2JZBA

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 17
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbA00
4RU9A 5DLFA 1ZQRA 3JPSA 1T4GA 5KFXA 4DFJA 4MEXA 1ZQCA 4ED8A 4O3OA 2ZJAA 3GIIA 3T5HA 5EOZA 9ICFA 4KLSA 4P2HA 4QZ8A 3V72A 4ED1A 4YN4A 4JUZA 3RB3A 4EEYA 9ICWA 3MFHA 5J2GA 5DB9A 1NK4A 4R65A 2V4QA 4M6WB 4ECWA 2RDIA 3RJIA 3JPRA 2W8KA 8ICOA 4O3PA 4YP3A 1HJPA 5J0WA 3EYZA 4I2IA 2ZTDA 4NXZA 4MF2A 4KLHA 3MR6A 4M2YA 2FMSA 3IHQB 2J6SA 4FBUA 8ICPA 2OWOA 4P4OA 4I28A 4QZFA 5IILA 4PHAA 2KZ3A 5TZVA 2MUTA 3RBDA 2UVUA 2HW3A 4F2RA 4O3SA 8ICHA 3OJUA 1ZQVA 4UAYA 3RTVA 4QWDA 9ICUA 2IHNA 5J29A 1BPEA 5KFFA 1CUKA 3THVA 5CR0A 2PFNA 1NOMA 5DLGA 4F4ZA 2AGOA 4IR9A 2JEIA 1NJWA 1D8LA 3RJEA 2ZTEA 4YR3A 4I2GA 3PW4A 1X9MA 3BQ0A 5IIOA 5J0PA 4PGXA 3OGUA 4YXMA 4ECTA 2XO7A 1RPLA 1Y88A 4DSFA 1A77A 3SV4A 4KLDA 4UB2A 7ICGA 4DOAA 3C1YA 1IXRA 3MBYA 4ELTA 5DB8A 8ICEA 2W9BB 3OJSA 4KITB 5L1JA 4Z6EA 4UB5A 3OHAA 2HHSA 3HT3A 4EZ9A 1RXWA 4DOCA 7ICOA 3BDPA 1S97A 2DPIA 2ZJ5A 7ICKA 4YR0A 4XUSA 1XWLA 1ZJNA 3LDAA 2BCSA 1U9LA 1ZQSA 1ZQWA 9ICVA 5KFCA 4I2JA 2HHXA 2ASJA 4UAWA 3G6XA 4X5VA 3KHHA 1NJXA 1MQ2A 5DGAA 4PHEA 4RQ3A 4J9NA 3SYZA 4DFKA 3N4MB 2FMPA 5IIKA 5DBBA 2ASLA 2PFOA 1S9FA 4GXKA 1X9SA 4QZEA 5BOMA 3KHGA 2NRWA 1QSLA 2VANA 3GIMA 4IRKA 4Q8EA 3HW8A 4M9GA 4I2EA 5J0UA 3BJYA 1U4BA 4IR1A 2R8GA 4R8UA 2VA2A 1EXNA 4F5NA 4TURA 1LB2B 3TAPA 1ZQOA 3UXNA 7ICPA 1C7YA 5KFGA 2C2DA 3Q8LA 4F92B 5DB6A 3Q8SB 2H5XA 4UB4A 4RQ7A 5DDYA 5KFAA 4BXOB 5KT6A 3H8JA 3MDCA 1COOA 4IQWA 1L3TA 4QZDA 4DL4A 5J0SA 3RH4A 2AGPA 9ICNA 4QZBA 3GQCA 2XC9A 4J9OA 4ECZA 4TQSA 7ICSA 8ICKA 4R64A 5F9LA 4BWJA 2NRXA 1RZTA 1SL0A 2GWSA 1XSPA 1RYSA 4RNMA 2B21A 7ICNA 3PW0A 4DLGA 4O5KA 3PO5A 4I27A 5KFMA 3RB4A 4F4XA 5J2EA 2FPLA 5KFQA 2AGQA 2IHMA 3RRGA 1X2IA 4MFCA 3HPOA 4I2CA 4J9MA 4RNNA 4F93B 4E0DA 5KFIA 5KFTA 4O9MA 2A1JB 2ISOA 7ICQA 3G6VA 4DFPA 1H38A 3TFRA 5KFHA 2NRZA 1ZQIA 4YVZA 4QZCA 3TANA 2FPMA 5CB1A 1UT5A 4DLEA 4I2FA 2F1HA 5IIJA 4O0IA 1N56A 3RJHA 8ICFA 1ZETA 4XQ8A 4C8NA 3T3FA 2XGQA 5KFVA 1Z3EB 5HMLA 4ECSA 4BDPA 4IRCA 4PPXA 8ICBA 1T8EA 1T3NA 4KLEA 2IMWP 4M47A 2WTFA 7ICJA 2FLPA 4I29A 1RXVA 4GC7A 3KTQA 4UB3A 4TQRA 3HWTA 4R66A 3MGHA 4Z6FA 4UBBA 3UPQA 3NTUA 4KLIA 2HVIA 1QSSA 4EZ6A 3MABA 4Q43A 5DQHA 2ZUDA 2UVWA 1D8YA 2JZBA 5IIIA 1KRPA 3JPPA 3EZ5A 9ICOA 1L5UA 4YMNA 4PH5A 8ICXA 1JX4A 5CWRA 4XRHA 3QZ8A 4I2BA 3MDAA 3SZ2A 2FLNA 3PV8A 3GIJA 1QSYA 4M04A 4I2DA 1NK0A 4RPZA 9ICKA 3ZDCA 1UA0A 3PR4A 1TAQA 9ICAA 2C2RA 2I1QA 4LZDA 4Z6DA 4DL2A 4QZAA 2C22A 4O3NA 5DBAA 1NKEA 4KLOA 1ZQZA 5KFOA 5DKWA 4KLQA 4F8RA 5J2DA 3M9OB 4F5PA 4DL5A 1K1SA 3HX0A 3ORYA 3PW7A 5HP4A 3B0YA 9ICIA 3GILA 1Z00B 3Q8QB 2MUTB 4M9HA 4P4PA 4BXOA 3MR5A 7ICRA 3ZD8A 4FBTA 3QEBZ 3ZDEA 4IQUA 1BPZA 4JV2A 4NM2A 2V4RA 9ICPA 2NRVA 3RAQA 2I9GA 8ICZA 3BQ2A 3V7JA 3PW2A 3RAXA 1K1QA 8ICRA 1ZQEA 2P6UA 4M9JA 5CHGA 5KFSA 4DS5A 4Z6CA 2ASDA 1Z00A 2A1JA 4ECUA 1RYRA 5D46A 1TVAA 4RUCA 4LZGA 1PZNA 3T5KA 3Q8RB 4F2SA 4M0AA 4DSKA 1ZQQA 5J2AA 3MGIA 5EWGA 4F4KA 4PHPA 1L3UA 3E2EA 7ICLA 3H7IA 3BQTA 4DEZA 5D49A 2W9MA 3H8WA 3RJGA 2XGPA 2BQUA 1BGXT 4Q44A 3GV5B 2W9AA 1JXLA 3RH5A 5J0YA 4KLFA 3H4DA 9ICSA 2KFNA 1U45A 3RB6A 1TKDA 2R8IA 4ED7A 1HUZA 3FDSA 1ZQNA 3KHLA 4RQ5A 2Q0ZX 3AUOA 2ZJ8A 1ZYQA 1UA1A 4R63A 3V6HA 4C8LA 1ZQFA 4QW9A 4QW8A 4ECVA 3T5LA 5KFJA 2XY5A 5CJ7A 1KFSA 4F91B 4BGDA 4DO9A 5J0OA 4QZHA 1WCLA 3V6JA 4F4YA 5KFWA 4YMOA 5KG4A 2XCAA 3AU2A 1ZQUA 3V7KA 2BHNA 3BQ1A 2BDPA 2BKEA 4ECRA 1U48A 1QLNA 4ECQA 1TAUA 2BCRA 1TFRA 4JK1A 5DB7A 4J9KA 2HHUA 3PX4A 1N48A 9ICJA 1QTMA 2FLLA 1S76D 3M8SA 3PX6A 9ICHA 1KLNA 4NLNA 5KG0A 4JWNA 3TI0A 4M9NA 3PO4A 2ATLA 4C8MA 3C1ZA 3V7LA 5CA7A 4ZH4A 3C21A 4RPYA 4CCHA 3MR2A 4TUSA 3N97B 1KSPA 2BPGA 8ICAA 1NJYA 2BPFA 3T5JA 3MFIA 4GXIA 4O5CA 1ZQDA 9ICLA 3ZDAA 1ZQAA 3C5FA 3Q8PB 4J9RA 4DFMA 4ECXA 2KZZA 5F9NA 4DL3A 4I2AA 2W8LA 4IQVA 5BOLA 2R8JA 5KFNA 3G6YA 3RB0A 5CP2A 4B9NA 3JPOA 4P4MA 3EW9A 4B9VA 3EPGA 2KFZA 4NLKA 3TFSA 5D4BA 4B9UA 1ZQXA 3B0XA 4QWEA 1SZPA 5J2JA 2BCUA 4C8KA 5KTQA 4TUPA 1KEJA 5HMMA 1ZQTA 1DOQA 2Y1JA 4RPXA 3QEAZ 1XSLA 4I2HA 5KG5A 4LVSA 2HHTA 4RQ6A 3ISDA 1BPYA 5DQGA 8ICGA 5J0RA 1ZQHA 3HP6A 1SKRA 3Q8MA 4Q8FA 3RJFA 8ICUA 1BPXA 4KLMA 9ICXA 4JV0A 2UVVA 5L1LA 3PY8A 7ICEA 9ICRA 3OSPA 3Q8KA 4NLGA 1S0VA 2AQ0A 5J2CA 5KG1A 4RT2A 5IIMA 4J9SA 1NKBA 1SL2A 2JZBB 5KT3A 4KLUA 7ICFA 1ZQLA 3M9NB 1BPBA 2FMQA 4IQTA 1SKSA 5KG7A 3M9MB 5IINA 5KT4A 4GLXA 4DOBA 4B9SA 4K4HA 2MAXA 5BPCA 9ICQA 2M9NA 2BQ3A 4HYKA 4B9TA 4DSLA 1S0NA 1XO1A 2J6TA 5KT5A 5J0TA 3K4GA 5KG2A 4RQ0A 2UVRA 4IRDA 2J6UA 4BWMA 5DDMA 4FO6A 2Y1IA 9ICMA 3UQ2A 4DSEA 2F1JA 3RJKA 1KFDA 8ICQA 2LYHA 5L1KA 5HHIA 5HNKA 4FS2A 4ED3A 1NK9A 2JEFA 7ICHA 3UXPA 4YD2A 4EYIB 4TUQA 5DBCA 3PMNA 5C5JA 3C5GA 2BCQA 7ICTA 4RT3A 3ISCA 3RBEA 9ICEA 3LK9A 1HUOA 1B22A 3EPIA 8ICIA 5KG6A 3QZ7A 4DWIA 3H4BA 1TK0A 4F50A 3SV3A 1T7PA 3K75D 1KTQA 1BPDA 4ECYA 2AQ4A 2R8HA 4M9LA 4DF8A 3ISBA 5HHHA 3UQ0A 3ZD9A 1JXEA 8ICVA 1JMSA 2BPCA 5J2HA 3TARA 1NK8A 1S10A 2IBKA 1JN3A 8ICSA 3H8SA 4UBCA 4O3RA 1CEZA 4F5RA 3PX0A 4F5OA 5DGBA 4YQWA 1ZQYA 4YCXA 4ELVA 2BQRA 2KZMA 2BR0A 1SKWA 4KN7A 3ZDDA 4RQ8A 4C8OA 4DSIA 4KLLA 2ZUCA 4KN4A 4JV1A 4DQSA 2DFLA 3H40A 5JUMA 1D9FA 3M8RA 4DQPA 4JWMA 4NY8A 1L3VA 3EWAA 4G3IA 5DG9A 4F3OA 4J9PA 1S0OA 2JEGA 4GC6A 3C23A 2ISPA 2F1IA 4GXJA 1NK6A 4R8UB 1UT8A 2VA8A 1SL1A 8ICJA 4J9QA 1IM4A 4EBDA 1DGSA 1NJZA 4YMMA 5KT7A 8ICMA 3RR7A 4DQQA 3RH6A 1TV9A 5KFUA 3OSNA 1ZQKA 2PI4A 4KMUA 3RJJA 4Q45A 3PVXA 7ICUA 4K4IA 1XU4A 2XCPA 5EWFA 4RZRA 4UQGA 3MR3A 2W9CA 4YG2A 3GFKB 4O3QA 4EYHB 5EWEA 3PNCA 1S0MA 2ZUBA 5L9XA 1ZQMA 4F4WA 4DSJA 4NLZA 3RRHA 2P66A 3QE9Y 7ICMA 4EBEA 2ZTCA 5KT2A 1XC9A 8ICTA 3GV8B 1TK8A 1NK5A 2HHQA 4F5QA 4QZGA 3OHBA 4RQ1A 4PGQA 2RDJA 2C2EA 2IA6A 1ZQJA 4ED2A 3JPNA 2AU0A 2P6RA 4KLGA 4KLTA 3PR5B 4YR2A 4M6WA 2W9CB 4PHDA 4O5EA 5KFZA 2BCVA 1JIHA 4RQ4A 4DL6A 1XSNA 1LV5A 1ZQGA 9ICCA 4YFKA 1ZQPA 2VA3A 3C2KA 1NK7A 4DQRA 1D9DA 5J2IA 5DQIA 8ICWA 5J2FA 1BVSA 3PW5A 2V9WA 8ICYA 7ICVA 4YD1A 4J9LA 2KTQA 1WCNA 2HHVA 1B43A 5L1IA 2PFPA 2R8KA 2PI5A 1MSWD 4DL7A 4QZ9A 2XY7A 9ICBA 1KFTA 3LWMA 3V6KA 3IM1A 1X9WA 2KN7A 3PMLA 3KHRA 5KFEA 2PXIA 9ICTA 4UB1A 4B9LA 2DPJA 1L3SA 3C2MA 4ELUA 1XS9D 5KFYA 2BGWA 2PFQA 4DS4A 1AROP 5KG3A 4XA5A 5KFKA 2HVHA 1A76A 5DG7A 1ZQBA 2AJQA 4RQ2A 4K4GA 9ICGA 5J0QA 4EBCA 7ICIA 5J0XA 3TQ1A 4NM1A 4ED6A 2NRTA 3SI8A 5J2KA 4DF4A 4DQIA 3FYHA 4QWBA 2XY6A 4QZIA 1ZJMA 3ZDBA 4MF8A 2W9BA 1MQ3A 2C28A 4RNOA 4QWAA 3JPQA 4KTQA 4ED0A 1U47A 3TAQA 1MC8A 4QWCA 4UAZA 4B9MA 3GV7B 5DG8A 1TK5A 2ALZA 1KDHA 1NKCA 8ICLA 3UXOA 3JPTA 3GIKA 5KFDA 2JEJA 5KFLA 3GDXA 3AU6A 2FPKA 4KLJA 2HHWA 8ICCA 1S77D 3RR8A 3C2LA 3LWLA 8ICNA 5KFPA 4MEYA 5KFRA 5J2BA 1U49A 1V9PA 4MFAA 4MFFA 3ETLA 4FS1A 5KFBA 4RUAA 4YXJA 4PGYA 3NGDA
chains in the Genus database with same CATH superfamily
