2JZBA

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
total genus 17
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbA00
7ICHA 4UQGA 5KFXA 4KLHA 4QZAA 2ATLA 1EXNA 4PGQA 3V72A 3C2MA 3THVA 2R8IA 4KLTA 2F1JA 5DBCA 3M8SA 3GV7B 1X9SA 1CUKA 4P4PA 1RXWA 8ICRA 2FMSA 3K4GA 3UXOA 5J0WA 2JZBA 3PX6A 2AU0A 1SKRA 4O3RA 4KLDA 5TZVA 2FLLA 1NJWA 4DL7A 2I9GA 7ICSA 1ZQVA 1L5UA 2RDJA 2P6RA 4I29A 2J6UA 4EBDA 1Z00A 1KFTA 4C8OA 3HWTA 2Y1JA 3PVXA 4KLEA 4PHPA 1RPLA 3RR7A 5J0QA 1KTQA 4J9RA 2GWSA 1MC8A 1Z00B 4DSLA 2BGWA 4F5NA 4NLGA 2W9CA 5EWEA 3V7KA 4F4YA 4J9NA 4ECSA 3FDSA 2BPGA 2IHMA 2R8GA 1ZQHA 2BR0A 5DB9A 3EPIA 1K1SA 4C8MA 3JPNA 1ZETA 4M9JA 4Q8EA 2BCUA 4RNNA 2W9CB 1KFSA 4RQ5A 4RT2A 5J29A 3V6JA 1IXRA 8ICFA 4HYKA 5DKWA 1TK0A 4M6WA 5KG7A 1KRPA 9ICMA 9ICOA 4ZH4A 4YP3A 1ZQIA 4F2RA 4R64A 4DOCA 2DFLA 2J6TA 5KG1A 4YR0A 7ICOA 2BCRA 2P6UA 1QLNA 4JV1A 3ORYA 1BPYA 2A1JA 4QZGA 4ECYA 4P4MA 4R8UA 1XWLA 1S0OA 4DQPA 7ICEA 8ICWA 4QZFA 4ED1A 2HVIA 2HW3A 4XA5A 3MABA 4YXMA 5BOLA 2ZTEA 2NRTA 1HJPA 5KFYA 5J2BA 5KFFA 4O3PA 4QZBA 4QWEA 3HP6A 3RR8A 5KFDA 2C2EA 4R8UB 4ED6A 5DB7A 4B9UA 4NM1A 5IIOA 4DSFA 4KLOA 4Z6CA 4DFPA 3NGDA 3UQ2A 3TAPA 3ZDDA 5DDMA 4P4OA 2Q0ZX 3ZDCA 3Q8LA 5J2JA 5CR0A 3PR5B 1SL0A 4I2JA 3BQ2A 1A76A 8ICXA 2FPMA 4KN4A 4YR2A 4CCHA 5KFVA 8ICZA 2ZUBA 3UQ0A 1ZQKA 8ICNA 4RPZA 3ISDA 4YMNA 4DQSA 4RZRA 3V7JA 3N97B 3IHQB 4J9KA 1S10A 3TQ1A 2OWOA 1S77D 5BPCA 2W8KA 1TKDA 2KFNA 1NJYA 3RB3A 4YG2A 2PFQA 4UAYA 2PXIA 1U48A 4NLZA 4O3NA 5KTQA 5KT3A 1ZQOA 3IM1A 4EZ9A 4DS4A 4Q44A 4KLJA 4F5OA 1C7YA 4KLUA 4I2EA 3ISCA 1S9FA 5KT7A 4KLSA 5HMMA 3Q8SB 2JEGA 1WCLA 2AGPA 2JEIA 5KFWA 3G6YA 8ICLA 4M2YA 4F5QA 2VA3A 1AROP 2XGQA 4RQ0A 4DSEA 4GC7A 8ICPA 4MF8A 4RQ8A 5J0YA 3V6KA 1JMSA 1LV5A 2UVRA 9ICXA 1B22A 4RNMA 2XO7A 1COOA 7ICFA 4IR1A 5KG6A 3E2EA 1XO1A 4F2SA 9ICHA 2IMWP 1JX4A 1ZQQA 3H40A 4J9PA 9ICUA 4RQ4A 1JXLA 3PO5A 4Q43A 9ICLA 3MGHA 9ICBA 4JK1A 5JUMA 3RB4A 1SKSA 4YD1A 1SL1A 2KFZA 4QWCA 5IIKA 3RJFA 4KLQA 1ZQXA 2IHNA 4QZIA 4YMMA 1MQ3A 1KFDA 4F4XA 4ECTA 1HUZA 7ICVA 3MFHA 