  2K39 A;  3C0R B;  3DHH C;  3EFU A;  3WIM A;  2PIA A;  2IO0 B;  3A1Q B;  5HG2 A;  4ZDV A;  2SAK A;  1HEZ E;  4NNJ B;  4DDG D;  3RYT A;  2O2V A;  2DAJ A;  2JXX A;  4FHK A;  3W1S C;  5JHA A;  3AE7 B;  2V0G A;  3NVZ A;  3O65 B;  1JQ4 A;  3A4R A;  1SF0 A;  3NVY A;  3LDZ E;  1RM6 C;  3DVN U;  4WAF A;  2AYO B;  3B1L X;  1FNW A;  2AWT A;  1Y8R C;  2E3T A;  2HDE A;  1V86 A;  5HKH A;  1XD3 B;  1XLO A;  2JYT A;  5IN7 A;  2MP2 A;  4B6W A;  4I6N B;  1V1P B;  2FCS A;  3CWI A;  3BWU D;  1FRD A;  2INN E;  2KJ6 A;  1FNV A;  3URY A;  4M8M A;  2G45 B;  1YJ1 A;  3M95 A;  4NQL B;  2ZCB A;  4XX5 A;  2VZK D;  4KSK C;  5C3J B;  2C9W B;  2WQY B;  3A9K B;  1XCQ L;  4L2Y A;  1FCL A;  2C5L C;  1UEL A;  5IO9 A;  3UIN B;  3TJP A;  3AEG B;  2V3S A;  4HRO A;  4P1C C;  2KQS A;  3I3T B;  3B0A A;  4AUQ C;  4L1B A;  3AED B;  3ABV B;  4LDT D;  4M0W B;  4LLG M;  5AUK A;  2K25 A;  2KTR B;  1EU3 A;  1FMA D;  2WXK A;  4KKJ A;  1Q1O A;  3P4S B;  4NQK E;  3V05 A;  4RCO A;  2KJR A;  2PKO A;  4KV2 A;  3ZW3 A;  5AUI A;  4IW0 A;  1DOI A;  4OVV A;  1OTR B;  1G6J A;  4C00 A;  2KWU B;  3AE2 B;  1FXA A;  3RNF C;  1UZX B;  2FNJ B;  4LNO A;  2KYW A;  2LWP A;  2L1A A;  1T6B X;  2Y5B B;  4IKG A;  2QJL A;  3QWZ B;  2K6D B;  1DOY A;  1K51 A;  2B76 B;  4XC2 A;  2RDG A;  2LI5 A;  3DBL I;  3BYT B;  3N1Y C;  2PE6 B;  2WYQ A;  4TMA B;  2YEP F;  2KHW B;  2WX0 A;  4WWN A;  1PYW D;  2N0S B;  3PGE A;  3RPF C;  3LJ3 A;  1PQS A;  4AQ7 A;  5JXV A;  1LFD A;  1C79 A;  3R66 C;  4LJO B;  1BXT A;  2L52 A;  1TIF A;  4MM3 A;  2WXL A;  1A70 A;  3AE3 B;  1RRB A;  4FJY A;  1XXG A;  3ZYY X;  5IA7 A;  3C19 A;  2V4L A;  2V3P A;  5AZF A;  2GRI A;  4BOZ B;  4DHJ B;  4GDK A;  4ZRK A;  1TYG B;  1MJD A;  3TIX A;  1HTO A;  3A1Q A;  1TT5 B;  2LMC A;  3ZNH B;  5IKC M;  1EWC A;  3MHZ A;  5BO4 B;  2IO1 B;  5MPO A;  2KDM A;  1EUV B;  3AI5 A;  1P7E A;  1XQQ A;  3CSF A;  1YIW A;  3TL5 A;  3DQV A;  3ZNG C;  4ZRJ A;  4ZHO A;  1YD8 U;  2ICI A;  3VUW A;  3VTW A;  3ZRF A;  1GUA B;  4NAW B;  1AN8 A;  3OJ3 A;  1GAQ B;  1UUP A;  2N4F A;  4N59 A;  3AU5 A;  1ET9 A;  3RFZ B;  1EU4 A;  2JYE A;  1V5O A;  2WXN A;  3UQA A;  1VRA B;  4GSW A;  4OHJ A;  2K6Q A;  2N7E A;  1XT9 B;  1K50 A;  3ZJV A;  2MRP A; 
#chains in the Genus database with same CATH homology