4RU9A 5DLFA 1DRGA 1ZQRA 5KFXA 1ZQCA 3V72A 2FI1A 5J2GA 2RDIA 3KBBA 5T14A 4O3PA 4YP3A 3EYZA 5J0WA 5AKXA 3MR6A 8ICPA 1RG6A 4QZFA 1QH9A 3RBDA 2MUTA 2HW3A 8ICHA 1ZQVA 3E0FA 3IG5A 5KFFA 2ZIUA 4OD0A 4F4ZA 4IR9A 1D8LA 4I2GA 2ZTEA 1X9MA 3BQ0A 5F3XB 4PGXA 3U26A 3DV9A 4UB8U 4ECTA 3LVWA 3IV6A 2XO7A 1RPLA 5ALDA 4UB2A 1IXRA 3HILA 5KL1B 1FO4A 1RXWA 2WAQF 1S97A 2ZIWA 2IOFK 2K60A 1ZJNA 2Y9TA 5KFCA 4I2JA 3SYZA 4KLDA 3F5AA 3M7DA 5BOMA 4Q8EA 4I2EA 4R8UA 4F5NA 4TURA 1C7YA 5KFGA 2CPRA 2C2DA 2G09A 5DDYA 4B6JA 5KFAA 4BXOB 2JH7A 3F5EA 3MDCA 1COOA 1L3TA 4DL4A 5J0SA 2AGPA 9ICNA 2YB4A 3GQCA 7ICSA 7ICNA 2DF4B 3PW0A 1B4FA 5AM3A 4F4XA 2H3ZA 2FPLA 5J2EA 1X2IA 2LI6A 4I2CA 4JB3A 1A6SA 2PKEA 7ICQA 2JGAA 3H0RB 5KFHA 4YVZA 4QZCA 5CB1A 3M1YA 1UT5A 4I2FA 5IIJA 4C4TA 4O0IA 1N56A 4XQ8A 2F2AB 2XGQA 5KFVA 5HMLA 4KLEA 4M47A 2WTFA 7ICJA 4GC7A 1HIWA 4TQRA 4KLIA 2HVIA 2A3VA 1ZOLA 2ZUDA 2EAMA 1K5OA 1KRPA 1N63A 3RFAA 3EZ5A 5ALSA 1JX4A 4G9BA 1CRXA 2FLNA 3PV8A 2K4IA 1UA0A 4UATA 2P35A 3QUQA 2C2RA 2C22A 4Z6DA 4DL2A 2AXTU 2MRLA 3NVYA 2KSOB 5DKWA 3PW7A 5HP4A 2EZXA 2KHQA 9ICIA 1WG8A 4M9HA 3D2NA 1PVQA 1RYUA 4P4PA 4BXOA 4Y2VA 3QEBZ 3QU4A 1SB3C 3RAQA 3NUQA 3BQ2A 2P6UA 2PMZC 4EX7A 2A1JA 5D46A 4GIBA 4M0AA 4PL2A 1ZQQA 5J2AA 5EWGA 4PHPA 3H7IA 2LM4A 4DEZA 1JXLA 3RB6A 2LPEA 1ZQNA 3FDSA 3KHLA 1P7DA 2YN4A 5KFJA 5ALGA 4F91B 4DO9A 3V6JA 4C0ZA 4YMOA 2YB1A 3I1YA 3V7KA 4ECRA 1U48A 2KHVA 1IG6A 3M8SA 2IOHA 4CF4A 4C8MA 3C1ZA 4ZH4A 1RDFA 3C21A 1O03A 4US9A 1KSPA 5AI9A 2BPGA 1NJYA 2BPFA 4OO1J 3BS7A 5CEHA 4FFDA 1LKYA 5F9NA 1X6JA 4IQVA 1Q46A 1SZPA 2BCUA 2Y1JA 4RPXA 1F5SA 1SKRA 3RJFA 5G5HA 8ICUA 5ALZA 1BPXA 4KLMA 2ODGA 3PY8A 4Y2PA 3OSPA 3QUCA 1S0VA 2AQ0A 5KG1A 2WF8A 5IIMA 2JZBB 2KJ9A 4AYBC 1IV8A 5KG7A 5AK3A 4P0PA 4CNQA 5KT4A 5BPCA 4QNLA 4Y2QA 2BQ3A 4PL1A 4HYKA 4DSLA 1S0NA 3KFUF 1XO1A 1FEZA 5KG2A 4IRDA 3AQEA 4FO6A 3UQ2A 2F1JA 3RJKA 5HR6A 1BNPA 4FS2A 1NZPA 3HJEA 1RM6C 2WAQC 3PMNA 2BCQA 7ICTA 3ISCA 9ICEA 4DWIA 3H4BA 1BPDA 2EAPA 4M9LA 3PZPA 1X9XA 2OEHA 5HHHA 1Z1VA 3ZD9A 1NK8A 4UBCA 2OXOA 2JMGA 3PX0A 1ZQYA 2KZMA 1ECWA 4RQ8A 4C8OA 1X40A 2K8AA 2ZUCA 4KN4A 3UM9A 5AIAA 4JV1A 3H40A 2ES6A 4JWMA 3AQFA 2LYAA 5DG9A 4F3OA 4F72A 4GXJA 4R8UB 2W54A 4FZMA 4USAA 2KKVA 3AEVA 1NJZA 4YMMA 2XVTA 5KT7A 8ICMA 2CXYA 4DQQA 3OSNA 1QCKA 4Q45A 3PVXA 4C80A 7ICUA 1XU4A 4RZRA 2EQYA 4UQGA 4EYHB 2ZUBA 5L9XA 4F4WA 2QB0B 4P0PB 1L8LA 1L7PA 2JV3A 1XC9A 1PK1B 2KEYA 2C2EA 4PGQA 3JPNA 2VJ4A 4M6WA 3CNHA 3TKAA 1LV5A 1S8OA 1ZQPA 2VA3A 1N61A 5J2FA 8ICYA 1JALA 7ICVA 5L1IA 4DL7A 4F71A 4QZ9A 1N2XA 1X9WA 1ZRNA 2WB1C 5CRXA 5KFEA 1FIQA 1KL9A 2KNJA 4B9LA 2DPJA 2KD1A 1Z1BA 4ELUA 3NS1A 5KFYA 2BGWA 1RQNA 3PSPA 3SD7A 2HBJA 5DG7A 3D2QA 2KSOA 2KICA 3LYSA 4K4GA 3BZCA 4NM1A 4DQIA 4DF4A 3AL0B 1UQVA 2KG5A 2Q4TA 1SWWA 4P0QA 2C28A 3JPQA 4KTQA 1AQ6A 2F3NA 3TAQA 5KL8B 4OCZA 1MC8A 1ZQ1C 3UXOA 3GIKA 5KFDA 1N5XA 5KFLA 1JRPA 4CF5A 1LVHA 2FPKA 4EELA 2NO4A 3RR8A 1Z19A 5KFRA 5J2BA 2DL0A 1OW5A 4YXJA 3H0MB 5AICA 3NGDA 2ZXIA 3JPSA 4DFJA 4ED8A 5L1MA 4O3OA 2ZJAA 3GIIA 2DBYA 5AKHA 4QZ8A 3WK4A 2I6XA 5G5GA 2NO5A 3RB3A 9ICWA 1SZHA 4NL9C 4R65A 4M6WB 3RJIA 1FFUA 2W8KA 1HJPA 4I2IA 4NXZA 4KLHA 2FMSA 2J6SA 1JROA 1L7NA 2OWOA 4P4OA 2W11A 3IP4B 4PHAA 4UB6U 2UVUA 4F2RA 9ICUA 3BZKA 5AHXA 1KBUA 2PFNA 2JEIA 1NJWA 3PW4A 5J0PA 3IG8A 1A77A 5AKIA 5ALOA 4ELTA 2G0AA 2WF7A 8ICEA 5L1JA 4Z6EA 3OHAA 5AK6A 4UAVA 3BDPA 2DPIA 1XWLA 3HRDD 1ZQWA 1MA7A 4UAWA 2QARB 3G6XA 1NJXA 3KHHA 1MQ2A 3FAHA 5KAIU 5AK5A 4RQ3A 4PHEA 2PFOA 1X9SA 3KHGA 2VANA 3GIMA 4M9GA 5J0UA 4PZOA 4IR1A 5EE0A 2R8GA 1ZD3A 7ICPA 3Q8LA 2H5XA 2LM1A 2FE9A 4UB4A 4RQ7A 1J2MA 4OJOA 3RH4A 4TQSA 2ZIWB 5F9LA 4BWJA 2NRXA 1RZTA 4DLGA 4O5KA 3PO5A 3WU2U 3RRGA 4J9MA 4E0DA 3KOOA 4IL6U 5KFIA 2ISOA 4DFPA 2NRZA 2HOQA 1ZQIA 2HCFA 4DLEA 3RJHA 1ZETA 1PK3A 3QX7A 2YX8A 1T8EA 3E58A 3O0FA 4I29A 4UB3A 4Y2TA 2WF6A 4R66A 3VCBA 3MGHA 4Z6FA 4UBBA 1WWVA 3MABA 2GH1A 2UVWA 2AH5A 5EE3A 2JZBA 2E3TA 9ICOA 4YMNA 4I2BA 3SZ2A 1BNOA 4ACOA 2D6FC 4BX9C 5DBAA 3ETRA 1ZQZA 5KFOA 4KLQA 5E79U 3ORYA 2W55A 3B0YA 1Z00B 3Q8QB 3WK6A 2MUTB 3ZD8A 2DGZA 4JV2A 9ICPA 2NRVA 2D3DA 3RAXA 1ZQEA 5CHGA 5KFSA 1Z00A 1RYRA 1TVAA 4LZGA 1M6YA 1PZNA 3Q8RB 2KP7A 1L3UA 3E2EA 3BQTA 1A0PA 3RJGA 2XGPA 1BGXT 4Q44A 3GV5B 2W9AA 9ICSA 2KFNA 1U45A 2R8IA 3NVVA 4C8LA 4ECVA 2XY5A 2W7PA 1KFSA 3H0LB 2WF5A 1WCLA 3QU2A 5KG4A 2XCAA 2BHNA 1QLNA 1VDVA 1TAUA 5B5EU 2BCRA 5DB7A 1ZD4A 5ALRA 1N48A 3PX6A 3CW2C 4RPYA 3D2SA 3F53A 8ICAA 2WFAA 3C5FA 3Q8PB 4J9RA 4DFMA 4DL3A 3D6JA 2W8LA 2R8JA 4I2AA 5KFNA 3G6YA 5CP2A 3EPGA 2KFZA 3TFSA 4NV0A 5FP0A 5HMMA 3SR6A 3ICXA 3ISDA 1BPYA 3T79A 1ZQHA 3Q8MA 9ICXA 4LJXA 4JV0A 5L1LA 9ICRA 4C7ZA 1C20A 4NLGA 2Y0SC 4UASA 2BDUA 7ICFA 3M9NB 2MA1A 3M9MB 5IINA 4DOBA 9ICQA 5AKJA 2M9NA 2QLTA 2A19A 4B9TA 2J6TA 1KW4A 5KT5A 5J0TA 3H8MA 4RQ0A 4BWMA 5GTIU 5KNIA 1KFDA 8ICQA 3C29A 5L1KA 5HHIA 2JEFA 4Y2RA 7ICHA 4YD2A 3BS5B 4EYIB 5AKYA 5DBCA 5C5JA 3RBEA 3EPIA 4KMOB 1NZBA 1TK0A 4F50A 1T7PA 1SV0C 4IC9A 5AI6A 1S10A 1D8BA 3H8SA 1CEZA 5DGBA 3MC1A 4ELVA 2BQRA 5AM0A 1URJA 2WB1F 4KLLA 2E8PA 4DQSA 3A0BU 5JUMA 3M8RA 5AKEA 2BZFA 4J9PA 4GC6A 1NK6A 2Y0SF 2VA8A 2HMXA 1TV9A 2JXJA 4NWIA 5EWFA 4CRXA 3GFKB 5EWEA 4DSJA 4NLZA 5ALXA 3ALRA 2K8CB 2ZTCA 1CI4A 3I76A 1KN5A 1NK5A 3N7PD 4F5QA 1J2NA 4RQ1A 2F8KA 4KLGA 3PR5B 4Y2JA 5AM5A 4O5EA 2BCVA 2KK0A 4DL6A 3SAFA 5DQIA 3PW5A 4CE6A 4YD1A 3WKDA 2PFPA 2DUYA 2XY7A 2H3IA 3V6KA 4P0QB 3KHRA 2JHDA 2PMZF 4UB1A 1OUQA 2K4HA 4DS4A 2K8BB 1AROP 4XA5A 2HVHA 2K89A 4NL9A 1ZQBA 9ICGA 5J0QA 5J0XA 4ED6A 3SI8A 4QWBA 4QZIA 1Q3UA 1MQ3A 4QWCA 1O08A 2ALZA 1TK5A 1KDHA 2G06A 2JEJA 3GDXA 1UPHA 3AU6A 2KE7A 8ICNA 1TAMA 1U49A 1V9PA 2XIDA 4MFAA 4PGYA 2E1FA 4AYBF 5K4LA 4US8A 3T5HA 9ICFA 3L4PA 4KLSA 4P2HA 3MFHA 5EE9A 3SMVA 5DB9A 1NK4A 2V4QA 5ALMA 1FFVA 4MF2A 5AI0A 1PVPA 2KZ3A 5TZVA 4QWDA 5AI5A 1BPEA 1CUKA 3THVA 5CR0A 2AGOA 4OJLA 4YR3A 5IIOA 2DQNB 4YXMA 4RQNA 4NLCA 1Y88A 3SV4A 4DOAA 4OJ6A 1ZD2P 3PSIA 4KITB 5AM2A 4UB5A 2GO7A 7ICOA 2NYVA 1ZXIA 4YR0A 4XUSA 5AIBA 3NRWA 3LDAA 1U9LA 9ICVA 2ASJA 5AI8A 4X5VA 2LYBA 5DGAA 4J9NA 2Y9UA 4DFKA 2FMPA 5DBBA 2E8NA 4ICAA 2RP5A 2F44A 4IS7A 3QXGA 3BJYA 1U4BA 1Z4OA 5ALIA 2VA2A 1EXNA 1LB2B 3TAPA 1ZQOA 3UXNA 4F92B 5DB6A 3Q8SB 3CYMA 2KJ8A 5KT6A 5ALVA 4FZLA 4QIWF 4QZDA 2GOLA 2XC9A 4J9OA 3R9KA 5AM4A 8ICKA 4R64A 1SL0A 1XSPA 3TADC 4I27A 5KFMA 3RB4A 5KFQA 2IHMA 1XO0A 4RNNA 5KFTA 4O9MA 1H38A 3TFRA 1KQQA 2NV3A 3F2BA 2F1HA 3KZIU 4IRCA 4PPXA 1T3NA 4C4RA 2LHTA 2IMWP 2FLPA 3PSTA 3KTQA 3UMBA 5JU5A 1N5WA 1OXJA 3SAGA 1D8YA 3JPPA 2KOBA 1L5UA 8ICXA 3IRUA 4XRHA 2KVCA 3MDAA 4M04A 2RQ5A 3GIJA 1NK0A 3ZDCA 2DWQA 2I1QA 5AM1A 4O3NA 4KLOA 5AKGA 3M9OB 4F5PA 4DL5A 1K1SA 3HX0A 2WF9A 2MU2A 5AKKA 2ZIXB 2EH9A 4FBTA 2ZIVA 3ZDEA 1JUDA 1BPZA 4NM2A 2V4RA 2I9GA 3WKAA 8ICZA 4UAUA 8ICRA 4M9JA 3WK7A 2ASDA 3VC8A 4MHVA 4ECUA 1ZRMA 3BQ7A 4F2SA 4DSKA 5ALWA 1DXSA 3F2CA 2BQUA 5J0YA 4Y2YA 3AUOA 2Q0ZX 4EENA 2G5IB 2ZJ8A 3V6HA 1ZQFA 5ALYA 2YTUA 1LKYB 3T5LA 5CJ7A 4BGDA 5J0OA 2H3VA 3AU2A 3BQ1A 2BDPA 2BKEA 3FC4A 4ECQA 3OTQA 1TFRA 4JK1A 4J9KA 2HHUA 9ICJA 2ESEA 1S76D 9ICHA 1SXEA 1KLNA 4M9NA 3PO4A 2E1EA 3V7LA 1Q8KA 3KZXA 1X6IA 2KVSA 4TUSA 3MR2A 3N97B 2W04A 4FE3A 3MFIA 4KX3A 4O5CA 4CDGA 1ZQDA 9ICLA 3ZDAA 2VKQA 1TE2A 3RB0A 4B9NA 2ZIXA 4P4MA 3IN5A 5D4BA 1ZQXA 2GLEA 2KJ5A 3B0XA 4C8KA 5J2JA 1DOQA 3K1RB 3QEAZ 5KG5A 2HHTA 1VJ5A 1F44A 5J0RA 3HP6A 2HSZA 1N62A 5TISU 2UVVA 3QUTA 7ICEA 3Q8KA 1L7OA 5J2CA 4RT2A 2R18A 3N28A 1NKBA 1SL2A 1ZQLA 1BPBA 2EDUA 1QQ5A 5ALEA 3UMCA 2I5HA 3A0HU 4K4HA 2OM6A 2MAXA 5J8YC 2EANA 3K4GA 4EX6A 2DKXA 2YY6A 2J6UA 5DDMA 2F76X 9ICMA 4DSEA 4AP9A 2LYHA 4ED3A 5HNKA 1NK9A 3ED5A 4ZOHC 4RT3A 3LK9A 1HUOA 1B22A 3QZ7A 3SV3A 3K75D 2AQ4A 2G07A 2HOFA 3CRXA 1JMSA 2BPCA 3TARA 2IBKA 4BUGA 3NVWA 4FZNA 4F5OA 3ZDDA 1SKWA 4KN7A 2DFLA 1D9FA 4DQPA 3EWAA 1S0OA 2JEGA 3C23A 2F1IA 8ICJA 1UT8A 3SEIA 1DK2A 2KIVA 4EBDA 2QKQA 1SV4A 4BJQA 5KFUA 2W3SA 4KMUA 1IIPA 1N60A 4K4IA 1L7MA 2W9CA 4YG2A 3QU7A 4O3QA 5ALLA 1S0MA 1ZQMA 7ICMA 2XICA 4EBEA 5KT2A 2LKYA 1TK8A 2HHQA 3OHBA 3L5KA 2IA6A 1ZQJA 3IDWA 4ED2A 2AU0A 2G08A 2W9CB 4YR2A 4PHDA 4GFJA 3N7SC 5KFZA 1JIHA 1WWUA 4RQ4A 1XSNA 1ZQGA 9ICCA 3LVVA 4YFKA 3C2KA 3M6ZA 4DQRA 3SENA 3TACB 1D9DA 1COKA 1BVSA 2V9WA 3OPXA 4J9LA 1WCNA 1B43A 2R8KA 1MSWD 4NJ8A 2EZZA 3IM1A 2PXIA 5KAFU 9ICTA 3WKBA 2HBKA 3C2MA 1WYGA 1XS9D 3QNMA 5H2FU 3AMZA 5KG3A 5KFKA 1A76A 2AJQA 4EBCA 4CGZA 2DKZA 2NRTA 3L3FX 2RRDA 3F2DA 2XY6A 3ZDBA 4MF8A 2D8CA 2W9BA 4RNOA 4QWAA 4ED0A 2XI9A 4UAZA 4B9MA 4DCCA 5DG8A 8ICLA 3JPTA 5JRTA 4QIWC 4KLJA 8ICCA 1S77D 5ALJA 2OHFA 2E8MA 4MEYA 5J8YA 4FS1A 4RUAA 3NRZA 2RHFA 3S6JA 1KKXA 5EE1A 3N7RC 1T4GA 3BS5A 4MEXA 1T3QA 5EOZA 4ED1A 4YN4A 4JUZA 4UW9A 4EEYA 1T94A 4ECWA 3JPRA 8ICOA 4U6PA 2YQEA 2ZTDA 1Q3VA 4M2YA 