5J0XA 4UAWA 5KT2A 2W9BA 4M0AA 3MGIA 5J2FA 4YMOA 3OSPA 8ICEA 3T3FA 5KT5A 1ZQFA 4LVSA 3T5KA 1NK0A 2ZJ5A 4K4IA 4K4HA 3ZDEA 3K75D 2W9BB 4XRHA 5KFIA 4RQ2A 3PW0A 4NLKA 5KT6A 4YD2A 4YQWA 4MFFA 4RNOA 3JPOA 4RQ6A 4RPXA 3EZ5A 1N48A 2NRZA 4ECUA 4YR3A 3RH5A 1ZQDA 9ICAA 4ED2A 4B9SA 4UB5A 4UB3A 3RJIA 2BPFA 4DSIA 3PMNA 5EOZA 5KG3A 3ISBA 4DL6A 1QSLA 2P66A 1NOMA 4O5EA 5CHGA 3MDCA 3OSNA 4F4WA 1ZQUA 2JZBB 2HHUA 3H4DA 8ICVA 2M9NA 2HHXA 1D9FA 2B21A 7ICPA 7ICUA 5KG5A 3H8SA 5KFEA 1X9WA 1ZQWA 3PW7A 5BOMA 4PHEA 3MFIA 3SV4A 5L1LA 2AQ0A 4NXZA 1MSWD 8ICKA 5CJ7A 1NKBA 8ICUA 2W8LA 5D46A 1V9PA 1K1QA 1NK8A 7ICIA 4I2DA 4IR9A 9ICCA 4I2IA 3C2LA 4F91B 4RQ7A 3G6XA 2WTFA 2HHSA 2HHQA 1L3SA 2KN7A 4O3SA 3RBDA 5EWGA 1ZQBA 3T5JA 1Y88A 5J0OA 3BJYA 4ED7A 2FMQA 4PHDA 3EWAA 4R65A 4XQ8A 4M6WB 3H7IA 4F50A 5DG7A 3JPTA 4QW8A 3LDAA 4PGXA 5DGAA 3OJUA 4DLEA 1XSNA 1B43A 1NK9A 4QZ9A 5KFPA 5J2GA 1D8LA 5J2CA 5IIMA 1NK7A 5J0PA 4I28A 3M9NB 2C2RA 1S0MA 5KFAA 4QW9A 4F93B 8ICQA 8ICHA 1N56A 3JPRA 2FLPA 9ICPA 2A1JB 3C2KA 2Y1IA 4JV0A 5KFTA 4B9TA 5KFCA 3EYZA 3MR6A 4DL2A 2HVHA 1HUOA 2BQRA 4TQRA 4J9SA 4F5RA 3RJEA 4UAZA 4PHAA 3C5FA 4UBCA 4ECZA 3MR2A 5C5JA 9ICFA 4GC6A 4IRKA 1ZJNA 5KFRA 5DBBA 4ED0A 5J2IA 2DPJA 2C22A 2LYHA 4UB4A 2ASJA 1NJZA 4DL3A 4B9VA 4KLGA 4MFCA 3PW5A 3GV5B 4TQSA 1T3NA 4YFKA 3HW8A 1CEZA 3GDXA 1BPZA 4M9HA 4QWAA 5KFZA 4Q8FA 9ICGA 4PPXA 4DFKA 3H8JA 1JN3A 3QZ7A 2XY5A 8ICOA 4NM2A 3PMLA 4EYIB 1UA1A 4J9OA 4DLGA 4G3IA 8ICYA 5KG4A 2VANA 4B9MA 2V9WA 3RRHA 4KTQA 1T4GA 2PI4A 3RJGA 4QWBA 4J9MA 4FS2A 3AU2A 3MBYA 4O9MA 3C1ZA 1T7PA 1KLNA 5DG8A 2IBKA 1ZQNA 1UT8A 1U49A 5J2KA 4I2CA 2BPCA 4DL4A 3QEAZ 3UXPA 4KN7A 1ZYQA 5DQIA 5IIJA 8ICJA 2KZ3A 1Z3EB 4IQTA 2AQ4A 9ICIA 3PV8A 5IIIA 3C1YA 5DGBA 4F3OA 5L1KA 2KTQA 1LB2B 1TK8A 4DEZA 2ASLA 2JEFA 1SZPA 4Z6FA 4DOAA 4NLNA 5KFHA 4QZCA 4MF2A 7ICLA 1KEJA 4EEYA 5J2EA 4ECXA 1UA0A 1A77A 4RT3A 1ZJMA 3OJSA 7ICRA 8ICGA 4QWDA 1DGSA 1NKCA 1ZQJA 5IILA 2MUTA 4QZEA 8ICAA 4EBCA 3TFRA 2J6SA 3EW9A 1L3UA 4KLFA 1D8YA 3AU6A 5DDYA 4C8LA 7ICNA 3PO4A 4IRDA 2MAXA 2NRVA 