2JZAA

Solution nmr structure of nitrite reductase [nad(p)h] small subunit from erwinia carotovora. northeast structural genomics consortium target ewr120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of nitrite reductase [NAD(P)H] small subunit from Erwinia carotovora.
rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Oxidoreductase
molecule keywords Nitrite reductase [NAD(P)H] small subunit
total genus 18
structure length 130
sequence length 130
ec nomenclature ec 1.7.1.4: Nitrite reductase (NAD(P)H).
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13806 Rieske_2 Rieske-like [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2jzaA01
3H1HE 4NB9D 2B24A 1SQBE 1RIEA 2A06E 2YVJB 3L75E 3VMHD 1NDOA 2FYNC 2NUKA 3VCPA 3GTSA 2E74D 3DQYA 4QDFA 1KB9E 4U3FE 3AZCA 4QURA 3CX5E 2E75D 4HM4A 2HMJA 1ULJA 2QPZA 4HM0A 3TGUE 3H1LE 1JM1A 2HMOA 2D2CD 4HJLA 1O7HA 4HM8A 3D89A 2JO6A 4H0LD 4HM6A 3H1JE 4NBAD 1NU1E 4NB8D 2GBXA 1L0NE 4H13D 4QUPA 1EG9A 1G8JB 2NWFA 1BE3E 1VCKA 1VM9A 2NVFA 3GZYA 4HKVA 5CXMA 1NTKE 2YFLA 2HMMA 3C0DA 3H1IE 4PD4E 5KLIC 1NTZE 2E4QA 1NTME 2ZYLA 3GL2A 3FOUA 2XSHA 3GTEA 4AAYB 2BMRA 2BCCE 3CWBE 3GCEA 1Q90C 1O7GA 1UUWA 2QJPC 4HM7A 2IBZE 2E76D 2B1XA 3H1KE 3L72E 3L74E 1SQQE 4H44D 4NBGD 4HM5A 1SQPE 2QJKC 1O7NA 4AIVA 1NYKA 4NBBD 2XSOA 1SJGA 1KYOE 1BCCE 2XRXA 3L71E 4EMJB 3BCCE 4QUQA 2ZT9D 4HM3A 2JZAA 4P1BH 2CKFA 2BMOA 3GOBA 3VMID 3VCAA 2XR8A 2HMKA 4HM2A 3N0QA 3VMGD 4NBHD 1VF5D 1ULIA 4NBDD 2HMLA 2YFJA 4QCKA 5KLVE 2DE7D 3L73E 1UUVA 2FYUE 2NVEA 1EZVE 5KKZC 4P1CH 4NBFD 2Q3WA 5BOKA 1RFSA 2HMNA 1PPJE 1L0LE 2BMQA 5HL4A 3EN1A 5AEUA 1O7PA 4QDCA 1O7MA 2NUMA 3GKEA 2YFIA 2YIUC 2E4PA 4HM1A 3CXHE 1G8KB 1PP9E 4QDDA 5AEWA 3GB4A 3L70E 1WQLA 4NBED 3GZXA 4PV1D 2QJYC 1ZRTE 1O7WA 1P84E 2DE6D 3GL0A 2GBWA 2I7FA 2DE5D 1SQVE 4OGQD 1FQTA 1SQXE 4NBCD 4QDFB 3EQQA 2NVGA
chains in the Genus database with same CATH superfamily
3H1HE 4NB9D 2B24A 1SQBE 1RIEA 2A06E 2YVJB 3L75E 3VMHD 1NDOA 2FYNC 2NUKA 3VCPA 3GTSA 2E74D 3DQYA 4QDFA 1KB9E 4U3FE 3AZCA 4QURA 3CX5E 2E75D 4HM4A 2HMJA 1ULJA 2QPZA 4HM0A 3TGUE 3H1LE 1JM1A 2HMOA 2D2CD 4HJLA 1O7HA 4HM8A 3D89A 2JO6A 4H0LD 4HM6A 3H1JE 4NBAD 1NU1E 4NB8D 2GBXA 1L0NE 4H13D 4QUPA 1EG9A 1G8JB 2NWFA 1BE3E 1VCKA 1VM9A 2NVFA 3GZYA 4HKVA 5CXMA 1NTKE 2YFLA 2HMMA 3C0DA 3H1IE 4PD4E 5KLIC 1NTZE 2E4QA 1NTME 2ZYLA 3GL2A 3FOUA 2XSHA 3GTEA 4AAYB 2BMRA 2BCCE 3CWBE 3GCEA 1Q90C 1O7GA 1UUWA 2QJPC 4HM7A 2IBZE 