3IHQB 4FBUA 5HR7A 2W7OA 4I28A 5IILA 5ALTA 4O3SA 1MN8A 3OJUA 4UAYA 2MSNA 3RTVA 2IHNA 5J29A 2N1RA 2JR5A 1NOMA 5DLGA 3RJEA 1QQ7A 3WKEA 3OGUA 3HKZF 2FDRA 4DSFA 7ICGA 4Y2UA 3C1YA 2HDOA 3MBYA 3KKAC 5DB8A 1UHUA 3OJSA 2W9BB 2H3QA 3NASA 2HHSA 3HT3A 1PK1A 4EZ9A 4DOCA 5ALHA 2YMMA 2B6GA 2ZJ5A 2HBLA 7ICKA 2BCSA 1ZQSA 2HHXA 2JH1A 3HKZC 1SXDA 3N4MB 5IIKA 2ASLA 1S9FA 4GXKA 4QZEA 3KD3A 2NRWA 1QSLA 4IRKA 3HW8A 4OJ5A 2VJ5A 3QU5A 5AKLA 3H8JA 3AM9A 5ALPA 4IQWA 4RQMA 2O6KA 2W3RA 4QZBA 3SQIA 4ECZA 4A8EA 2LBOA 2GWSA 1RYSA 4RNMA 2B21A 3K1ZA 4NLBA 3WK5A 2AGQA 4MFCA 3HPOA 3EUB2 4F93B 5B66U 2A1JB 3G6VA 4UARA 1X66A 2KKPA 3TANA 2FPMA 2HOIA 8ICFA 4C8NA 4OJPA 3T3FA 1Z3EB 4ECSA 4BDPA 8ICBA 1S5LU 1RXVA 3NVZA 3HWTA 3ONNA 3UPQA 3NTUA 1QSSA 4EZ6A 2JRZA 1YZ6A 4Q43A 5DQHA 1PVRA 1SGGA 5IIIA 1NNLA 4PH5A 5CWRA 3QZ8A 1QSYA 4I2DA 4RPZA 9ICKA 3PR4A 1TAQA 9ICAA 4LZDA 5ALFA 4QZAA 2Z7JA 1NKEA 5ALKA 4F8RA 5J2DA 1Z4NA 3GILA 4EEKA 3MGVA 3WK9A 3MR5A 7ICRA 4IQUA 2VIXA 1SWVA 4Y2XA 3V7JA 3PW2A 1K1QA 1NI3A 4DS5A 4PJ0U 4Z6CA 1HEKA 2KMDA 3SAHA 3WKCA 4RUCA 5AI4A 4C4SA 3T5KA 1UCVA 3MGIA 4F4KA 5ALUA 7ICLA 5D49A 2W9MA 3H8WA 2YMPA 3RH5A 1ED1A 3KKAA 4KLFA 3H4DA 4DFDA 2F77X 1TKDA 4ED7A 1HUZA 1XNSA 4RQ5A 1ZYQA 1UA1A 4R63A 3ZI4A 2ZG6A 4QW9A 4QW8A 2ZIVB 1VLBA 4QZHA 4F4YA 5KFWA 1ZQUA 5AKZA 1L8OA 5GTHU 3C28A 3PX4A 1QTMA 2A1AA 4KX5A 2FLLA 4NLNA 5KG0A 4JWNA 3TI0A 4J03A 2ATLA 2YMLA 5CA7A 4CCHA 5C0YA 2K4EA 3T5JA 2M0NA 4GXIA 1ZQAA 3QUBA 2KZZA 4ECXA 5BOLA 5ALQA 1QQ6A 3JPOA 3AN1A 3EW9A 4B9VA 2IOFA 4NLKA 4B9UA 4QWEA 5KTQA 4TUPA 1KEJA 2L5YA 1ZQTA 4I2HA 4LVSA 1XSLA 4RQ6A 8ICGA 5DQGA 4Q8FA 4O3MA 1DK3A 1V85A 2HI0A 3RF9A 3B9JA 4JMUA 3I28A 4J9SA 5KT3A 4KLUA 2FMQA 1PUZA 4IQTA 1SKSA 1YT3A 4GLXA 4B9SA 2EZYA 2LMRA 3M6KA 3PSFA 2G5HB 2UVRA 1JI7A 2Y1IA 2HBMA 4WJ3B 2KIWA 2F8LA 3UXPA 2AHOB 4TUQA 1WUDA 4U7CA 3C5GA 2B0CA 4C7YA 8ICIA 5KG6A 4CF3A 1KTQA 4ECYA 2R8HA 1J97A 3QYPA 4DF8A 3ISBA 2EAOA 3UQ0A 1JXEA 8ICVA 5J2HA 2YMQA 8ICSA 1JN3A 4O3RA 4F5RA 4YQWA 4YCXA 2W03A 2BR0A 4DSIA 3UMGA 4NY8A 1L3VA 4G3IA 3FM9A 5AK4A 1X42A 2ISPA 1SL1A 4J9QA 3QU9A 1IM4A 1DGSA 5ALNA 3RR7A 3DDHA 3RH6A 2PI4A 3RJJA 1ZQKA 5A0LA 2W43A 3WK8A 3DEEA 2XCPA 3J81j 3MR3A 2WHEA 3PNCA 3RRHA 2P66A 3QE9Y 1V97A 5JTIA 2E8OA 2CRXA 8ICTA 3GV8B 4QZGA 2RDJA 1L6NA 4PZNA 4KLTA 2QARA 1SIJA 2P6RA 2H3FA 2E5SA 2K4PA 1NK7A 5J2IA 2QB0A 8ICWA 2OH2A 2KTQA 2HHVA 2ZIUB 2PI5A 1DGJA 1F0MA 9ICBA 1KFTA 3LWMA 2KN7A 2OYYA 3PMLA 2ZXHA 1GO3F 3CP8A 1L3SA 4QJFB 2QB1A 1YZ7A 2PFQA 1SV0A 4RQ2A 7ICIA 3TQ1A 4HAIA 5J2KA 2FJ6A 3FYHA 3TADA 1V38A 1ZJMA 1U47A 3GV7B 1NKCA 1ZD5A 2KV2A 1B0XA 2HHWA 3C2LA 3LWLA 5KFPA 4MFFA 1RQLA 3ETLA 5KFBA 2CN1A 2RLTA 3GZFA 2OCEA 4Y2SA 3GU3A
chains in the Genus database with same CATH topology
4RU9A 5DLFA 1ZQRA 3JPSA 1T4GA 5KFXA 4DFJA 4MEXA 1ZQCA 4ED8A 4O3OA 2ZJAA 3GIIA 3T5HA 5EOZA 9ICFA 4KLSA 4P2HA 4QZ8A 3V72A 4ED1A 4YN4A 4JUZA 3RB3A 4EEYA 9ICWA 3MFHA 5J2GA 5DB9A 1NK4A 4R65A 2V4QA 4M6WB 4ECWA 2RDIA 3RJIA 3JPRA 2W8KA 8ICOA 4O3PA 4YP3A 1HJPA 5J0WA 3EYZA 4I2IA 2ZTDA 4NXZA 4MF2A 4KLHA 3MR6A 4M2YA 2FMSA 3IHQB 2J6SA 4FBUA 8ICPA 2OWOA 4P4OA 4I28A 4QZFA 5IILA 4PHAA 2KZ3A 5TZVA 2MUTA 3RBDA 2UVUA 2HW3A 4F2RA 4O3SA 8ICHA 3OJUA 1ZQVA 4UAYA 3RTVA 4QWDA 9ICUA 2IHNA 5J29A 1BPEA 5KFFA 1CUKA 3THVA 5CR0A 2PFNA 1NOMA 5DLGA 4F4ZA 2AGOA 4IR9A 2JEIA 1NJWA 1D8LA 3RJEA 2ZTEA 4YR3A 4I2GA 3PW4A 1X9MA 3BQ0A 5IIOA 5J0PA 4PGXA 3OGUA 4YXMA 4ECTA 2XO7A 1RPLA 1Y88A 4DSFA 1A77A 3SV4A 4KLDA 4UB2A 7ICGA 4DOAA 3C1YA 1IXRA 3MBYA 4ELTA 5DB8A 8ICEA 2W9BB 3OJSA 4KITB 5L1JA 4Z6EA 4UB5A 3OHAA 2HHSA 3HT3A 4EZ9A 1RXWA 4DOCA 7ICOA 3BDPA 1S97A 2DPIA 2ZJ5A 7ICKA 4YR0A 4XUSA 1XWLA 1ZJNA 3LDAA 2BCSA 1U9LA 1ZQSA 1ZQWA 9ICVA 5KFCA 4I2JA 2HHXA 2ASJA 4UAWA 3G6XA 4X5VA 3KHHA 1NJXA 1MQ2A 5DGAA 4PHEA 4RQ3A 4J9NA 3SYZA 4DFKA 3N4MB 2FMPA 5IIKA 5DBBA 2ASLA 2PFOA 1S9FA 4GXKA 1X9SA 4QZEA 5BOMA 3KHGA 2NRWA 1QSLA 2VANA 3GIMA 4IRKA 4Q8EA 3HW8A 4M9GA 4I2EA 5J0UA 3BJYA 1U4BA 4IR1A 2R8GA 4R8UA 2VA2A 1EXNA 4F5NA 4TURA 1LB2B 3TAPA 1ZQOA 3UXNA 7ICPA 1C7YA 5KFGA 2C2DA 3Q8LA 4F92B 5DB6A 3Q8SB 2H5XA 4UB4A 4RQ7A 5DDYA 5KFAA 4BXOB 5KT6A 3H8JA 3MDCA 1COOA 4IQWA 1L3TA 4QZDA 4DL4A 5J0SA 3RH4A 2AGPA 9ICNA 4QZBA 3GQCA 2XC9A 4J9OA 4ECZA 4TQSA 7ICSA 8ICKA 4R64A 5F9LA 4BWJA 2NRXA 1RZTA 1SL0A 2GWSA 1XSPA 1RYSA 4RNMA 2B21A 7ICNA 3PW0A 4DLGA 4O5KA 3PO5A 4I27A 5KFMA 3RB4A 4F4XA 5J2EA 2FPLA 5KFQA 2AGQA 2IHMA 3RRGA 1X2IA 4MFCA 3HPOA 4I2CA 4J9MA 4RNNA 4F93B 4E0DA 5KFIA 5KFTA 4O9MA 2A1JB 2ISOA 7ICQA 3G6VA 4DFPA 1H38A 3TFRA 5KFHA 2NRZA 1ZQIA 4YVZA 4QZCA 3TANA 2FPMA 5CB1A 1UT5A 4DLEA 4I2FA 2F1HA 5IIJA 4O0IA 1N56A 3RJHA 8ICFA 1ZETA 4XQ8A 4C8NA 3T3FA 2XGQA 5KFVA 1Z3EB 5HMLA 4ECSA 4BDPA 4IRCA 4PPXA 8ICBA 1T8EA 1T3NA 4KLEA 2IMWP 4M47A 2WTFA 7ICJA 2FLPA 4I29A 1RXVA 4GC7A 3KTQA 4UB3A 4TQRA 3HWTA 4R66A 3MGHA 4Z6FA 4UBBA 3UPQA 3NTUA 4KLIA 2HVIA 1QSSA 4EZ6A 3MABA 4Q43A 5DQHA 2ZUDA 2UVWA 1D8YA 2JZBA 5IIIA 1KRPA 3JPPA 3EZ5A 9ICOA 1L5UA 4YMNA 4PH5A 8ICXA 1JX4A 5CWRA 4XRHA 3QZ8A 4I2BA 3MDAA 3SZ2A 2FLNA 3PV8A 3GIJA 1QSYA 4M04A 4I2DA 1NK0A 4RPZA 9ICKA 3ZDCA 1UA0A 3PR4A 1TAQA 9ICAA 2C2RA 2I1QA 4LZDA 4Z6DA 4DL2A 4QZAA 2C22A 4O3NA 5DBAA 1NKEA 4KLOA 1ZQZA 5KFOA 5DKWA 4KLQA 4F8RA 5J2DA 3M9OB 4F5PA 4DL5A 1K1SA 3HX0A 3ORYA 3PW7A 5HP4A 3B0YA 9ICIA 3GILA 1Z00B 3Q8QB 2MUTB 4M9HA 4P4PA 4BXOA 3MR5A 7ICRA 3ZD8A 4FBTA 3QEBZ 3ZDEA 4IQUA 1BPZA 4JV2A 4NM2A 2V4RA 9ICPA 2NRVA 3RAQA 2I9GA 8ICZA 3BQ2A 3V7JA 3PW2A 3RAXA 1K1QA 8ICRA 1ZQEA 2P6UA 4M9JA 5CHGA 5KFSA 4DS5A 4Z6CA 2ASDA 1Z00A 2A1JA 4ECUA 1RYRA 5D46A 1TVAA 4RUCA 4LZGA 1PZNA 3T5KA 3Q8RB 4F2SA 4M0AA 4DSKA 1ZQQA 5J2AA 3MGIA 5EWGA 4F4KA 4PHPA 1L3UA 3E2EA 7ICLA 3H7IA 3BQTA 4DEZA 5D49A 2W9MA 3H8WA 3RJGA 2XGPA 2BQUA 1BGXT 4Q44A 3GV5B 2W9AA 1JXLA 3RH5A 5J0YA 4KLFA 3H4DA 9ICSA 2KFNA 1U45A 3RB6A 1TKDA 2R8IA 4ED7A 1HUZA 3FDSA 1ZQNA 3KHLA 4RQ5A 2Q0ZX 3AUOA 2ZJ8A 1ZYQA 1UA1A 4R63A 3V6HA 4C8LA 1ZQFA 4QW9A 4QW8A 4ECVA 3T5LA 5KFJA 2XY5A 5CJ7A 1KFSA 4F91B 4BGDA 4DO9A 5J0OA 4QZHA 1WCLA 3V6JA 4F4YA 5KFWA 4YMOA 5KG4A 2XCAA 3AU2A 1ZQUA 3V7KA 2BHNA 3BQ1A 2BDPA 2BKEA 4ECRA 1U48A 1QLNA 4ECQA 1TAUA 2BCRA 1TFRA 4JK1A 5DB7A 4J9KA 2HHUA 3PX4A 1N48A 9ICJA 1QTMA 2FLLA 1S76D 3M8SA 3PX6A 9ICHA 1KLNA 4NLNA 5KG0A 4JWNA 3TI0A 4M9NA 3PO4A 2ATLA 4C8MA 3C1ZA 3V7LA 5CA7A 4ZH4A 3C21A 4RPYA 4CCHA 3MR2A 4TUSA 3N97B 1KSPA 2BPGA 8ICAA 1NJYA 2BPFA 3T5JA 3MFIA 4GXIA 4O5CA 1ZQDA 9ICLA 3ZDAA 1ZQAA 3C5FA 3Q8PB 4J9RA 4DFMA 4ECXA 2KZZA 5F9NA 4DL3A 4I2AA 2W8LA 4IQVA 5BOLA 2R8JA 5KFNA 3G6YA 3RB0A 5CP2A 4B9NA 3JPOA 4P4MA 3EW9A 4B9VA 3EPGA 2KFZA 4NLKA 3TFSA 5D4BA 4B9UA 1ZQXA 3B0XA 4QWEA 1SZPA 5J2JA 2BCUA 4C8KA 5KTQA 4TUPA 1KEJA 5HMMA 1ZQTA 1DOQA 2Y1JA 4RPXA 3QEAZ 1XSLA 4I2HA 5KG5A 4LVSA 2HHTA 4RQ6A 3ISDA 1BPYA 5DQGA 8ICGA 5J0RA 1ZQHA 3HP6A 1SKRA 3Q8MA 4Q8FA 3RJFA 8ICUA 1BPXA 4KLMA 9ICXA 4JV0A 2UVVA 5L1LA 3PY8A 7ICEA 9ICRA 3OSPA 3Q8KA 4NLGA 1S0VA 2AQ0A 5J2CA 5KG1A 4RT2A 5IIMA 4J9SA 1NKBA 1SL2A 2JZBB 5KT3A 4KLUA 7ICFA 1ZQLA 3M9NB 1BPBA 2FMQA 4IQTA 1SKSA 5KG7A 3M9MB 5IINA 5KT4A 4GLXA 4DOBA 4B9SA 4K4HA 2MAXA 5BPCA 9ICQA 2M9NA 2BQ3A 4HYKA 4B9TA 4DSLA 1S0NA 1XO1A 2J6TA 5KT5A 5J0TA 3K4GA 5KG2A 4RQ0A 2UVRA 4IRDA 2J6UA 4BWMA 5DDMA 4FO6A 2Y1IA 9ICMA 3UQ2A 4DSEA 2F1JA 3RJKA 1KFDA 8ICQA 2LYHA 5L1KA 5HHIA 5HNKA 4FS2A 4ED3A 1NK9A 2JEFA 7ICHA 3UXPA 4YD2A 4EYIB 4TUQA 5DBCA 3PMNA 5C5JA 3C5GA 2BCQA 7ICTA 4RT3A 3ISCA 3RBEA 9ICEA 3LK9A 1HUOA 1B22A 3EPIA 8ICIA 5KG6A 3QZ7A 4DWIA 3H4BA 1TK0A 4F50A 3SV3A 1T7PA 3K75D 1KTQA 1BPDA 4ECYA 2AQ4A 2R8HA 4M9LA 4DF8A 3ISBA 5HHHA 3UQ0A 3ZD9A 1JXEA 8ICVA 1JMSA 2BPCA 5J2HA 3TARA 1NK8A 1S10A 2IBKA 1JN3A 8ICSA 3H8SA 4UBCA 4O3RA 1CEZA 4F5RA 3PX0A 4F5OA 5DGBA 4YQWA 1ZQYA 4YCXA 4ELVA 2BQRA 2KZMA 2BR0A 1SKWA 4KN7A 3ZDDA 4RQ8A 4C8OA 4DSIA 4KLLA 