 1SE4 A;  5D3D A;  4XWW A;  2WP9 B;  3GB1 A;  5I4D A;  2G1E A;  5H8Y E;  1JRP A;  3TEY A;  3AB5 A;  4P16 A;  3Q8C A;  2PVG C;  2BYT A;  1L0X B;  3O13 A;  3SEB A;  4DXF A;  4US9 A;  3PZ8 A;  2FBW B;  1KH0 A;  1VZ7 A;  1E0Z A;  1TZO A;  3Q8B A;  2BS2 B;  4ZRQ A;  1KTK A;  4OZB A;  4O1N A;  4RNA A;  5E6J A;  2GB1 A;  2BW2 A;  2GI9 A;  3U52 E;  1VZ6 A;  1DOX A;  1FM0 D;  3AEE B;  2IJ0 A;  3LXF A;  1IGD A;  4YSY B;  2V3N A;  4LK0 M;  2IPK D;  4M0W A;  1SJH D;  3J9C A;  2INP E;  5HI1 A;  3W1S A;  3VR8 B;  1NYQ A;  1I4R A;  1ESF A;  5BYS A;  2W54 A;  2ZW1 A;  2ACZ B;  1I4X A;  2LEK A;  4R3D A;  1HZ6 A;  3C8Y A;  1YN4 A;  2WXO A;  2D5G A;  1E7P B;  2IGH A;  3KLS X;  2WXM A;  1K53 A;  4KGT A;  1IUE A;  4MH8 A;  2Y3A A;  3TUO A;  3TEZ A;  1P7F A;  1SBB B;  3ZQ4 A;  2OED A;  3T3N A;  5BMI A;  2J42 A;  1N63 A;  3IXS A;  2W82 A;  4USA A;  3MJ5 A;  2BS4 B;  2MH7 A;  4PT5 A;  1HA5 A;  1WRI A;  2KAC A;  2KN4 A;  2R61 A;  1D5Z C;  3E56 A;  1STE A;  2LHD A;  1TKG A;  1F2R I;  2J4X A;  2M0A A;  2KMM A;  2JSV X;  3LB8 C;  4RF0 A;  2PW9 A;  2RMM A;  1JRO A;  3T3O A;  1JWB D;  4YXD B;  1ZE3 D;  2WDR B;  1R7S A;  2KAJ A;  2WXH A;  2AX5 A;  1QLB B;  1DYQ A;  1FD6 A;  1PDX A;  2BS3 B;  1PGB A;  1C4A A;  1JWS D;  1TY2 A;  1C78 A;  2J53 A;  3AE6 B;  2IDY A;  5HFY A;  4IOI E;  1PGX A;  1IGC A;  1V97 A;  4JE3 B;  1VJK A;  1CZP A;  2WXI A;  3AMZ A;  2M19 A;  3BK2 A;  1WSP A;  1XLQ A;  2LHE A;  3NUH B;  4REZ A;  4N58 A;  2NTT A;  3EA6 A;  4C7Z A;  5FKA C;  4WQM A;  1D6E C;  1SJE D;  4OVZ A;  3LYY A;  3W2D A;  3NVW A;  4ARI A;  1JWU D;  4A9A A;  1JWM D;  3CIR B;  2NTS A;  1BML C;  1E6E B;  3MFG A;  2IGG A;  3GS2 A;  1C4C A;  3BK1 A;  5BMG A;  3I9V 1;  4JX1 C;  4L23 A;  4C56 C;  2H89 B;  3TEX A;  1V8C A;  1VDV A;  3Q8F A;  3SFE B;  2QIL A;  2WXQ A;  1L0Y B;  1SIJ A;  2RDH A;  2WS3 B;  1I4Q A;  5G5H A;  3PO0 A;  1N5X A;  3VRB B;  4HKQ A;  1J7B A;  1KRH A;  4JPS A;  1TS5 A;  2MJ3 A;  4NZL B;  3HUI A;  1QF6 A;  3AE1 B;  1SE3 A;  5BMH A;  4B0E A;  4US8 A;  1AWD A;  1IBX A;  2WDQ B;  1HQR D;  1YN3 A;  4XWT A;  1SB3 C;  1C9F A;  4NAM A;  1WXQ A;  2DYO A;  2PLP A;  3ZJT A;  4J3O D;  1CQV A;  1J7A A;  4MAC A;  1FFV A;  3GP7 A;  1TJE A;  3TSS A;  1I7H A;  2I38 A;  1UWM A;  1XF5 L;  2E6X A;  1UWX A;  5D7G A;  4TQ0 A;  5FR3 A;  2DYM A;  2BB5 A;  3AEA B;  