2E76D 2B1XA 3H1KE 3L72E 3L74E 1SQQE 4H44D 4NBGD 4HM5A 1SQPE 2QJKC 1O7NA 4AIVA 1NYKA 4NBBD 2XSOA 1SJGA 1KYOE 1BCCE 2XRXA 3L71E 4EMJB 3BCCE 4QUQA 2ZT9D 4HM3A 2JZAA 4P1BH 2CKFA 2BMOA 3GOBA 3VMID 3VCAA 2XR8A 2HMKA 4HM2A 3N0QA 3VMGD 4NBHD 1VF5D 1ULIA 4NBDD 2HMLA 2YFJA 4QCKA 5KLVE 2DE7D 3L73E 1UUVA 2FYUE 2NVEA 1EZVE 5KKZC 4P1CH 4NBFD 2Q3WA 5BOKA 1RFSA 2HMNA 1PPJE 1L0LE 2BMQA 5HL4A 3EN1A 5AEUA 1O7PA 4QDCA 1O7MA 2NUMA 3GKEA 2YFIA 2YIUC 2E4PA 4HM1A 3CXHE 1G8KB 1PP9E 4QDDA 5AEWA 3GB4A 3L70E 1WQLA 4NBED 3GZXA 4PV1D 2QJYC 1ZRTE 1O7WA 1P84E 2DE6D 3GL0A 2GBWA 2I7FA 2DE5D 1SQVE 4OGQD 1FQTA 1SQXE 4NBCD 4QDFB 3EQQA 2NVGA
chains in the Genus database with same CATH topology
3H1HE 4NB9D 2B24A 1SQBE 1RIEA 2A06E 2YVJB 3L75E 3VMHD 1NDOA 2FYNC 2NUKA 3VCPA 3GTSA 2E74D 3DQYA 4QDFA 1KB9E 4U3FE 3AZCA 4QURA 3CX5E 2E75D 4HM4A 2HMJA 1ULJA 2QPZA 4HM0A 3TGUE 3H1LE 1JM1A 2HMOA 2D2CD 4HJLA 1O7HA 4HM8A 3D89A 2JO6A 4H0LD 4HM6A 3H1JE 4NBAD 1NU1E 4NB8D 2GBXA 1L0NE 4H13D 4QUPA 1EG9A 1G8JB 2NWFA 1BE3E 1VCKA 1VM9A 2NVFA 3GZYA 4HKVA 5CXMA 1NTKE 2YFLA 2HMMA 3C0DA 3H1IE 4PD4E 5KLIC 1NTZE 2E4QA 1NTME 2ZYLA 3GL2A 3FOUA 2XSHA 3GTEA 4AAYB 2BMRA 2BCCE 3CWBE 3GCEA 1Q90C 1O7GA 1UUWA 2QJPC 4HM7A 2IBZE 2E76D 2B1XA 3H1KE 3L72E 3L74E 1SQQE 4H44D 4NBGD 4HM5A 1SQPE 2QJKC 1O7NA 4AIVA 1NYKA 4NBBD 2XSOA 1SJGA 1KYOE 1BCCE 2XRXA 3L71E 4EMJB 3BCCE 4QUQA 2ZT9D 4HM3A 2JZAA 4P1BH 2CKFA 2BMOA 3GOBA 3VMID 3VCAA 2XR8A 2HMKA 4HM2A 3N0QA 3VMGD 4NBHD 1VF5D 1ULIA 4NBDD 2HMLA 2YFJA 4QCKA 5KLVE 2DE7D 3L73E 1UUVA 2FYUE 2NVEA 1EZVE 5KKZC 4P1CH 4NBFD 2Q3WA 5BOKA 1RFSA 2HMNA 1PPJE 1L0LE 2BMQA 5HL4A 3EN1A 5AEUA 1O7PA 4QDCA 1O7MA 2NUMA 3GKEA 2YFIA 2YIUC 2E4PA 4HM1A 3CXHE 1G8KB 1PP9E 4QDDA 5AEWA 3GB4A 3L70E 1WQLA 4NBED 3GZXA 4PV1D 2QJYC 1ZRTE 1O7WA 1P84E 2DE6D 3GL0A 2GBWA 2I7FA 2DE5D 1SQVE 4OGQD 1FQTA 1SQXE 4NBCD 4QDFB 3EQQA 2NVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H E;  4NB9 D;  2B24 A;  1SQB E;  1RIE A;  2A06 E;  2YVJ B;  3L75 E;  3VMH D;  1NDO A;  2FYN C;  2NUK A;  3VCP A;  3GTS A;  2E74 D;  3DQY A;  4QDF A;  1KB9 E;  4U3F E;  3AZC A;  4QUR A;  3CX5 E;  2E75 D;  4HM4 A;  2HMJ A;  1ULJ A;  2QPZ A;  4HM0 A;  3TGU E;  3H1L E;  1JM1 A;  2HMO A;  2D2C D;  4HJL A;  1O7H A;  4HM8 A;  3D89 A;  2JO6 A;  4H0L D;  4HM6 A;  3H1J E;  4NBA D;  1NU1 E;  4NB8 D;  2GBX A;  1L0N E;  4H13 D;  4QUP A;  1EG9 A;  1G8J B;  2NWF A;  1BE3 E;  1VCK A;  1VM9 A;  2NVF A;  3GZY A;  4HKV