2JZBA

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 17
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbA00
5J2BA 4DOCA 3TARA 2HHWA 3NTUA 1ZQCA 4YR2A 4M0AA 4IRKA 3Q8PB 4EZ6A 4DQIA 5J2CA 4YVZA 4YCXA 5DDMA 5DB6A 4RZRA 5DLFA 4UBBA 5IILA 4KN7A 3UXOA 2IMWP 2W9CA 3G6VA 5KG2A 4F5RA 1QSYA 5IIMA 5J2HA 1KDHA 4JUZA 4ECWA 1TK8A 4UAWA 2C2EA 4PGXA 3RJGA 4I2FA 2DFLA 1MQ3A 4DLEA 2UVVA 3ZDEA 4EYIB 2V4QA 1NKBA 2NRTA 4PHDA 3BDPA 3BQ2A 5KFQA 5EWEA 5IIJA 1ZQJA 4J9OA 2BCVA 2J6UA 1KSPA 1ZQKA 1ZQWA 1XU4A 4KMUA 4B9MA 1HUOA 8ICMA 1COOA 5KG0A 4XQ8A 3JPQA 4DL4A 1S76D 4DSJA 4K4IA 4JV1A 9ICTA 3UXPA 2BHNA 4BWJA 4M9GA 7ICMA 5J0OA 3M8SA 1TFRA 1ZQIA 4ECXA 4QZBA 3MDCA 2ASLA 4EBDA 5IIOA 4F4YA 3ORYA 5DLGA 3LK9A 4KLQA 3TAPA 1JN3A 1KLNA 2XCAA 4KLJA 3EZ5A 1JIHA 4TUSA 2AGOA 3Q8KA 2W9BA 2FLLA 3GV7B 4I2HA 2R8IA 2XGQA 1BVSA 4JK1A 2XC9A 3H4BA 2BQ3A 4F2SA 7ICQA 2R8HA 2RDIA 3FDSA 5KFHA 1RXVA 4QZDA 4ECRA 1NJXA 2R8GA 3ZD9A 4MFCA 2VA2A 4C8NA 3TI0A 3E2EA 4F5PA 4FS1A 2XO7A 5JUMA 4Q8EA 3T5KA 1N56A 1DOQA 4F4WA 5DBBA 4ELVA 1SL1A 1UT5A 2NRVA 4YD2A 1NK8A 3C23A 1JMSA 4QZEA 4DS5A 4F8RA 9ICRA 7ICPA 3MR2A 4R65A 1U9LA 2P66A 4ELUA 2DPIA 4KLGA 1S0VA 2XY7A 5KFEA 1QSSA 3AU2A 1ZETA 3N97B 4QWEA 4EZ9A 1SKRA 5CA7A 2BCQA 1BPYA 2FMSA 4I2JA 4I2BA 2GWSA 2F1JA 4QZIA 4RQ2A 3SZ2A 2JZBA 2PFNA 9ICXA 5KG5A 1U49A 3C21A 2R8JA 2MUTB 4YN4A 1MQ2A 3MABA 3V7JA 2C2RA 1AROP 2BDPA 1EXNA 4I2DA 2JEIA 4EEYA 1HJPA 4ZH4A 4QZHA 9ICHA 1IXRA 1S97A 1DGSA 7ICOA 2Y1JA 3PX6A 3EPGA 4DL3A 5KG4A 4YXJA 3Q8MA 4KLLA 2C28A 9ICEA 1TV9A 4IR9A 4PH5A 3PX4A 5L1JA 4O3RA 3JPOA 5J0XA 4DOAA 7ICEA 3ZDAA 3QZ8A 3RRGA 8ICGA 9ICQA 2ZUBA 5KFUA 3C2KA 4PHPA 4O3QA 4NLKA 4DFPA 4P2HA 4GXJA 3ETLA 5HP4A 2MAXA 3KHRA 1NK0A 2A1JB 2AGQA 2FPKA 3GIMA 3PW4A 3RB4A 3OSPA 1X9SA 7ICRA 2MUTA 2AU0A 4I29A 5HHIA 3ZD8A 4PGQA 3UQ2A 1N48A 4QZFA 4K4HA 4O3NA 4F4ZA 4MEXA 5HHHA 3HW8A 1BPXA 2UVUA 1U48A 3AUOA 4K4GA 2ZUDA 4J9RA 5KFZA 4UAYA 4I28A 2BCSA 3M9OB 1U4BA 4B9UA 5KFLA 4Z6DA 4QZGA 3HT3A 4GLXA 3RTVA 4F5OA 4TUPA 5J29A 4J9KA 4GC6A 5J0UA 3KHHA 1NK9A 2PFOA 4C8KA 4KLMA 9ICCA 1PZNA 4UB3A 1NK7A 4DSKA 2BQRA 2F1IA 3KHGA 2W9CB 3RJJA 4BGDA 4I2EA 4I27A 1ZQBA 5L1KA 8ICNA 2A1JA 5EWGA 7ICGA 5J2AA 5KFYA 4J9NA 1QTMA 4MFFA 3RJFA 4TQSA 1ZQVA 8ICAA 9ICPA 1TVAA 8ICJA 9ICGA 1B22A 4BDPA 4DFJA 1T4GA 4DSFA 4ED2A 4UB4A 4Q44A 4ECTA 3GIKA 4M47A 3OHBA 4C8OA 2I9GA 8ICBA 2HVHA 2HHQA 4R64A 4YFKA 1XS9D 2JEJA 1RXWA 3HPOA 2AQ4A 1SL2A 4ED3A 7ICUA 5DGAA 3EYZA 4NM2A 3OSNA 5D49A 1K1SA 4FO6A 8ICYA 1UT8A 4ECVA 3TFRA 4HYKA 3T5JA 4F3OA 2P6RA 4DL6A 4DQPA 2BGWA 4DQQA 4RT3A 7ICJA 1NK6A 2PXIA 5KFIA 7ICNA 1L3TA 2W8LA 3T3FA 3MBYA 1ZQHA 4KLHA 1H38A 3SYZA 4DEZA 1CUKA 4X5VA 1NK5A 3IM1A 4PPXA 4DL2A 3ZDDA 5KFTA 4FBUA 5DB9A 3LWMA 1S10A 3RR7A 2ZTDA 3MR6A 4GXIA 3ZDBA 4B9SA 3JPSA 5DBAA 2NRZA 4YMMA 5J2KA 4B9LA 8ICRA 1IM4A 1X2IA 3H40A 3ZDCA 3FYHA 1Z00B 8ICVA 1NOMA 3QEAZ 5KTQA 1ZQAA 2NRXA 5J2IA 1SL0A 1TKDA 5KFKA 5IIIA 3RJKA 2HHTA 5J2JA 4MEYA 4YXMA 5KFWA 4UB2A 4J9MA 1RYRA 4KLUA 3RRHA 5KFOA 2ISPA 3SV3A 3Q8SB 2XY5A 4RPZA 4P4PA 5J0SA 4FS2A 3OHAA 1HUZA 1BPZA 4KLDA 3ISBA 9ICSA 4CCHA 4QZ8A 4BXOA 5J0TA 3C1YA 4YP3A 5TZVA 2VANA 4M6WB 4ED0A 5KFAA 1ZYQA 4F93B 2XY6A 1T7PA 2W9MA 2ALZA 8ICEA 5J2DA 4RQ1A 4MF8A 5BOMA 3BQ1A 5C5JA 5CHGA 3PV8A 1XSPA 4M04A 3C2MA 5DQGA 4O5KA 4DO9A 8ICHA 9ICFA 1T3NA 4RNNA 3ISDA 2PFQA 9ICAA 1S0OA 3H8WA 4R8UB 4KLTA 4O0IA 4M9JA 5KFDA 4PHEA 4RQ8A 3PNCA 4C8LA 4UQGA 8ICIA 1ZQGA 3V6KA 3M8RA 2P6UA 3RAQA 4IR1A 5DG7A 2WTFA 3MFHA 3GILA 1TK0A 4I2IA 4F4XA 3V7KA 3UXNA 5KFGA 5KG6A 3RJEA 4QWAA 1XSNA 4RQ3A 4LZGA 4QZAA 1NJWA 7ICKA 5KFMA 5HNKA 4JWNA 4C8MA 3RB0A 3JPNA 4Z6EA 5EWFA 3Q8LA 4KLEA 4RNMA 1U45A 3V72A 2FPLA 5D46A 3AU6A 2KZ3A 4DLGA 1U47A 3KHLA 4RQ0A 3GQCA 5DB7A 5J0QA 3PR4A 1S77D 8ICFA 1B43A 3RH5A 1QLNA 1L3UA 4DS4A 4GXKA 5KFPA 2FLPA 2C2DA 4QW8A 4EYHB 3PW5A 4J9QA 1XC9A 3V6JA 2ISOA 3BJYA 5J2GA 4M9HA 3GIIA 4NLGA 3B0XA 2FMQA 4Q45A 2BPCA 7ICIA 8ICXA 2UVRA 3N4MB 2HHXA 2ZJ8A 4DQSA 4NLZA 9ICLA 2JZBB 4XA5A 3SI8A 1T8EA 2ASDA 4ECUA 2ATLA 4M2YA 2JEFA 4RQ6A 1Y88A 1S9FA 4RU9A 4J9SA 1ZJNA 5L9XA 1UA1A 2VA3A 4ED6A 4M9LA 5KFRA 2PI4A 1MSWD 4RPYA 2ZJ5A 3LDAA 9ICVA 1ZJMA 8ICUA 4R63A 1ZQFA 1L3SA 4ED1A 3PW7A 5CP2A 4O3PA 4QZ9A 1BPEA 5J0YA 3OJUA 3HWTA 3QE9Y 1SZPA 3RB6A 3RBEA 5KT5A 1ZQPA 2KN7A 1X9WA 5J0PA 3KTQA 7ICFA 3BQTA 4RUAA 3EPIA 3PW0A 4UB5A 1ZQNA 4RUCA 1WCLA 3OJSA 2HHVA 4BWMA 4Z6CA 1ZQEA 1BGXT 1ZQTA 2DPJA 5CB1A 3GFKB 2I1QA 3RBDA 1TK5A 3IHQB 1S0NA 4JWMA 2HHUA 4ECYA 3V6HA 2Q0ZX 2BCRA 5BPCA 3GV5B 4IRCA 2XCPA 3TQ1A 2HW3A 3RAXA 3M9MB 1X9MA 4YMNA 2BQUA 4DFKA 5DQIA 5KT6A 2J6TA 4O9MA 9ICKA 4YR0A 5DB8A 2BPGA 3OGUA 3H8SA 3G6XA 1SKWA 1RPLA 2M9NA 4KLOA 4F5QA 1ZQOA 4XUSA 5CWRA 4F4KA 3PW2A 8ICOA 2ZTEA 3C1ZA 3NGDA 4ED7A 4J9PA 1MC8A 5IIKA 4NXZA 1XSLA 5HMLA 4UAZA 8ICZA 2OWOA 3PMNA 4IQVA 1ZQRA 4YG2A 2KZMA 1KRPA 9ICIA 2KZZA 4LZDA 2PFPA 1NJZA 3PX0A 5HMMA 8ICLA 9ICMA 1TAUA 2KFNA 4KLFA 3GIJA 4PGYA 5L1LA 4MF2A 4YQWA 5KG7A 8ICQA 2IHMA 5DBCA 4NY8A 1XWLA 3JPTA 3RR8A 4B9NA 4UBCA 2FMPA 5KFCA 8ICTA 5IINA 1D9DA 2ASJA 9ICOA 5D4BA 4QWBA 1ZQSA 1SKSA 4ECSA 5BOLA 4MFAA 9ICUA 1XO1A 3EWAA 3UPQA 3QEBZ 4DSLA 5KT7A 4QWDA 4DWIA 4YR3A 2ZTCA 2F1HA 3Q8QB 2H5XA 2AJQA 4I2GA 4NLNA 4M9NA 2UVWA 5KT3A 4DF8A 5KFBA 4F5NA 4KN4A 2NRWA 3GV8B 4XRHA 1LV5A 4G3IA 1LB2B 1NKEA 5F9NA 4KLIA 3H8JA 4TURA 5CR0A 4DSIA 4DFMA 5DKWA 1KEJA 4LVSA 1NK4A 3GDXA 5J2EA 4EBEA 4KLSA 1ZQMA 3MR5A 1K1QA 4YD1A 1WCNA 2XGPA 2FLNA 4FBTA 2KFZA 1TAQA 3RJHA 4M6WA 4Q8FA 8ICKA 2V4RA 3PR5B 8ICWA 1CEZA 1ZQZA 5KFSA 2ZUCA 5F9LA 5L1IA 2C22A 2V9WA 3MGHA 4ECZA 4ED8A 4RPXA 3TFSA 3PO4A 5KG3A 4IQTA 4JV2A 4R66A 4Z6FA 3TANA 1JX4A 2ZJAA 4QZCA 1KFSA 1V9PA 4TUQA 1NKCA 9ICBA 3K4GA 2AGPA 3MR3A 1A76A 3EW9A 1ZQYA 3K75D 3HX0A 1RZTA 1ZQUA 1S0MA 4RNOA 9ICJA 1L3VA 2HHSA 3RJIA 1NJYA 2HVIA 4P4MA 2FPMA 4JV0A 3HP6A 9ICWA 3TAQA 4R8UA 4IQUA 5DQHA 3SV4A 3RH6A 4B9TA 5KG1A 2RDJA 5DG8A 1BPBA 3MGIA 4NM1A 1ZQXA 5KFNA 4J9LA 3UQ0A 5KFXA 4ECQA 3T5LA 3QZ7A 3PMLA 4EBCA 1JXLA 3PVXA 3C5FA 2AQ0A 4IRDA 3H7IA 4KITB 4GC7A 5KT4A 7ICVA 3PY8A 1KFDA 1ZQDA 3MDAA 1ZQQA 2IBKA 4RQ7A 2W8KA 4B9VA 3LWLA 4DOBA 1L5UA 4TQRA 4PHAA 3V7LA 3ISCA 2VA8A 3MFIA 4DL5A 2PI5A 4DQRA 1A77A 4O3OA 4YMOA 4I2CA 4O5EA 4QW9A 4I2AA 3T5HA 5J0WA 2BPFA 2BCUA 8ICSA 4DF4A 4ELTA 4QWCA 5DGBA 3JPPA 2W9BB 4F92B 2W9AA 1KTQA 4UB1A 3RH4A 1RYSA 3PO5A 7ICLA 1KFTA 1ZQLA 3B0YA 2R8KA 8ICCA 3H4DA 3C5GA 9ICNA 2IHNA 2JEGA 3G6YA 2BKEA 5CJ7A 3RB3A 1C7YA 5EOZA 3JPRA 1D8LA 1QSLA 2IA6A 4KTQA 2BR0A 1D9FA 4RT2A 1BPDA 1UA0A 4RQ5A 4P4OA 5KT2A 5KFFA 1Z00A 4F50A 4Q43A 4DSEA 3THVA 2LYHA 2KTQA 4E0DA 3Q8RB 4O5CA 2J6SA 3M9NB 4F2RA 8ICPA 1JXEA 2Y1IA 7ICTA 4O3SA 7ICSA 4F91B 2B21A 4IQWA 4RQ4A 1Z3EB 5KFJA 5DDYA 4BXOB 4DL7A 5KFVA 3C2LA 5J0RA 7ICHA 5J2FA 3BQ0A 5DG9A 1D8YA
chains in the Genus database with same CATH superfamily
