2JZAA

Solution nmr structure of nitrite reductase [nad(p)h] small subunit from erwinia carotovora. northeast structural genomics consortium target ewr120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
130
structure length
130
Chain Sequence
b'MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLPLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase [NAD(P)H] small subunit
publication title Solution NMR structure of nitrite reductase [NAD(P)H] small subunit from Erwinia carotovora.
rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Oxidoreductase
total genus 18
structure length 130
sequence length 130
ec nomenclature ec 1.7.1.4: Nitrite reductase (NAD(P)H).
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13806 Rieske_2 Rieske-like [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2jzaA01
2ZT9D 4NBHD 3VCAA 1BE3E 4QCKA 2HMMA 1NYKA 2YVJB 3DQYA 5CXMA 2Q3WA 4HM3A 1O7MA 3L73E 4QDFB 4QUPA 3GZXA 1NDOA 4HM2A 4QUQA 1BCCE 3VMGD 4NBDD 4HKVA 2NVEA 2E4QA 1ULIA 2NUKA 2HMJA 3VMID 4U3FE 3GL2A 2NVGA 2YFJA 2DE5D 4H0LD 1VCKA 4NBBD 3GCEA 3AZCA 2NUMA 1SQVE 3GB4A 2QJPC 1NTZE 3GTSA 1ULJA 3GZYA 2HMKA 3VCPA 2XSOA 2E75D 2YFLA 4AAYB 2QJYC 3L75E 1NTME 1UUVA 1SQXE 5KLIC 2HMNA 3BCCE 3L72E 2BMQA 1EG9A 3EQQA 4NBGD 4HJLA 3D89A 3H1HE 4NB9D 1O7NA 1KB9E 4H13D 1SJGA 5AEUA 3CXHE 2E74D 2FYUE 4NB8D 1O7GA 4OGQD 2DE7D 3H1IE 4QURA 5AEWA 2QPZA 1L0NE 2ZYLA 4NBAD 4P1BH 1O7PA 2A06E 4PV1D 3GKEA 4QDFA 2NVFA 5KLVE 3VMHD 4HM0A 4P1CH 1G8KB 1RIEA 3CX5E 1NTKE 5BOKA 3GOBA 4NBED 3EN1A 3GL0A 1O7WA 1VF5D 3L71E 2E4PA 3L74E 1SQQE 2BCCE 3CWBE 4HM1A 2YFIA 2JZAA 1G8JB 1ZRTE 4HM4A 4QDCA 1KYOE 1SQBE 4HM7A 4AIVA 2I7FA 3H1KE 1O7HA 3TGUE 2NWFA 2DE6D 1RFSA 2HMOA 2JO6A 3N0QA 1EZVE 1JM1A 4H44D 3C0DA 1L0LE 4NBCD 1SQPE 2BMOA 2IBZE 1PP9E 4HM5A 5KKZC 4NBFD 1WQLA 2HMLA 2B1XA 1UUWA 2B24A 2QJKC 3FOUA 1NU1E 3GTEA 4HM8A 2FYNC 4EMJB 2XR8A 2XSHA 3H1JE 2D2CD 2GBWA 2GBXA 3H1LE 4QDDA 2E76D 2XRXA 1Q90C 4PD4E 4HM6A 1VM9A 2YIUC 1P84E 2CKFA 2BMRA 5HL4A 1FQTA 1PPJE 3L70E
chains in the Genus database with same CATH superfamily
2ZT9D 4NBHD 3VCAA 1BE3E 4QCKA 2HMMA 1NYKA 2YVJB 3DQYA 5CXMA 2Q3WA 4HM3A 1O7MA 3L73E 4QDFB 4QUPA 3GZXA 1NDOA 4HM2A 4QUQA 1BCCE 3VMGD 4NBDD 4HKVA 2NVEA 2E4QA 1ULIA 2NUKA 2HMJA 3VMID 4U3FE 3GL2A 2NVGA 2YFJA 2DE5D 4H0LD 1VCKA 4NBBD 3GCEA 3AZCA 2NUMA 1SQVE 3GB4A 2QJPC 1NTZE 3GTSA 1ULJA 3GZYA 2HMKA 3VCPA 2XSOA 2E75D 2YFLA 4AAYB 2QJYC 3L75E 1NTME 1UUVA 1SQXE 5KLIC 2HMNA 3BCCE 3L72E 2BMQA 