A;  5CXM A;  1NTK E;  2YFL A;  2HMM A;  3C0D A;  3H1I E;  4PD4 E;  5KLI C;  1NTZ E;  2E4Q A;  1NTM E;  2ZYL A;  3GL2 A;  3FOU A;  2XSH A;  3GTE A;  4AAY B;  2BMR A;  2BCC E;  3CWB E;  3GCE A;  1Q90 C;  1O7G A;  1UUW A;  2QJP C;  4HM7 A;  2IBZ E;  2E76 D;  2B1X A;  3H1K E;  3L72 E;  3L74 E;  1SQQ E;  4H44 D;  4NBG D;  4HM5 A;  1SQP E;  2QJK C;  1O7N A;  4AIV A;  1NYK A;  4NBB D;  2XSO A;  1SJG A;  1KYO E;  1BCC E;  2XRX A;  3L71 E;  4EMJ B;  3BCC E;  4QUQ A;  2ZT9 D;  4HM3 A;  2JZA A;  4P1B H;  2CKF A;  2BMO A;  3GOB A;  3VMI D;  3VCA A;  2XR8 A;  2HMK A;  4HM2 A;  3N0Q A;  3VMG D;  4NBH D;  1VF5 D;  1ULI A;  4NBD D;  2HML A;  2YFJ A;  4QCK A;  5KLV E;  2DE7 D;  3L73 E;  1UUV A;  2FYU E;  2NVE A;  1EZV E;  5KKZ C;  4P1C H;  4NBF D;  2Q3W A;  5BOK A;  1RFS A;  2HMN A;  1PPJ E;  1L0L E;  2BMQ A;  5HL4 A;  3EN1 A;  5AEU A;  1O7P A;  4QDC A;  1O7M A;  2NUM A;  3GKE A;  2YFI A;  2YIU C;  2E4P A;  4HM1 A;  3CXH E;  1G8K B;  1PP9 E;  4QDD A;  5AEW A;  3GB4 A;  3L70 E;  1WQL A;  4NBE D;  3GZX A;  4PV1 D;  2QJY C;  1ZRT E;  1O7W A;  1P84 E;  2DE6 D;  3GL0 A;  2GBW A;  2I7F A;  2DE5 D;  1SQV E;  4OGQ D;  1FQT A;  1SQX E;  4NBC D;  4QDF B;  3EQQ A;  2NVG A; 
#chains in the Genus database with same CATH topology
 3H1H E;  4NB9 D;  2B24 A;  1SQB E;  1RIE A;  2A06 E;  2YVJ B;  3L75 E;  3VMH D;  1NDO A;  2FYN C;  2NUK A;  3VCP A;  3GTS A;  2E74 D;  3DQY A;  4QDF A;  1KB9 E;  4U3F E;  3AZC A;  4QUR A;  3CX5 E;  2E75 D;  4HM4 A;  2HMJ A;  1ULJ A;  2QPZ A;  4HM0 A;  3TGU E;  3H1L E;  1JM1 A;  2HMO A;  2D2C D;  4HJL A;  1O7H A;  4HM8 A;  3D89 A;  2JO6 A;  4H0L D;  4HM6 A;  3H1J E;  4NBA D;  1NU1 E;  4NB8 D;  2GBX A;  1L0N E;  4H13 D;  4QUP A;  1EG9 A;  1G8J B;  2NWF A;  1BE3 E;  1VCK A;  1VM9 A;  2NVF A;  3GZY A;  4HKV A;  5CXM A;  1NTK E;  2YFL A;  2HMM A;  3C0D A;  3H1I E;  4PD4 E;  5KLI C;  1NTZ E;  2E4Q A;  1NTM E;  2ZYL A;  3GL2 A;  3FOU A;  2XSH A;  3GTE A;  4AAY B;  2BMR A;  2BCC E;  3CWB E;  3GCE A;  1Q90 C;  1O7G A;  1UUW A;  2QJP C;  4HM7 A;  2IBZ E;  2E76 D;  2B1X A;  3H1K E;  3L72 E;  3L74 E;  1SQQ E;  4H44 D;  4NBG D;  4HM5 A;  1SQP E;  2QJK C;  1O7N A;  4AIV A;  1NYK A;  4NBB D;  2XSO A;  1SJG A;  1KYO E;  1BCC E;  2XRX A;  3L71 E;  4EMJ B;  3BCC E;  4QUQ A;  2ZT9 D;  4HM3 A;  2JZA A;  4P1B H;  2CKF A;  2BMO A;  3GOB A;  3VMI D;  3VCA A;  2XR8 A;  2HMK A;  4HM2 A;  3N0Q A;  3VMG D;  4NBH D;  1VF5 D;  