3NTUA 3TKAA 1OUQA 5IILA 4KN7A 5ALMA 1PK3A 5J2HA 1TK8A 3A0HU 2BCVA 2H3VA 4J9OA 2J6UA 3AEVA 4K4IA 4C0ZA 4JV1A 4M9GA 5J0OA 1ZQIA 1J2NA 4QZBA 3SENA 1KLNA 4KLJA 4CGZA 4I2HA 7ICQA 2BQ3A 3FDSA 2YMQA 2R8GA 3MGVA 4MFCA 1QH9A 2LI6A 2WB1C 3T5KA 1O08A 4F4WA 5DBBA 4ELVA 1UT5A 3WKBA 2I5HA 3MR2A 4R65A 5B66U 2P66A 2G09A 2LHTA 3D2NA 4EX6A 2XY7A 5KFEA 2H3QA 2KVCA 4QWEA 5TISU 2W3SA 2OXOA 3C21A 2LBOA 2MUTB 3QU4A 2JEIA 2XI9A 4CRXA 1N60A 1SWVA 3WK7A 3Q8MA 4Y2PA 4KLLA 2C28A 4O3RA 2FE9A 3JPOA 4DOAA 7ICEA 3ZDAA 3RRGA 8ICGA 4GXJA 2AGQA 2FPKA 2MUTA 2AU0A 3ZD8A 1BPXA 2KIWA 3AUOA 5KFZA 5ALXA 1N5WA 1U4BA 4Z6DA 4F5OA 2PFOA 3J81j 4UB3A 1NK7A 1WG8A 2BQRA 2HBMA 4DSKA 1B4FA 3RJJA 3TACB 4I2EA 3BS5B 5AKIA 3O0FA 5EWGA 4J9NA 1QTMA 1TVAA 3GIKA 4M47A 3OHBA 4C8OA 2LM4A 8ICBA 2HVHA 2JEJA 4YFKA 2AQ4A 2DF4B 1SL2A 3UMCA 3EYZA 1F0MA 8ICYA 4HYKA 4C7ZA 4NV0A 4DQQA 4RT3A 3L5KA 2PXIA 1ZOLA 4IL6U 3T3FA 3GZFA 1L3TA 1H38A 3SYZA 1NK5A 4PPXA 2WAQF 4Y2RA 4FBUA 3LWMA 3RR7A 4B9SA 1N62A 4B9LA 2A3VA 1IM4A 5AK5A 2KHVA 5G5GA 4FZLA 5IIIA 5KFWA 3M6KA 3Q8SB 1FFUA 2H3IA 5ALDA 2QLTA 4KLDA 9ICSA 5EE9A 2KSOB 1ZRMA 3M7DA 3SAGA 1HEKA 2KKVA 1SV4A 4ED0A 4GFJA 2W9MA 5J2DA 5L1MA 2MU2A 5CHGA 3PV8A 2NV3A 3C2MA 3BS5A 2Y9TA 2ZG6A 1T3NA 2PFQA 1S0OA 3H0MB 2K4IA 1XO0A 2RLTA 2EANA 8ICIA 5GTIU 1V38A 5AKZA 3KFUF 5DG7A 2WTFA 1ZQ1C 4I2IA 2Q4TA 4QWAA 2YQEA 1NJWA 4KLEA 5D46A 2KZ3A 5E79U 3QXGA 1KN5A 4RQ0A 1GO3F 5DB7A 5AIAA 4WJ3B 3WK5A 3KOOA 3UM9A 4GXKA 5KL8B 5KFPA 2FLPA 4J9QA 5J2GA 4M9HA 3B0XA 2BPCA 8ICXA 2HHXA 4DQSA 9ICLA 2JZBB 3SI8A 1QQ5A 3QUQA 1Y88A 5L9XA 5AKGA 2E8OA 2WFAA 3LDAA 2KVSA 3WKEA 1L7OA 1KDHA 1BPEA 1ZQPA 3HWTA 3MC1A 1X9WA 3BQTA 3EPIA 3PW0A 4CNQA 2I1QA 1S0NA 2HHUA 3GV5B 2HW3A 3M9MB 1X9MA 4YR0A 5DB8A 3G6XA 4HAIA 2KK0A 3BQ7A 1ZQOA 5CWRA 3PW2A 3U26A 2B0CA 4NXZA 8ICZA 2OWOA 3PMNA 4YG2A 2KZMA 1PUZA 1NJZA 9ICMA 1ZD2P 5L1LA 8ICQA 2IHMA 1V85A 4B9NA 4UBCA 8ICTA 5AI0A 1D9DA 9ICOA 2I6XA 1ZQSA 4C80A 1LVHA 4QWDA 4JMUA 2LYAA 4YR3A 2ZIVA 2F1HA 2EDUA 2H5XA 2AJQA 4I2GA 2UVWA 4DF8A 5KFBA 1LV5A 4G3IA 1LB2B 2KJ5A 4KLSA 1RDFA 1ZQMA 1K1QA 3ZI4A 2KFZA 3PR5B 8ICWA 1CEZA 5L1IA 2HDOA 4RPXA 3TFSA 3PO4A 4Y2TA 4IQTA 3IRUA 1V9PA 9ICBA 3K4GA 2DGZA 1A76A 3EW9A 5ALWA 1ZQYA 5C0YA 9ICWA 3TAQA 3SV4A 4PJ0U 2R18A 2KNJA 1BPBA 3NVVA 4OJ6A 1CRXA 5KFXA 3T5LA 1JXLA 3PVXA 2ZIUB 3H7IA 7ICVA 3PY8A 1KFDA 3MDAA 2IBKA 2D3DA 1NZPA 4RQ7A 2KG5A 2G5HB 2FDRA 3SD7A 2PI5A 4DL5A 1Z4NA 1IV8A 4O3OA 5JTIA 3NASA 2FJ6A 2LYBA 3RH4A 1KFTA 5ALZA 1ZQLA 5G5HA 3B0YA 1Q3VA 2IHNA 1DK2A 5CJ7A 1IIPA 5JU5A 5EOZA 1D8LA 2JV3A 2IA6A 2BR0A 1D9FA 2K8CB 5J8YA 4OJ5A 1URJA 5AK4A 2RRDA 5ALPA 5KFFA 4F50A 4DSEA 2DUYA 5AM3A 3PSPA 5AM5A 3Q8RB 4F2RA 7ICTA 2NO5A 1T3QA 5DDYA 4JB3A 1DGJA 4ZOHC 2HHVA 1D8YA 3FAHA 5ALUA 3TARA 2OYYA 4M0AA 3AQEA 4IRKA 3AL0B 4RZRA 2JH7A 2HOFA 4Y2UA 2IMWP 2W9CA 2CRXA 4P0PA 4UAWA 3KKAC 3RJGA 2DFLA 1MQ3A 4DLEA 3QUCA 2V4QA 1COKA 3BQ2A 5KFQA 4UARA 1ZQJA 5IIJA 4NL9C 1KSPA 1XU4A 2G08A 4KMUA 1HUOA 4B9MA 8ICMA 2DL0A 2OH2A 1COOA 4DL4A 1S76D 4DSJA 2W7PA 2BHNA 4BWJA 7ICMA 1TFRA 3KKAA 2H3ZA 1L8LA 3BZCA 4Y2YA 3MDCA 2ASLA 5IIOA 5DLGA 3LK9A 4OCZA 1Z4OA 3TAPA 3EZ5A 1VLBA 2YB1A 3GV7B 3WK4A 1BVSA 3H4BA 4ECRA 1NJXA 2VA2A 2GOLA 4C8NA 5K4LA 4Q8EA 1SL1A 2NRVA 3NRWA 5AI8A 1U9LA 4ELUA 3IG8A 5KL1B 2CN1A 3T79A 3PSFA 2DQNB 2F2AB 1BPYA 2FMSA 4I2BA 4UB6U 2F1JA 3SZ2A 2JZBA 2PFNA 1U49A 3MABA 3V7JA 4I2DA 3WU2U 4BUGA 4EEYA 2WF9A 4OJOA 1S97A 3A0BU 3EPGA 5KG4A 3PX4A 1SV0A 3QZ8A 3C2KA 2W03A 4P0QA 3I76A 3WKCA 4P2HA 4US9A 1L7PA 2Y9UA 2A1JB 2NYVA 2KV2A 3RB4A 5CRXA 1X9SA 5HHIA 4PGQA 1N48A 2UVUA 1U48A 4J9RA 4I28A 3CW2C 4EEKA 4QZGA 4GLXA 3RTVA 4F71A 2BDUA 5J29A 3KHHA 1NK9A 4KLMA 2HCFA 1WUDA 3KHGA 1ZQBA 2A1JA 7ICGA 1YZ7A 4MFFA 3RJFA 2K8AA 1B22A 2WHEA 4DFJA 1T4GA 4UB4A 2DKXA 4Q44A 2I9GA 3SAFA 1RXWA 5AK3A 2KEYA 3TFRA 3T5JA 4F3OA 4DQPA 5ALSA 3AN1A 5KFIA 1X40A 3MBYA 1ZQHA 3IM1A 4DL2A 3ZDBA 1JALA 5AICA 3JPSA 3WK6A 4YMMA 8ICRA 1X2IA 1Z00B 8ICVA 2W55A 5KTQA 1TKDA 4MEYA 4YXMA 4KLUA 5KFOA 2E8PA 1A0PA 2XY5A 1X6IA 2YMMA 4P4PA 4FS2A 1JI7A 4U6PA 4PL2A 1LKYB 5AKKA 5AIBA 4CCHA 4QZ8A 4BXOA 3C1YA 3HKZF 2ZIWA 2EAPA 4AP9A 2XY6A 5ALQA 2ALZA 5BOMA 5C5JA 4M04A 3IDWA 2KD1A 4O5KA 4DO9A 2QARB 4RNNA 9ICAA 4KLTA 4M9JA 2WF6A 5KFDA 4PHEA 4C8LA 3C29A 1LKYA 1M6YA 3M8RA 2ES6A 2KMDA 5KFGA 5KG6A 1SZHA 5ALNA 5ALKA 4QZAA 2F8LA 5HNKA 2KKPA 1WWVA 4JWNA 1Z1VA 3JPNA 1SWWA 4U7CA 3V72A 3AU6A 4DLGA 2HBLA 1U47A 3GQCA 3PR4A 1S77D 3F5EA 1QLNA 4QW8A 4EYHB 3NVYA 4NLGA 4Q45A 2H3FA 2F3NA 2ZJ8A 1T8EA 3QUTA 4M2YA 1L7MA 3PSIA 2G07A 3QYPA 1ZJNA 4J9SA 4M9LA 2VA3A 4FFDA 3RFAA 2DKZA 2ZJ5A 2XICA 8ICUA 4R63A 1SB3C 1ZQFA 2KSOA 4ED1A 3QE9Y 3OJUA 3RB6A 1Q3UA 1SZPA 2E3TA 5KT5A 2GLEA 1FFVA 4UB5A 4EELA 4RUCA 4FZNA 1RQLA 3I1YA 4ACOA 5CB1A 3RBDA 1QCKA 4ECYA 2Q0ZX 3E58A 5BPCA 2XCPA 2ZXHA 4A8EA 2BQUA 2J6TA 9ICKA 3FC4A 2QARA 2E8NA 3OGUA 2LPEA 3HJEA 1SKWA 2JGAA 4AYBC 1KW4A 1ZD3A 4XUSA 1WYGA 2ZIUA 2AXTU 1SGGA 4UAZA 1ZQRA 5A0LA 4CDGA 4LZDA 3KZIU 4KLFA 5KG7A 3M1YA 5DBCA 4NY8A 1XWLA 3M6ZA 5KFCA 1OXJA 3HRDD 1TE2A 5ALOA 1SKSA 4MFAA 1UCVA 3QEBZ 3F53A 2ZTCA 4M9NA 4F5NA 2NRWA 3KZXA 5ALGA 4KLIA 2JXJA 4DFMA 5DKWA 3MR5A 4YD1A 1FEZA 2FLNA 3SEIA 3SMVA 4M6WA 1ZQZA 5F9LA 2C22A 4ED8A 4ECZA 1QQ7A 4R66A 1KFSA 3TADA 5ALTA 3K75D 1RZTA 1ZQUA 9ICJA 2HHSA 1NJYA 1FIQA 2HVIA 4JV0A 5KG1A 2RDJA 3N7PD 3MGIA 2FI1A 4DFDA 1ZQXA 1J97A 1C20A 3QZ7A 1V97A 4GC7A 1ZQDA 4NLCA 2W8KA 4B9VA 4DOBA 4TQRA 3SR6A 3ONNA 2G0AA 4I2CA 4I2AA 1N61A 4QWCA 4F92B 2W9AA 1KTQA 5F3XB 4UB1A 7ICLA 1NZBA 2R8KA 8ICCA 2YTUA 2JEGA 3RB3A 1QQ6A 1HIWA 4RT2A 1BPDA 1UA0A 1Z00A 4QJFB 1T94A 4E0DA 4IS7A 2W3RA 8ICPA 5AI6A 2MA1A 2YMPA 1JXEA 4O3SA 7ICSA 4F91B 5GTHU 5KFJA 4BXOB 5B5EU 5KFVA 4UB8U 4DOCA 1ZD4A 2HHWA 4US8A 4EZ6A 5J2CA 4YVZA 4YCXA 1RYUA 2W43A 2EAMA 1PVQA 4PGXA 3F2BA 4I2FA 1DRGA 2UVVA 3ZDEA 4EYIB 1NKBA 3BDPA 1B0XA 1ZQKA 4RQNA 3NUQA 5KG0A 4XQ8A 3JPQA 3DEEA 9ICTA 3UXPA 1UQVA 4ECXA 4EBDA 2MRLA 4KLQA 1JIHA 2AGOA 2FLLA 5AI5A 2XGQA 2XC9A 2R8HA 2RDIA 2P35A 5KFHA 1RXVA 5ALHA 3NRZA 4QZDA 4F5PA 2XO7A 1DOQA 4F8RA 1NK8A 3C23A 4QZEA 2HBKA 4KX5A 2DPIA 1S0VA 3AU2A 5H2FU 3IV6A 3N97B 1ZETA 5CA7A 2BCQA 2GWSA 5AM4A 4RQ2A 4DCCA 4YN4A 2VIXA 2C2RA 2BDPA 1EXNA 5JRTA 1HJPA 1IXRA 1DGSA 3KD3A 7ICOA 2Y1JA 3PX6A 4DL3A 4YXJA 3GU3A 9ICEA 4IR9A 5L1JA 2VKQA 5J0XA 9ICQA 2RP5A 2E1FA 5KFUA 2N1RA 4P0PB 4PHPA 4O3QA 4NLKA 4DFPA 2RQ5A 5AKHA 2MAXA 3GIMA 2O6KA 2K4PA 2CPRA 3OSPA 3UQ2A 4QZFA 4MEXA 1N5XA 4UAYA 2BCSA 5ALFA 3M9OB 5KFLA 4J9KA 9ICCA 1PZNA 5AKJA 2F1IA 2OHFA 2YX8A 2W9CB 4BGDA 3F5AA 5L1KA 4QIWF 1SIJA 5J2AA 5KFYA 5AHXA 4TQSA 1ZQVA 9ICPA 8ICJA 4DSFA 3BZKA 4ED2A 4ECTA 1YZ6A 2E5SA 2HHQA 2PMZF 4R64A 2K4EA 7ICUA 4Y2VA 3OSNA 2YMLA 5D49A 4LJXA 4DL6A 2EAOA 2DBYA 2JMGA 2K89A 4AYBF 1L6NA 1NK6A 2LKYA 7ICNA 3D2SA 2W8LA 4KLHA 3AQFA 3QU2A 4DEZA 4X5VA 4QIWC 3ZDDA 5DB9A 4CE6A 1NI3A 2ZTDA 3MR6A 4UATA 3ZDCA 3H40A 3FYHA 4NLBA 4J03A 3QEAZ 1SL0A 3RJKA 3QNMA 4J9MA 1Z19A 3RRHA 2ISPA 5AKXA 4RPZA 3OHAA 3QUBA 3ISBA 5ALIA 5TZVA 2KICA 2VANA 5KFAA 1ZYQA 4F93B 2QB0B 4MF8A 5DQGA 3E0FA 3UMBA 8ICHA 9ICFA 3ISDA 4C4RA 3QX7A 4R8UB 1SXEA 1VJ5A 4O0IA 5ALEA 3PNCA 5KAIU 4UQGA 1F5SA 1ZQGA 2KE7A 3V6KA 2P6UA 1CI4A 5J8YC 3RAQA 4IR1A 3MFHA 1TK0A 2ZIVB 4F4XA 3UXNA 3RJEA 2HSZA 1XSNA 7ICKA 1L8OA 2F8KA 4C8MA 4Z6EA 4RNMA 2WB1F 2ESEA 5ALRA 4DS4A 4BJQA 3PW5A 1XC9A 3V6JA 2ISOA 3BJYA 3GIIA 3HKZC 7ICIA 2UVRA 3D2QA 3N4MB 4IC9A 2ASDA 4ECUA 3QU7A 2JEFA 4RQ6A 2NO4A 7ICRA 1UA1A 1MSWD 4ED6A 2PI4A 1ZJMA 2OM6A 1L3SA 3PW7A 1Z1BA 2WF8A 5CP2A 4O3PA 2QB0A 4QZ9A 5J0YA 5J0PA 2ODGA 3S6JA 3BS7A 1WCLA 5T14A 3OJSA 4BWMA 4Z6CA 5AK6A 1BGXT 1S5LU 4UAUA 1OW5A 2B6GA 1ZQTA 3GFKB 4PL1A 4JWMA 3IHQB 4PZOA 2BCRA 3TQ1A 4YMNA 5KAFU 3SQIA 4DFKA 1YT3A 5DQIA 2BPGA 1RPLA 2M9NA 4KLOA 4ICAA 8ICOA 2ZTEA 3C1ZA 3NGDA 3VC8A 4J9PA 4C4TA 5HMLA 4IQVA 5EE1A 1KRPA 9ICIA 3PX0A 8ICLA 4MHVA 2KP7A 1TAUA 2KFNA 3GIJA 3K1RB 3RR8A 1UPHA 5IINA 2AH5A 3RF9A 3F2DA 2ASJA 1PVRA 5AKEA 5D4BA 5BOLA 3UPQA 4DSLA 4DWIA 2D8CA 3Q8QB 4NLNA 4RQMA 5ALJA 3GV8B 4XRHA 2A19A 1NKEA 4NL9A 4TURA 3K1ZA 4O3MA 4DSIA 1KEJA 1NK4A 3GDXA 4EBEA 1WCNA 2K8BB 1WWUA 2IOFA 3RJHA 4Q8FA 2LMRA 5AM1A 2KIVA 1KL9A 5KFSA 2ZUCA 2V9WA 4JV2A 1JX4A 4QZCA 4GIBA 2JHDA 4TUQA 1NKCA 2L5YA 2AGPA 1VDVA 3HX0A 4NJ8A 4P4MA 3OTQA 3RH6A 5DQHA 2BZFA 3WK9A 4OJLA 5KFNA 3UQ0A 4ECQA 4IRDA 2AQ0A 2G06A 5AKYA 2KHQA 3ISCA 3B9JA 1A77A 5ALVA 1MN8A 4YMOA 4O5EA 4QW9A 4ELTA 5DGBA 2W9BB 3C5GA 2GO7A 9ICNA 4UAVA 3QU5A 2BKEA 3G6YA 1C7YA 3JPRA 4KTQA 3LVVA 2IOFK 4RQ5A 5KT2A 3THVA 2LYHA 2KTQA 4O5CA 1O03A 2J6SA 2OCEA 3CRXA 2PMZC 4IQWA 1Z3EB 2EZXA 3L4PA 2EZZA 4DL7A 3ALRA 5J0RA 5J2FA 1J2MA 5DG9A 1ECWA 5J2BA 1ZQCA 4YR2A 5AM2A 3Q8PB 2EQYA 4DQIA 2E8MA 3ICXA 5DDMA 1RM6C 3UMGA 4G9BA 2Z7JA 5DB6A 4UBBA 5DLFA 2JR5A 