2ZUCA 4KN4A 4JV1A 4DQSA 2DFLA 3H40A 5JUMA 1D9FA 3M8RA 4DQPA 4JWMA 4NY8A 1L3VA 3EWAA 4G3IA 5DG9A 4F3OA 4J9PA 1S0OA 2JEGA 4GC6A 3C23A 2ISPA 2F1IA 4GXJA 1NK6A 4R8UB 1UT8A 2VA8A 1SL1A 8ICJA 4J9QA 1IM4A 4EBDA 1DGSA 1NJZA 4YMMA 5KT7A 8ICMA 3RR7A 4DQQA 3RH6A 1TV9A 5KFUA 3OSNA 1ZQKA 2PI4A 4KMUA 3RJJA 4Q45A 3PVXA 7ICUA 4K4IA 1XU4A 2XCPA 5EWFA 4RZRA 4UQGA 3MR3A 2W9CA 4YG2A 3GFKB 4O3QA 4EYHB 5EWEA 3PNCA 1S0MA 2ZUBA 5L9XA 1ZQMA 4F4WA 4DSJA 4NLZA 3RRHA 2P66A 3QE9Y 7ICMA 4EBEA 2ZTCA 5KT2A 1XC9A 8ICTA 3GV8B 1TK8A 1NK5A 2HHQA 4F5QA 4QZGA 3OHBA 4RQ1A 4PGQA 2RDJA 2C2EA 2IA6A 1ZQJA 4ED2A 3JPNA 2AU0A 2P6RA 4KLGA 4KLTA 3PR5B 4YR2A 4M6WA 2W9CB 4PHDA 4O5EA 5KFZA 2BCVA 1JIHA 4RQ4A 4DL6A 1XSNA 1LV5A 1ZQGA 9ICCA 4YFKA 1ZQPA 2VA3A 3C2KA 1NK7A 4DQRA 1D9DA 5J2IA 5DQIA 8ICWA 5J2FA 1BVSA 3PW5A 2V9WA 8ICYA 7ICVA 4YD1A 4J9LA 2KTQA 1WCNA 2HHVA 1B43A 5L1IA 2PFPA 2R8KA 2PI5A 1MSWD 4DL7A 4QZ9A 2XY7A 9ICBA 1KFTA 3LWMA 3V6KA 3IM1A 1X9WA 2KN7A 3PMLA 3KHRA 5KFEA 2PXIA 9ICTA 4UB1A 4B9LA 2DPJA 1L3SA 3C2MA 4ELUA 1XS9D 5KFYA 2BGWA 2PFQA 4DS4A 1AROP 5KG3A 4XA5A 5KFKA 2HVHA 1A76A 5DG7A 1ZQBA 2AJQA 4RQ2A 4K4GA 9ICGA 5J0QA 4EBCA 7ICIA 5J0XA 3TQ1A 4NM1A 4ED6A 2NRTA 3SI8A 5J2KA 4DF4A 4DQIA 3FYHA 4QWBA 2XY6A 4QZIA 1ZJMA 3ZDBA 4MF8A 2W9BA 1MQ3A 2C28A 4RNOA 4QWAA 3JPQA 4KTQA 4ED0A 1U47A 3TAQA 1MC8A 4QWCA 4UAZA 4B9MA 3GV7B 5DG8A 1TK5A 2ALZA 1KDHA 1NKCA 8ICLA 3UXOA 3JPTA 3GIKA 5KFDA 2JEJA 5KFLA 3GDXA 3AU6A 2FPKA 4KLJA 2HHWA 8ICCA 1S77D 3RR8A 3C2LA 3LWLA 8ICNA 5KFPA 4MEYA 5KFRA 5J2BA 1U49A 1V9PA 4MFAA 4MFFA 3ETLA 4FS1A 5KFBA 4RUAA 4YXJA 4PGYA 3NGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RU9 A;  5DLF A;  1ZQR A;  3JPS A;  1T4G A;  5KFX A;  4DFJ A;  4MEX A;  1ZQC A;  4ED8 A;  4O3O A;  2ZJA A;  3GII A;  3T5H A;  5EOZ A;  9ICF A;  4KLS A;  4P2H A;  4QZ8 A;  3V72 A;  4ED1 A;  4YN4 A;  4JUZ A;  3RB3 A;  4EEY A;  9ICW A;  3MFH A;  5J2G A;  5DB9 A;  1NK4 A;  4R65 A;  2V4Q A;  4M6W B;  4ECW A;  2RDI A;  3RJI A;  3JPR A;  2W8K A;  8ICO A;  4O3P A;  4YP3 A;  1HJP A;  5J0W A;  3EYZ A;  4I2I A;  2ZTD A;  4NXZ A;  4MF2 A;  4KLH A;  3MR6 A;  4M2Y A;  2FMS A;  3IHQ B;  2J6S A;  4FBU A;  8ICP A;  2OWO A;  4P4O A;  4I28 A;  4QZF A;  5IIL A;  4PHA A;  2KZ3 A;  5TZV A;  2MUT A;  3RBD A;  2UVU A;  2HW3 A;  4F2R A;  4O3S A;  8ICH A;  3OJU A;  1ZQV A;  4UAY A;  3RTV A;  4QWD A;  9ICU A;  2IHN A;  5J29 A;  1BPE A;  5KFF A;  1CUK A;  3THV A;  5CR0 A;  2PFN A;  1NOM A;  5DLG A;  4F4Z A;  2AGO A;  4IR9 A;  2JEI A;  1NJW A;  1D8L A;  3RJE A;  2ZTE A;  4YR3 A;  4I2G A;  3PW4 A;  1X9M A;  3BQ0 A;  5IIO A;  5J0P A;  4PGX A;  3OGU A;  4YXM A;  4ECT A;  2XO7 A;  1RPL A;  1Y88 A;  4DSF A;  1A77 A;  3SV4 A;  4KLD A;  4UB2 A;  7ICG A;  4DOA A;  3C1Y A;  1IXR A;  3MBY A;  4ELT A;  5DB8 A;  8ICE A;  2W9B B;  3OJS A;  4KIT B;  5L1J A;  4Z6E A;  4UB5 A;  3OHA A;  2HHS A;  3HT3 A;  4EZ9 A;  1RXW A;  4DOC A;  7ICO A;  3BDP A;  1S97 A;  2DPI A;  2ZJ5 A;  7ICK A;  4YR0 A;  4XUS A;  1XWL A;  1ZJN A;  3LDA A;  2BCS A;  1U9L A;  1ZQS A;  1ZQW A;  9ICV A;  5KFC A;  4I2J A;  2HHX A;  2ASJ A;  4UAW A;  3G6X A;  4X5V A;  3KHH A;  1NJX A;  1MQ2 A;  5DGA A;  4PHE A;  4RQ3 A;  4J9N A;  3SYZ A;  4DFK A;  3N4M B;  2FMP A;  5IIK A;  5DBB A;  2ASL A;  2PFO A;  1S9F A;  4GXK A;  1X9S A;  4QZE A;  5BOM A;  3KHG A;  2NRW A;  1QSL A;  2VAN A;  3GIM A;  4IRK A;  4Q8E A;  3HW8 A;  4M9G A;  4I2E A;  5J0U A;  3BJY A;  1U4B A;  4IR1 A;  2R8G A;  4R8U A;  2VA2 A;  1EXN A;  4F5N A;  4TUR A;  1LB2 B;  3TAP A;  1ZQO A;  3UXN A;  7ICP A;  1C7Y A;  5KFG A;  2C2D A;  3Q8L A;  4F92 B;  5DB6 A;  3Q8S B;  2H5X A;  4UB4 A;  4RQ7 A;  5DDY A;  5KFA A;  4BXO B;  5KT6 A;  3H8J A;  3MDC A;  1COO A;  4IQW A;  1L3T A;  4QZD A;  4DL4 A;  5J0S A;  3RH4 A;  2AGP A;  9ICN A;  4QZB A;  3GQC A;  2XC9 A;  4J9O A;  4ECZ A;  4TQS A;  7ICS A;  8ICK A;  4R64 A;  5F9L A;  4BWJ A;  2NRX A;  1RZT A;  1SL0 A;  2GWS A;  1XSP A;  1RYS A;  4RNM A;  2B21 A;  7ICN A;  3PW0 A;  4DLG A;  4O5K A;  3PO5 A;  4I27 A;  5KFM A;  3RB4 A;  4F4X A;  5J2E A;  2FPL A;  5KFQ A;  2AGQ A;  2IHM A;  3RRG A;  1X2I A;  4MFC A;  3HPO A;  4I2C A;  4J9M A;  4RNN A;  4F93 B;  4E0D A;  5KFI A;  5KFT A;  4O9M A;  2A1J B;  2ISO A;  7ICQ A;  3G6V A;  4DFP A;  1H38 A;  3TFR A;  5KFH A;  2NRZ A;  1ZQI A;  4YVZ A;  4QZC A;  3TAN A;  2FPM A;  5CB1 A;  1UT5 A;  4DLE A;  4I2F A;  2F1H A;  5IIJ A;  4O0I A;  1N56 A;  3RJH A;  8ICF A;  1ZET A;  4XQ8 A;  4C8N A;  3T3F A;  2XGQ A;  5KFV A;  1Z3E B;  5HML A;  4ECS A;  4BDP A;  4IRC A;  4PPX A;  8ICB A;  1T8E A;  1T3N A;  4KLE A;  2IMW P;  4M47 A;  2WTF A;  7ICJ A;  2FLP A;  4I29 A;  1RXV A;  4GC7 A;  3KTQ A;  4UB3 A;  4TQR A;  3HWT A;  4R66 A;  3MGH A;  4Z6F A;  4UBB A;  3UPQ A;  3NTU A;  4KLI A;  2HVI A;  1QSS A;  4EZ6 A;  3MAB A;  4Q43 A;  5DQH A;  2ZUD A;  2UVW A;  1D8Y A;  2JZB A;  5III A;  1KRP A;  3JPP A;  3EZ5 A;  9ICO A;  1L5U A;  4YMN A;  4PH5 A;  8ICX A;  1JX4 A;  5CWR A;  4XRH A;  3QZ8 A;  4I2B A;  3MDA A;  3SZ2 A;  2FLN A;  3PV8 A;  3GIJ A;  1QSY A;  4M04 A;  4I2D A;  1NK0 A;  4RPZ A;  9ICK A;  3ZDC A;  1UA0 A;  3PR4 A;  1TAQ A;  9ICA A;  2C2R A;  2I1Q A;  4LZD A;  4Z6D A;  4DL2 A;  4QZA A;  2C22 A;  4O3N A;  5DBA A;  1NKE A;  4KLO A;  1ZQZ A;  5KFO A;  5DKW A;  4KLQ A;  4F8R A;  5J2D A;  3M9O B;  4F5P A;  4DL5 A;  1K1S A;  3HX0 A;  3ORY A;  3PW7 A;  5HP4 A;  3B0Y A;  9ICI A;  3GIL A;  1Z00 B;  3Q8Q B;  2MUT B;  4M9H A;  4P4P A;  4BXO A;  3MR5 A;  7ICR A;  3ZD8 A;  4FBT A;  3QEB Z;  3ZDE A;  4IQU A;  1BPZ A;  4JV2 A;  4NM2 A;  2V4R A;  9ICP A;  2NRV A;  3RAQ A;  2I9G A;  8ICZ A;  3BQ2 A;  3V7J A;  3PW2 A;  3RAX A;  1K1Q A;  8ICR A;  1ZQE A;  2P6U A;  4M9J A;  5CHG A;  5KFS A;  4DS5 A;  4Z6C A;  2ASD A;  1Z00 A;  2A1J A;  4ECU A;  1RYR A;  5D46 A;  1TVA A;  4RUC A;  4LZG A;  1PZN A;  3T5K A;  3Q8R B;  4F2S A;  4M0A A;  4DSK A;  1ZQQ A;  5J2A A;  3MGI A;  5EWG A;  4F4K A;  4PHP A;  1L3U A;  3E2E A;  7ICL A;  3H7I A;  3BQT A;  4DEZ A;  5D49 A;  2W9M A;  3H8W A;  3RJG A;  2XGP A;  2BQU A;  1BGX T;  4Q44 A;  3GV5 B;  2W9A A;  1JXL A;  3RH5 A;  5J0Y A;  4KLF A;  3H4D A;  9ICS A;  2KFN A;  1U45 A;  3RB6 A;  1TKD A;  2R8I A;  4ED7 A;  1HUZ A;  3FDS A;  1ZQN A;  3KHL A;  4RQ5 A;  2Q0Z X;  3AUO A;  2ZJ8 A;  1ZYQ A;  1UA1 A;  4R63 A;  3V6H A;  4C8L A;  1ZQF A;  4QW9 A;  4QW8 A;  4ECV A;  3T5L A;  5KFJ A;  2XY5 A;  5CJ7 A;  1KFS A;  4F91 B;  4BGD A;  4DO9 A;  5J0O A;  4QZH A;  1WCL A;  3V6J A;  4F4Y A;  5KFW A;  4YMO A;  5KG4 A;  2XCA A;  3AU2 A;  1ZQU A;  3V7K A;  2BHN A;  3BQ1 A;  2BDP A;  2BKE A;  4ECR A;  1U48 A;  1QLN A;  4ECQ A;  1TAU A;  2BCR A;  1TFR A;  4JK1 A;  5DB7 A;  4J9K A;  2HHU A;  3PX4 A;  1N48 A;  9ICJ A;  1QTM A;  2FLL A;  1S76 D;  3M8S A;  3PX6 A;  9ICH A;  1KLN A;  4NLN A;  5KG0 A;  4JWN A;  3TI0 A;  4M9N A;  3PO4 A;  2ATL A;  4C8M A;  3C1Z A;  3V7L A;  5CA7 A;  4ZH4 A;  3C21 A;  4RPY A;  4CCH A;  3MR2 A;  4TUS A;  3N97 B;  1KSP A;  2BPG A;  8ICA A;  1NJY A;  2BPF A;  3T5J A;  3MFI A;  4GXI A;  4O5C A;  1ZQD A;  9ICL A;  3ZDA A;  1ZQA A;  3C5F A;  3Q8P B;  4J9R A;  4DFM A;  4ECX A;  2KZZ A;  5F9N A;  4DL3 A;  4I2A A;  2W8L A;  4IQV A;  5BOL A;  2R8J A;  5KFN A;  3G6Y A;  3RB0 A;  5CP2 A;  4B9N A;  3JPO A;  4P4M A;  3EW9 A;  4B9V A;  3EPG A;  2KFZ A;  4NLK A;  3TFS A;  5D4B A;  4B9U A;  1ZQX A;  3B0X A;  4QWE A;  1SZP A;  5J2J A;  2BCU A;  4C8K A;  5KTQ A;  4TUP A;  1KEJ A;  5HMM A;  1ZQT A;  1DOQ A;  2Y1J A;  4RPX A;  3QEA Z;  1XSL A;  4I2H A;  5KG5 A;  4LVS A;  2HHT A;  4RQ6 A;  3ISD A;  1BPY A;  5DQG A;  8ICG A;  5J0R A;  1ZQH A;  3HP6 A;  1SKR A;  3Q8M A;  4Q8F A;  3RJF A;  8ICU A;  1BPX A;  4KLM