1ULI A;  4NBD D;  2HML A;  2YFJ A;  4QCK A;  5KLV E;  2DE7 D;  3L73 E;  1UUV A;  2FYU E;  2NVE A;  1EZV E;  5KKZ C;  4P1C H;  4NBF D;  2Q3W A;  5BOK A;  1RFS A;  2HMN A;  1PPJ E;  1L0L E;  2BMQ A;  5HL4 A;  3EN1 A;  5AEU A;  1O7P A;  4QDC A;  1O7M A;  2NUM A;  3GKE A;  2YFI A;  2YIU C;  2E4P A;  4HM1 A;  3CXH E;  1G8K B;  1PP9 E;  4QDD A;  5AEW A;  3GB4 A;  3L70 E;  1WQL A;  4NBE D;  3GZX A;  4PV1 D;  2QJY C;  1ZRT E;  1O7W A;  1P84 E;  2DE6 D;  3GL0 A;  2GBW A;  2I7F A;  2DE5 D;  1SQV E;  4OGQ D;  1FQT A;  1SQX E;  4NBC D;  4QDF B;  3EQQ A;  2NVG A; 
#chains in the Genus database with same CATH homology
 3H1H E;  4NB9 D;  2B24 A;  1SQB E;  1RIE A;  2A06 E;  2YVJ B;  3L75 E;  3VMH D;  1NDO A;  2FYN C;  2NUK A;  3VCP A;  3GTS A;  2E74 D;  3DQY A;  4QDF A;  1KB9 E;  4U3F E;  3AZC A;  4QUR A;  3CX5 E;  2E75 D;  4HM4 A;  2HMJ A;  1ULJ A;  2QPZ A;  4HM0 A;  3TGU E;  3H1L E;  1JM1 A;  2HMO A;  2D2C D;  4HJL A;  1O7H A;  4HM8 A;  3D89 A;  2JO6 A;  4H0L D;  4HM6 A;  3H1J E;  4NBA D;  1NU1 E;  4NB8 D;  2GBX A;  1L0N E;  4H13 D;  4QUP A;  1EG9 A;  1G8J B;  2NWF A;  1BE3 E;  1VCK A;  1VM9 A;  2NVF A;  3GZY A;  4HKV A;  5CXM A;  1NTK E;  2YFL A;  2HMM A;  3C0D A;  3H1I E;  4PD4 E;  5KLI C;  1NTZ E;  2E4Q A;  1NTM E;  2ZYL A;  3GL2 A;  3FOU A;  2XSH A;  3GTE A;  4AAY B;  2BMR A;  2BCC E;  3CWB E;  3GCE A;  1Q90 C;  1O7G A;  1UUW A;  2QJP C;  4HM7 A;  2IBZ E;  2E76 D;  2B1X A;  3H1K E;  3L72 E;  3L74 E;  1SQQ E;  4H44 D;  4NBG D;  4HM5 A;  1SQP E;  2QJK C;  1O7N A;  4AIV A;  1NYK A;  4NBB D;  2XSO A;  1SJG A;  1KYO E;  1BCC E;  2XRX A;  3L71 E;  4EMJ B;  3BCC E;  4QUQ A;  2ZT9 D;  4HM3 A;  2JZA A;  4P1B H;  2CKF A;  2BMO A;  3GOB A;  3VMI D;  3VCA A;  2XR8 A;  2HMK A;  4HM2 A;  3N0Q A;  3VMG D;  4NBH D;  1VF5 D;  1ULI A;  4NBD D;  2HML A;  2YFJ A;  4QCK A;  5KLV E;  2DE7 D;  3L73 E;  1UUV A;  2FYU E;  2NVE A;  1EZV E;  5KKZ C;  4P1C H;  4NBF D;  2Q3W A;  5BOK A;  1RFS A;  2HMN A;  1PPJ E;  1L0L E;  2BMQ A;  5HL4 A;  3EN1 A;  5AEU A;  1O7P A;  4QDC A;  1O7M A;  2NUM A;  3GKE A;  2YFI A;  2YIU C;  2E4P A;  4HM1 A;  3CXH E;  1G8K B;  1PP9 E;  4QDD A;  5AEW A;  3GB4 A;  3L70 E;  1WQL A;  4NBE D;  3GZX A;  4PV1 D;  2QJY C;  1ZRT E;  1O7W A;  1P84 E;  2DE6 D;  3GL0 A;  2GBW A;  2I7F A;  2DE5 D;  1SQV E;  4OGQ D;  1FQT A;  1SQX E;  4NBC D;  4QDF B;  3EQQ A;  2NVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...