3UXOA 3G6VA 5AKLA 5KG2A 4F5RA 1QSYA 1RQNA 5IIMA 4JUZA 4ECWA 2C2EA 1N63A 2NRTA 2VJ4A 4PHDA 5EWEA 2ZIWB 1ZQWA 4UW9A 1ED1A 3M8SA 2IOHA 4F4YA 3ORYA 3ED5A 1JN3A 2XCAA 4TUSA 1X6JA 2QB1A 3Q8KA 2W9BA 2R8IA 4JK1A 4F2SA 1BNOA 2F44A 3ZD9A 3TI0A 3E2EA 4FS1A 5JUMA 1N56A 3WKDA 4YD2A 4DS5A 1JMSA 9ICRA 2ZIXA 2M0NA 7ICPA 1L7NA 1Q46A 4KLGA 1QSSA 4EENA 4EZ9A 1SKRA 4I2JA 4Y2SA 4QZIA 3ETRA 2JRZA 9ICXA 5KG5A 2R8JA 1MQ2A 4CF4A 1AROP 2K60A 2KJ9A 4B6JA 4ZH4A 4QZHA 9ICHA 2HOQA 2LM1A 1A6SA 1TV9A 3KBBA 4PH5A 2WAQC 2ZUBA 3NVWA 4QNLA 1PVPA 3ETLA 2KJ8A 5HP4A 3LVWA 3KHRA 1NK0A 2E1EA 2K4HA 3PW4A 1KKXA 2XIDA 3H8MA 3IG5A 4FZMA 2EZYA 1IG6A 4I29A 4KMOB 2A1AA 4K4HA 4O3NA 4F4ZA 1RG6A 5HHHA 3HW8A 4K4GA 2ZUDA 1P7DA 4B9UA 3HT3A 4TUPA 3I28A 4GC6A 4C8KA 5J0UA 2MSNA 3VCBA 3CNHA 4Y2XA 4KX3A 3TADC 3PZPA 4I27A 8ICNA 1PK1B 8ICAA 9ICGA 4BDPA 1Q8KA 1JUDA 1XS9D 3HPOA 4C7YA 4ED3A 5DGAA 4NM2A 4FO6A 1K1SA 1BNPA 1UT8A 4ECVA 2PKEA 2JH1A 2P6RA 2BGWA 2DWQA 7ICJA 3AM9A 3EUB2 2Y0SC 1CUKA 4CF5A 4NWIA 5KFTA 1S10A 2W11A 4GXIA 5EE3A 5DBAA 2NRZA 4UASA 5J2KA 2XVTA 4EX7A 2HMXA 1NOMA 1ZQAA 2NRXA 5J2IA 3HILA 3N28A 5KFKA 2HHTA 4BX9C 5J2JA 4UB2A 1RYRA 3SV3A 3CP8A 5J0SA 1HUZA 4OD0A 2QKQA 1BPZA 2HBJA 2VJ5A 5J0TA 2F76X 4YP3A 2W7OA 4M6WB 1T7PA 8ICEA 4RQ1A 3BQ1A 5HR6A 1XSPA 2KOBA 3CYMA 1JRPA 2F77X 2ZXIA 2W04A 3H8WA 4Y2QA 4RQ8A 2RHFA 4C4SA 3IP4B 3GILA 1KQQA 3V7KA 1UHUA 3DDHA 4USAA 4RQ3A 4LZGA 3FM9A 3H0RB 1SV0C 5KFMA 3C28A 4PZNA 3RB0A 5EWFA 3Q8LA 2YB4A 3NS1A 1U45A 2FPLA 1DXSA 3KHLA 3L3FX 2W54A 5J0QA 3IN5A 8ICFA 1B43A 3DV9A 3RH5A 1L3UA 3SAHA 1X9XA 2HOIA 2C2DA 1S8OA 2FMQA 5AI4A 4NLZA 4XA5A 2ATLA 1S9FA 4RU9A 4P0QB 5KFRA 3WK8A 4RPYA 9ICVA 3KTQA 4OJPA 3RBEA 2KN7A 2WF7A 7ICFA 2D6FC 4RUAA 1ZQNA 1D8BA 5FP0A 2DPJA 1ZQEA 1JROA 1ZRNA 1TK5A 3V6HA 5ALYA 4IRCA 1ZD5A 4F72A 3RAXA 3AMZA 5KT6A 4O9MA 4Y2JA 3H8SA 1X42A 4F5QA 2ZIXB 4F4KA 3PSTA 3D6JA 4ED7A 3LYSA 1MC8A 5IIKA 1XSLA 1TAMA 1NNLA 2KZZA 2GH1A 2PFPA 5HMMA 4PGYA 4MF2A 3N7SC 4YQWA 1FO4A 3JPTA 2FMPA 1MA7A 1N2XA 4QWBA 5KNIA 4ECSA 9ICUA 4OO1J 1XO1A 3EWAA 1SXDA 1AQ6A 5KT7A 2AHOB 5KT3A 2YN4A 4KN4A 3QU9A 4CF3A 5AM0A 5ALLA 5F9NA 3H8JA 5CR0A 4LVSA 5J2EA 2HI0A 2XGPA 4FBTA 5CEHA 1TAQA 8ICKA 2V4RA 2G5IB 3MGHA 2WF5A 5KG3A 3R9KA 4Z6FA 3F2CA 3TANA 2ZJAA 3MR3A 1S0MA 4RNOA 1L3VA 1ZXIA 3RJIA 3NVZA 2FPMA 3HP6A 1PK1A 4R8UA 4IQUA 5EE0A 4B9TA 5DG8A 4NM1A 1KBUA 2OEHA 4J9LA 2YY6A 3PMLA 5AI9A 4EBCA 3C5FA 1K5OA 4KITB 5KT4A 1ZQQA 3OPXA 3LWLA 1L5UA 4PHAA 3V7LA 2VA8A 3MFIA 4DQRA 2CXYA 1F44A 5HR7A 3T5HA 5J0WA 2BPFA 2BCUA 8ICSA 4DF4A 3JPPA 3H0LB 1RYSA 3PO5A 1X66A 1XNSA 3H4DA 2Y0SF 2EH9A 4FE3A 1QSLA 4P4OA 3WKAA 4Q43A 3M9NB 2Y1IA 2B21A 4RQ4A 3N7RC 3C2LA 7ICHA 3BQ0A 1DK3A
chains in the Genus database with same CATH topology
5J2BA 4DOCA 3TARA 2HHWA 3NTUA 1ZQCA 4YR2A 4M0AA 4IRKA 3Q8PB 4EZ6A 4DQIA 5J2CA 4YVZA 4YCXA 5DDMA 5DB6A 4RZRA 5DLFA 4UBBA 5IILA 4KN7A 3UXOA 2IMWP 2W9CA 3G6VA 5KG2A 4F5RA 1QSYA 5IIMA 5J2HA 1KDHA 4JUZA 4ECWA 1TK8A 4UAWA 2C2EA 4PGXA 3RJGA 4I2FA 2DFLA 1MQ3A 4DLEA 2UVVA 3ZDEA 4EYIB 2V4QA 1NKBA 2NRTA 4PHDA 3BDPA 3BQ2A 5KFQA 5EWEA 5IIJA 1ZQJA 4J9OA 2BCVA 2J6UA 1KSPA 1ZQKA 1ZQWA 1XU4A 4KMUA 4B9MA 1HUOA 8ICMA 1COOA 5KG0A 4XQ8A 3JPQA 4DL4A 1S76D 4DSJA 4K4IA 4JV1A 9ICTA 3UXPA 2BHNA 4BWJA 4M9GA 7ICMA 5J0OA 3M8SA 1TFRA 1ZQIA 4ECXA 4QZBA 3MDCA 2ASLA 4EBDA 5IIOA 4F4YA 3ORYA 5DLGA 3LK9A 4KLQA 3TAPA 1JN3A 1KLNA 2XCAA 4KLJA 3EZ5A 1JIHA 4TUSA 2AGOA 3Q8KA 2W9BA 2FLLA 3GV7B 4I2HA 2R8IA 2XGQA 1BVSA 4JK1A 2XC9A 3H4BA 2BQ3A 4F2SA 7ICQA 2R8HA 2RDIA 3FDSA 5KFHA 1RXVA 4QZDA 4ECRA 1NJXA 2R8GA 3ZD9A 4MFCA 2VA2A 4C8NA 3TI0A 3E2EA 4F5PA 4FS1A 2XO7A 5JUMA 4Q8EA 3T5KA 1N56A 1DOQA 4F4WA 5DBBA 4ELVA 1SL1A 1UT5A 2NRVA 4YD2A 1NK8A 3C23A 1JMSA 4QZEA 4DS5A 4F8RA 9ICRA 7ICPA 3MR2A 4R65A 1U9LA 2P66A 4ELUA 2DPIA 4KLGA 1S0VA 2XY7A 5KFEA 1QSSA 3AU2A 1ZETA 3N97B 4QWEA 4EZ9A 1SKRA 5CA7A 2BCQA 1BPYA 2FMSA 4I2JA 4I2BA 2GWSA 2F1JA 4QZIA 4RQ2A 3SZ2A 2JZBA 2PFNA 9ICXA 5KG5A 1U49A 3C21A 2R8JA 2MUTB 4YN4A 1MQ2A 3MABA 3V7JA 2C2RA 1AROP 2BDPA 1EXNA 4I2DA 2JEIA 4EEYA 1HJPA 4ZH4A 4QZHA 9ICHA 1IXRA 1S97A 1DGSA 7ICOA 2Y1JA 3PX6A 3EPGA 4DL3A 5KG4A 4YXJA 3Q8MA 4KLLA 2C28A 9ICEA 1TV9A 4IR9A 4PH5A 3PX4A 5L1JA 4O3RA 3JPOA 5J0XA 4DOAA 7ICEA 3ZDAA 3QZ8A 3RRGA 8ICGA 9ICQA 2ZUBA 5KFUA 3C2KA 4PHPA 4O3QA 4NLKA 4DFPA 4P2HA 4GXJA 3ETLA 5HP4A 2MAXA 3KHRA 1NK0A 2A1JB 2AGQA 2FPKA 3GIMA 3PW4A 3RB4A 3OSPA 1X9SA 7ICRA 2MUTA 2AU0A 4I29A 5HHIA 3ZD8A 4PGQA 3UQ2A 1N48A 4QZFA 4K4HA 4O3NA 4F4ZA 4MEXA 5HHHA 3HW8A 1BPXA 2UVUA 1U48A 3AUOA 4K4GA 2ZUDA 4J9RA 5KFZA 4UAYA 4I28A 2BCSA 3M9OB 1U4BA 4B9UA 5KFLA 4Z6DA 4QZGA 3HT3A 4GLXA 3RTVA 4F5OA 4TUPA 5J29A 4J9KA 4GC6A 5J0UA 3KHHA 1NK9A 2PFOA 4C8KA 4KLMA 9ICCA 1PZNA 4UB3A 1NK7A 4DSKA 2BQRA 2F1IA 3KHGA 2W9CB 3RJJA 4BGDA 4I2EA 4I27A 1ZQBA 5L1KA 8ICNA 2A1JA 5EWGA 7ICGA 5J2AA 5KFYA 4J9NA 1QTMA 4MFFA 3RJFA 4TQSA 1ZQVA 8ICAA 9ICPA 1TVAA 8ICJA 9ICGA 1B22A 4BDPA 4DFJA 1T4GA 4DSFA 4ED2A 4UB4A 4Q44A 4ECTA 3GIKA 4M47A 3OHBA 4C8OA 2I9GA 8ICBA 2HVHA 2HHQA 4R64A 4YFKA 1XS9D 2JEJA 1RXWA 3HPOA 2AQ4A 1SL2A 4ED3A 7ICUA 5DGAA 3EYZA 4NM2A 3OSNA 5D49A 1K1SA 4FO6A 8ICYA 1UT8A 4ECVA 3TFRA 4HYKA 3T5JA 4F3OA 2P6RA 4DL6A 4DQPA 2BGWA 4DQQA 4RT3A 7ICJA 1NK6A 2PXIA 5KFIA 7ICNA 1L3TA 2W8LA 3T3FA 3MBYA 1ZQHA 4KLHA 1H38A 3SYZA 4DEZA 1CUKA 4X5VA 1NK5A 3IM1A 4PPXA 4DL2A 3ZDDA 5KFTA 4FBUA 5DB9A 3LWMA 1S10A 3RR7A 2ZTDA 3MR6A 4GXIA 3ZDBA 4B9SA 3JPSA 5DBAA 2NRZA 4YMMA 5J2KA 4B9LA 8ICRA 1IM4A 1X2IA 3H40A 3ZDCA 3FYHA 1Z00B 8ICVA 1NOMA 3QEAZ 5KTQA 1ZQAA 2NRXA 5J2IA 1SL0A 1TKDA 5KFKA 5IIIA 3RJKA 2HHTA 5J2JA 4MEYA 4YXMA 5KFWA 4UB2A 4J9MA 1RYRA 4KLUA 3RRHA 5KFOA 2ISPA 3SV3A 3Q8SB 2XY5A 4RPZA 4P4PA 5J0SA 4FS2A 3OHAA 1HUZA 1BPZA 4KLDA 3ISBA 9ICSA 4CCHA 4QZ8A 4BXOA 5J0TA 3C1YA 4YP3A 5TZVA 2VANA 4M6WB 4ED0A 5KFAA 1ZYQA 4F93B 2XY6A 1T7PA 2W9MA 2ALZA 8ICEA 5J2DA 4RQ1A 4MF8A 5BOMA 3BQ1A 5C5JA 5CHGA 3PV8A 1XSPA 4M04A 3C2MA 5DQGA 4O5KA 4DO9A 8ICHA 9ICFA 1T3NA 4RNNA 3ISDA 2PFQA 9ICAA 1S0OA 3H8WA 4R8UB 4KLTA 4O0IA 4M9JA 5KFDA 4PHEA 4RQ8A 3PNCA 4C8LA 4UQGA 8ICIA 1ZQGA 3V6KA 3M8RA 2P6UA 3RAQA 4IR1A 5DG7A 2WTFA 3MFHA 3GILA 1TK0A 4I2IA 4F4XA 3V7KA 3UXNA 5KFGA 5KG6A 3RJEA 4QWAA 1XSNA 4RQ3A 4LZGA 4QZAA 1NJWA 7ICKA 5KFMA 5HNKA 4JWNA 4C8MA 3RB0A 3JPNA 4Z6EA 5EWFA 3Q8LA 4KLEA 4RNMA 1U45A 3V72A 2FPLA 5D46A 3AU6A 2KZ3A 4DLGA 1U47A 3KHLA 4RQ0A 3GQCA 5DB7A 5J0QA 3PR4A 1S77D 8ICFA 1B43A 3RH5A 1QLNA 1L3UA 4DS4A 4GXKA 5KFPA 2FLPA 2C2DA 4QW8A 4EYHB 3PW5A 4J9QA 1XC9A 3V6JA 2ISOA 3BJYA 5J2GA 4M9HA 3GIIA 4NLGA 3B0XA 2FMQA 4Q45A 2BPCA 7ICIA 8ICXA 2UVRA 3N4MB 2HHXA 2ZJ8A 4DQSA 4NLZA 9ICLA 2JZBB 4XA5A 3SI8A 1T8EA 2ASDA 4ECUA 2ATLA 4M2YA 2JEFA 4RQ6A 1Y88A 1S9FA 4RU9A 4J9SA 1ZJNA 5L9XA 1UA1A 2VA3A 4ED6A 4M9LA 5KFRA 2PI4A 1MSWD 4RPYA 2ZJ5A 3LDAA 9ICVA 1ZJMA 8ICUA 4R63A 1ZQFA 1L3SA 4ED1A 3PW7A 5CP2A 4O3PA 4QZ9A 1BPEA 5J0YA 3OJUA 3HWTA 3QE9Y 1SZPA 3RB6A 3RBEA 5KT5A 1ZQPA 2KN7A 1X9WA 5J0PA 3KTQA 7ICFA 3BQTA 4RUAA 3EPIA 3PW0A 4UB5A 1ZQNA 4RUCA 1WCLA 3OJSA 2HHVA 4BWMA 4Z6CA 1ZQEA 1BGXT 1ZQTA 2DPJA 5CB1A 3GFKB 2I1QA 3RBDA 1TK5A 3IHQB 1S0NA 4JWMA 2HHUA 4ECYA 3V6HA 2Q0ZX 2BCRA 5BPCA 3GV5B 4IRCA 2XCPA 3TQ1A 2HW3A 3RAXA 3M9MB 1X9MA 4YMNA 2BQUA 4DFKA 5DQIA 5KT6A 2J6TA 4O9MA 9ICKA 4YR0A 5DB8A 2BPGA 3OGUA 3H8SA 3G6XA 1SKWA 1RPLA 2M9NA 4KLOA 4F5QA 1ZQOA 4XUSA 5CWRA 4F4KA 3PW2A 8ICOA 2ZTEA 3C1ZA 3NGDA 4ED7A 4J9PA 1MC8A 5IIKA 4NXZA 1XSLA 5HMLA 4UAZA 8ICZA 2OWOA 3PMNA 4IQVA 1ZQRA 4YG2A 2KZMA 1KRPA 9ICIA 2KZZA 4LZDA 2PFPA 1NJZA 3PX0A 5HMMA 8ICLA 9ICMA 1TAUA 2KFNA 4KLFA 3GIJA 4PGYA 5L1LA 4MF2A 4YQWA 5KG7A 8ICQA 2IHMA 5DBCA 4NY8A 1XWLA 3JPTA 3RR8A 4B9NA 4UBCA 2FMPA 5KFCA 8ICTA 5IINA 1D9DA 2ASJA 9ICOA 5D4BA 4QWBA 1ZQSA 1SKSA 4ECSA 5BOLA 4MFAA 9ICUA 1XO1A 3EWAA 3UPQA 3QEBZ 4DSLA 5KT7A 