1AYF A;  4AS1 A;  4JWS C;  1C77 A;  1D5X C;  1YMH E;  1YN5 A;  2J52 A;  3FIL B;  3L4P A;  4HKZ E;  2BTE A;  1CJE A;  1L4D B;  1V1O A;  4OW0 A;  3P42 A;  3SFD B;  3W5V B;  4MT5 A;  1K52 A;  1LO5 D;  4C80 A;  3Q8E A;  5H92 C;  4YWG G;  4ZOH C;  5EE3 A;  1KF6 B;  3BZD B;  3ZJU A;  2K22 A;  4IDI A;  1FIQ A;  1Y56 A;  3HVD A;  1B9R A;  5TSS A;  3MP9 A;  4ZRP A;  1ACC A;  1QKZ A;  2JQR B;  1GOZ A;  1SSN A;  1WWT A;  2WDV B;  2Y5C A;  3P4P B;  2L32 A;  2N9L A;  2KQ4 X;  3EUB 2;  4YTM B;  1F0Z A;  1UGJ A;  3FIL A;  2MJE A;  4ZHP A;  2DWQ A;  3PZ7 A;  4WUR A;  1I4G A;  3N9Y C;  1T5X D;  4RGO S;  2TSS A;  1TS4 A;  1RYJ A;  2EEL A;  3U2S C;  2OHF A;  3B2G A;  2PTL A;  1D5M C;  1NI3 A;  1KLG D;  3B2F A;  4MM3 B;  1XLN A;  3R2I A;  1XO3 A;  2FE8 A;  1QOB A;  1NYR A;  3AEC B;  1ZOY B;  1MPE A;  2SEB D;  1ENF A;  3ETR A;  5G5G A;  1ZP0 B;  4GDK B;  5BYR A;  3TEW A;  1N60 A;  4N6E B;  1KFY B;  2AQ2 B;  2W3S A;  2WLB A;  1MHX A;  1XLP A;  2PIA A;  3AH7 A;  4KX6 B;  3OWE B;  5HG2 A;  4KGS A;  4RGN A;  4DXG A;  2SAK A;  1F2R C;  1HEZ E;  2RPV A;  1OFF A;  3MC0 B;  2ZW0 A;  2MEK A;  4OZC A;  4WIP A;  4LTU A;  1MI0 A;  1TKY A;  2N7J A;  3AE7 B;  2V0G A;  1C4P A;  3NVZ A;  5EE1 A;  1QQR A;  2WXG A;  1JQ4 A;  1OQR A;  1SF0 A;  1VZ8 A;  3NVY A;  5FK9 C;  1YNT E;  1RM6 C;  1WYG A;  4XDC A;  4WAF A;  1VLB A;  2QEJ C;  2ON8 A;  1FNW A;  2JX5 A;  4P6V F;  1GPX A;  1EM7 A;  2W55 A;  1PGA A;  2E3T A;  2HDE A;  3KQ4 A;  3U4E G;  4D2K A;  1JW9 D;  1VR9 A;  1XLO A;  2WXF A;  2QMT A;  1I4H A;  2QIE B;  2JYT A;  1AW7 A;  4YTN B;  2YEP B;  4CQN A;  1V1P B;  2WXR A;  2LFI A;  3AE5 B;  3CWI A;  1E10 A;  3BWU D;  1FRD A;  1D4B A;  2INN E;  1QT9 A;  2JU6 X;  2LGI A;  4RGM A;  4TQ1 A;  2X38 A;  4ZYS A;  1FNV A;  4RH6 A;  4TSS A;  3URY A;  3AE8 B;  3AE9 B;  3NRZ A;  5BYQ A;  2WXJ A;  3W5U B;  5T8I A;  2AQ1 B;  3Q69 A;  1TS2 A;  4XE0 A;  4WH4 A;  2L83 A;  3W9C B;  1KLU D;  4NJC A;  3AEB B;  2Z8L A;  1XCT L;  1L5P A;  2VZK D;  5C3J B;  2N9K A;  1RWS A;  3DWM A;  3IAM 1;  5C2T B;  3IAS 1;  3VRA B;  2WQY B;  3B9J A;  1YJI A;  2DBY A;  1L6U A;  1GB1 A;  1SE2 A;  2WU5 B;  3R2T A;  3AN1 A;  4XDD A;  2JXT A;  1V1P A;  2IGD A;  2PVO D;  1XCQ L;  4L2Y A;  4DQO C;  2CJN A;  4KKI A;  3VR9 B;  1L4Z B;  1ZXH A;  2BT6 A;  4OZA A;  1HZ5 A;  