4R63A 1L3VA 4DFJA 3SYZA 1TFRA 2MUTB 1PZNA 3BQ0A 3Q8MA 5HNKA 2BKEA 5KFQA 4DQRA 4ECWA 2R8HA 4X5VA 5KFKA 4DL5A 3RRGA 1ZQCA 1XC9A 2XCPA 1ZQLA 3GFKB 3RAXA 4J9LA 3UPQA 3GQCA 1TV9A 1D9DA 5J0TA 3Q8KA 5KFOA 3KHHA 3T5HA 1ZQTA 7ICGA 3NTUA 1XSLA 2AGOA 4UB2A 1ZQMA 4C8KA 4O5CA 3N4MB 1RYRA 5D49A 4FO6A 2ZTDA 3HX0A 3TARA 7ICQA 3PW2A 4QZ8A 4DSKA 2F1IA 3C21A 3V7LA 4JUZA 1RXVA 1BPEA 1MQ2A 4RQ1A 1ZQGA 2FLNA 8ICCA 3T5LA 2PFPA 4KLIA 3LWMA 1WCNA 3Q8QB 4DS5A 4BWMA 2XGPA 4ELVA 4BXOA 4K4GA 4KLLA 3ETLA 3RTVA 5DQHA 2PFNA 1TK5A 1S0VA 3EPGA 3TI0A 3BQ1A 3QEBZ 2PI5A 4IQVA 3KTQA 3KHGA 3M8RA 4BXOB 4FBUA 3JPSA 2AJQA 3QE9Y 8ICMA 4DF8A 5L1IA 2ALZA 5HHHA 2JEJA 1KDHA 4GXJA 1NK4A 2BCVA 3PX4A 3TFSA 4DWIA 4Z6EA 4LZGA 2NRWA 4TURA 3RBEA 5KFSA 1ZQYA 4BGDA 4FS1A 2ZJAA 1UT5A 4NY8A 1X2IA 3OGUA 1TAUA 4F8RA 1RZTA 4Z6DA 2H5XA 3KHLA 2DPIA 2UVVA 5HHIA 9ICSA 5DB6A 5KFMA 4ECQA 4TUQA 4PH5A 4M47A 5J0RA 1U45A 4KLMA 5D4BA 2KZMA 4RU9A 9ICWA 4O0IA 3RB6A 5EWFA 1NK6A 3RB0A 3LK9A 3LWLA 3SI8A 4ED3A 2ISOA 3Q8RB 4JWNA 1XU4A 3PX0A 4LZDA 1ZQRA 3C23A 2ZJ8A 4I27A 5DB8A 4DO9A 1T8EA 3ZDBA 5F9LA 2IA6A 4UB1A 2NRXA 4B9NA 4KMUA 9ICTA 3BDPA 2ZUCA 2HHWA 2XY6A 1BPDA 1JIHA 2XY7A 3UXNA 4F4ZA 1TVAA 4ELUA 9ICRA 5DBAA 3TANA 8ICSA 1X9MA 9ICEA 1QTMA 1NJXA 5DLGA 2FMPA 4YXJA 4MFAA 2V4RA 4DF4A 4O5KA 4I2HA 3FYHA 4M9NA 4RPYA 4YN4A 4TUPA 5CA7A 1QSYA 2HHTA 9ICJA 3Q8PB 3GIJA 4IQWA 3H8WA 3BQTA 3H4BA 5KFBA 1JXEA 4J9QA 2FPKA 2BQ3A 1SKWA 1BGXT 5KG2A 3MR5A 4F4KA 2PFOA 3RJKA 2ZTCA 1IM4A 5CWRA 4B9LA 4M9LA 5KFLA 2UVUA 2R8JA 1XSPA 1BVSA 3KHRA 3HPOA 2C2DA 3PNCA 5DLFA 4DQQA 7ICJA 3RH6A 4M9GA 1U4BA 3PR4A 5L9XA 3ZD8A 2KZZA 2XCAA 2W9AA 3QZ8A 4EYHB 1BPXA 1ZQPA 4MEYA 4GXKA 1NKEA 9ICNA 3JPPA 7ICMA 3GIKA 1S76D 5DQGA 4KITB 2I1QA 4F5PA 4E0DA 5J0UA 4PGYA 5KFGA 4Q45A 3MDAA 5HMLA 2F1HA 5KFJA 3RH4A 5KFNA 2BQUA 4DQIA 4DSJA 4F92B 3M9OB 3GV8B 4IQUA 2UVWA 1XS9D 1S0NA 8ICTA 3MR3A 2HHVA 5KG0A 4R66A 3RJJA 4XUSA 5KT4A 4O3OA 1TAQA 5CP2A 1ZQZA 2VA8A 3ZDAA 1KSPA 7ICTA 2W9MA 4ELTA 4ED8A 4I2FA 2ZUDA 2RDIA 4GLXA 4EZ6A 2BCSA 5F9NA 4I2BA 4IRCA 5L1JA 