4QWDA 4DWIA 4YR3A 2ZTCA 2F1HA 3Q8QB 2H5XA 2AJQA 4I2GA 4NLNA 4M9NA 2UVWA 5KT3A 4DF8A 5KFBA 4F5NA 4KN4A 2NRWA 3GV8B 4XRHA 1LV5A 4G3IA 1LB2B 1NKEA 5F9NA 4KLIA 3H8JA 4TURA 5CR0A 4DSIA 4DFMA 5DKWA 1KEJA 4LVSA 1NK4A 3GDXA 5J2EA 4EBEA 4KLSA 1ZQMA 3MR5A 1K1QA 4YD1A 1WCNA 2XGPA 2FLNA 4FBTA 2KFZA 1TAQA 3RJHA 4M6WA 4Q8FA 8ICKA 2V4RA 3PR5B 8ICWA 1CEZA 1ZQZA 5KFSA 2ZUCA 5F9LA 5L1IA 2C22A 2V9WA 3MGHA 4ECZA 4ED8A 4RPXA 3TFSA 3PO4A 5KG3A 4IQTA 4JV2A 4R66A 4Z6FA 3TANA 1JX4A 2ZJAA 4QZCA 1KFSA 1V9PA 4TUQA 1NKCA 9ICBA 3K4GA 2AGPA 3MR3A 1A76A 3EW9A 1ZQYA 3K75D 3HX0A 1RZTA 1ZQUA 1S0MA 4RNOA 9ICJA 1L3VA 2HHSA 3RJIA 1NJYA 2HVIA 4P4MA 2FPMA 4JV0A 3HP6A 9ICWA 3TAQA 4R8UA 4IQUA 5DQHA 3SV4A 3RH6A 4B9TA 5KG1A 2RDJA 5DG8A 1BPBA 3MGIA 4NM1A 1ZQXA 5KFNA 4J9LA 3UQ0A 5KFXA 4ECQA 3T5LA 3QZ7A 3PMLA 4EBCA 1JXLA 3PVXA 3C5FA 2AQ0A 4IRDA 3H7IA 4KITB 4GC7A 5KT4A 7ICVA 3PY8A 1KFDA 1ZQDA 3MDAA 1ZQQA 2IBKA 4RQ7A 2W8KA 4B9VA 3LWLA 4DOBA 1L5UA 4TQRA 4PHAA 3V7LA 3ISCA 2VA8A 3MFIA 4DL5A 2PI5A 4DQRA 1A77A 4O3OA 4YMOA 4I2CA 4O5EA 4QW9A 4I2AA 3T5HA 5J0WA 2BPFA 2BCUA 8ICSA 4DF4A 4ELTA 4QWCA 5DGBA 3JPPA 2W9BB 4F92B 2W9AA 1KTQA 4UB1A 3RH4A 1RYSA 3PO5A 7ICLA 1KFTA 1ZQLA 3B0YA 2R8KA 8ICCA 3H4DA 3C5GA 9ICNA 2IHNA 2JEGA 3G6YA 2BKEA 5CJ7A 3RB3A 1C7YA 5EOZA 3JPRA 1D8LA 1QSLA 2IA6A 4KTQA 2BR0A 1D9FA 4RT2A 1BPDA 1UA0A 4RQ5A 4P4OA 5KT2A 5KFFA 1Z00A 4F50A 4Q43A 4DSEA 3THVA 2LYHA 2KTQA 4E0DA 3Q8RB 4O5CA 2J6SA 3M9NB 4F2RA 8ICPA 1JXEA 2Y1IA 7ICTA 4O3SA 7ICSA 4F91B 2B21A 4IQWA 4RQ4A 1Z3EB 5KFJA 5DDYA 4BXOB 4DL7A 5KFVA 3C2LA 5J0RA 7ICHA 5J2FA 3BQ0A 5DG9A 1D8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2B A;  4DOC A;  3TAR A;  2HHW A;  3NTU A;  1ZQC A;  4YR2 A;  4M0A A;  4IRK A;  3Q8P B;  4EZ6 A;  4DQI A;  5J2C A;  4YVZ A;  4YCX A;  5DDM A;  5DB6 A;  4RZR A;  5DLF A;  4UBB A;  5IIL A;  4KN7 A;  3UXO A;  2IMW P;  2W9C A;  3G6V A;  5KG2 A;  4F5R A;  1QSY A;  5IIM A;  5J2H A;  1KDH A;  4JUZ A;  4ECW A;  1TK8 A;  4UAW A;  2C2E A;  4PGX A;  3RJG A;  4I2F A;  2DFL A;  1MQ3 A;  4DLE A;  2UVV A;  3ZDE A;  4EYI B;  2V4Q A;  1NKB A;  2NRT A;  4PHD A;  3BDP A;  3BQ2 A;  5KFQ A;  5EWE A;  5IIJ A;  1ZQJ A;  4J9O A;  2BCV A;  2J6U A;  1KSP A;  1ZQK A;  1ZQW A;  1XU4 A;  4KMU A;  4B9M A;  1HUO A;  8ICM A;  1COO A;  5KG0 A;  4XQ8 A;  3JPQ A;  4DL4 A;  1S76 D;  4DSJ A;  4K4I A;  4JV1 A;  9ICT A;  3UXP A;  2BHN A;  4BWJ A;  4M9G A;  7ICM A;  5J0O A;  3M8S A;  1TFR A;  1ZQI A;  4ECX A;  4QZB A;  3MDC A;  2ASL A;  4EBD A;  5IIO A;  4F4Y A;  3ORY A;  5DLG A;  3LK9 A;  4KLQ A;  3TAP A;  1JN3 A;  1KLN A;  2XCA A;  4KLJ A;  3EZ5 A;  1JIH A;  4TUS A;  2AGO A;  3Q8K A;  2W9B A;  2FLL A;  3GV7 B;  4I2H A;  2R8I A;  2XGQ A;  1BVS A;  4JK1 A;  2XC9 A;  3H4B A;  2BQ3 A;  4F2S A;  7ICQ A;  2R8H A;  2RDI A;  3FDS A;  5KFH A;  1RXV A;  4QZD A;  4ECR A;  1NJX A;  2R8G A;  3ZD9 A;  4MFC A;  2VA2 A;  4C8N A;  3TI0 A;  3E2E A;  4F5P A;  4FS1 A;  2XO7 A;  5JUM A;  4Q8E A;  3T5K A;  1N56 A;  1DOQ A;  4F4W A;  5DBB A;  4ELV A;  1SL1 A;  1UT5 A;  2NRV A;  4YD2 A;  1NK8 A;  3C23 A;  1JMS A;  4QZE A;  4DS5 A;  4F8R A;  9ICR A;  7ICP A;  3MR2 A;  4R65 A;  1U9L A;  2P66 A;  4ELU A;  2DPI A;  4KLG A;  1S0V A;  2XY7 A;  5KFE A;  1QSS A;  3AU2 A;  1ZET A;  3N97 B;  4QWE A;  4EZ9 A;  1SKR A;  5CA7 A;  2BCQ A;  1BPY A;  2FMS A;  4I2J A;  4I2B A;  2GWS A;  2F1J A;  4QZI A;  4RQ2 A;  3SZ2 A;  2JZB A;  2PFN A;  9ICX A;  5KG5 A;  1U49 A;  3C21 A;  2R8J A;  2MUT B;  4YN4 A;  1MQ2 A;  3MAB A;  3V7J A;  2C2R A;  1ARO P;  2BDP A;  1EXN A;  4I2D A;  2JEI A;  4EEY A;  1HJP A;  4ZH4 A;  4QZH A;  9ICH A;  1IXR A;  1S97 A;  1DGS A;  7ICO A;  2Y1J A;  3PX6 A;  3EPG A;  4DL3 A;  5KG4 A;  4YXJ A;  3Q8M A;  4KLL A;  2C28 A;  9ICE A;  1TV9 A;  4IR9 A;  4PH5 A;  3PX4 A;  5L1J A;  4O3R A;  3JPO A;  5J0X A;  4DOA A;  7ICE A;  3ZDA A;  3QZ8 A;  3RRG A;  8ICG A;  9ICQ A;  2ZUB A;  5KFU A;  3C2K A;  4PHP A;  4O3Q A;  4NLK A;  4DFP A;  4P2H A;  4GXJ A;  3ETL A;  5HP4 A;  2MAX A;  3KHR A;  1NK0 A;  2A1J B;  2AGQ A;  2FPK A;  3GIM A;  3PW4 A;  3RB4 A;  3OSP A;  1X9S A;  7ICR A;  2MUT A;  2AU0 A;  4I29 A;  5HHI A;  3ZD8 A;  4PGQ A;  3UQ2 A;  1N48 A;  4QZF A;  4K4H A;  4O3N A;  4F4Z A;  4MEX A;  5HHH A;  3HW8 A;  1BPX A;  2UVU A;  1U48 A;  3AUO A;  4K4G A;  2ZUD A;  4J9R A;  5KFZ A;  4UAY A;  4I28 A;  2BCS A;  3M9O B;  1U4B A;  4B9U A;  5KFL A;  4Z6D A;  4QZG A;  3HT3 A;  4GLX A;  3RTV A;  4F5O A;  4TUP A;  5J29 A;  4J9K A;  4GC6 A;  5J0U A;  3KHH A;  1NK9 A;  2PFO A;  4C8K A;  4KLM A;  9ICC A;  1PZN A;  4UB3 A;  1NK7 A;  4DSK A;  2BQR A;  2F1I A;  3KHG A;  2W9C B;  3RJJ A;  4BGD A;  4I2E A;  4I27 A;  1ZQB A;  5L1K A;  8ICN A;  2A1J A;  5EWG A;  7ICG A;  5J2A A;  5KFY A;  4J9N A;  1QTM A;  4MFF A;  3RJF A;  4TQS A;  1ZQV A;  8ICA A;  9ICP A;  1TVA A;  8ICJ A;  9ICG A;  1B22 A;  4BDP A;  4DFJ A;  1T4G A;  4DSF A;  4ED2 A;  4UB4 A;  4Q44 A;  4ECT A;  3GIK A;  4M47 A;  3OHB A;  4C8O A;  2I9G A;  8ICB A;  2HVH A;  2HHQ A;  4R64 A;  4YFK A;  1XS9 D;  2JEJ A;  1RXW A;  3HPO A;  2AQ4 A;  1SL2 A;  4ED3 A;  7ICU A;  5DGA A;  3EYZ A;  4NM2 A;  3OSN A;  5D49 A;  1K1S A;  4FO6 A;  8ICY A;  1UT8 A;  4ECV A;  3TFR A;  4HYK A;  3T5J A;  4F3O A;  2P6R A;  4DL6 A;  4DQP A;  2BGW A;  4DQQ A;  4RT3 A;  7ICJ A;  1NK6 A;  2PXI A;  5KFI A;  7ICN A;  1L3T A;  2W8L A;  3T3F A;  3MBY A;  1ZQH A;  4KLH A;  1H38 A;  3SYZ A;  4DEZ A;  1CUK A;  4X5V A;  1NK5 A;  3IM1 A;  4PPX A;  4DL2 A;  3ZDD A;  5KFT A;  4FBU A;  5DB9 A;  3LWM A;  1S10 A;  3RR7 A;  2ZTD A;  3MR6 A;  4GXI A;  3ZDB A;  4B9S A;  3JPS A;  5DBA A;  2NRZ A;  4YMM A;  5J2K A;  4B9L A;  8ICR A;  1IM4 A;  1X2I A;  3H40 A;  3ZDC A;  3FYH A;  1Z00 B;  8ICV A;  1NOM A;  3QEA Z;  5KTQ A;  1ZQA A;  2NRX A;  5J2I A;  1SL0 A;  1TKD A;  5KFK A;  5III A;  3RJK A;  2HHT A;  5J2J A;  4MEY A;  4YXM A;  5KFW A;  4UB2 A;  4J9M A;  1RYR A;  4KLU A;  3RRH A;  5KFO A;  2ISP A;  3SV3 A;  3Q8S B;  2XY5 A;  4RPZ A;  4P4P A;  5J0S A;  4FS2 A;  3OHA A;  1HUZ A;  1BPZ A;  4KLD A;  3ISB A;  9ICS A;  4CCH A;  4QZ8 A;  4BXO A;  5J0T A;  3C1Y A;  4YP3 A;  5TZV A;  2VAN A;  4M6W B;  4ED0 A;  5KFA A;  1ZYQ A;  4F93 B;  2XY6 A;  1T7P A;  2W9M A;  2ALZ A;  8ICE A;  5J2D A;  4RQ1 A;  4MF8 A;  5BOM A;  3BQ1 A;  5C5J A;  5CHG A;  3PV8 A;  1XSP A;  4M04 A;  3C2M A;  5DQG A;  4O5K A;  4DO9 A;  8ICH A;  9ICF A;  1T3N A;  4RNN A;  3ISD A;  2PFQ A;  9ICA A;  1S0O A;  3H8W A;  4R8U B;  4KLT A;  4O0I A;  4M9J A;  5KFD A;  4PHE A;  4RQ8 A;  3PNC A;  4C8L A;  4UQG A;  8ICI A;  1ZQG A;  3V6K A;  3M8R A;  2P6U A;  3RAQ A;  4IR1 A;  5DG7 A;  2WTF A;  3MFH A;  3GIL A;  1TK0 A;  4I2I A;  4F4X A;  3V7K A;  3UXN A;  5KFG A;  5KG6 A;  3RJE A;  4QWA A;  1XSN A;  4RQ3 A;  4LZG A;  4QZA A;  1NJW A;  7ICK A;  5KFM A;  5HNK A;  4JWN A;  4C8M A;  3RB0 A;  3JPN A;  4Z6E A;  5EWF A;  3Q8L A;  4KLE A;  4RNM A;  1U45 A;  3V72 A;  2FPL A;  5D46 A;  3AU6 A;  2KZ3 A;  4DLG A;  1U47 A;  3KHL A;  4RQ0 A;  3GQC A;  5DB7 A;  5J0Q A;  3PR4 A;  1S77 D;  8ICF A;  1B43 A;  3RH5 A;  1QLN A;  1L3U A;  4DS4 A;  4GXK A;  5KFP A;  2FLP A;  2C2D A;  4QW8 A;  4EYH B;  3PW5 A;  4J9Q A;  1XC9 A;  3V6J A;  2ISO A;  3BJY A;  5J2G A;  4M9H A;  3GII A;  4NLG A;  3B0X A;  2FMQ A;  4Q45 A;  2BPC A;  7ICI A;  8ICX A;  2UVR A;  3N4M B;  2HHX A;  2ZJ8 A;  4DQS A;  4NLZ A;  9ICL A;  2JZB B;  4XA5 A;  3SI8 A;  1T8E A;  2ASD A;  4ECU A;  2ATL A;  4M2Y A;  2JEF A;  4RQ6 A;  1Y88 A;  1S9F A;  4RU9 A;  4J9S A;  1ZJN A;  5L9X A;  1UA1 A;  2VA3 A;  4ED6 A;  4M9L A;  5KFR A;  2PI4 A;  1MSW D;  4RPY A;  2ZJ5 A;  3LDA A;  9ICV A;  1ZJM A;  8ICU A;  4R63 A;  1ZQF A;  1L3S A;  4ED1 A;  3PW7 