1EG9A 3EQQA 4NBGD 4HJLA 3D89A 3H1HE 4NB9D 1O7NA 1KB9E 4H13D 1SJGA 5AEUA 3CXHE 2E74D 2FYUE 4NB8D 1O7GA 4OGQD 2DE7D 3H1IE 4QURA 5AEWA 2QPZA 1L0NE 2ZYLA 4NBAD 4P1BH 1O7PA 2A06E 4PV1D 3GKEA 4QDFA 2NVFA 5KLVE 3VMHD 4HM0A 4P1CH 1G8KB 1RIEA 3CX5E 1NTKE 5BOKA 3GOBA 4NBED 3EN1A 3GL0A 1O7WA 1VF5D 3L71E 2E4PA 3L74E 1SQQE 2BCCE 3CWBE 4HM1A 2YFIA 2JZAA 1G8JB 1ZRTE 4HM4A 4QDCA 1KYOE 1SQBE 4HM7A 4AIVA 2I7FA 3H1KE 1O7HA 3TGUE 2NWFA 2DE6D 1RFSA 2HMOA 2JO6A 3N0QA 1EZVE 1JM1A 4H44D 3C0DA 1L0LE 4NBCD 1SQPE 2BMOA 2IBZE 1PP9E 4HM5A 5KKZC 4NBFD 1WQLA 2HMLA 2B1XA 1UUWA 2B24A 2QJKC 3FOUA 1NU1E 3GTEA 4HM8A 2FYNC 4EMJB 2XR8A 2XSHA 3H1JE 2D2CD 2GBWA 2GBXA 3H1LE 4QDDA 2E76D 2XRXA 1Q90C 4PD4E 4HM6A 1VM9A 2YIUC 1P84E 2CKFA 2BMRA 5HL4A 1FQTA 1PPJE 3L70E
chains in the Genus database with same CATH topology
2ZT9D 4NBHD 3VCAA 1BE3E 4QCKA 2HMMA 1NYKA 2YVJB 3DQYA 5CXMA 2Q3WA 4HM3A 1O7MA 3L73E 4QDFB 4QUPA 3GZXA 1NDOA 4HM2A 4QUQA 1BCCE 3VMGD 4NBDD 4HKVA 2NVEA 2E4QA 1ULIA 2NUKA 2HMJA 3VMID 4U3FE 3GL2A 2NVGA 2YFJA 2DE5D 4H0LD 1VCKA 4NBBD 3GCEA 3AZCA 2NUMA 1SQVE 3GB4A 2QJPC 1NTZE 3GTSA 1ULJA 3GZYA 2HMKA 3VCPA 2XSOA 2E75D 2YFLA 4AAYB 2QJYC 3L75E 1NTME 1UUVA 1SQXE 5KLIC 2HMNA 3BCCE 3L72E 2BMQA 1EG9A 3EQQA 4NBGD 4HJLA 3D89A 3H1HE 4NB9D 1O7NA 1KB9E 4H13D 1SJGA 5AEUA 3CXHE 2E74D 2FYUE 4NB8D 1O7GA 4OGQD 2DE7D 3H1IE 4QURA 5AEWA 2QPZA 1L0NE 2ZYLA 4NBAD 4P1BH 1O7PA 2A06E 4PV1D 3GKEA 4QDFA 2NVFA 5KLVE 3VMHD 4HM0A 4P1CH 1G8KB 1RIEA 3CX5E 1NTKE 5BOKA 3GOBA 4NBED 3EN1A 3GL0A 1O7WA 1VF5D 3L71E 2E4PA 3L74E 1SQQE 2BCCE 3CWBE 4HM1A 2YFIA 2JZAA 1G8JB 1ZRTE 4HM4A 4QDCA 1KYOE 1SQBE 4HM7A 4AIVA 2I7FA 3H1KE 1O7HA 3TGUE 2NWFA 2DE6D 1RFSA 2HMOA 2JO6A 3N0QA 1EZVE 1JM1A 4H44D 3C0DA 1L0LE 4NBCD 1SQPE 2BMOA 2IBZE 1PP9E 4HM5A 5KKZC 4NBFD 1WQLA 2HMLA 2B1XA 1UUWA 2B24A 2QJKC 3FOUA 1NU1E 3GTEA 4HM8A 2FYNC 4EMJB 2XR8A 2XSHA 3H1JE 2D2CD 2GBWA 2GBXA 3H1LE 4QDDA 2E76D 2XRXA 1Q90C 4PD4E 4HM6A 1VM9A 2YIUC 1P84E 2CKFA 2BMRA 5HL4A 1FQTA 1PPJE 3L70E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 D;  4NBH D;  3VCA A;  1BE3 E;  4QCK A;  2HMM A;  1NYK A;  2YVJ B;  3DQY A;  5CXM A;  2Q3W A;  4HM3 A;  1O7M A;  3L73 E;  4QDF B;  4QUP A;  3GZX A;  1NDO A;  4HM2 A;  4QUQ A;  1BCC E;  3VMG D;  4NBD D;  4HKV A;  2NVE A;  2E4Q A;  1ULI A;  2NUK A;  2HMJ A;  3VMI D;  4U3F E;  3GL2 A;  2NVG A;  2YFJ A;  2DE5 D;  4H0L D;  1VCK A;  4NBB D;  3GCE A;  3AZC A;  2NUM A;  1SQV E;  3GB4 A;  2QJP C;  1NTZ E;  3GTS A;  1ULJ A;  3GZY