4M04A 4GXIA 4FBTA 3PY8A 2BDPA 4JWMA 1ZQEA 1NK5A 9ICQA 1SL2A 2ASDA 4MEXA 3SZ2A 3GIIA 9ICKA 2AGQA 3GIMA 4UBBA 1L3TA 3B0YA 4P2HA 1S97A 4RQ3A 1ZQSA 8ICBA 1QSSA 5KFUA 8ICIA 4ECRA 9ICVA 2V4QA 1RYSA 7ICKA 4JV2A 4RUCA 4YCXA 1DOQA 4QZDA 4QZHA 4ECVA 5IINA 3HT3A 3SV3A 3ZD9A 3OHBA 4BWJA 2BCQA 2C28A 4RUAA 1H38A 5J0SA 5J2AA 4TUSA 1BPBA 3C5GA 1ZQAA 4DOBA 1U9LA 3V6HA 4I2AA 4C8NA 3RJHA 2XC9A 5J2DA 3OHAA 3RAQA 1U47A 3G6VA 5J2HA 4DFMA 3TAQA 2VA2A 4YVZA 4EBEA 2R8KA 2BHNA 3M9MB 2FPLA 3B0XA 2ISPA 4BDPA 4I2GA 5CB1A 5HP4A 5DG9A 3PW4A 3GILA 3JPQA 4O3QA 3AUOA
chains in the Genus database with same CATH superfamily
7ICHA 4UQGA 2ATLA 3THVA 4KLTA 2EANA 2F1JA 3TADC 5DBCA 4OJPA 4P4PA 8ICRA 2FMSA 2JZBA 2E8MA 5AKLA 4KLDA 4DL7A 1ZQ1C 7ICSA 2LM1A 2QB0A 2RDJA 2P6RA 1F0MA 4KLEA 2LM4A 1BNOA 1RPLA 1RQLA 3RR7A 4NLGA 2KHQA 2R8GA 4ECSA 2Z7JA 3EPIA 4C8MA 2HOIA 5AM1A 4M9JA 1KFSA 2W9CB 5AKIA 4RQ5A 4RT2A 4C0ZA 5J29A 3V6JA 4HYKA 2H3FA 5DKWA 5KG7A 2A3VA 9ICOA 4R64A 5AK4A 2DFLA 4Y2PA 3SAHA 2RQ5A 5ALZA 1IIPA 2HBMA 1BPYA 2A1JA 4QZGA 2HVIA 4YXMA 4QWEA 3HJEA 2RP5A 4R8UB 2Y0SC 1QCKA 4DSFA 4KLOA 5DDMA 5J2JA 2JMGA 2ZIWA 3BQ2A 5KFVA 2ZUBA 1WUDA 4RPZA 3IHQB 5KL8B 1S77D 2ZIUA 2DBYA 1NJYA 3RB3A 1U48A 4NLZA 5KT3A 5AM5A 4KLUA 3ISCA 2ZIVB 3Q8SB 3UMCA 2JEIA 2VA3A 3TADA 4DSEA 4IC9A 4RQ8A 2EZZA 9ICXA 4NWIA 2XO7A 2OCEA 4IR1A 5KG6A 1NNLA 2IMWP 2YTUA 1ZQQA 3H40A 3O0FA 5B5EU 4OD0A 9ICUA 1JXLA 3PO5A 1JRPA 2DKXA 4QJFB 1RG6A 1SL1A 2F8KA 4KLQA 4Y2TA 1MQ3A 4ECTA 1HUZA 3MFHA 5AI8A 5KT2A 3CW2C 2JGAA 5J2FA 4YMOA 1N2XA 4NLKA 2W9BB 4RQ2A 5KT6A 4YQWA 4RNOA 1X6IA 9ICAA 4B9SA 1VJ5A 4UB5A 5KG3A 3MDCA 2JZBB 5ALYA 8ICVA 3J81j 7ICPA 5KG5A 2LBOA 1X9WA 5BOMA 2AQ0A 1MSWD 5CJ7A 3AMZA 2NO5A 1V9PA 2F3NA 3B9JA 2WTFA 2KN7A 5EWGA 1N62A 3N7PD 3UMGA 1Y88A 3BJYA 3T5JA 2LHTA 5EE3A 4R65A 5DG7A 3H7IA 4J03A 4QW8A 3LDAA 3EUB2 3OJUA 2EAOA 2C2RA 1S0MA 3S6JA 4F93B 3NRWA 2G5HB 2A1JB 1A0PA 4JV0A 1DK3A 3EYZA 2HVHA 4F5RA 1PVQA 3RJEA 5ALDA 2WF5A 2YN4A 4IRKA 2DPJA 4DCCA 4UB4A 2ASJA 5ALKA 4KLGA 2E3TA 5AIAA 3GV5B 5GTIU 3HW8A 