A;  5CP2 A;  4O3P A;  4QZ9 A;  1BPE A;  5J0Y A;  3OJU A;  3HWT A;  3QE9 Y;  1SZP A;  3RB6 A;  3RBE A;  5KT5 A;  1ZQP A;  2KN7 A;  1X9W A;  5J0P A;  3KTQ A;  7ICF A;  3BQT A;  4RUA A;  3EPI A;  3PW0 A;  4UB5 A;  1ZQN A;  4RUC A;  1WCL A;  3OJS A;  2HHV A;  4BWM A;  4Z6C A;  1ZQE A;  1BGX T;  1ZQT A;  2DPJ A;  5CB1 A;  3GFK B;  2I1Q A;  3RBD A;  1TK5 A;  3IHQ B;  1S0N A;  4JWM A;  2HHU A;  4ECY A;  3V6H A;  2Q0Z X;  2BCR A;  5BPC A;  3GV5 B;  4IRC A;  2XCP A;  3TQ1 A;  2HW3 A;  3RAX A;  3M9M B;  1X9M A;  4YMN A;  2BQU A;  4DFK A;  5DQI A;  5KT6 A;  2J6T A;  4O9M A;  9ICK A;  4YR0 A;  5DB8 A;  2BPG A;  3OGU A;  3H8S A;  3G6X A;  1SKW A;  1RPL A;  2M9N A;  4KLO A;  4F5Q A;  1ZQO A;  4XUS A;  5CWR A;  4F4K A;  3PW2 A;  8ICO A;  2ZTE A;  3C1Z A;  3NGD A;  4ED7 A;  4J9P A;  1MC8 A;  5IIK A;  4NXZ A;  1XSL A;  5HML A;  4UAZ A;  8ICZ A;  2OWO A;  3PMN A;  4IQV A;  1ZQR A;  4YG2 A;  2KZM A;  1KRP A;  9ICI A;  2KZZ A;  4LZD A;  2PFP A;  1NJZ A;  3PX0 A;  5HMM A;  8ICL A;  9ICM A;  1TAU A;  2KFN A;  4KLF A;  3GIJ A;  4PGY A;  5L1L A;  4MF2 A;  4YQW A;  5KG7 A;  8ICQ A;  2IHM A;  5DBC A;  4NY8 A;  1XWL A;  3JPT A;  3RR8 A;  4B9N A;  4UBC A;  2FMP A;  5KFC A;  8ICT A;  5IIN A;  1D9D A;  2ASJ A;  9ICO A;  5D4B A;  4QWB A;  1ZQS A;  1SKS A;  4ECS A;  5BOL A;  4MFA A;  9ICU A;  1XO1 A;  3EWA A;  3UPQ A;  3QEB Z;  4DSL A;  5KT7 A;  4QWD A;  4DWI A;  4YR3 A;  2ZTC A;  2F1H A;  3Q8Q B;  2H5X A;  2AJQ A;  4I2G A;  4NLN A;  4M9N A;  2UVW A;  5KT3 A;  4DF8 A;  5KFB A;  4F5N A;  4KN4 A;  2NRW A;  3GV8 B;  4XRH A;  1LV5 A;  4G3I A;  1LB2 B;  1NKE A;  5F9N A;  4KLI A;  3H8J A;  4TUR A;  5CR0 A;  4DSI A;  4DFM A;  5DKW A;  1KEJ A;  4LVS A;  1NK4 A;  3GDX A;  5J2E A;  4EBE A;  4KLS A;  1ZQM A;  3MR5 A;  1K1Q A;  4YD1 A;  1WCN A;  2XGP A;  2FLN A;  4FBT A;  2KFZ A;  1TAQ A;  3RJH A;  4M6W A;  4Q8F A;  8ICK A;  2V4R A;  3PR5 B;  8ICW A;  1CEZ A;  1ZQZ A;  5KFS A;  2ZUC A;  5F9L A;  5L1I A;  2C22 A;  2V9W A;  3MGH A;  4ECZ A;  4ED8 A;  4RPX A;  3TFS A;  3PO4 A;  5KG3 A;  4IQT A;  4JV2 A;  4R66 A;  4Z6F A;  3TAN A;  1JX4 A;  2ZJA A;  4QZC A;  1KFS A;  1V9P A;  4TUQ A;  1NKC A;  9ICB A;  3K4G A;  2AGP A;  3MR3 A;  1A76 A;  3EW9 A;  1ZQY A;  3K75 D;  3HX0 A;  1RZT A;  1ZQU A;  1S0M A;  4RNO A;  9ICJ A;  1L3V A;  2HHS A;  3RJI A;  1NJY A;  2HVI A;  4P4M A;  2FPM A;  4JV0 A;  3HP6 A;  9ICW A;  3TAQ A;  4R8U A;  4IQU A;  5DQH A;  3SV4 A;  3RH6 A;  4B9T A;  5KG1 A;  2RDJ A;  5DG8 A;  1BPB A;  3MGI A;  4NM1 A;  1ZQX A;  5KFN A;  4J9L A;  3UQ0 A;  5KFX A;  4ECQ A;  3T5L A;  3QZ7 A;  3PML A;  4EBC A;  1JXL A;  3PVX A;  3C5F A;  2AQ0 A;  4IRD A;  3H7I A;  4KIT B;  4GC7 A;  5KT4 A;  7ICV A;  3PY8 A;  1KFD A;  1ZQD A;  3MDA A;  1ZQQ A;  2IBK A;  4RQ7 A;  2W8K A;  4B9V A;  3LWL A;  4DOB A;  1L5U A;  4TQR A;  4PHA A;  3V7L A;  3ISC A;  2VA8 A;  3MFI A;  4DL5 A;  2PI5 A;  4DQR A;  1A77 A;  4O3O A;  4YMO A;  4I2C A;  4O5E A;  4QW9 A;  4I2A A;  3T5H A;  5J0W A;  2BPF A;  2BCU A;  8ICS A;  4DF4 A;  4ELT A;  4QWC A;  5DGB A;  3JPP A;  2W9B B;  4F92 B;  2W9A A;  1KTQ A;  4UB1 A;  3RH4 A;  1RYS A;  3PO5 A;  7ICL A;  1KFT A;  1ZQL A;  3B0Y A;  2R8K A;  8ICC A;  3H4D A;  3C5G A;  9ICN A;  2IHN A;  2JEG A;  3G6Y A;  2BKE A;  5CJ7 A;  3RB3 A;  1C7Y A;  5EOZ A;  3JPR A;  1D8L A;  1QSL A;  2IA6 A;  4KTQ A;  2BR0 A;  1D9F A;  4RT2 A;  1BPD A;  1UA0 A;  4RQ5 A;  4P4O A;  5KT2 A;  5KFF A;  1Z00 A;  4F50 A;  4Q43 A;  4DSE A;  3THV A;  2LYH A;  2KTQ A;  4E0D A;  3Q8R B;  4O5C A;  2J6S A;  3M9N B;  4F2R A;  8ICP A;  1JXE A;  2Y1I A;  7ICT A;  4O3S A;  7ICS A;  4F91 B;  2B21 A;  4IQW A;  4RQ4 A;  1Z3E B;  5KFJ A;  5DDY A;  4BXO B;  4DL7 A;  5KFV A;  3C2L A;  5J0R A;  7ICH A;  5J2F A;  3BQ0 A;  5DG9 A;  1D8Y A; 
#chains in the Genus database with same CATH topology
 3NTU A;  3TKA A;  1OUQ A;  5IIL A;  4KN7 A;  5ALM A;  1PK3 A;  5J2H A;  1TK8 A;  3A0H U;  2BCV A;  2H3V A;  4J9O A;  2J6U A;  3AEV A;  4K4I A;  4C0Z A;  4JV1 A;  4M9G A;  5J0O A;  1ZQI A;  1J2N A;  4QZB A;  3SEN A;  1KLN A;  4KLJ A;  4CGZ A;  4I2H A;  7ICQ A;  2BQ3 A;  3FDS A;  2YMQ A;  2R8G A;  3MGV A;  4MFC A;  1QH9 A;  2LI6 A;  2WB1 C;  3T5K A;  1O08 A;  4F4W A;  5DBB A;  4ELV A;  1UT5 A;  3WKB A;  2I5H A;  3MR2 A;  4R65 A;  5B66 U;  2P66 A;  2G09 A;  2LHT A;  3D2N A;  4EX6 A;  2XY7 A;  5KFE A;  2H3Q A;  2KVC A;  4QWE A;  5TIS U;  2W3S A;  2OXO A;  3C21 A;  2LBO A;  2MUT B;  3QU4 A;  2JEI A;  2XI9 A;  4CRX A;  1N60 A;  1SWV A;  3WK7 A;  3Q8M A;  4Y2P A;  4KLL A;  2C28 A;  4O3R A;  2FE9 A;  3JPO A;  4DOA A;  7ICE A;  3ZDA A;  3RRG A;  8ICG A;  4GXJ A;  2AGQ A;  2FPK A;  2MUT A;  2AU0 A;  3ZD8 A;  1BPX A;  2KIW A;  3AUO A;  5KFZ A;  5ALX A;  1N5W A;  1U4B A;  4Z6D A;  4F5O A;  2PFO A;  3J81 j;  4UB3 A;  1NK7 A;  1WG8 A;  2BQR A;  2HBM A;  4DSK A;  1B4F A;  3RJJ A;  3TAC B;  4I2E A;  3BS5 B;  5AKI A;  3O0F A;  5EWG A;  4J9N A;  1QTM A;  1TVA A;  3GIK A;  4M47 A;  3OHB A;  4C8O A;  2LM4 A;  8ICB A;  2HVH A;  2JEJ A;  4YFK A;  2AQ4 A;  2DF4 B;  1SL2 A;  3UMC A;  3EYZ A;  1F0M A;  8ICY A;  4HYK A;  4C7Z A;  4NV0 A;  4DQQ A;  4RT3 A;  3L5K A;  2PXI A;  1ZOL A;  4IL6 U;  3T3F A;  3GZF A;  1L3T A;  1H38 A;  3SYZ A;  1NK5 A;  4PPX A;  2WAQ F;  4Y2R A;  4FBU A;  3LWM A;  3RR7 A;  4B9S A;  1N62 A;  4B9L A;  2A3V A;  1IM4 A;  5AK5 A;  2KHV A;  5G5G A;  4FZL A;  5III A;  5KFW A;  3M6K A;  3Q8S B;  1FFU A;  2H3I A;  5ALD A;  2QLT A;  4KLD A;  9ICS A;  5EE9 A;  2KSO B;  1ZRM A;  3M7D A;  3SAG A;  1HEK A;  2KKV A;  1SV4 A;  4ED0 A;  4GFJ A;  2W9M A;  5J2D A;  5L1M A;  2MU2 A;  5CHG A;  3PV8 A;  2NV3 A;  3C2M A;  3BS5 A;  2Y9T A;  2ZG6 A;  1T3N A;  2PFQ A;  1S0O A;  3H0M B;  2K4I A;  1XO0 A;  2RLT A;  2EAN A;  8ICI A;  5GTI U;  1V38 A;  5AKZ A;  3KFU F;  5DG7 A;  2WTF A;  1ZQ1 C;  4I2I A;  2Q4T A;  4QWA A;  2YQE A;  1NJW A;  4KLE A;  5D46 A;  2KZ3 A;  5E79 U;  3QXG A;  1KN5 A;  4RQ0 A;  1GO3 F;  5DB7 A;  5AIA A;  4WJ3 B;  3WK5 A;  3KOO A;  3UM9 A;  4GXK A;  5KL8 B;  5KFP A;  2FLP A;  4J9Q A;  5J2G A;  4M9H A;  3B0X A;  2BPC A;  8ICX A;  2HHX A;  4DQS A;  9ICL A;  2JZB B;  3SI8 A;  1QQ5 A;  3QUQ A;  1Y88 A;  5L9X A;  5AKG A;  2E8O A;  2WFA A;  3LDA A;  2KVS A;  3WKE A;  1L7O A;  1KDH A;  1BPE A;  1ZQP A;  3HWT A;  3MC1 A;  1X9W A;  3BQT A;  3EPI A;  3PW0 A;  4CNQ A;  2I1Q A;  1S0N A;  2HHU A;  3GV5 B;  2HW3 A;  3M9M B;  1X9M A;  4YR0 A;  5DB8 A;  3G6X A;  4HAI A;  2KK0 A;  3BQ7 A;  1ZQO A;  5CWR A;  3PW2 A;  3U26 A;  2B0C A;  4NXZ A;  8ICZ A;  2OWO A;  3PMN A;  4YG2 A;  2KZM A;  1PUZ A;  1NJZ A;  9ICM A;  1ZD2 P;  5L1L A;  8ICQ A;  2IHM A;  1V85 A;  4B9N A;  4UBC A;  8ICT A;  5AI0 A;  1D9D A;  9ICO A;  2I6X A;  1ZQS A;  4C80 A;  1LVH A;  4QWD A;  4JMU A;  2LYA A;  4YR3 A;  2ZIV A;  2F1H A;  2EDU A;  2H5X A;  2AJQ A;  4I2G A;  2UVW A;  4DF8 A;  5KFB A;  1LV5 A;  4G3I A;  1LB2 B;  2KJ5 A;  4KLS A;  1RDF A;  1ZQM A;  1K1Q A;  3ZI4 A;  2KFZ A;  3PR5 B;  8ICW A;  1CEZ A;  5L1I A;  2HDO A;  4RPX A;  3TFS A;  3PO4 A;  4Y2T A;  4IQT A;  3IRU A;  1V9P A;  9ICB A;  3K4G A;  2DGZ A;  1A76 A;  3EW9 A;  5ALW A;  1ZQY A;  5C0Y A;  9ICW A;  3TAQ A;  3SV4 A;  4PJ0 U;  2R18 A;  2KNJ A;  1BPB A;  3NVV A;  4OJ6 A;  1CRX A;  5KFX A;  3T5L A;  1JXL A;  3PVX A;  2ZIU B;  3H7I A;  7ICV A;  3PY8 A;  1KFD A;  3MDA A;  2IBK A;  2D3D A;  1NZP A;  4RQ7 A;  2KG5 A;  2G5H B;  2FDR A;  3SD7 A;  2PI5 A;  4DL5 A;  1Z4N A;  1IV8 A;  4O3O A;  5JTI A;  3NAS A;  2FJ6 A;  2LYB A;  3RH4 A;  1KFT A;  5ALZ A;  1ZQL A;  5G5H A;  3B0Y A;  1Q3V A;  2IHN A;  1DK2 A;  5CJ7 A;  1IIP A;  5JU5 A;  5EOZ A;  1D8L A;  2JV3 A;  2IA6 A;  2BR0 A;  1D9F A;  