A;  9ICX A;  4JV0 A;  2UVV A;  5L1L A;  3PY8 A;  7ICE A;  9ICR A;  3OSP A;  3Q8K A;  4NLG A;  1S0V A;  2AQ0 A;  5J2C A;  5KG1 A;  4RT2 A;  5IIM A;  4J9S A;  1NKB A;  1SL2 A;  2JZB B;  5KT3 A;  4KLU A;  7ICF A;  1ZQL A;  3M9N B;  1BPB A;  2FMQ A;  4IQT A;  1SKS A;  5KG7 A;  3M9M B;  5IIN A;  5KT4 A;  4GLX A;  4DOB A;  4B9S A;  4K4H A;  2MAX A;  5BPC A;  9ICQ A;  2M9N A;  2BQ3 A;  4HYK A;  4B9T A;  4DSL A;  1S0N A;  1XO1 A;  2J6T A;  5KT5 A;  5J0T A;  3K4G A;  5KG2 A;  4RQ0 A;  2UVR A;  4IRD A;  2J6U A;  4BWM A;  5DDM A;  4FO6 A;  2Y1I A;  9ICM A;  3UQ2 A;  4DSE A;  2F1J A;  3RJK A;  1KFD A;  8ICQ A;  2LYH A;  5L1K A;  5HHI A;  5HNK A;  4FS2 A;  4ED3 A;  1NK9 A;  2JEF A;  7ICH A;  3UXP A;  4YD2 A;  4EYI B;  4TUQ A;  5DBC A;  3PMN A;  5C5J A;  3C5G A;  2BCQ A;  7ICT A;  4RT3 A;  3ISC A;  3RBE A;  9ICE A;  3LK9 A;  1HUO A;  1B22 A;  3EPI A;  8ICI A;  5KG6 A;  3QZ7 A;  4DWI A;  3H4B A;  1TK0 A;  4F50 A;  3SV3 A;  1T7P A;  3K75 D;  1KTQ A;  1BPD A;  4ECY A;  2AQ4 A;  2R8H A;  4M9L A;  4DF8 A;  3ISB A;  5HHH A;  3UQ0 A;  3ZD9 A;  1JXE A;  8ICV A;  1JMS A;  2BPC A;  5J2H A;  3TAR A;  1NK8 A;  1S10 A;  2IBK A;  1JN3 A;  8ICS A;  3H8S A;  4UBC A;  4O3R A;  1CEZ A;  4F5R A;  3PX0 A;  4F5O A;  5DGB A;  4YQW A;  1ZQY A;  4YCX A;  4ELV A;  2BQR A;  2KZM A;  2BR0 A;  1SKW A;  4KN7 A;  3ZDD A;  4RQ8 A;  4C8O A;  4DSI A;  4KLL A;  2ZUC A;  4KN4 A;  4JV1 A;  4DQS A;  2DFL A;  3H40 A;  5JUM A;  1D9F A;  3M8R A;  4DQP A;  4JWM A;  4NY8 A;  1L3V A;  3EWA A;  4G3I A;  5DG9 A;  4F3O A;  4J9P A;  1S0O A;  2JEG A;  4GC6 A;  3C23 A;  2ISP A;  2F1I A;  4GXJ A;  1NK6 A;  4R8U B;  1UT8 A;  2VA8 A;  1SL1 A;  8ICJ A;  4J9Q A;  1IM4 A;  4EBD A;  1DGS A;  1NJZ A;  4YMM A;  5KT7 A;  8ICM A;  3RR7 A;  4DQQ A;  3RH6 A;  1TV9 A;  5KFU A;  3OSN A;  1ZQK A;  2PI4 A;  4KMU A;  3RJJ A;  4Q45 A;  3PVX A;  7ICU A;  4K4I A;  1XU4 A;  2XCP A;  5EWF A;  4RZR A;  4UQG A;  3MR3 A;  2W9C A;  4YG2 A;  3GFK B;  4O3Q A;  4EYH B;  5EWE A;  3PNC A;  1S0M A;  2ZUB A;  5L9X A;  1ZQM A;  4F4W A;  4DSJ A;  4NLZ A;  3RRH A;  2P66 A;  3QE9 Y;  7ICM A;  4EBE A;  2ZTC A;  5KT2 A;  1XC9 A;  8ICT A;  3GV8 B;  1TK8 A;  1NK5 A;  2HHQ A;  4F5Q A;  4QZG A;  3OHB A;  4RQ1 A;  4PGQ A;  2RDJ A;  2C2E A;  2IA6 A;  1ZQJ A;  4ED2 A;  3JPN A;  2AU0 A;  2P6R A;  4KLG A;  4KLT A;  3PR5 B;  4YR2 A;  4M6W A;  2W9C B;  4PHD A;  4O5E A;  5KFZ A;  2BCV A;  1JIH A;  4RQ4 A;  4DL6 A;  1XSN A;  1LV5 A;  1ZQG A;  9ICC A;  4YFK A;  1ZQP A;  2VA3 A;  3C2K A;  1NK7 A;  4DQR A;  1D9D A;  5J2I A;  5DQI A;  8ICW A;  5J2F A;  1BVS A;  3PW5 A;  2V9W A;  8ICY A;  7ICV A;  4YD1 A;  4J9L A;  2KTQ A;  1WCN A;  2HHV A;  1B43 A;  5L1I A;  2PFP A;  2R8K A;  2PI5 A;  1MSW D;  4DL7 A;  4QZ9 A;  2XY7 A;  9ICB A;  1KFT A;  3LWM A;  3V6K A;  3IM1 A;  1X9W A;  2KN7 A;  3PML A;  3KHR A;  5KFE A;  2PXI A;  9ICT A;  4UB1 A;  4B9L A;  2DPJ A;  1L3S A;  3C2M A;  4ELU A;  1XS9 D;  5KFY A;  2BGW A;  2PFQ A;  4DS4 A;  1ARO P;  5KG3 A;  4XA5 A;  5KFK A;  2HVH A;  1A76 A;  5DG7 A;  1ZQB A;  2AJQ A;  4RQ2 A;  4K4G A;  9ICG A;  5J0Q A;  4EBC A;  7ICI A;  5J0X A;  3TQ1 A;  4NM1 A;  4ED6 A;  2NRT A;  3SI8 A;  5J2K A;  4DF4 A;  4DQI A;  3FYH A;  4QWB A;  2XY6 A;  4QZI A;  1ZJM A;  3ZDB A;  4MF8 A;  2W9B A;  1MQ3 A;  2C28 A;  4RNO A;  4QWA A;  3JPQ A;  4KTQ A;  4ED0 A;  1U47 A;  3TAQ A;  1MC8 A;  4QWC A;  4UAZ A;  4B9M A;  3GV7 B;  5DG8 A;  1TK5 A;  2ALZ A;  1KDH A;  1NKC A;  8ICL A;  3UXO A;  3JPT A;  3GIK A;  5KFD A;  2JEJ A;  5KFL A;  3GDX A;  3AU6 A;  2FPK A;  4KLJ A;  2HHW A;  8ICC A;  1S77 D;  3RR8 A;  3C2L A;  3LWL A;  8ICN A;  5KFP A;  4MEY A;  5KFR A;  5J2B A;  1U49 A;  1V9P A;  4MFA A;  4MFF A;  3ETL A;  4FS1 A;  5KFB A;  4RUA A;  4YXJ A;  4PGY A;  3NGD A; 
#chains in the Genus database with same CATH topology
 4RU9 A;  5DLF A;  1DRG A;  1ZQR A;  5KFX A;  1ZQC A;  3V72 A;  2FI1 A;  5J2G A;  2RDI A;  3KBB A;  5T14 A;  4O3P A;  4YP3 A;  3EYZ A;  5J0W A;  5AKX A;  3MR6 A;  8ICP A;  1RG6 A;  4QZF A;  1QH9 A;  3RBD A;  2MUT A;  2HW3 A;  8ICH A;  1ZQV A;  3E0F A;  3IG5 A;  5KFF A;  2ZIU A;  4OD0 A;  4F4Z A;  4IR9 A;  1D8L A;  4I2G A;  2ZTE A;  1X9M A;  3BQ0 A;  5F3X B;  4PGX A;  3U26 A;  3DV9 A;  4UB8 U;  4ECT A;  3LVW A;  3IV6 A;  2XO7 A;  1RPL A;  5ALD A;  4UB2 A;  1IXR A;  3HIL A;  5KL1 B;  1FO4 A;  1RXW A;  2WAQ F;  1S97 A;  2ZIW A;  2IOF K;  2K60 A;  1ZJN A;  2Y9T A;  5KFC A;  4I2J A;  3SYZ A;  4KLD A;  3F5A A;  3M7D A;  5BOM A;  4Q8E A;  4I2E A;  4R8U A;  4F5N A;  4TUR A;  1C7Y A;  5KFG A;  2CPR A;  2C2D A;  2G09 A;  5DDY A;  4B6J A;  5KFA A;  4BXO B;  2JH7 A;  3F5E A;  3MDC A;  1COO A;  1L3T A;  4DL4 A;  5J0S A;  2AGP A;  9ICN A;  2YB4 A;  3GQC A;  7ICS A;  7ICN A;  2DF4 B;  3PW0 A;  1B4F A;  5AM3 A;  4F4X A;  2H3Z A;  2FPL A;  5J2E A;  1X2I A;  2LI6 A;  4I2C A;  4JB3 A;  1A6S A;  2PKE A;  7ICQ A;  2JGA A;  3H0R B;  5KFH A;  4YVZ A;  4QZC A;  5CB1 A;  3M1Y A;  1UT5 A;  4I2F A;  5IIJ A;  4C4T A;  4O0I A;  1N56 A;  4XQ8 A;  2F2A B;  2XGQ A;  5KFV A;  5HML A;  4KLE A;  4M47 A;  2WTF A;  7ICJ A;  4GC7 A;  1HIW A;  4TQR A;  4KLI A;  2HVI A;  2A3V A;  1ZOL A;  2ZUD A;  2EAM A;  1K5O A;  1KRP A;  1N63 A;  3RFA A;  3EZ5 A;  5ALS A;  1JX4 A;  4G9B A;  1CRX A;  2FLN A;  3PV8 A;  2K4I A;  1UA0 A;  4UAT A;  2P35 A;  3QUQ A;  2C2R A;  2C22 A;  4Z6D A;  4DL2 A;  2AXT U;  2MRL A;  3NVY A;  2KSO B;  5DKW A;  3PW7 A;  5HP4 A;  2EZX A;  2KHQ A;  9ICI A;  1WG8 A;  4M9H A;  3D2N A;  1PVQ A;  1RYU A;  4P4P A;  4BXO A;  4Y2V A;  3QEB Z;  3QU4 A;  1SB3 C;  3RAQ A;  3NUQ A;  3BQ2 A;  2P6U A;  2PMZ C;  4EX7 A;  2A1J A;  5D46 A;  4GIB A;  4M0A A;  4PL2 A;  1ZQQ A;  5J2A A;  5EWG A;  4PHP A;  3H7I A;  2LM4 A;  4DEZ A;  1JXL A;  3RB6 A;  2LPE A;  1ZQN A;  3FDS A;  3KHL A;  1P7D A;  2YN4 A;  5KFJ A;  5ALG A;  4F91 B;  4DO9 A;  3V6J A;  4C0Z A;  4YMO A;  2YB1 A;  3I1Y A;  3V7K A;  4ECR A;  1U48 A;  2KHV A;  1IG6 A;  3M8S A;  2IOH A;  4CF4 A;  4C8M A;  3C1Z A;  4ZH4 A;  1RDF A;  3C21 A;  1O03 A;  4US9 A;  1KSP A;  5AI9 A;  2BPG A;  1NJY A;  2BPF A;  4OO1 J;  3BS7 A;  5CEH A;  4FFD A;  1LKY A;  5F9N A;  1X6J A;  4IQV A;  1Q46 A;  1SZP A;  2BCU A;  2Y1J A;  4RPX A;  1F5S A;  1SKR A;  3RJF A;  5G5H A;  8ICU A;  5ALZ A;  1BPX A;  4KLM A;  2ODG A;  3PY8 A;  4Y2P A;  3OSP A;  3QUC A;  1S0V A;  2AQ0 A;  5KG1 A;  2WF8 A;  5IIM A;  2JZB B;  2KJ9 A;  4AYB C;  1IV8 A;  5KG7 A;  5AK3 A;  4P0P A;  4CNQ A;  5KT4 A;  5BPC A;  4QNL A;  4Y2Q A;  2BQ3 A;  4PL1 A;  4HYK A;  4DSL A;  1S0N A;  3KFU F;  1XO1 A;  1FEZ A;  5KG2 A;  4IRD A;  3AQE A;  4FO6 A;  3UQ2 A;  2F1J A;  3RJK A;  5HR6 A;  1BNP A;  4FS2 A;  1NZP A;  3HJE A;  1RM6 C;  2WAQ C;  3PMN A;  2BCQ A;  7ICT A;  3ISC A;  9ICE A;  4DWI A;  3H4B A;  1BPD A;  2EAP A;  4M9L A;  3PZP A;  1X9X A;  2OEH A;  5HHH A;  1Z1V A;  3ZD9 A;  1NK8 A;  4UBC A;  2OXO A;  2JMG A;  3PX0 A;  1ZQY A;  2KZM A;  1ECW A;  4RQ8 A;  4C8O A;  1X40 A;  2K8A A;  2ZUC A;  4KN4 A;  3UM9 A;  5AIA A;  4JV1 A;  3H40 A;  2ES6 A;  4JWM A;  3AQF A;  2LYA A;  5DG9 A;  4F3O A;  4F72 A;  4GXJ A;  4R8U B;  2W54 A;  4FZM A;  4USA A;  2KKV A;  3AEV A;  1NJZ A;  4YMM A;  2XVT A;  5KT7 A;  8ICM A;  2CXY A;  4DQQ A;  3OSN A;  1QCK A;  4Q45 A;  3PVX A;  4C80 A;  7ICU A;  1XU4 A;  4RZR A;  2EQY A;  4UQG A;  4EYH B;  2ZUB A;  5L9X A;  4F4W A;  2QB0 B;  4P0P B;  1L8L A;  1L7P A;  2JV3 A;  1XC9 A;  1PK1 B;  2KEY A;  2C2E A;  4PGQ A;  3JPN A;  2VJ4 A;  4M6W A;  3CNH A;  3TKA A;  1LV5 A;  1S8O A;  1ZQP A;  2VA3 A;  1N61 A;  5J2F A;  8ICY A;  1JAL A;  7ICV A;  5L1I A;  4DL7 A;  4F71 A;  4QZ9 A;  1N2X A;  1X9W A;  1ZRN A;  2WB1 C;  5CRX A;  