A;  2HMK A;  3VCP A;  2XSO A;  2E75 D;  2YFL A;  4AAY B;  2QJY C;  3L75 E;  1NTM E;  1UUV A;  1SQX E;  5KLI C;  2HMN A;  3BCC E;  3L72 E;  2BMQ A;  1EG9 A;  3EQQ A;  4NBG D;  4HJL A;  3D89 A;  3H1H E;  4NB9 D;  1O7N A;  1KB9 E;  4H13 D;  1SJG A;  5AEU A;  3CXH E;  2E74 D;  2FYU E;  4NB8 D;  1O7G A;  4OGQ D;  2DE7 D;  3H1I E;  4QUR A;  5AEW A;  2QPZ A;  1L0N E;  2ZYL A;  4NBA D;  4P1B H;  1O7P A;  2A06 E;  4PV1 D;  3GKE A;  4QDF A;  2NVF A;  5KLV E;  3VMH D;  4HM0 A;  4P1C H;  1G8K B;  1RIE A;  3CX5 E;  1NTK E;  5BOK A;  3GOB A;  4NBE D;  3EN1 A;  3GL0 A;  1O7W A;  1VF5 D;  3L71 E;  2E4P A;  3L74 E;  1SQQ E;  2BCC E;  3CWB E;  4HM1 A;  2YFI A;  2JZA A;  1G8J B;  1ZRT E;  4HM4 A;  4QDC A;  1KYO E;  1SQB E;  4HM7 A;  4AIV A;  2I7F A;  3H1K E;  1O7H A;  3TGU E;  2NWF A;  2DE6 D;  1RFS A;  2HMO A;  2JO6 A;  3N0Q A;  1EZV E;  1JM1 A;  4H44 D;  3C0D A;  1L0L E;  4NBC D;  1SQP E;  2BMO A;  2IBZ E;  1PP9 E;  4HM5 A;  5KKZ C;  4NBF D;  1WQL A;  2HML A;  2B1X A;  1UUW A;  2B24 A;  2QJK C;  3FOU A;  1NU1 E;  3GTE A;  4HM8 A;  2FYN C;  4EMJ B;  2XR8 A;  2XSH A;  3H1J E;  2D2C D;  2GBW A;  2GBX A;  3H1L E;  4QDD A;  2E76 D;  2XRX A;  1Q90 C;  4PD4 E;  4HM6 A;  1VM9 A;  2YIU C;  1P84 E;  2CKF A;  2BMR A;  5HL4 A;  1FQT A;  1PPJ E;  3L70 E; 
#chains in the Genus database with same CATH topology
 2ZT9 D;  4NBH D;  3VCA A;  1BE3 E;  4QCK A;  2HMM A;  1NYK A;  2YVJ B;  3DQY A;  5CXM A;  2Q3W A;  4HM3 A;  1O7M A;  3L73 E;  4QDF B;  4QUP A;  3GZX A;  1NDO A;  4HM2 A;  4QUQ A;  1BCC E;  3VMG D;  4NBD D;  4HKV A;  2NVE A;  2E4Q A;  1ULI A;  2NUK A;  2HMJ A;  3VMI D;  4U3F E;  3GL2 A;  2NVG A;  2YFJ A;  2DE5 D;  4H0L D;  1VCK A;  4NBB D;  3GCE A;  3AZC A;  2NUM A;  1SQV E;  3GB4 A;  2QJP C;  1NTZ E;  3GTS A;  1ULJ A;  3GZY A;  2HMK A;  3VCP A;  2XSO A;  2E75 D;  2YFL A;  4AAY B;  2QJY C;  3L75 E;  1NTM E;  1UUV A;  1SQX E;  5KLI C;  2HMN A;  3BCC E;  3L72 E;  2BMQ A;  1EG9 A;  3EQQ A;  4NBG D;  4HJL A;  3D89 A;  3H1H E;  4NB9 D;  1O7N A;  1KB9 E;  4H13 D;  1SJG A;  5AEU A;  3CXH E;  2E74 D;  2FYU E;  4NB8 D;  1O7G A;  4OGQ D;  2DE7 D;  3H1I E;  4QUR A;  5AEW A;  2QPZ A;  1L0N E;  2ZYL A;  4NBA D;  4P1B H;  1O7P A;  2A06 E;  4PV1 D;  3GKE A;  4QDF A;  2NVF A;  5KLV E;  3VMH D;  4HM0 A;  4P1C H;  1G8K B;  1RIE A;  3CX5 E;  1NTK E;  5BOK A;  3GOB A;  4NBE D;  3EN1 A;  3GL0 A;  1O7W A;  1VF5 D;  3L71 E;  2E4P A;  3L74 E;  1SQQ E;  2BCC E;  3CWB E;  4HM1 A;  2YFI