2K8C B;  5J8Y A;  4OJ5 A;  1URJ A;  5AK4 A;  2RRD A;  5ALP A;  5KFF A;  4F50 A;  4DSE A;  2DUY A;  5AM3 A;  3PSP A;  5AM5 A;  3Q8R B;  4F2R A;  7ICT A;  2NO5 A;  1T3Q A;  5DDY A;  4JB3 A;  1DGJ A;  4ZOH C;  2HHV A;  1D8Y A;  3FAH A;  5ALU A;  3TAR A;  2OYY A;  4M0A A;  3AQE A;  4IRK A;  3AL0 B;  4RZR A;  2JH7 A;  2HOF A;  4Y2U A;  2IMW P;  2W9C A;  2CRX A;  4P0P A;  4UAW A;  3KKA C;  3RJG A;  2DFL A;  1MQ3 A;  4DLE A;  3QUC A;  2V4Q A;  1COK A;  3BQ2 A;  5KFQ A;  4UAR A;  1ZQJ A;  5IIJ A;  4NL9 C;  1KSP A;  1XU4 A;  2G08 A;  4KMU A;  1HUO A;  4B9M A;  8ICM A;  2DL0 A;  2OH2 A;  1COO A;  4DL4 A;  1S76 D;  4DSJ A;  2W7P A;  2BHN A;  4BWJ A;  7ICM A;  1TFR A;  3KKA A;  2H3Z A;  1L8L A;  3BZC A;  4Y2Y A;  3MDC A;  2ASL A;  5IIO A;  5DLG A;  3LK9 A;  4OCZ A;  1Z4O A;  3TAP A;  3EZ5 A;  1VLB A;  2YB1 A;  3GV7 B;  3WK4 A;  1BVS A;  3H4B A;  4ECR A;  1NJX A;  2VA2 A;  2GOL A;  4C8N A;  5K4L A;  4Q8E A;  1SL1 A;  2NRV A;  3NRW A;  5AI8 A;  1U9L A;  4ELU A;  3IG8 A;  5KL1 B;  2CN1 A;  3T79 A;  3PSF A;  2DQN B;  2F2A B;  1BPY A;  2FMS A;  4I2B A;  4UB6 U;  2F1J A;  3SZ2 A;  2JZB A;  2PFN A;  1U49 A;  3MAB A;  3V7J A;  4I2D A;  3WU2 U;  4BUG A;  4EEY A;  2WF9 A;  4OJO A;  1S97 A;  3A0B U;  3EPG A;  5KG4 A;  3PX4 A;  1SV0 A;  3QZ8 A;  3C2K A;  2W03 A;  4P0Q A;  3I76 A;  3WKC A;  4P2H A;  4US9 A;  1L7P A;  2Y9U A;  2A1J B;  2NYV A;  2KV2 A;  3RB4 A;  5CRX A;  1X9S A;  5HHI A;  4PGQ A;  1N48 A;  2UVU A;  1U48 A;  4J9R A;  4I28 A;  3CW2 C;  4EEK A;  4QZG A;  4GLX A;  3RTV A;  4F71 A;  2BDU A;  5J29 A;  3KHH A;  1NK9 A;  4KLM A;  2HCF A;  1WUD A;  3KHG A;  1ZQB A;  2A1J A;  7ICG A;  1YZ7 A;  4MFF A;  3RJF A;  2K8A A;  1B22 A;  2WHE A;  4DFJ A;  1T4G A;  4UB4 A;  2DKX A;  4Q44 A;  2I9G A;  3SAF A;  1RXW A;  5AK3 A;  2KEY A;  3TFR A;  3T5J A;  4F3O A;  4DQP A;  5ALS A;  3AN1 A;  5KFI A;  1X40 A;  3MBY A;  1ZQH A;  3IM1 A;  4DL2 A;  3ZDB A;  1JAL A;  5AIC A;  3JPS A;  3WK6 A;  4YMM A;  8ICR A;  1X2I A;  1Z00 B;  8ICV A;  2W55 A;  5KTQ A;  1TKD A;  4MEY A;  4YXM A;  4KLU A;  5KFO A;  2E8P A;  1A0P A;  2XY5 A;  1X6I A;  2YMM A;  4P4P A;  4FS2 A;  1JI7 A;  4U6P A;  4PL2 A;  1LKY B;  5AKK A;  5AIB A;  4CCH A;  4QZ8 A;  4BXO A;  3C1Y A;  3HKZ F;  2ZIW A;  2EAP A;  4AP9 A;  2XY6 A;  5ALQ A;  2ALZ A;  5BOM A;  5C5J A;  4M04 A;  3IDW A;  2KD1 A;  4O5K A;  4DO9 A;  2QAR B;  4RNN A;  9ICA A;  4KLT A;  4M9J A;  2WF6 A;  5KFD A;  4PHE A;  4C8L A;  3C29 A;  1LKY A;  1M6Y A;  3M8R A;  2ES6 A;  2KMD A;  5KFG A;  5KG6 A;  1SZH A;  5ALN A;  5ALK A;  4QZA A;  2F8L A;  5HNK A;  2KKP A;  1WWV A;  4JWN A;  1Z1V A;  3JPN A;  1SWW A;  4U7C A;  3V72 A;  3AU6 A;  4DLG A;  2HBL A;  1U47 A;  3GQC A;  3PR4 A;  1S77 D;  3F5E A;  1QLN A;  4QW8 A;  4EYH B;  3NVY A;  4NLG A;  4Q45 A;  2H3F A;  2F3N A;  2ZJ8 A;  1T8E A;  3QUT A;  4M2Y A;  1L7M A;  3PSI A;  2G07 A;  3QYP A;  1ZJN A;  4J9S A;  4M9L A;  2VA3 A;  4FFD A;  3RFA A;  2DKZ A;  2ZJ5 A;  2XIC A;  8ICU A;  4R63 A;  1SB3 C;  1ZQF A;  2KSO A;  4ED1 A;  3QE9 Y;  3OJU A;  3RB6 A;  1Q3U A;  1SZP A;  2E3T A;  5KT5 A;  2GLE A;  1FFV A;  4UB5 A;  4EEL A;  4RUC A;  4FZN A;  1RQL A;  3I1Y A;  4ACO A;  5CB1 A;  3RBD A;  1QCK A;  4ECY A;  2Q0Z X;  3E58 A;  5BPC A;  2XCP A;  2ZXH A;  4A8E A;  2BQU A;  2J6T A;  9ICK A;  3FC4 A;  2QAR A;  2E8N A;  3OGU A;  2LPE A;  3HJE A;  1SKW A;  2JGA A;  4AYB C;  1KW4 A;  1ZD3 A;  4XUS A;  1WYG A;  2ZIU A;  2AXT U;  1SGG A;  4UAZ A;  1ZQR A;  5A0L A;  4CDG A;  4LZD A;  3KZI U;  4KLF A;  5KG7 A;  3M1Y A;  5DBC A;  4NY8 A;  1XWL A;  3M6Z A;  5KFC A;  1OXJ A;  3HRD D;  1TE2 A;  5ALO A;  1SKS A;  4MFA A;  1UCV A;  3QEB Z;  3F53 A;  2ZTC A;  4M9N A;  4F5N A;  2NRW A;  3KZX A;  5ALG A;  4KLI A;  2JXJ A;  4DFM A;  5DKW A;  3MR5 A;  4YD1 A;  1FEZ A;  2FLN A;  3SEI A;  3SMV A;  4M6W A;  1ZQZ A;  5F9L A;  2C22 A;  4ED8 A;  4ECZ A;  1QQ7 A;  4R66 A;  1KFS A;  3TAD A;  5ALT A;  3K75 D;  1RZT A;  1ZQU A;  9ICJ A;  2HHS A;  1NJY A;  1FIQ A;  2HVI A;  4JV0 A;  5KG1 A;  2RDJ A;  3N7P D;  3MGI A;  2FI1 A;  4DFD A;  1ZQX A;  1J97 A;  1C20 A;  3QZ7 A;  1V97 A;  4GC7 A;  1ZQD A;  4NLC A;  2W8K A;  4B9V A;  4DOB A;  4TQR A;  3SR6 A;  3ONN A;  2G0A A;  4I2C A;  4I2A A;  1N61 A;  4QWC A;  4F92 B;  2W9A A;  1KTQ A;  5F3X B;  4UB1 A;  7ICL A;  1NZB A;  2R8K A;  8ICC A;  2YTU A;  2JEG A;  3RB3 A;  1QQ6 A;  1HIW A;  4RT2 A;  1BPD A;  1UA0 A;  1Z00 A;  4QJF B;  1T94 A;  4E0D A;  4IS7 A;  2W3R A;  8ICP A;  5AI6 A;  2MA1 A;  2YMP A;  1JXE A;  4O3S A;  7ICS A;  4F91 B;  5GTH U;  5KFJ A;  4BXO B;  5B5E U;  5KFV A;  4UB8 U;  4DOC A;  1ZD4 A;  2HHW A;  4US8 A;  4EZ6 A;  5J2C A;  4YVZ A;  4YCX A;  1RYU A;  2W43 A;  2EAM A;  1PVQ A;  4PGX A;  3F2B A;  4I2F A;  1DRG A;  2UVV A;  3ZDE A;  4EYI B;  1NKB A;  3BDP A;  1B0X A;  1ZQK A;  4RQN A;  3NUQ A;  5KG0 A;  4XQ8 A;  3JPQ A;  3DEE A;  9ICT A;  3UXP A;  1UQV A;  4ECX A;  4EBD A;  2MRL A;  4KLQ A;  1JIH A;  2AGO A;  2FLL A;  5AI5 A;  2XGQ A;  2XC9 A;  2R8H A;  2RDI A;  2P35 A;  5KFH A;  1RXV A;  5ALH A;  3NRZ A;  4QZD A;  4F5P A;  2XO7 A;  1DOQ A;  4F8R A;  1NK8 A;  3C23 A;  4QZE A;  2HBK A;  4KX5 A;  2DPI A;  1S0V A;  3AU2 A;  5H2F U;  3IV6 A;  3N97 B;  1ZET A;  5CA7 A;  2BCQ A;  2GWS A;  5AM4 A;  4RQ2 A;  4DCC A;  4YN4 A;  2VIX A;  2C2R A;  2BDP A;  1EXN A;  5JRT A;  1HJP A;  1IXR A;  1DGS A;  3KD3 A;  7ICO A;  2Y1J A;  3PX6 A;  4DL3 A;  4YXJ A;  3GU3 A;  9ICE A;  4IR9 A;  5L1J A;  2VKQ A;  5J0X A;  9ICQ A;  2RP5 A;  2E1F A;  5KFU A;  2N1R A;  4P0P B;  4PHP A;  4O3Q A;  4NLK A;  4DFP A;  2RQ5 A;  5AKH A;  2MAX A;  3GIM A;  2O6K A;  2K4P A;  2CPR A;  3OSP A;  3UQ2 A;  4QZF A;  4MEX A;  1N5X A;  4UAY A;  2BCS A;  5ALF A;  3M9O B;  5KFL A;  4J9K A;  9ICC A;  1PZN A;  5AKJ A;  2F1I A;  2OHF A;  2YX8 A;  2W9C B;  4BGD A;  3F5A A;  5L1K A;  4QIW F;  1SIJ A;  5J2A A;  5KFY A;  5AHX A;  4TQS A;  1ZQV A;  9ICP A;  8ICJ A;  4DSF A;  3BZK A;  4ED2 A;  4ECT A;  1YZ6 A;  2E5S A;  2HHQ A;  2PMZ F;  4R64 A;  2K4E A;  7ICU A;  4Y2V A;  3OSN A;  2YML A;  5D49 A;  4LJX A;  4DL6 A;  2EAO A;  2DBY A;  2JMG A;  2K89 A;  4AYB F;  1L6N A;  1NK6 A;  2LKY A;  7ICN A;  3D2S A;  2W8L A;  4KLH A;  3AQF A;  3QU2 A;  4DEZ A;  4X5V A;  4QIW C;  3ZDD A;  5DB9 A;  4CE6 A;  1NI3 A;  2ZTD A;  3MR6 A;  4UAT A;  3ZDC A;  3H40 A;  3FYH A;  4NLB A;  4J03 A;  3QEA Z;  1SL0 A;  3RJK A;  3QNM A;  4J9M A;  1Z19 A;  3RRH A;  2ISP A;  5AKX A;  4RPZ A;  3OHA A;  3QUB A;  3ISB A;  5ALI A;  5TZV A;  2KIC A;  2VAN A;  5KFA A;  1ZYQ A;  4F93 B;  2QB0 B;  4MF8 A;  5DQG A;  3E0F A;  3UMB A;  8ICH A;  9ICF A;  3ISD A;  4C4R A;  3QX7 A;  4R8U B;  1SXE A;  1VJ5 A;  4O0I A;  5ALE A;  3PNC A;  5KAI U;  4UQG A;  1F5S A;  1ZQG A;  2KE7 A;  3V6K A;  2P6U A;  1CI4 A;  5J8Y C;  3RAQ A;  4IR1 A;  3MFH A;  1TK0 A;  2ZIV B;  4F4X A;  3UXN A;  3RJE A;  2HSZ A;  1XSN A;  7ICK A;  1L8O A;  2F8K A;  4C8M A;  4Z6E A;  4RNM A;  2WB1 F;  2ESE A;  5ALR A;  4DS4 A;  4BJQ A;  3PW5 A;  1XC9 A;  3V6J A;  2ISO A;  3BJY A;  3GII A;  3HKZ C;  7ICI A;  2UVR A;  3D2Q A;  3N4M B;  4IC9 A;  2ASD A;  4ECU A;  3QU7 A;  2JEF A;  4RQ6 A;  2NO4 A;  7ICR A;  1UA1 A;  1MSW D;  4ED6 A;  2PI4 A;  1ZJM A;  2OM6 A;  1L3S A;  3PW7 A;  1Z1B A;  2WF8 A;  5CP2 A;  4O3P A;  2QB0 A;  4QZ9 A;  5J0Y A;  5J0P A;  2ODG A;  3S6J A;  3BS7 A;  1WCL A;  5T14 A;  3OJS A;  4BWM A;  4Z6C A;  5AK6 A;  1BGX T;  1S5L U;  4UAU A;  1OW5 A;  2B6G A;  1ZQT A;  3GFK B;  4PL1 A;  4JWM A;  3IHQ B;  4PZO A;  2BCR A;  3TQ1 A;  4YMN A;  5KAF U;  3SQI A;  4DFK A;  1YT3 A;  5DQI A;  2BPG A;  1RPL A;  2M9N A;  4KLO A;  4ICA A;  8ICO A;  2ZTE A;  3C1Z A;  3NGD A;  3VC8 A;  