1FCL A;  4EE2 A;  1I4P A;  3P1M A;  3KWL A;  1TKE A;  3AEG B;  4HRO A;  1N61 A;  5LNK 1;  1JWA D;  4L1B A;  3VQI A;  3AED B;  3ABV B;  4YT0 B;  2K5P A;  4LLG M;  1ZDV A;  4JWU C;  3P4R B;  4YSX B;  5AUK A;  4C7Y A;  1F77 A;  2Q5W D;  1EU3 A;  1FMA D;  1GB4 A;  4ITK A;  4H2A A;  2WXK A;  4KKJ A;  3P4S B;  3V05 A;  4RCO A;  3FAH A;  1N62 A;  2PKO A;  2VZK B;  1ZDX A;  1YJJ A;  1WGK A;  1HXY D;  2K3U A;  2FUG 1;  3NZ3 A;  2CU3 A;  5AUI A;  1DOI A;  1FO4 A;  3WCQ A;  1FCC C;  1TY0 A;  3AE2 B;  1FXA A;  4GLS C;  1C76 A;  2AQ3 B;  4HJG E;  2XN9 C;  4A8X C;  2L1A A;  1T6B X;  4IKG A;  2QJL A;  4RGT A;  3BYY B;  2LUM A;  1DOY A;  1K51 A;  2B76 B;  5D3I B;  5HHD G;  4YTP B;  1JCK B;  3IT6 B;  1QOG A;  2RDG A;  3ZGZ A;  3BYT B;  2K0P A;  3AEF B;  2CJO A;  4TMA B;  2YEP F;  5GXG B;  3BVG A;  3DWG C;  1Q10 A;  1NEN B;  2V4I B;  1ET6 A;  4KGR A;  2XNA C;  2ONQ A;  2PMV A;  1PYW D;  1PFD A;  2N0S B;  3RPF C;  1YQ4 B;  4AQ7 A;  3NVV A;  5JXV A;  1UNS A;  3H8H A;  1C79 A;  2NMQ A;  3EGR A;  3V3X A;  1BXT A;  4FXC A;  1J7C A;  2HTM E;  2KWD A;  2L52 A;  2Y5P A;  3E9S A;  1ZPS A;  5EE0 A;  2WXL A;  1A70 A;  3AE3 B;  1M4V A;  1N5W A;  1XXG A;  3Q8A A;  3ZYY X;  4GDL B;  1DGJ A;  1XEE A;  1EWY C;  2V3P A;  3AV8 A;  3FC4 A;  3HVZ A;  2GRI A;  4ARC A;  1B1Z A;  1L6V A;  1QIL A;  2DLB A;  4B0M A;  1QOA A;  4RFB A;  2LJI A;  1JML A;  1ZUD 2;  4A90 A;  1TYG B;  2WU2 B;  4Q2J A;  1RFK A;  5EE9 A;  2JZP A;  1QOF A;  3NS1 A;  2LMC A;  3AE4 B;  1EWC A;  3MHZ A;  3P4Q B;  1L0V B;  4A55 A;  5MPO A;  1YQ3 B;  2KDM A;  2M56 B;  4WWM A;  1JAL A;  1TS3 A;  1P7E A;  1NVI D;  3U7Z A;  1NEK B;  1SEB D;  2BB6 A;  3AM9 A;  3R8B A;  1E9M A;  2BBC A;  4UDU C;  1FRR A;  3BVZ A;  2W3R A;  1FXI A;  2WNM A;  1PUT A;  4ZHO A;  1ROE A;  1ZXI A;  4HEA 1;  2ICI A;  2QSD A;  3SR6 A;  2H88 B;  3BVM A;  3BII D;  2MJD A;  4NAW B;  2JWU A;  2K9X A;  2I2Y A;  4HRS A;  1CK1 A;  3HRD D;  1MHH E;  3IT4 B;  1AN8 A;  1MVK A;  1T3Q A;  4YSZ B;  1IBX B;  1SXT A;  1FFU A;  1GAQ B;  1UUP A;  4N59 A;  1FEH A;  1ET9 A;  1FNU A;  3RFZ B;  1EU4 A;  2JYE A;  1OQQ A;  2EKI A;  2WXP A;  2WXN A;  3UI3 A;  4RF1 A;  1VRA B;  4OHJ A;  3P63 A;  1K50 A;  3I57 A;  4A6Q A;  3ZJV A;  1BUI C;  3KWV A;  2G9H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...