3SR6A 4CF5A 3GDXA 4M9HA 4Q8FA 5KFZA 4UW9A 3SQIA 8ICOA 3A0HU 1UA1A 4NV0A 5KG4A 2VANA 4KTQA 2XI9A 1T4GA 4QWBA 4O9MA 1YZ7A 3ZI4A 3OPXA 1UT8A 4FZMA 5ALOA 1Z3EB 4IQTA 2AQ4A 2K4PA 2WF9A 5DGBA 5L1KA 2KTQA 2E5SA 2ZIXB 4DOAA 4NLBA 3ONNA 5ALIA 4QZCA 4KMOB 4ECXA 1KL9A 2D3DA 1ZJMA 2BDUA 2MUTA 2J6SA 3WKAA 4KLFA 2MAXA 1L3VA 1PZNA 3Q8MA 1ZD3A 5KFQA 4ECWA 4X5VA 2HSZA 1ZQCA 1ZQLA 3GFKB 1D9DA 2KP7A 3T5HA 3T79A 4AP9A 4DSKA 2F1IA 4C4TA 5ALWA 4PJ0U 3Q8QB 1NZBA 4DS5A 1DGJA 3RTVA 2PFNA 3IDWA 2CXYA 1S0VA 4JMUA 3EPGA 3BQ1A 3TI0A 1VDVA 4IQVA 3M8RA 4FBUA 3JPSA 2AJQA 3QE9Y 4DF8A 5L1IA 4Z6EA 2NRWA 3QUTA 5KL1B 5KFSA 1ZQYA 1SV4A 2H5XA 3IP4B 3HKZF 3KHLA 2DPIA 3NVWA 2UVVA 3PZPA 4PH5A 2RRDA 3E0FA 4RU9A 9ICWA 3AN1A 4UAVA 3RB0A 2ISOA 3LVVA 1ZQRA 2RLTA 2K8CB 4EELA 4Y2UA 2KHVA 4PL2A 2DQNB 5AKZA 2HHWA 2XY6A 2WB1F 2XY7A 8ICSA 1RDFA 3WKEA 3KD3A 2FMPA 4MFAA 2V4RA 4RPYA 2HHTA 2CPRA 3GIJA 4J9QA 3H8WA 1L5UA 1SKWA 5KG2A 1XSPA 2EDUA 5KAIU 4EENA 4DQQA 2HCFA 4M9GA 3I1YA 3QZ8A 1BPXA 1S5LU 1WWUA 5KFGA 2QARB 5HMLA 3RH4A 3WK4A 4DQIA 3M9OB 1XS9D 1S0NA 5T14A 1TAQA 3H8MA 4ED8A 2ZUDA 4EZ6A 2BCSA 2KKVA 1PK1A 4M04A 2W04A 4FBTA 5G5HA 3PY8A 4JWMA 4KX5A 3QU9A 2BZFA 2PMZF 8ICBA 9ICVA 4CE6A 3HILA 2V4QA 2W3SA 1DOQA 4QZDA 4QZHA 4NLCA 2E8PA 1Q3UA 4RUAA 4TUSA 1BPBA 4AYBC 2XC9A 3G6VA 4EBEA 3VCBA 2FPLA 1T8EA 1EXNA 4PGQA 2R8IA 3R9KA 3M8SA 3K4GA 3UXOA 4US8A 5HR7A 2HI0A 4O3RA 1NJWA 2G07A 4MHVA 4U7CA 2WAQF 4EBDA 5J0QA 1ZD4A 1MC8A 2W9CA 2IHMA 2BPGA 2BR0A 5DB9A 4OO1J 4UB8U 1K1SA 1ZETA 1MN8A 2BCUA 2W03A 1IXRA 1TK0A 4WJ3B 4CF3A 9ICMA 5ALTA 2J6TA 5KG1A 4YR0A 5AKEA 4JV1A 1UQVA 3QU2A 4R8UA 1XWLA 7ICEA 3NASA 4QZFA 2HW3A 5AKHA 2NRTA 1HJPA 5KFFA 3PSTA 5KFDA 5DB7A 4Z6CA 2W7OA 2RHFA 4DFPA 3UQ2A 3AQEA 3ZDCA 2KVCA 3Q8LA 1V97A 3PR5B 2D6FC 4I2JA 4KN4A 8ICNA 2MU2A 4YMNA 2HBLA 3V7JA 3TQ1A 5BPCA 4UAYA 1L7NA 1X66A 4KLJA 3SAFA 5HMMA 1WCLA 4O3MA 2AGPA 5AK3A 2XGQA 2GLEA 2UVRA 1B22A 1L6NA 1COOA 1UPHA 2KSOB 2YY6A 1ZXIA 2VJ4A 9ICLA 9ICBA 4JK1A 4A8EA 1SKSA 2KFZA 4QWCA 4QZIA 2CRXA 3WK9A 3FC4A 1Q3VA 2W9BA 1URJA 