4J9P A;  4C4T A;  5HML A;  4IQV A;  5EE1 A;  1KRP A;  9ICI A;  3PX0 A;  8ICL A;  4MHV A;  2KP7 A;  1TAU A;  2KFN A;  3GIJ A;  3K1R B;  3RR8 A;  1UPH A;  5IIN A;  2AH5 A;  3RF9 A;  3F2D A;  2ASJ A;  1PVR A;  5AKE A;  5D4B A;  5BOL A;  3UPQ A;  4DSL A;  4DWI A;  2D8C A;  3Q8Q B;  4NLN A;  4RQM A;  5ALJ A;  3GV8 B;  4XRH A;  2A19 A;  1NKE A;  4NL9 A;  4TUR A;  3K1Z A;  4O3M A;  4DSI A;  1KEJ A;  1NK4 A;  3GDX A;  4EBE A;  1WCN A;  2K8B B;  1WWU A;  2IOF A;  3RJH A;  4Q8F A;  2LMR A;  5AM1 A;  2KIV A;  1KL9 A;  5KFS A;  2ZUC A;  2V9W A;  4JV2 A;  1JX4 A;  4QZC A;  4GIB A;  2JHD A;  4TUQ A;  1NKC A;  2L5Y A;  2AGP A;  1VDV A;  3HX0 A;  4NJ8 A;  4P4M A;  3OTQ A;  3RH6 A;  5DQH A;  2BZF A;  3WK9 A;  4OJL A;  5KFN A;  3UQ0 A;  4ECQ A;  4IRD A;  2AQ0 A;  2G06 A;  5AKY A;  2KHQ A;  3ISC A;  3B9J A;  1A77 A;  5ALV A;  1MN8 A;  4YMO A;  4O5E A;  4QW9 A;  4ELT A;  5DGB A;  2W9B B;  3C5G A;  2GO7 A;  9ICN A;  4UAV A;  3QU5 A;  2BKE A;  3G6Y A;  1C7Y A;  3JPR A;  4KTQ A;  3LVV A;  2IOF K;  4RQ5 A;  5KT2 A;  3THV A;  2LYH A;  2KTQ A;  4O5C A;  1O03 A;  2J6S A;  2OCE A;  3CRX A;  2PMZ C;  4IQW A;  1Z3E B;  2EZX A;  3L4P A;  2EZZ A;  4DL7 A;  3ALR A;  5J0R A;  5J2F A;  1J2M A;  5DG9 A;  1ECW A;  5J2B A;  1ZQC A;  4YR2 A;  5AM2 A;  3Q8P B;  2EQY A;  4DQI A;  2E8M A;  3ICX A;  5DDM A;  1RM6 C;  3UMG A;  4G9B A;  2Z7J A;  5DB6 A;  4UBB A;  5DLF A;  2JR5 A;  3UXO A;  3G6V A;  5AKL A;  5KG2 A;  4F5R A;  1QSY A;  1RQN A;  5IIM A;  4JUZ A;  4ECW A;  2C2E A;  1N63 A;  2NRT A;  2VJ4 A;  4PHD A;  5EWE A;  2ZIW B;  1ZQW A;  4UW9 A;  1ED1 A;  3M8S A;  2IOH A;  4F4Y A;  3ORY A;  3ED5 A;  1JN3 A;  2XCA A;  4TUS A;  1X6J A;  2QB1 A;  3Q8K A;  2W9B A;  2R8I A;  4JK1 A;  4F2S A;  1BNO A;  2F44 A;  3ZD9 A;  3TI0 A;  3E2E A;  4FS1 A;  5JUM A;  1N56 A;  3WKD A;  4YD2 A;  4DS5 A;  1JMS A;  9ICR A;  2ZIX A;  2M0N A;  7ICP A;  1L7N A;  1Q46 A;  4KLG A;  1QSS A;  4EEN A;  4EZ9 A;  1SKR A;  4I2J A;  4Y2S A;  4QZI A;  3ETR A;  2JRZ A;  9ICX A;  5KG5 A;  2R8J A;  1MQ2 A;  4CF4 A;  1ARO P;  2K60 A;  2KJ9 A;  4B6J A;  4ZH4 A;  4QZH A;  9ICH A;  2HOQ A;  2LM1 A;  1A6S A;  1TV9 A;  3KBB A;  4PH5 A;  2WAQ C;  2ZUB A;  3NVW A;  4QNL A;  1PVP A;  3ETL A;  2KJ8 A;  5HP4 A;  3LVW A;  3KHR A;  1NK0 A;  2E1E A;  2K4H A;  3PW4 A;  1KKX A;  2XID A;  3H8M A;  3IG5 A;  4FZM A;  2EZY A;  1IG6 A;  4I29 A;  4KMO B;  2A1A A;  4K4H A;  4O3N A;  4F4Z A;  1RG6 A;  5HHH A;  3HW8 A;  4K4G A;  2ZUD A;  1P7D A;  4B9U A;  3HT3 A;  4TUP A;  3I28 A;  4GC6 A;  4C8K A;  5J0U A;  2MSN A;  3VCB A;  3CNH A;  4Y2X A;  4KX3 A;  3TAD C;  3PZP A;  4I27 A;  8ICN A;  1PK1 B;  8ICA A;  9ICG A;  4BDP A;  1Q8K A;  1JUD A;  1XS9 D;  3HPO A;  4C7Y A;  4ED3 A;  5DGA A;  4NM2 A;  4FO6 A;  1K1S A;  1BNP A;  1UT8 A;  4ECV A;  2PKE A;  2JH1 A;  2P6R A;  2BGW A;  2DWQ A;  7ICJ A;  3AM9 A;  3EUB 2;  2Y0S C;  1CUK A;  4CF5 A;  4NWI A;  5KFT A;  1S10 A;  2W11 A;  4GXI A;  5EE3 A;  5DBA A;  2NRZ A;  4UAS A;  5J2K A;  2XVT A;  4EX7 A;  2HMX A;  1NOM A;  1ZQA A;  2NRX A;  5J2I A;  3HIL A;  3N28 A;  5KFK A;  2HHT A;  4BX9 C;  5J2J A;  4UB2 A;  1RYR A;  3SV3 A;  3CP8 A;  5J0S A;  1HUZ A;  4OD0 A;  2QKQ A;  1BPZ A;  2HBJ A;  2VJ5 A;  5J0T A;  2F76 X;  4YP3 A;  2W7O A;  4M6W B;  1T7P A;  8ICE A;  4RQ1 A;  3BQ1 A;  5HR6 A;  1XSP A;  2KOB A;  3CYM A;  1JRP A;  2F77 X;  2ZXI A;  2W04 A;  3H8W A;  4Y2Q A;  4RQ8 A;  2RHF A;  4C4S A;  3IP4 B;  3GIL A;  1KQQ A;  3V7K A;  1UHU A;  3DDH A;  4USA A;  4RQ3 A;  4LZG A;  3FM9 A;  3H0R B;  1SV0 C;  5KFM A;  3C28 A;  4PZN A;  3RB0 A;  5EWF A;  3Q8L A;  2YB4 A;  3NS1 A;  1U45 A;  2FPL A;  1DXS A;  3KHL A;  3L3F X;  2W54 A;  5J0Q A;  3IN5 A;  8ICF A;  1B43 A;  3DV9 A;  3RH5 A;  1L3U A;  3SAH A;  1X9X A;  2HOI A;  2C2D A;  1S8O A;  2FMQ A;  5AI4 A;  4NLZ A;  4XA5 A;  2ATL A;  1S9F A;  4RU9 A;  4P0Q B;  5KFR A;  3WK8 A;  4RPY A;  9ICV A;  3KTQ A;  4OJP A;  3RBE A;  2KN7 A;  2WF7 A;  7ICF A;  2D6F C;  4RUA A;  1ZQN A;  1D8B A;  5FP0 A;  2DPJ A;  1ZQE A;  1JRO A;  1ZRN A;  1TK5 A;  3V6H A;  5ALY A;  4IRC A;  1ZD5 A;  4F72 A;  3RAX A;  3AMZ A;  5KT6 A;  4O9M A;  4Y2J A;  3H8S A;  1X42 A;  4F5Q A;  2ZIX B;  4F4K A;  3PST A;  3D6J A;  4ED7 A;  3LYS A;  1MC8 A;  5IIK A;  1XSL A;  1TAM A;  1NNL A;  2KZZ A;  2GH1 A;  2PFP A;  5HMM A;  4PGY A;  4MF2 A;  3N7S C;  4YQW A;  1FO4 A;  3JPT A;  2FMP A;  1MA7 A;  1N2X A;  4QWB A;  5KNI A;  4ECS A;  9ICU A;  4OO1 J;  1XO1 A;  3EWA A;  1SXD A;  1AQ6 A;  5KT7 A;  2AHO B;  5KT3 A;  2YN4 A;  4KN4 A;  3QU9 A;  4CF3 A;  5AM0 A;  5ALL A;  5F9N A;  3H8J A;  5CR0 A;  4LVS A;  5J2E A;  2HI0 A;  2XGP A;  4FBT A;  5CEH A;  1TAQ A;  8ICK A;  2V4R A;  2G5I B;  3MGH A;  2WF5 A;  5KG3 A;  3R9K A;  4Z6F A;  3F2C A;  3TAN A;  2ZJA A;  3MR3 A;  1S0M A;  4RNO A;  1L3V A;  1ZXI A;  3RJI A;  3NVZ A;  2FPM A;  3HP6 A;  1PK1 A;  4R8U A;  4IQU A;  5EE0 A;  4B9T A;  5DG8 A;  4NM1 A;  1KBU A;  2OEH A;  4J9L A;  2YY6 A;  3PML A;  5AI9 A;  4EBC A;  3C5F A;  1K5O A;  4KIT B;  5KT4 A;  1ZQQ A;  3OPX A;  3LWL A;  1L5U A;  4PHA A;  3V7L A;  2VA8 A;  3MFI A;  4DQR A;  2CXY A;  1F44 A;  5HR7 A;  3T5H A;  5J0W A;  2BPF A;  2BCU A;  8ICS A;  4DF4 A;  3JPP A;  3H0L B;  1RYS A;  3PO5 A;  1X66 A;  1XNS A;  3H4D A;  2Y0S F;  2EH9 A;  4FE3 A;  1QSL A;  4P4O A;  3WKA A;  4Q43 A;  3M9N B;  2Y1I A;  2B21 A;  4RQ4 A;  3N7R C;  3C2L A;  7ICH A;  3BQ0 A;  1DK3 A; 
#chains in the Genus database with same CATH homology
 5J2B A;  4DOC A;  3TAR A;  2HHW A;  3NTU A;  1ZQC A;  4YR2 A;  4M0A A;  4IRK A;  3Q8P B;  4EZ6 A;  4DQI A;  5J2C A;  4YVZ A;  4YCX A;  5DDM A;  5DB6 A;  4RZR A;  5DLF A;  4UBB A;  5IIL A;  4KN7 A;  3UXO A;  2IMW P;  2W9C A;  3G6V A;  5KG2 A;  4F5R A;  1QSY A;  5IIM A;  5J2H A;  1KDH A;  4JUZ A;  4ECW A;  1TK8 A;  4UAW A;  2C2E A;  4PGX A;  3RJG A;  4I2F A;  2DFL A;  1MQ3 A;  4DLE A;  2UVV A;  3ZDE A;  4EYI B;  2V4Q A;  1NKB A;  2NRT A;  4PHD A;  3BDP A;  3BQ2 A;  5KFQ A;  5EWE A;  5IIJ A;  1ZQJ A;  4J9O A;  2BCV A;  2J6U A;  1KSP A;  1ZQK A;  1ZQW A;  1XU4 A;  4KMU A;  4B9M A;  1HUO A;  8ICM A;  1COO A;  5KG0 A;  4XQ8 A;  3JPQ A;  4DL4 A;  1S76 D;  4DSJ A;  4K4I A;  4JV1 A;  9ICT A;  3UXP A;  2BHN A;  4BWJ A;  4M9G A;  7ICM A;  5J0O A;  3M8S A;  1TFR A;  1ZQI A;  4ECX A;  4QZB A;  3MDC A;  2ASL A;  4EBD A;  5IIO A;  4F4Y A;  3ORY A;  5DLG A;  3LK9 A;  4KLQ A;  3TAP A;  1JN3 A;  1KLN A;  2XCA A;  4KLJ A;  3EZ5 A;  1JIH A;  4TUS A;  2AGO A;  3Q8K A;  2W9B A;  2FLL A;  3GV7 B;  4I2H A;  2R8I A;  2XGQ A;  1BVS A;  4JK1 A;  2XC9 A;  3H4B A;  2BQ3 A;  4F2S A;  7ICQ A;  2R8H A;  2RDI A;  3FDS A;  5KFH A;  1RXV A;  4QZD A;  4ECR A;  1NJX A;  2R8G A;  3ZD9 A;  4MFC A;  2VA2 A;  4C8N A;  3TI0 A;  3E2E A;  4F5P A;  4FS1 A;  2XO7 A;  5JUM A;  4Q8E A;  3T5K A;  1N56 A;  1DOQ A;  4F4W A;  5DBB A;  4ELV A;  1SL1 A;  1UT5 A;  2NRV A;  4YD2 A;  1NK8 A;  3C23 A;  1JMS A;  4QZE A;  4DS5 A;  4F8R A;  9ICR A;  7ICP A;  3MR2 A;  4R65 A;  1U9L A;  2P66 A;  4ELU A;  2DPI A;  4KLG A;  1S0V A;  2XY7 A;  5KFE A;  1QSS A;  3AU2 A;  1ZET A;  3N97 B;  4QWE A;  4EZ9 A;  1SKR A;  5CA7 A;  2BCQ A;  1BPY A;  2FMS A;  4I2J A;  4I2B A;  2GWS A;  2F1J A;  4QZI A;  4RQ2 A;  3SZ2 A;  2JZB A;  2PFN A;  9ICX A;  5KG5 A;  1U49 A;  3C21 A;  2R8J A;  2MUT B;  4YN4 A;  1MQ2 A;  3MAB A;  3V7J A;  2C2R A;  1ARO P;  2BDP A;  1EXN A;  4I2D A;  2JEI A;  4EEY A;  1HJP A;  4ZH4 A;  4QZH A;  9ICH A;  1IXR A;  1S97 A;  1DGS A;  7ICO A;  2Y1J A;  3PX6 A;  3EPG A;  4DL3 A;  5KG4 A;  4YXJ A;  3Q8M A;  4KLL A;  2C28 A;  9ICE A;  1TV9 A;  4IR9 A;  4PH5 A;  3PX4 A;  5L1J A;  4O3R A;  3JPO A;  5J0X A;  4DOA A;  7ICE