5KFE A;  1FIQ A;  1KL9 A;  2KNJ A;  4B9L A;  2DPJ A;  2KD1 A;  1Z1B A;  4ELU A;  3NS1 A;  5KFY A;  2BGW A;  1RQN A;  3PSP A;  3SD7 A;  2HBJ A;  5DG7 A;  3D2Q A;  2KSO A;  2KIC A;  3LYS A;  4K4G A;  3BZC A;  4NM1 A;  4DQI A;  4DF4 A;  3AL0 B;  1UQV A;  2KG5 A;  2Q4T A;  1SWW A;  4P0Q A;  2C28 A;  3JPQ A;  4KTQ A;  1AQ6 A;  2F3N A;  3TAQ A;  5KL8 B;  4OCZ A;  1MC8 A;  1ZQ1 C;  3UXO A;  3GIK A;  5KFD A;  1N5X A;  5KFL A;  1JRP A;  4CF5 A;  1LVH A;  2FPK A;  4EEL A;  2NO4 A;  3RR8 A;  1Z19 A;  5KFR A;  5J2B A;  2DL0 A;  1OW5 A;  4YXJ A;  3H0M B;  5AIC A;  3NGD A;  2ZXI A;  3JPS A;  4DFJ A;  4ED8 A;  5L1M A;  4O3O A;  2ZJA A;  3GII A;  2DBY A;  5AKH A;  4QZ8 A;  3WK4 A;  2I6X A;  5G5G A;  2NO5 A;  3RB3 A;  9ICW A;  1SZH A;  4NL9 C;  4R65 A;  4M6W B;  3RJI A;  1FFU A;  2W8K A;  1HJP A;  4I2I A;  4NXZ A;  4KLH A;  2FMS A;  2J6S A;  1JRO A;  1L7N A;  2OWO A;  4P4O A;  2W11 A;  3IP4 B;  4PHA A;  4UB6 U;  2UVU A;  4F2R A;  9ICU A;  3BZK A;  5AHX A;  1KBU A;  2PFN A;  2JEI A;  1NJW A;  3PW4 A;  5J0P A;  3IG8 A;  1A77 A;  5AKI A;  5ALO A;  4ELT A;  2G0A A;  2WF7 A;  8ICE A;  5L1J A;  4Z6E A;  3OHA A;  5AK6 A;  4UAV A;  3BDP A;  2DPI A;  1XWL A;  3HRD D;  1ZQW A;  1MA7 A;  4UAW A;  2QAR B;  3G6X A;  1NJX A;  3KHH A;  1MQ2 A;  3FAH A;  5KAI U;  5AK5 A;  4RQ3 A;  4PHE A;  2PFO A;  1X9S A;  3KHG A;  2VAN A;  3GIM A;  4M9G A;  5J0U A;  4PZO A;  4IR1 A;  5EE0 A;  2R8G A;  1ZD3 A;  7ICP A;  3Q8L A;  2H5X A;  2LM1 A;  2FE9 A;  4UB4 A;  4RQ7 A;  1J2M A;  4OJO A;  3RH4 A;  4TQS A;  2ZIW B;  5F9L A;  4BWJ A;  2NRX A;  1RZT A;  4DLG A;  4O5K A;  3PO5 A;  3WU2 U;  3RRG A;  4J9M A;  4E0D A;  3KOO A;  4IL6 U;  5KFI A;  2ISO A;  4DFP A;  2NRZ A;  2HOQ A;  1ZQI A;  2HCF A;  4DLE A;  3RJH A;  1ZET A;  1PK3 A;  3QX7 A;  2YX8 A;  1T8E A;  3E58 A;  3O0F A;  4I29 A;  4UB3 A;  4Y2T A;  2WF6 A;  4R66 A;  3VCB A;  3MGH A;  4Z6F A;  4UBB A;  1WWV A;  3MAB A;  2GH1 A;  2UVW A;  2AH5 A;  5EE3 A;  2JZB A;  2E3T A;  9ICO A;  4YMN A;  4I2B A;  3SZ2 A;  1BNO A;  4ACO A;  2D6F C;  4BX9 C;  5DBA A;  3ETR A;  1ZQZ A;  5KFO A;  4KLQ A;  5E79 U;  3ORY A;  2W55 A;  3B0Y A;  1Z00 B;  3Q8Q B;  3WK6 A;  2MUT B;  3ZD8 A;  2DGZ A;  4JV2 A;  9ICP A;  2NRV A;  2D3D A;  3RAX A;  1ZQE A;  5CHG A;  5KFS A;  1Z00 A;  1RYR A;  1TVA A;  4LZG A;  1M6Y A;  1PZN A;  3Q8R B;  2KP7 A;  1L3U A;  3E2E A;  3BQT A;  1A0P A;  3RJG A;  2XGP A;  1BGX T;  4Q44 A;  3GV5 B;  2W9A A;  9ICS A;  2KFN A;  1U45 A;  2R8I A;  3NVV A;  4C8L A;  4ECV A;  2XY5 A;  2W7P A;  1KFS A;  3H0L B;  2WF5 A;  1WCL A;  3QU2 A;  5KG4 A;  2XCA A;  2BHN A;  1QLN A;  1VDV A;  1TAU A;  5B5E U;  2BCR A;  5DB7 A;  1ZD4 A;  5ALR A;  1N48 A;  3PX6 A;  3CW2 C;  4RPY A;  3D2S A;  3F53 A;  8ICA A;  2WFA A;  3C5F A;  3Q8P B;  4J9R A;  4DFM A;  4DL3 A;  3D6J A;  2W8L A;  2R8J A;  4I2A A;  5KFN A;  3G6Y A;  5CP2 A;  3EPG A;  2KFZ A;  3TFS A;  4NV0 A;  5FP0 A;  5HMM A;  3SR6 A;  3ICX A;  3ISD A;  1BPY A;  3T79 A;  1ZQH A;  3Q8M A;  9ICX A;  4LJX A;  4JV0 A;  5L1L A;  9ICR A;  4C7Z A;  1C20 A;  4NLG A;  2Y0S C;  4UAS A;  2BDU A;  7ICF A;  3M9N B;  2MA1 A;  3M9M B;  5IIN A;  4DOB A;  9ICQ A;  5AKJ A;  2M9N A;  2QLT A;  2A19 A;  4B9T A;  2J6T A;  1KW4 A;  5KT5 A;  5J0T A;  3H8M A;  4RQ0 A;  4BWM A;  5GTI U;  5KNI A;  1KFD A;  8ICQ A;  3C29 A;  5L1K A;  5HHI A;  2JEF A;  4Y2R A;  7ICH A;  4YD2 A;  3BS5 B;  4EYI B;  5AKY A;  5DBC A;  5C5J A;  3RBE A;  3EPI A;  4KMO B;  1NZB A;  1TK0 A;  4F50 A;  1T7P A;  1SV0 C;  4IC9 A;  5AI6 A;  1S10 A;  1D8B A;  3H8S A;  1CEZ A;  5DGB A;  3MC1 A;  4ELV A;  2BQR A;  5AM0 A;  1URJ A;  2WB1 F;  4KLL A;  2E8P A;  4DQS A;  3A0B U;  5JUM A;  3M8R A;  5AKE A;  2BZF A;  4J9P A;  4GC6 A;  1NK6 A;  2Y0S F;  2VA8 A;  2HMX A;  1TV9 A;  2JXJ A;  4NWI A;  5EWF A;  4CRX A;  3GFK B;  5EWE A;  4DSJ A;  4NLZ A;  5ALX A;  3ALR A;  2K8C B;  2ZTC A;  1CI4 A;  3I76 A;  1KN5 A;  1NK5 A;  3N7P D;  4F5Q A;  1J2N A;  4RQ1 A;  2F8K A;  4KLG A;  3PR5 B;  4Y2J A;  5AM5 A;  4O5E A;  2BCV A;  2KK0 A;  4DL6 A;  3SAF A;  5DQI A;  3PW5 A;  4CE6 A;  4YD1 A;  3WKD A;  2PFP A;  2DUY A;  2XY7 A;  2H3I A;  3V6K A;  4P0Q B;  3KHR A;  2JHD A;  2PMZ F;  4UB1 A;  1OUQ A;  2K4H A;  4DS4 A;  2K8B B;  1ARO P;  4XA5 A;  2HVH A;  2K89 A;  4NL9 A;  1ZQB A;  9ICG A;  5J0Q A;  5J0X A;  4ED6 A;  3SI8 A;  4QWB A;  4QZI A;  1Q3U A;  1MQ3 A;  4QWC A;  1O08 A;  2ALZ A;  1TK5 A;  1KDH A;  2G06 A;  2JEJ A;  3GDX A;  1UPH A;  3AU6 A;  2KE7 A;  8ICN A;  1TAM A;  1U49 A;  1V9P A;  2XID A;  4MFA A;  4PGY A;  2E1F A;  4AYB F;  5K4L A;  4US8 A;  3T5H A;  9ICF A;  3L4P A;  4KLS A;  4P2H A;  3MFH A;  5EE9 A;  3SMV A;  5DB9 A;  1NK4 A;  2V4Q A;  5ALM A;  1FFV A;  4MF2 A;  5AI0 A;  1PVP A;  2KZ3 A;  5TZV A;  4QWD A;  5AI5 A;  1BPE A;  1CUK A;  3THV A;  5CR0 A;  2AGO A;  4OJL A;  4YR3 A;  5IIO A;  2DQN B;  4YXM A;  4RQN A;  4NLC A;  1Y88 A;  3SV4 A;  4DOA A;  4OJ6 A;  1ZD2 P;  3PSI A;  4KIT B;  5AM2 A;  4UB5 A;  2GO7 A;  7ICO A;  2NYV A;  1ZXI A;  4YR0 A;  4XUS A;  5AIB A;  3NRW A;  3LDA A;  1U9L A;  9ICV A;  2ASJ A;  5AI8 A;  4X5V A;  2LYB A;  5DGA A;  4J9N A;  2Y9U A;  4DFK A;  2FMP A;  5DBB A;  2E8N A;  4ICA A;  2RP5 A;  2F44 A;  4IS7 A;  3QXG A;  3BJY A;  1U4B A;  1Z4O A;  5ALI A;  2VA2 A;  1EXN A;  1LB2 B;  3TAP A;  1ZQO A;  3UXN A;  4F92 B;  5DB6 A;  3Q8S B;  3CYM A;  2KJ8 A;  5KT6 A;  5ALV A;  4FZL A;  4QIW F;  4QZD A;  2GOL A;  2XC9 A;  4J9O A;  3R9K A;  5AM4 A;  8ICK A;  4R64 A;  1SL0 A;  1XSP A;  3TAD C;  4I27 A;  5KFM A;  3RB4 A;  5KFQ A;  2IHM A;  1XO0 A;  4RNN A;  5KFT A;  4O9M A;  1H38 A;  3TFR A;  1KQQ A;  2NV3 A;  3F2B A;  2F1H A;  3KZI U;  4IRC A;  4PPX A;  1T3N A;  4C4R A;  2LHT A;  2IMW P;  2FLP A;  3PST A;  3KTQ A;  3UMB A;  5JU5 A;  1N5W A;  1OXJ A;  3SAG A;  1D8Y A;  3JPP A;  2KOB A;  1L5U A;  8ICX A;  3IRU A;  4XRH A;  2KVC A;  3MDA A;  4M04 A;  2RQ5 A;  3GIJ A;  1NK0 A;  3ZDC A;  2DWQ A;  2I1Q A;  5AM1 A;  4O3N A;  4KLO A;  5AKG A;  3M9O B;  4F5P A;  4DL5 A;  1K1S A;  3HX0 A;  2WF9 A;  2MU2 A;  5AKK A;  2ZIX B;  2EH9 A;  4FBT A;  2ZIV A;  3ZDE A;  1JUD A;  1BPZ A;  4NM2 A;  2V4R A;  2I9G A;  3WKA A;  8ICZ A;  4UAU A;  8ICR A;  4M9J A;  3WK7 A;  2ASD A;  3VC8 A;  4MHV A;  4ECU A;  1ZRM A;  3BQ7 A;  4F2S A;  4DSK A;  5ALW A;  1DXS A;  3F2C A;  2BQU A;  5J0Y A;  4Y2Y A;  3AUO A;  2Q0Z X;  4EEN A;  2G5I B;  2ZJ8 A;  3V6H A;  1ZQF A;  5ALY A;  2YTU A;  1LKY B;  3T5L A;  5CJ7 A;  4BGD A;  5J0O A;  2H3V A;  3AU2 A;  3BQ1 A;  2BDP A;  2BKE A;  3FC4 A;  4ECQ A;  3OTQ A;  1TFR A;  4JK1 A;  4J9K A;  2HHU A;  9ICJ A;  2ESE A;  1S76 D;  9ICH A;  1SXE A;  1KLN A;  4M9N A;  3PO4 A;  2E1E A;  3V7L A;  1Q8K A;  3KZX A;  1X6I A;  2KVS A;  4TUS A;  3MR2 A;  3N97 B;  2W04 A;  4FE3 A;  3MFI A;  4KX3 A;  4O5C A;  4CDG A;  1ZQD A;  9ICL A;  3ZDA A;  2VKQ A;  1TE2 A;  3RB0 A;  4B9N A;  2ZIX A;  4P4M A;  3IN5 A;  5D4B A;  1ZQX A;  2GLE A;  2KJ5 A;  3B0X A;  4C8K A;  5J2J A;  1DOQ A;  3K1R B;  3QEA Z;  5KG5 A;  2HHT A;  1VJ5 A;  1F44 A;  5J0R A;  3HP6 A;  2HSZ A;  1N62 A;  5TIS U;  2UVV A;  3QUT A;  7ICE A;  3Q8K A;  1L7O A;  5J2C A;  4RT2 A;  2R18 A;  3N28 A;  1NKB A;  1SL2 A;  1ZQL A;  1BPB A;  2EDU A;  1QQ5 A;  5ALE A;  3UMC A;  2I5H A;  3A0H U;  4K4H A;  2OM6 A;  2MAX A;  5J8Y C;  2EAN A;  3K4G A;  4EX6 A;  2DKX A;  2YY6 A;  2J6U A;  5DDM A;  2F76 X;  9ICM A;  4DSE A;  4AP9 A;  2LYH A;  4ED3 A;  5HNK A;  1NK9 A;  3ED5 A;  4ZOH C;  4RT3 A;  3LK9 A;  1HUO A;  1B22 A;  3QZ7 A;  3SV3 A;  3K75 D;  2AQ4 A;  2G07 A;  2HOF A;  3CRX A;  1JMS A;  2BPC A;  3TAR A;  2IBK A;  4BUG A;  3NVW A;  4FZN A;  4F5O A;  3ZDD A;  1SKW A;  4KN7 A;  2DFL A;  