2MRLA 3OSPA 1ZQFA 4LVSA 2ZJ5A 2KKPA 4K4HA 4XRHA 5KFIA 3PW0A 1KFTA 2AH5A 4MFFA 4RQ6A 4RPXA 3EZ5A 2NRZA 3MC1A 4ED2A 3E58A 1JI7A 2P66A 3PSIA 4F4WA 2HHUA 4CNQA 3H4DA 2YMMA 2HHXA 5AK6A 1L8LA 1ZRNA 1O03A 1ZD2P 8ICUA 1UHUA 5D46A 1CRXA 7ICIA 3OTQA 4I2DA 4IR9A 2DKZA 3FAHA 3RBDA 5J0OA 4ED7A 2KJ5A 2XVTA 3H0LB 4XQ8A 2YB1A 3JPTA 2QB1A 4PGXA 2JEFA 4QZ9A 5J2GA 1VLBA 1DXSA 5KFAA 9ICPA 1N56A 2Y1IA 4B9TA 2IOHA 4J9SA 9ICFA 1ZJNA 5KFRA 5J2IA 1NJZA 3PW5A 4TQSA 1T3NA 3L5KA 4QWAA 2FJ6A 4DFKA 3H8JA 4BUGA 2K89A 1JN3A 4ICAA 4J9OA 4DLGA 3DEEA 2V9WA 3RRHA 4J9MA 3AU2A 3M6ZA 1T7PA 1KLNA 2EAPA 5DG8A 4I2CA 1TAMA 4DL4A 1QQ7A 4GIBA 1ZYQA 1SIJA 2ZIXA 3IG8A 5IIJA 3NVYA 9ICIA 3C1YA 4F3OA 4DEZA 4Z6FA 3TACB 4OJLA 3PSPA 4MF2A 1PK3A 4EEYA 3WK6A 4RT3A 2OXOA 3OJSA 7ICRA 1ECWA 4Y2JA 5IILA 4QZEA 5JRTA 2KNJA 1L3UA 4Y2XA 3SENA 3PO4A 4IRDA 1FEZA 2NRVA 3BQ0A 1SWVA 5HNKA 2Y0SF 2BKEA 4DQRA 1XC9A 4J9LA 3UPQA 3GQCA 1TV9A 5KFOA 3KHHA 3M1YA 1XSLA 4UB2A 2JV3A 5D49A 4FO6A 2ZTDA 3PW2A 4QZ8A 3C21A 4KX3A 1M6YA 1N5WA 2VKQA 3T5LA 4KLIA 3VC8A 2HBKA 2XGPA 4ELVA 1SGGA 5EE9A 4GFJA 1TK5A 3KTQA 2WF8A 3KHGA 4BXOB 5AKJA 3TFSA 1KBUA 5AI5A 2Q4TA 3KKAA 4QNLA 4BGDA 3ICXA 1UT5A 3PSFA 2HOQA 1ED1A 5AM0A 5DB6A 2A19A 1U45A 1L8OA 5D4BA 3RB6A 2K8BB 4JWNA 4F72A 5E79U 1XU4A 5F9LA 2IA6A 9ICTA 2NRXA 1LKYB 3BDPA 2KOBA 3UXNA 4F4ZA 1TVAA 3TANA 2O6KA 1X9MA 1QTMA 5AI4A 2HDOA 2QKQA 4IQWA 3H4BA 4BJQA 1B4FA 2BQ3A 1N63A 9ICJA 2EH9A 3QXGA 3C28A 4M9LA 2R8JA 1BVSA 3HPOA 2C2DA 4BX9C 3PNCA 5DLFA 7ICJA 2ZXHA 2QARA 1SZHA 2XCAA 3DDHA 4EYHB 4GXKA 1S76D 4KITB 4PGYA 5J0UA 4Q45A 2FDRA 2BQUA 1ZD5A 3D2QA 4F92B 2UVWA 1SB3C 8ICTA 3MR3A 5KG0A 4R66A 2G06A 2P35A 3ZDAA 1KSPA 4ELTA 4GLXA 4CDGA 5F9NA 4P0QA 3AQFA 1ZQEA 2DGZA 3SZ2A 9ICKA 2AGQA 3GIMA 4UBBA 1UCVA 1QSSA 2F76X 1COKA 5AK5A 4YCXA 1JALA 4F71A 3HT3A 3SV3A 2NYVA 4FFDA 2BCQA 2H3ZA 2ESEA 5J2AA 5ALGA 4Y2RA 3V6HA 4I2AA 4C8NA 3RJHA 2WF6A 4CRXA 1JROA 3MGVA 5J2HA 4DFMA 3TAQA 4YVZA 2GO7A 2BHNA 3M9MB 4NL9A 5HP4A 3PW4A 2ASDA 8ICXA 3AUOA 2EZYA 4QZAA 3GV7B 1HIWA 5J0WA 1KW4A 3PX6A 2AU0A 