A;  3ZDA A;  3QZ8 A;  3RRG A;  8ICG A;  9ICQ A;  2ZUB A;  5KFU A;  3C2K A;  4PHP A;  4O3Q A;  4NLK A;  4DFP A;  4P2H A;  4GXJ A;  3ETL A;  5HP4 A;  2MAX A;  3KHR A;  1NK0 A;  2A1J B;  2AGQ A;  2FPK A;  3GIM A;  3PW4 A;  3RB4 A;  3OSP A;  1X9S A;  7ICR A;  2MUT A;  2AU0 A;  4I29 A;  5HHI A;  3ZD8 A;  4PGQ A;  3UQ2 A;  1N48 A;  4QZF A;  4K4H A;  4O3N A;  4F4Z A;  4MEX A;  5HHH A;  3HW8 A;  1BPX A;  2UVU A;  1U48 A;  3AUO A;  4K4G A;  2ZUD A;  4J9R A;  5KFZ A;  4UAY A;  4I28 A;  2BCS A;  3M9O B;  1U4B A;  4B9U A;  5KFL A;  4Z6D A;  4QZG A;  3HT3 A;  4GLX A;  3RTV A;  4F5O A;  4TUP A;  5J29 A;  4J9K A;  4GC6 A;  5J0U A;  3KHH A;  1NK9 A;  2PFO A;  4C8K A;  4KLM A;  9ICC A;  1PZN A;  4UB3 A;  1NK7 A;  4DSK A;  2BQR A;  2F1I A;  3KHG A;  2W9C B;  3RJJ A;  4BGD A;  4I2E A;  4I27 A;  1ZQB A;  5L1K A;  8ICN A;  2A1J A;  5EWG A;  7ICG A;  5J2A A;  5KFY A;  4J9N A;  1QTM A;  4MFF A;  3RJF A;  4TQS A;  1ZQV A;  8ICA A;  9ICP A;  1TVA A;  8ICJ A;  9ICG A;  1B22 A;  4BDP A;  4DFJ A;  1T4G A;  4DSF A;  4ED2 A;  4UB4 A;  4Q44 A;  4ECT A;  3GIK A;  4M47 A;  3OHB A;  4C8O A;  2I9G A;  8ICB A;  2HVH A;  2HHQ A;  4R64 A;  4YFK A;  1XS9 D;  2JEJ A;  1RXW A;  3HPO A;  2AQ4 A;  1SL2 A;  4ED3 A;  7ICU A;  5DGA A;  3EYZ A;  4NM2 A;  3OSN A;  5D49 A;  1K1S A;  4FO6 A;  8ICY A;  1UT8 A;  4ECV A;  3TFR A;  4HYK A;  3T5J A;  4F3O A;  2P6R A;  4DL6 A;  4DQP A;  2BGW A;  4DQQ A;  4RT3 A;  7ICJ A;  1NK6 A;  2PXI A;  5KFI A;  7ICN A;  1L3T A;  2W8L A;  3T3F A;  3MBY A;  1ZQH A;  4KLH A;  1H38 A;  3SYZ A;  4DEZ A;  1CUK A;  4X5V A;  1NK5 A;  3IM1 A;  4PPX A;  4DL2 A;  3ZDD A;  5KFT A;  4FBU A;  5DB9 A;  3LWM A;  1S10 A;  3RR7 A;  2ZTD A;  3MR6 A;  4GXI A;  3ZDB A;  4B9S A;  3JPS A;  5DBA A;  2NRZ A;  4YMM A;  5J2K A;  4B9L A;  8ICR A;  1IM4 A;  1X2I A;  3H40 A;  3ZDC A;  3FYH A;  1Z00 B;  8ICV A;  1NOM A;  3QEA Z;  5KTQ A;  1ZQA A;  2NRX A;  5J2I A;  1SL0 A;  1TKD A;  5KFK A;  5III A;  3RJK A;  2HHT A;  5J2J A;  4MEY A;  4YXM A;  5KFW A;  4UB2 A;  4J9M A;  1RYR A;  4KLU A;  3RRH A;  5KFO A;  2ISP A;  3SV3 A;  3Q8S B;  2XY5 A;  4RPZ A;  4P4P A;  5J0S A;  4FS2 A;  3OHA A;  1HUZ A;  1BPZ A;  4KLD A;  3ISB A;  9ICS A;  4CCH A;  4QZ8 A;  4BXO A;  5J0T A;  3C1Y A;  4YP3 A;  5TZV A;  2VAN A;  4M6W B;  4ED0 A;  5KFA A;  1ZYQ A;  4F93 B;  2XY6 A;  1T7P A;  2W9M A;  2ALZ A;  8ICE A;  5J2D A;  4RQ1 A;  4MF8 A;  5BOM A;  3BQ1 A;  5C5J A;  5CHG A;  3PV8 A;  1XSP A;  4M04 A;  3C2M A;  5DQG A;  4O5K A;  4DO9 A;  8ICH A;  9ICF A;  1T3N A;  4RNN A;  3ISD A;  2PFQ A;  9ICA A;  1S0O A;  3H8W A;  4R8U B;  4KLT A;  4O0I A;  4M9J A;  5KFD A;  4PHE A;  4RQ8 A;  3PNC A;  4C8L A;  4UQG A;  8ICI A;  1ZQG A;  3V6K A;  3M8R A;  2P6U A;  3RAQ A;  4IR1 A;  5DG7 A;  2WTF A;  3MFH A;  3GIL A;  1TK0 A;  4I2I A;  4F4X A;  3V7K A;  3UXN A;  5KFG A;  5KG6 A;  3RJE A;  4QWA A;  1XSN A;  4RQ3 A;  4LZG A;  4QZA A;  1NJW A;  7ICK A;  5KFM A;  5HNK A;  4JWN A;  4C8M A;  3RB0 A;  3JPN A;  4Z6E A;  5EWF A;  3Q8L A;  4KLE A;  4RNM A;  1U45 A;  3V72 A;  2FPL A;  5D46 A;  3AU6 A;  2KZ3 A;  4DLG A;  1U47 A;  3KHL A;  4RQ0 A;  3GQC A;  5DB7 A;  5J0Q A;  3PR4 A;  1S77 D;  8ICF A;  1B43 A;  3RH5 A;  1QLN A;  1L3U A;  4DS4 A;  4GXK A;  5KFP A;  2FLP A;  2C2D A;  4QW8 A;  4EYH B;  3PW5 A;  4J9Q A;  1XC9 A;  3V6J A;  2ISO A;  3BJY A;  5J2G A;  4M9H A;  3GII A;  4NLG A;  3B0X A;  2FMQ A;  4Q45 A;  2BPC A;  7ICI A;  8ICX A;  2UVR A;  3N4M B;  2HHX A;  2ZJ8 A;  4DQS A;  4NLZ A;  9ICL A;  2JZB B;  4XA5 A;  3SI8 A;  1T8E A;  2ASD A;  4ECU A;  2ATL A;  4M2Y A;  2JEF A;  4RQ6 A;  1Y88 A;  1S9F A;  4RU9 A;  4J9S A;  1ZJN A;  5L9X A;  1UA1 A;  2VA3 A;  4ED6 A;  4M9L A;  5KFR A;  2PI4 A;  1MSW D;  4RPY A;  2ZJ5 A;  3LDA A;  9ICV A;  1ZJM A;  8ICU A;  4R63 A;  1ZQF A;  1L3S A;  4ED1 A;  3PW7 A;  5CP2 A;  4O3P A;  4QZ9 A;  1BPE A;  5J0Y A;  3OJU A;  3HWT A;  3QE9 Y;  1SZP A;  3RB6 A;  3RBE A;  5KT5 A;  1ZQP A;  2KN7 A;  1X9W A;  5J0P A;  3KTQ A;  7ICF A;  3BQT A;  4RUA A;  3EPI A;  3PW0 A;  4UB5 A;  1ZQN A;  4RUC A;  1WCL A;  3OJS A;  2HHV A;  4BWM A;  4Z6C A;  1ZQE A;  1BGX T;  1ZQT A;  2DPJ A;  5CB1 A;  3GFK B;  2I1Q A;  3RBD A;  1TK5 A;  3IHQ B;  1S0N A;  4JWM A;  2HHU A;  4ECY A;  3V6H A;  2Q0Z X;  2BCR A;  5BPC A;  3GV5 B;  4IRC A;  2XCP A;  3TQ1 A;  2HW3 A;  3RAX A;  3M9M B;  1X9M A;  4YMN A;  2BQU A;  4DFK A;  5DQI A;  5KT6 A;  2J6T A;  4O9M A;  9ICK A;  4YR0 A;  5DB8 A;  2BPG A;  3OGU A;  3H8S A;  3G6X A;  1SKW A;  1RPL A;  2M9N A;  4KLO A;  4F5Q A;  1ZQO A;  4XUS A;  5CWR A;  4F4K A;  3PW2 A;  8ICO A;  2ZTE A;  3C1Z A;  3NGD A;  4ED7 A;  4J9P A;  1MC8 A;  5IIK A;  4NXZ A;  1XSL A;  5HML A;  4UAZ A;  8ICZ A;  2OWO A;  3PMN A;  4IQV A;  1ZQR A;  4YG2 A;  2KZM A;  1KRP A;  9ICI A;  2KZZ A;  4LZD A;  2PFP A;  1NJZ A;  3PX0 A;  5HMM A;  8ICL A;  9ICM A;  1TAU A;  2KFN A;  4KLF A;  3GIJ A;  4PGY A;  5L1L A;  4MF2 A;  4YQW A;  5KG7 A;  8ICQ A;  2IHM A;  5DBC A;  4NY8 A;  1XWL A;  3JPT A;  3RR8 A;  4B9N A;  4UBC A;  2FMP A;  5KFC A;  8ICT A;  5IIN A;  1D9D A;  2ASJ A;  9ICO A;  5D4B A;  4QWB A;  1ZQS A;  1SKS A;  4ECS A;  5BOL A;  4MFA A;  9ICU A;  1XO1 A;  3EWA A;  3UPQ A;  3QEB Z;  4DSL A;  5KT7 A;  4QWD A;  4DWI A;  4YR3 A;  2ZTC A;  2F1H A;  3Q8Q B;  2H5X A;  2AJQ A;  4I2G A;  4NLN A;  4M9N A;  2UVW A;  5KT3 A;  4DF8 A;  5KFB A;  4F5N A;  4KN4 A;  2NRW A;  3GV8 B;  4XRH A;  1LV5 A;  4G3I A;  1LB2 B;  1NKE A;  5F9N A;  4KLI A;  3H8J A;  4TUR A;  5CR0 A;  4DSI A;  4DFM A;  5DKW A;  1KEJ A;  4LVS A;  1NK4 A;  3GDX A;  5J2E A;  4EBE A;  4KLS A;  1ZQM A;  3MR5 A;  1K1Q A;  4YD1 A;  1WCN A;  2XGP A;  2FLN A;  4FBT A;  2KFZ A;  1TAQ A;  3RJH A;  4M6W A;  4Q8F A;  8ICK A;  2V4R A;  3PR5 B;  8ICW A;  1CEZ A;  1ZQZ A;  5KFS A;  2ZUC A;  5F9L A;  5L1I A;  2C22 A;  2V9W A;  3MGH A;  4ECZ A;  4ED8 A;  4RPX A;  3TFS A;  3PO4 A;  5KG3 A;  4IQT A;  4JV2 A;  4R66 A;  4Z6F A;  3TAN A;  1JX4 A;  2ZJA A;  4QZC A;  1KFS A;  1V9P A;  4TUQ A;  1NKC A;  9ICB A;  3K4G A;  2AGP A;  3MR3 A;  1A76 A;  3EW9 A;  1ZQY A;  3K75 D;  3HX0 A;  1RZT A;  1ZQU A;  1S0M A;  4RNO A;  9ICJ A;  1L3V A;  2HHS A;  3RJI A;  1NJY A;  2HVI A;  4P4M A;  2FPM A;  4JV0 A;  3HP6 A;  9ICW A;  3TAQ A;  4R8U A;  4IQU A;  5DQH A;  3SV4 A;  3RH6 A;  4B9T A;  5KG1 A;  2RDJ A;  5DG8 A;  1BPB A;  3MGI A;  4NM1 A;  1ZQX A;  5KFN A;  4J9L A;  3UQ0 A;  5KFX A;  4ECQ A;  3T5L A;  3QZ7 A;  3PML A;  4EBC A;  1JXL A;  3PVX A;  3C5F A;  2AQ0 A;  4IRD A;  3H7I A;  4KIT B;  4GC7 A;  5KT4 A;  7ICV A;  3PY8 A;  1KFD A;  1ZQD A;  3MDA A;  1ZQQ A;  2IBK A;  4RQ7 A;  2W8K A;  4B9V A;  3LWL A;  4DOB A;  1L5U A;  4TQR A;  4PHA A;  3V7L A;  3ISC A;  2VA8 A;  3MFI A;  4DL5 A;  2PI5 A;  4DQR A;  1A77 A;  4O3O A;  4YMO A;  4I2C A;  4O5E A;  4QW9 A;  4I2A A;  3T5H A;  5J0W A;  2BPF A;  2BCU A;  8ICS A;  4DF4 A;  4ELT A;  4QWC A;  5DGB A;  3JPP A;  2W9B B;  4F92 B;  2W9A A;  1KTQ A;  4UB1 A;  3RH4 A;  1RYS A;  3PO5 A;  7ICL A;  1KFT A;  1ZQL A;  3B0Y A;  2R8K A;  8ICC A;  3H4D A;  3C5G A;  9ICN A;  2IHN A;  2JEG A;  3G6Y A;  2BKE A;  5CJ7 A;  3RB3 A;  1C7Y A;  5EOZ A;  3JPR A;  1D8L A;  1QSL A;  2IA6 A;  4KTQ A;  2BR0 A;  1D9F A;  4RT2 A;  1BPD A;  1UA0 A;  4RQ5 A;  4P4O A;  5KT2 A;  5KFF A;  1Z00 A;  4F50 A;  4Q43 A;  4DSE A;  3THV A;  2LYH A;  2KTQ A;  4E0D A;  3Q8R B;  4O5C A;  2J6S A;  3M9N B;  4F2R A;  8ICP A;  1JXE A;  2Y1I A;  7ICT A;  4O3S A;  7ICS A;  4F91 B;  2B21 A;  4IQW A;  4RQ4 A;  1Z3E B;  5KFJ A;  5DDY A;  4BXO B;  4DL7 A;  5KFV A;  3C2L A;  5J0R A;  7ICH A;  5J2F A;  3BQ0 A;  5DG9 A;  1D8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...