A;  2JZA A;  1G8J B;  1ZRT E;  4HM4 A;  4QDC A;  1KYO E;  1SQB E;  4HM7 A;  4AIV A;  2I7F A;  3H1K E;  1O7H A;  3TGU E;  2NWF A;  2DE6 D;  1RFS A;  2HMO A;  2JO6 A;  3N0Q A;  1EZV E;  1JM1 A;  4H44 D;  3C0D A;  1L0L E;  4NBC D;  1SQP E;  2BMO A;  2IBZ E;  1PP9 E;  4HM5 A;  5KKZ C;  4NBF D;  1WQL A;  2HML A;  2B1X A;  1UUW A;  2B24 A;  2QJK C;  3FOU A;  1NU1 E;  3GTE A;  4HM8 A;  2FYN C;  4EMJ B;  2XR8 A;  2XSH A;  3H1J E;  2D2C D;  2GBW A;  2GBX A;  3H1L E;  4QDD A;  2E76 D;  2XRX A;  1Q90 C;  4PD4 E;  4HM6 A;  1VM9 A;  2YIU C;  1P84 E;  2CKF A;  2BMR A;  5HL4 A;  1FQT A;  1PPJ E;  3L70 E; 
#chains in the Genus database with same CATH homology
 2ZT9 D;  4NBH D;  3VCA A;  1BE3 E;  4QCK A;  2HMM A;  1NYK A;  2YVJ B;  3DQY A;  5CXM A;  2Q3W A;  4HM3 A;  1O7M A;  3L73 E;  4QDF B;  4QUP A;  3GZX A;  1NDO A;  4HM2 A;  4QUQ A;  1BCC E;  3VMG D;  4NBD D;  4HKV A;  2NVE A;  2E4Q A;  1ULI A;  2NUK A;  2HMJ A;  3VMI D;  4U3F E;  3GL2 A;  2NVG A;  2YFJ A;  2DE5 D;  4H0L D;  1VCK A;  4NBB D;  3GCE A;  3AZC A;  2NUM A;  1SQV E;  3GB4 A;  2QJP C;  1NTZ E;  3GTS A;  1ULJ A;  3GZY A;  2HMK A;  3VCP A;  2XSO A;  2E75 D;  2YFL A;  4AAY B;  2QJY C;  3L75 E;  1NTM E;  1UUV A;  1SQX E;  5KLI C;  2HMN A;  3BCC E;  3L72 E;  2BMQ A;  1EG9 A;  3EQQ A;  4NBG D;  4HJL A;  3D89 A;  3H1H E;  4NB9 D;  1O7N A;  1KB9 E;  4H13 D;  1SJG A;  5AEU A;  3CXH E;  2E74 D;  2FYU E;  4NB8 D;  1O7G A;  4OGQ D;  2DE7 D;  3H1I E;  4QUR A;  5AEW A;  2QPZ A;  1L0N E;  2ZYL A;  4NBA D;  4P1B H;  1O7P A;  2A06 E;  4PV1 D;  3GKE A;  4QDF A;  2NVF A;  5KLV E;  3VMH D;  4HM0 A;  4P1C H;  1G8K B;  1RIE A;  3CX5 E;  1NTK E;  5BOK A;  3GOB A;  4NBE D;  3EN1 A;  3GL0 A;  1O7W A;  1VF5 D;  3L71 E;  2E4P A;  3L74 E;  1SQQ E;  2BCC E;  3CWB E;  4HM1 A;  2YFI A;  2JZA A;  1G8J B;  1ZRT E;  4HM4 A;  4QDC A;  1KYO E;  1SQB E;  4HM7 A;  4AIV A;  2I7F A;  3H1K E;  1O7H A;  3TGU E;  2NWF A;  2DE6 D;  1RFS A;  2HMO A;  2JO6 A;  3N0Q A;  1EZV E;  1JM1 A;  4H44 D;  3C0D A;  1L0L E;  4NBC D;  1SQP E;  2BMO A;  2IBZ E;  1PP9 E;  4HM5 A;  5KKZ C;  4NBF D;  1WQL A;  2HML A;  2B1X A;  1UUW A;  2B24 A;  2QJK C;  3FOU A;  1NU1 E;  3GTE A;  4HM8 A;  2FYN C;  4EMJ B;  2XR8 A;  2XSH A;  3H1J E;  2D2C D;  2GBW A;  2GBX A;  3H1L E;  4QDD A;  2E76 D;  2XRX A;  1Q90 C;  4PD4 E;  4HM6 A;  1VM9 A;  2YIU C;  1P84 E;  2CKF A;  2BMR A;  5HL4 A;  1FQT A;  1PPJ E;  3L70 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...