3CNHA 5TZVA 2FLLA 2I9GA 2K8AA 4PZNA 1ZQVA 2J6UA 2H3IA 1F44A 3HWTA 3PVXA 4J9RA 1Z00B 2BGWA 4F5NA 4F4YA 3V7KA 4J9NA 2WHEA 1ZQHA 5AKGA 3JPNA 4Q8EA 4RNNA 8ICFA 4M6WA 1KRPA 3DV9A 5F3XB 4ZH4A 4YP3A 1ZQIA 4F2RA 2YMPA 1BNPA 2F8LA 2B0CA 2BCRA 2P6UA 1QLNA 2QLTA 3WK8A 3ORYA 2H3VA 2G0AA 4DQPA 8ICWA 1S0OA 1J2MA 3N7SC 2ZG6A 2G5IB 4ED1A 3WU2U 3MABA 7ICMA 4MFCA 2W7PA 5J2BA 4QZBA 4O3PA 3HP6A 3RR8A 4B9UA 2D8CA 3TAPA 5AHXA 4P4OA 2Q0ZX 3H0MB 5CR0A 3QYPA 2KJ9A 1SL0A 1A76A 5ALHA 2FPMA 4YR2A 4CCHA 4EX6A 3UQ0A 4NJ8A 1S10A 4PZOA 4J9KA 8ICMA 2W8KA 1TKDA 4YG2A 2PFQA 2PXIA 1YT3A 4O3NA 5KTQA 4ACOA 4EZ9A 3QU7A 4F5OA 4C4SA 1C7YA 5L1MA 4I2EA 1S9FA 3SAGA 1OXJA 5KT7A 2JEGA 1SXDA 5KFWA 3G6YA 3C29A 8ICLA 1GO3F 2ODGA 8ICPA 4MF8A 3TKAA 4DFDA 2KSOA 1JMSA 1LV5A 1N60A 1PVRA 4RNMA 4UAUA 7ICFA 4P0QB 2JHDA 3CRXA 2KIWA 9ICHA 4J9PA 3D2NA 4RQ4A 5B66U 4FE3A 5JUMA 3WK5A 1RQNA 5IIKA 4YMMA 1KFDA 2K4EA 4F4XA 3QUCA 3UMBA 1X40A 7ICVA 5AI9A 4UAWA 2OHFA 1SXEA 3F53A 4M0AA 4CF4A 8ICEA 3NVVA 4Y2YA 3K75D 3I76A 1N48A 1Z4NA 4ECUA 4YR3A 1ZQDA 4LJXA 4UB3A 3RJIA 5AI0A 2I5HA 3KBBA 4DL6A 1QQ5A 5CHGA 1ZQUA 1SV0A 2M9NA 5ALUA 4OCZA 2XICA 2B21A 7ICUA 4QIWC 2KK0A 5KFEA 2EQYA 3PW7A 1L7MA 3MFIA 5L1LA 4NXZA 8ICKA 1NKBA 3SMVA 1XO0A 1K1QA 9ICCA 3F2DA 3G6XA 2HHSA 2HHQA 4O3SA 1O08A 1ZQBA 3HRDD 4UASA 4M6WB 4DLEA 5KFPA 1NK7A 5J0PA 4I28A 4AYBF 4QW9A 3JPRA 3BZKA 5KFTA 4DL2A 1HUOA 2BQRA 3IRUA 4TQRA 4UAZA 2IOFA 2YB4A 4PHAA 2HMXA 4UBCA 5AI6A 5C5JA 2K4IA 3N7RC 2C22A 2LYHA 2KV2A 2JR5A 4YFKA 1DK2A 3QZ7A 2XY5A 4EYIB 5AM4A 4G3IA 8ICYA 2PKEA 4CGZA 1S8OA 3I28A 4UARA 2IBKA 1ZQNA 1U49A 5J2KA 3L3FX 3QEAZ 2W3RA 5DQIA 8ICJA 3UM9A 5IIIA 2KJ8A 5ALXA 2ASLA 4PL1A 2W55A 4NLNA 5KFHA 2GOLA 5J2EA 4US9A 2DWQA 8ICGA 1NKCA 1ZQJA 8ICAA 4EBCA 3TFRA 3EW9A 1D8YA 3AU6A 4C8LA 7ICNA 3AM9A 4DFJA 2W11A 2CN1A 2R8HA 1SWWA 4DL5A 2XCPA 3Q8KA 3NTUA 2AGOA 1ZQMA 3N4MB 2L5YA 3M6KA 3HX0A 3TARA 7ICQA 4FZLA 1RXVA 4JUZA 4UB6U 1MQ2A 2FLNA 8ICCA 4IL6U 1FO4A 2F2AB 2E1FA 4BXOA 4K4GA 4KLLA 3A0BU 1D8BA 3ETLA 5H2FU 5DQHA 1XNSA 1WYGA 5ALNA 5HHHA 