1D9F A;  4DQP A;  3EWA A;  1S0O A;  2JEG A;  3C23 A;  2F1I A;  8ICJ A;  1UT8 A;  3SEI A;  1DK2 A;  2KIV A;  4EBD A;  2QKQ A;  1SV4 A;  4BJQ A;  5KFU A;  2W3S A;  4KMU A;  1IIP A;  1N60 A;  4K4I A;  1L7M A;  2W9C A;  4YG2 A;  3QU7 A;  4O3Q A;  5ALL A;  1S0M A;  1ZQM A;  7ICM A;  2XIC A;  4EBE A;  5KT2 A;  2LKY A;  1TK8 A;  2HHQ A;  3OHB A;  3L5K A;  2IA6 A;  1ZQJ A;  3IDW A;  4ED2 A;  2AU0 A;  2G08 A;  2W9C B;  4YR2 A;  4PHD A;  4GFJ A;  3N7S C;  5KFZ A;  1JIH A;  1WWU A;  4RQ4 A;  1XSN A;  1ZQG A;  9ICC A;  3LVV A;  4YFK A;  3C2K A;  3M6Z A;  4DQR A;  3SEN A;  3TAC B;  1D9D A;  1COK A;  1BVS A;  2V9W A;  3OPX A;  4J9L A;  1WCN A;  1B43 A;  2R8K A;  1MSW D;  4NJ8 A;  2EZZ A;  3IM1 A;  2PXI A;  5KAF U;  9ICT A;  3WKB A;  2HBK A;  3C2M A;  1WYG A;  1XS9 D;  3QNM A;  5H2F U;  3AMZ A;  5KG3 A;  5KFK A;  1A76 A;  2AJQ A;  4EBC A;  4CGZ A;  2DKZ A;  2NRT A;  3L3F X;  2RRD A;  3F2D A;  2XY6 A;  3ZDB A;  4MF8 A;  2D8C A;  2W9B A;  4RNO A;  4QWA A;  4ED0 A;  2XI9 A;  4UAZ A;  4B9M A;  4DCC A;  5DG8 A;  8ICL A;  3JPT A;  5JRT A;  4QIW C;  4KLJ A;  8ICC A;  1S77 D;  5ALJ A;  2OHF A;  2E8M A;  4MEY A;  5J8Y A;  4FS1 A;  4RUA A;  3NRZ A;  2RHF A;  3S6J A;  1KKX A;  5EE1 A;  3N7R C;  1T4G A;  3BS5 A;  4MEX A;  1T3Q A;  5EOZ A;  4ED1 A;  4YN4 A;  4JUZ A;  4UW9 A;  4EEY A;  1T94 A;  4ECW A;  3JPR A;  8ICO A;  4U6P A;  2YQE A;  2ZTD A;  1Q3V A;  4M2Y A;  3IHQ B;  4FBU A;  5HR7 A;  2W7O A;  4I28 A;  5IIL A;  5ALT A;  4O3S A;  1MN8 A;  3OJU A;  4UAY A;  2MSN A;  3RTV A;  2IHN A;  5J29 A;  2N1R A;  2JR5 A;  1NOM A;  5DLG A;  3RJE A;  1QQ7 A;  3WKE A;  3OGU A;  3HKZ F;  2FDR A;  4DSF A;  7ICG A;  4Y2U A;  3C1Y A;  2HDO A;  3MBY A;  3KKA C;  5DB8 A;  1UHU A;  3OJS A;  2W9B B;  2H3Q A;  3NAS A;  2HHS A;  3HT3 A;  1PK1 A;  4EZ9 A;  4DOC A;  5ALH A;  2YMM A;  2B6G A;  2ZJ5 A;  2HBL A;  7ICK A;  2BCS A;  1ZQS A;  2HHX A;  2JH1 A;  3HKZ C;  1SXD A;  3N4M B;  5IIK A;  2ASL A;  1S9F A;  4GXK A;  4QZE A;  3KD3 A;  2NRW A;  1QSL A;  4IRK A;  3HW8 A;  4OJ5 A;  2VJ5 A;  3QU5 A;  5AKL A;  3H8J A;  3AM9 A;  5ALP A;  4IQW A;  4RQM A;  2O6K A;  2W3R A;  4QZB A;  3SQI A;  4ECZ A;  4A8E A;  2LBO A;  2GWS A;  1RYS A;  4RNM A;  2B21 A;  3K1Z A;  4NLB A;  3WK5 A;  2AGQ A;  4MFC A;  3HPO A;  3EUB 2;  4F93 B;  5B66 U;  2A1J B;  3G6V A;  4UAR A;  1X66 A;  2KKP A;  3TAN A;  2FPM A;  2HOI A;  8ICF A;  4C8N A;  4OJP A;  3T3F A;  1Z3E B;  4ECS A;  4BDP A;  8ICB A;  1S5L U;  1RXV A;  3NVZ A;  3HWT A;  3ONN A;  3UPQ A;  3NTU A;  1QSS A;  4EZ6 A;  2JRZ A;  1YZ6 A;  4Q43 A;  5DQH A;  1PVR A;  1SGG A;  5III A;  1NNL A;  4PH5 A;  5CWR A;  3QZ8 A;  1QSY A;  4I2D A;  4RPZ A;  9ICK A;  3PR4 A;  1TAQ A;  9ICA A;  4LZD A;  5ALF A;  4QZA A;  2Z7J A;  1NKE A;  5ALK A;  4F8R A;  5J2D A;  1Z4N A;  3GIL A;  4EEK A;  3MGV A;  3WK9 A;  3MR5 A;  7ICR A;  4IQU A;  2VIX A;  1SWV A;  4Y2X A;  3V7J A;  3PW2 A;  1K1Q A;  1NI3 A;  4DS5 A;  4PJ0 U;  4Z6C A;  1HEK A;  2KMD A;  3SAH A;  3WKC A;  4RUC A;  5AI4 A;  4C4S A;  3T5K A;  1UCV A;  3MGI A;  4F4K A;  5ALU A;  7ICL A;  5D49 A;  2W9M A;  3H8W A;  2YMP A;  3RH5 A;  1ED1 A;  3KKA A;  4KLF A;  3H4D A;  4DFD A;  2F77 X;  1TKD A;  4ED7 A;  1HUZ A;  1XNS A;  4RQ5 A;  1ZYQ A;  1UA1 A;  4R63 A;  3ZI4 A;  2ZG6 A;  4QW9 A;  4QW8 A;  2ZIV B;  1VLB A;  4QZH A;  4F4Y A;  5KFW A;  1ZQU A;  5AKZ A;  1L8O A;  5GTH U;  3C28 A;  3PX4 A;  1QTM A;  2A1A A;  4KX5 A;  2FLL A;  4NLN A;  5KG0 A;  4JWN A;  3TI0 A;  4J03 A;  2ATL A;  2YML A;  5CA7 A;  4CCH A;  5C0Y A;  2K4E A;  3T5J A;  2M0N A;  4GXI A;  1ZQA A;  3QUB A;  2KZZ A;  4ECX A;  5BOL A;  5ALQ A;  1QQ6 A;  3JPO A;  3AN1 A;  3EW9 A;  4B9V A;  2IOF A;  4NLK A;  4B9U A;  4QWE A;  5KTQ A;  4TUP A;  1KEJ A;  2L5Y A;  1ZQT A;  4I2H A;  4LVS A;  1XSL A;  4RQ6 A;  8ICG A;  5DQG A;  4Q8F A;  4O3M A;  1DK3 A;  1V85 A;  2HI0 A;  3RF9 A;  3B9J A;  4JMU A;  3I28 A;  4J9S A;  5KT3 A;  4KLU A;  2FMQ A;  1PUZ A;  4IQT A;  1SKS A;  1YT3 A;  4GLX A;  4B9S A;  2EZY A;  2LMR A;  3M6K A;  3PSF A;  2G5H B;  2UVR A;  1JI7 A;  2Y1I A;  2HBM A;  4WJ3 B;  2KIW A;  2F8L A;  3UXP A;  2AHO B;  4TUQ A;  1WUD A;  4U7C A;  3C5G A;  2B0C A;  4C7Y A;  8ICI A;  5KG6 A;  4CF3 A;  1KTQ A;  4ECY A;  2R8H A;  1J97 A;  3QYP A;  4DF8 A;  3ISB A;  2EAO A;  3UQ0 A;  1JXE A;  8ICV A;  5J2H A;  2YMQ A;  8ICS A;  1JN3 A;  4O3R A;  4F5R A;  4YQW A;  4YCX A;  2W03 A;  2BR0 A;  4DSI A;  3UMG A;  4NY8 A;  1L3V A;  4G3I A;  3FM9 A;  5AK4 A;  1X42 A;  2ISP A;  1SL1 A;  4J9Q A;  3QU9 A;  1IM4 A;  1DGS A;  5ALN A;  3RR7 A;  3DDH A;  3RH6 A;  2PI4 A;  3RJJ A;  1ZQK A;  5A0L A;  2W43 A;  3WK8 A;  3DEE A;  2XCP A;  3J81 j;  3MR3 A;  2WHE A;  3PNC A;  3RRH A;  2P66 A;  3QE9 Y;  1V97 A;  5JTI A;  2E8O A;  2CRX A;  8ICT A;  3GV8 B;  4QZG A;  2RDJ A;  1L6N A;  4PZN A;  4KLT A;  2QAR A;  1SIJ A;  2P6R A;  2H3F A;  2E5S A;  2K4P A;  1NK7 A;  5J2I A;  2QB0 A;  8ICW A;  2OH2 A;  2KTQ A;  2HHV A;  2ZIU B;  2PI5 A;  1DGJ A;  1F0M A;  9ICB A;  1KFT A;  3LWM A;  2KN7 A;  2OYY A;  3PML A;  2ZXH A;  1GO3 F;  3CP8 A;  1L3S A;  4QJF B;  2QB1 A;  1YZ7 A;  2PFQ A;  1SV0 A;  4RQ2 A;  7ICI A;  3TQ1 A;  4HAI A;  5J2K A;  2FJ6 A;  3FYH A;  3TAD A;  1V38 A;  1ZJM A;  1U47 A;  3GV7 B;  1NKC A;  1ZD5 A;  2KV2 A;  1B0X A;  2HHW A;  3C2L A;  3LWL A;  5KFP A;  4MFF A;  1RQL A;  3ETL A;  5KFB A;  2CN1 A;  2RLT A;  3GZF A;  2OCE A;  4Y2S A;  3GU3 A; 
#chains in the Genus database with same CATH homology
 4RU9 A;  5DLF A;  1ZQR A;  3JPS A;  1T4G A;  5KFX A;  4DFJ A;  4MEX A;  1ZQC A;  4ED8 A;  4O3O A;  2ZJA A;  3GII A;  3T5H A;  5EOZ A;  9ICF A;  4KLS A;  4P2H A;  4QZ8 A;  3V72 A;  4ED1 A;  4YN4 A;  4JUZ A;  3RB3 A;  4EEY A;  9ICW A;  3MFH A;  5J2G A;  5DB9 A;  1NK4 A;  4R65 A;  2V4Q A;  4M6W B;  4ECW A;  2RDI A;  3RJI A;  3JPR A;  2W8K A;  8ICO A;  4O3P A;  4YP3 A;  1HJP A;  5J0W A;  3EYZ A;  4I2I A;  2ZTD A;  4NXZ A;  4MF2 A;  4KLH A;  3MR6 A;  4M2Y A;  2FMS A;  3IHQ B;  2J6S A;  4FBU A;  8ICP A;  2OWO A;  4P4O A;  4I28 A;  4QZF A;  5IIL A;  4PHA A;  2KZ3 A;  5TZV A;  2MUT A;  3RBD A;  2UVU A;  2HW3 A;  4F2R A;  4O3S A;  8ICH A;  3OJU A;  1ZQV A;  4UAY A;  3RTV A;  4QWD A;  9ICU A;  2IHN A;  5J29 A;  1BPE A;  5KFF A;  1CUK A;  3THV A;  5CR0 A;  2PFN A;  1NOM A;  5DLG A;  4F4Z A;  2AGO A;  4IR9 A;  2JEI A;  1NJW A;  1D8L A;  3RJE A;  2ZTE A;  4YR3 A;  4I2G A;  3PW4 A;  1X9M A;  3BQ0 A;  5IIO A;  5J0P A;  4PGX A;  3OGU A;  4YXM A;  4ECT A;  2XO7 A;  1RPL A;  1Y88 A;  4DSF A;  1A77 A;  3SV4 A;  4KLD A;  4UB2 A;  7ICG A;  4DOA A;  3C1Y A;  1IXR A;  3MBY A;  4ELT A;  5DB8 A;  8ICE A;  2W9B B;  3OJS A;  4KIT B;  5L1J A;  4Z6E A;  4UB5 A;  3OHA A;  2HHS A;  3HT3 A;  4EZ9 A;  1RXW A;  4DOC A;  7ICO A;  3BDP A;  1S97 A;  2DPI A;  2ZJ5 A;  7ICK A;  4YR0 A;  4XUS A;  1XWL A;  1ZJN A;  3LDA A;  2BCS A;  1U9L A;  1ZQS A;  1ZQW A;  9ICV A;  5KFC A;  4I2J A;  2HHX A;  2ASJ A;  4UAW A;  3G6X A;  4X5V A;  3KHH A;  1NJX A;  1MQ2 A;  5DGA A;  4PHE A;  4RQ3 A;  4J9N A;  3SYZ A;  4DFK A;  3N4M B;  2FMP A;  5IIK A;  5DBB A;  2ASL A;  2PFO A;  1S9F A;  4GXK A;  1X9S A;  4QZE A;  5BOM A;  3KHG A;  2NRW A;  1QSL A;  2VAN A;  3GIM A;  4IRK A;  4Q8E A;  3HW8 A;  4M9G A;  4I2E A;  5J0U A;  3BJY A;  1U4B A;  4IR1 A;  2R8G A;  4R8U A;  2VA2 A;  1EXN A;  4F5N A;  4TUR A;  1LB2 B;  3TAP A;  1ZQO A;  3UXN A;  7ICP A;  1C7Y A;  5KFG A;  2C2D A;  3Q8L A;  4F92 B;  5DB6 A;  3Q8S B;  2H5X A;  4UB4 A;  4RQ7 A;  5DDY A;  5KFA A;  4BXO B;  5KT6 A;  3H8J A;  3MDC A;  1COO A;  4IQW A;  1L3T A;  4QZD A;  4DL4 A;  5J0S A;  3RH4 A;  2AGP A;  9ICN A;  4QZB A;  3GQC A;  2XC9 A;  4J9O A;  4ECZ A;  4TQS A;  7ICS A;  8ICK A;  4R64 A;  5F9L A;  4BWJ A;  2NRX A;  1RZT A;  1SL0 A;  2GWS A;  1XSP A;  1RYS A;  4RNM A;  2B21 A;  7ICN A;  3PW0 A;  4DLG A;  4O5K A;  3PO5 A;  4I27 A;  5KFM A;  3RB4 A;  4F4X A;  5J2E A;  2FPL A;  5KFQ A;  2AGQ A;  2IHM A;  3RRG A;  1X2I A;  4MFC A;  3HPO A;  4I2C A;  4J9M A;  4RNN A;  4F93 B;  4E0D A;  5KFI A;  5KFT A;  4O9M A;  2A1J B;  2ISO A;  7ICQ A;  3G6V A;  4DFP A;  1H38 A;  3TFR A;  5KFH A;  2NRZ A;  1ZQI A;  4YVZ A;  4QZC A;  3TAN A;  2FPM A;  5CB1 A;  1UT5 A;  4DLE A;  4I2F A;  2F1H A;  5IIJ A;  4O0I A;  1N56 A;  3RJH A;  8ICF A;  1ZET A;  4XQ8 A;  4C8N A;  3T3F A;  2XGQ A;  5KFV A;  1Z3E B;  5HML A;  4ECS A;  4BDP A;  4IRC A;  4PPX A;  8ICB A;  1T8E A;  1T3N A;  4KLE A;  2IMW P;  4M47 A;  2WTF A;  7ICJ A;  2FLP A;  4I29 A;  1RXV A;  4GC7 A;  3KTQ A;  4UB3 A;  4TQR A;  3HWT A;  4R66 A;  3MGH A;  4Z6F A;  4UBB A;  3UPQ A;  3NTU A;  4KLI A;  2HVI A;  1QSS A;  4EZ6 A;  3MAB A;  4Q43 A;  5DQH A;  2ZUD A;  2UVW A;  1D8Y A;  2JZB A;  5III A;  1KRP A;  3JPP A;  3EZ5 A;  9ICO A;  1L5U A;  4YMN A;  4PH5 A;  8ICX A;  1JX4 A;  5CWR A;  4XRH A;  3QZ8 A;  4I2B A;  3MDA A;  3SZ2 A;  2FLN A;  3PV8 A;  3GIJ A;  1QSY A;  4M04 A;  4I2D A;  1NK0 A;  4RPZ A;  9ICK A;  3ZDC A;  1UA0 A;  3PR4 A;  1TAQ A;  9ICA A;  2C2R A;  2I1Q A;  4LZD A;  4Z6D A;  4DL2 A;  4QZA A;  2C22 A;  4O3N A;  5DBA A;  1NKE A;  4KLO A;  1ZQZ A;  5KFO A;  5DKW A;  4KLQ A;  4F8R A;  5J2D A;  3M9O B;  4F5P A;  4DL5 A;  1K1S A;  3HX0 A;  3ORY A;  3PW7 A;  5HP4 A;  3B0Y A;  9ICI A;  3GIL A;  1Z00 B;  3Q8Q B;  2MUT B;  4M9H A;  4P4P A;  4BXO A;  3MR5 A;  7ICR A;  3ZD8 A;  4FBT A;  3QEB Z;  3ZDE A;  4IQU A;  1BPZ A;  4JV2 A;  4NM2 A;  2V4R A;  9ICP A;  2NRV A;  3RAQ A;  2I9G A;  8ICZ A;  3BQ2 A;  3V7J A;  3PW2 A;  3RAX A;  1K1Q A;  8ICR A;  1ZQE A;  2P6U A;  4M9J A;  5CHG A;  5KFS A;  4DS5 A;  4Z6C A;  2ASD A;  1Z00 A;  2A1J A;  4ECU A;  1RYR A;  5D46 A;  1TVA A;  4RUC A;  4LZG A;  1PZN A;  3T5K A;  3Q8R B;  4F2S A;  4M0A A;  4DSK A;  1ZQQ A;  5J2A A;  3MGI A;  5EWG A;  4F4K A;  4PHP A;  1L3U A;  3E2E A;  7ICL A;  3H7I A;  3BQT A;  4DEZ A;  5D49 A;  2W9M A;  3H8W A;  3RJG A;  2XGP A;  2BQU A;  1BGX T;  4Q44 A;  3GV5 B;  2W9A A;  1JXL A;  3RH5 A;  5J0Y A;  4KLF A;  3H4D A;  9ICS A;  2KFN A;  1U45 A;  3RB6 A;  1TKD A;  2R8I A;  4ED7 A;  1HUZ A;  3FDS A;  1ZQN A;  3KHL A;  4RQ5 A;  2Q0Z X;  3AUO A;  2ZJ8 A;  1ZYQ A;  1UA1 A;  4R63 A;  3V6H A;  4C8L A;  1ZQF A;  4QW9 A;  4QW8 A;  4ECV A;  3T5L A;  5KFJ A;  2XY5 A;  5CJ7 A;  1KFS A;  4F91 B;  4BGD A;  4DO9 A;  5J0O A;  4QZH A;  1WCL A;  3V6J A;  4F4Y A;  5KFW A;  4YMO A;  5KG4 A;  2XCA A;  3AU2 A;  1ZQU A;  3V7K A;  2BHN A;  3BQ1 A;  2BDP A;  2BKE A;  4ECR A;  1U48 A;  1QLN A;  4ECQ A;  1TAU A;  2BCR A;  1TFR A;  4JK1 A;  5DB7 A;  4J9K A;  2HHU A;  3PX4 A;  1N48 A;  9ICJ A;  1QTM A;  2FLL A;  1S76 D;  3M8S A;  3PX6 A;  9ICH A;  1KLN A;  4NLN A;  5KG0 A;  4JWN A;  3TI0 A;  4M9N A;  3PO4 A;  2ATL A;  4C8M A;  3C1Z A;  3V7L A;  5CA7 A;  4ZH4 A;  3C21 A;  4RPY A;  4CCH A;  3MR2 A;  4TUS A;  3N97 B;  1KSP A;  2BPG A;  8ICA A;  1NJY A;  2BPF A;  3T5J A;  3MFI A;  4GXI A;  4O5C A;  1ZQD A;  9ICL A;  3ZDA A;  1ZQA A;  3C5F A;  3Q8P B;  4J9R A;  4DFM A;  4ECX A;  2KZZ A;  5F9N A;  4DL3 A;  4I2A A;  2W8L A;  4IQV A;  5BOL A;  2R8J A;  5KFN A;  3G6Y A;  3RB0 A;  5CP2 A;  4B9N A;  3JPO A;  4P4M A;  3EW9 A;  4B9V A;  3EPG A;  2KFZ A;  4NLK A;  3TFS A;  5D4B A;  4B9U A;  1ZQX A;  3B0X A;  4QWE A;  1SZP A;  5J2J A;  2BCU A;  4C8K A;  5KTQ A;  4TUP A;  1KEJ A;  5HMM A;  1ZQT A;  1DOQ A;  2Y1J A;  4RPX A;  3QEA Z;  1XSL A;  4I2H A;  5KG5 A;  4LVS A;  2HHT A;  4RQ6 A;  3ISD A;  1BPY A;  5DQG A;  8ICG A;  5J0R A;  1ZQH A;  3HP6 A;  1SKR A;  3Q8M A;  4Q8F A;  3RJF A;  8ICU A;  1BPX A;  4KLM A;  9ICX A;  4JV0 A;  2UVV A;  5L1L A;  3PY8 A;  7ICE A;  9ICR A;  3OSP A;  3Q8K A;  4NLG A;  1S0V A;  2AQ0 A;  5J2C A;  5KG1 A;  4RT2 A;  5IIM A;  4J9S A;  1NKB A;  1SL2 A;  2JZB B;  5KT3 A;  4KLU A;  7ICF A;  1ZQL A;  3M9N B;  1BPB A;  2FMQ A;  4IQT A;  1SKS A;  5KG7 A;  3M9M B;  5IIN A;  5KT4 A;  4GLX A;  4DOB A;  4B9S A;  4K4H A;  2MAX A;  5BPC A;  9ICQ A;  2M9N A;  2BQ3 A;  4HYK A;  4B9T A;  4DSL A;  1S0N A;  1XO1 A;  2J6T A;  5KT5 A;  5J0T A;  3K4G A;  5KG2 A;  4RQ0 A;  2UVR A;  4IRD A;  2J6U A;  4BWM A;  5DDM A;  4FO6 A;  2Y1I A;  9ICM A;  3UQ2 A;  4DSE A;  2F1J A;  3RJK A;  1KFD A;  8ICQ A;  2LYH A;  5L1K A;  5HHI A;  5HNK A;  4FS2 A;  4ED3 A;  1NK9 A;  2JEF A;  7ICH A;  3UXP A;  4YD2 A;  4EYI B;  4TUQ A;  5DBC A;  3PMN A;  5C5J A;  3C5G A;  2BCQ A;  7ICT A;  4RT3 A;  3ISC A;  3RBE A;  9ICE A;  3LK9 A;  1HUO A;  1B22 A;  3EPI A;  8ICI A;  5KG6 A;  3QZ7 A;  4DWI A;  3H4B A;  1TK0 A;  4F50 A;  3SV3 A;  1T7P A;  3K75 D;  1KTQ A;  1BPD A;  4ECY A;  2AQ4 A;  2R8H A;  4M9L A;  4DF8 A;  3ISB A;  5HHH A;  3UQ0 A;  3ZD9 A;  1JXE A;  8ICV A;  1JMS A;  2BPC A;  5J2H A;  3TAR A;  1NK8 A;  1S10 A;  2IBK A;  1JN3 A;  8ICS A;  3H8S A;  4UBC A;  4O3R A;  1CEZ A;  4F5R A;  3PX0 A;  4F5O A;  5DGB A;  4YQW A;  1ZQY A;  4YCX A;  4ELV A;  2BQR A;  2KZM A;  2BR0 A;  1SKW A;  4KN7 A;  3ZDD A;  4RQ8 A;  4C8O A;  4DSI A;  4KLL A;  2ZUC A;  4KN4 A;  4JV1 A;  4DQS A;  2DFL A;  3H40 A;  5JUM A;  1D9F A;  3M8R A;  4DQP A;  4JWM A;  4NY8 A;  1L3V A;  3EWA A;  4G3I A;  5DG9 A;  4F3O A;  4J9P A;  1S0O A;  2JEG A;  4GC6 A;  3C23 A;  2ISP A;  2F1I A;  4GXJ A;  1NK6 A;  4R8U B;  1UT8 A;  2VA8 A;  1SL1 A;  8ICJ A;  4J9Q A;  1IM4 A;  4EBD A;  1DGS A;  1NJZ A;  4YMM A;  5KT7 A;  8ICM A;  3RR7 A;  4DQQ A;  3RH6 A;  1TV9 A;  5KFU A;  3OSN A;  1ZQK A;  2PI4 A;  4KMU A;  3RJJ A;  4Q45 A;  3PVX A;  7ICU A;  4K4I A;  1XU4 A;  2XCP A;  5EWF A;  4RZR A;  4UQG A;  3MR3 A;  2W9C A;  4YG2 A;  3GFK B;  4O3Q A;  4EYH B;  5EWE A;  3PNC A;  1S0M A;  2ZUB A;  5L9X A;  1ZQM A;  4F4W A;  4DSJ A;  4NLZ A;  3RRH A;  2P66 A;  3QE9 Y;  7ICM A;  4EBE A;  2ZTC A;  5KT2 A;  1XC9 A;  8ICT A;  3GV8 B;  1TK8 A;  1NK5 A;  2HHQ A;  4F5Q A;  4QZG A;  3OHB A;  4RQ1 A;  4PGQ A;  2RDJ A;  2C2E A;  2IA6 A;  1ZQJ A;  4ED2 A;  3JPN A;  2AU0 A;  2P6R A;  4KLG A;  4KLT A;  3PR5 B;  4YR2 A;  4M6W A;  2W9C B;  4PHD A;  4O5E A;  5KFZ A;  2BCV A;  1JIH A;  4RQ4 A;  4DL6 A;  1XSN A;  1LV5 A;  1ZQG A;  9ICC A;  4YFK A;  1ZQP A;  2VA3 A;  3C2K A;  1NK7 A;  4DQR A;  1D9D A;  5J2I A;  5DQI A;  8ICW A;  5J2F A;  1BVS A;  3PW5 A;  2V9W A;  8ICY A;  7ICV A;  4YD1 A;  4J9L A;  2KTQ A;  1WCN A;  2HHV A;  1B43 A;  5L1I A;  2PFP A;  2R8K A;  2PI5 A;  1MSW D;  4DL7 A;  4QZ9 A;  2XY7 A;  9ICB A;  1KFT A;  3LWM A;  3V6K A;  3IM1 A;  1X9W A;  2KN7 A;  3PML A;  3KHR A;  5KFE A;  2PXI A;  9ICT A;  4UB1 A;  4B9L A;  2DPJ A;  1L3S A;  3C2M A;  4ELU A;  1XS9 D;  5KFY A;  2BGW A;  2PFQ A;  4DS4 A;  1ARO P;  5KG3 A;  4XA5 A;  5KFK A;  2HVH A;  1A76 A;  5DG7 A;  1ZQB A;  2AJQ A;  4RQ2 A;  4K4G A;  9ICG A;  5J0Q A;  4EBC A;  7ICI A;  5J0X A;  3TQ1 A;  4NM1 A;  4ED6 A;  2NRT A;  3SI8 A;  5J2K A;  4DF4 A;  4DQI A;  3FYH A;  4QWB A;  2XY6 A;  4QZI A;  1ZJM A;  3ZDB A;  4MF8 A;  2W9B A;  1MQ3 A;  2C28 A;  4RNO A;  4QWA A;  3JPQ A;  4KTQ A;  4ED0 A;  1U47 A;  3TAQ A;  1MC8 A;  4QWC A;  4UAZ A;  4B9M A;  3GV7 B;  5DG8 A;  1TK5 A;  2ALZ A;  1KDH A;  1NKC A;  8ICL A;  3UXO A;  3JPT A;  3GIK A;  5KFD A;  2JEJ A;  5KFL A;  3GDX A;  3AU6 A;  2FPK A;  4KLJ A;  2HHW A;  8ICC A;  1S77 D;  3RR8 A;  3C2L A;  3LWL A;  8ICN A;  5KFP A;  4MEY A;  5KFR A;  5J2B A;  1U49 A;  1V9P A;  4MFA A;  4MFF A;  3ETL A;  4FS1 A;  5KFB A;  4RUA A;  4YXJ A;  4PGY A;  3NGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...