2KIVA 2JEJA 2YQEA 1KDHA 1NK4A 3CYMA 2BCVA 4DWIA 4LZGA 2KD1A 4RQMA 2Y9TA 4C7ZA 2ZJAA 3OGUA 1TAUA 5HHIA 9ICSA 5KFMA 4ECQA 4TUQA 4M47A 4KLMA 2KZMA 3GZFA 4U6PA 1LKYA 5AM2A 3LK9A 4ED3A 3PX0A 4C4RA 4I27A 5DB8A 4DO9A 4B9NA 4KMUA 3ED5A 1BPDA 1JIHA 2I6XA 4ELUA 3F2BA 1AQ6A 9ICEA 1NJXA 2M0NA 2AXTU 5DLGA 4DF4A 4I2HA 3FYHA 4YN4A 5CA7A 3Q8PB 1OW5A 3BQTA 1BGXT 3RFAA 3MR5A 4F4KA 3KKAC 2ZTCA 5CWRA 4B9LA 5KFLA 2UVUA 5AKXA 3RH6A 4JB3A 3PR4A 5L9XA 3WK7A 5TISU 4MEYA 1Q46A 1NKEA 9ICNA 3JPPA 3GIKA 3F5AA 1L7OA 3MDAA 2F1HA 5KFJA 5KFNA 4DSJA 4FZNA 2B6GA 2HHVA 1N5XA 4OJOA 1ZQZA 2VA8A 3BZCA 4I2FA 2OH2A 1NZPA 1QH9A 1NK5A 9ICQA 1SL2A 1ZRMA 5CRXA 3GIIA 1L3TA 3WKCA 5KFUA 8ICIA 1RYSA 7ICKA 4JV2A 4RUCA 4ECVA 5IINA 5AICA 2HOFA 3ZD9A 4EX7A 3OHBA 4BWJA 2GH1A 2C28A 1JUDA 1L7PA 1WG8A 3C5GA 4DOBA 3KZXA 1U9LA 1ZQAA 4B6JA 2LKYA 5J2DA 3RAQA 1U47A 2OM6A 2R8KA 1FFVA 3B0XA 4I2GA 4BDPA 5DG9A 3GILA 3KFUF 5KFXA 4KLHA 3V72A 3C2MA 2JXJA 1RXWA 1X9SA 1CUKA 5HR6A 2MA1A 2E1EA 1SKRA 3RF9A 1V85A 4I29A 3LYSA 1Z00A 3QUBA 1C20A 3L4PA 4C8OA 3FM9A 2Y1JA 4PHPA 2QB0B 5JU5A 1KTQA 2GWSA 4DSLA 1TE2A 5EWEA 3FDSA 4OJ6A 3GU3A 5EE1A 1IV8A 2KMDA 2IOFK 1KQQA 1X6JA 4NL9C 3K1RB 2AHOB 4DOCA 7ICOA 3SEIA 3N28A 3IV6A 4ECYA 4P4MA 3F2CA 5ALEA 1P7DA 4XA5A 3K1ZA 2G09A 2ZTEA 5KFYA 5BOLA 3C2LA 2C2EA 4HAIA 4ED6A 4NM1A 5IIOA 5CEHA 3NGDA 3ZDDA 2E8OA 5ALVA 5G5GA 8ICZA 1ZQKA 2W43A 4P0PA 3ISDA 2OWOA 5ALMA 3WKDA 4RZRA 4DQSA 3N97B 2KFNA 1WWVA 2ZIWB 3IG5A 1Q8KA 1RYUA 2E8NA 1ZQOA 3IM1A 4DS4A 4Q44A 3D6JA 2ZIUB 1KN5A 4KLSA 2YMLA 3QX7A 1Z1BA 4M2YA 4EEKA 5ALJA 4F5QA 1AROP 4RQ0A 4GC7A 5J0YA 3V6KA 5KNIA 5ALPA 3E2EA 1XO1A 4F2SA 1JX4A 5AKYA 1Z1VA 5FP0A 3HKZC 4Q43A 5EE0A 3MGHA 3RB4A 4YD1A 2VJ5A 3NRZA 5ALLA 3RJFA 1ZQXA 2IHNA 3M7DA 2YMQA 4Y2SA 5J0XA 3BS7A 2W54A 3MGIA 2WF7A 3T3FA 5KT5A 2WB1C 3T5KA 5ALFA 1NK0A 4K4IA 4UATA 3ZDEA 2HBJA 3SD7A 1A6SA 4YD2A 3JPOA 1RM6C 5AM3A 3RH5A 3F5EA 2BPFA 4DSIA 3PMNA 5EOZA 1QSLA 3ISBA 1NOMA 2LI6A 4O5EA 5JTIA 3OSNA 2H3QA 5AKKA 5GTHU 1D9FA 3QUQA 3H8SA 3AEVA 2K60A 1ZQWA 4PHEA 3SV4A 2W8LA 4RQNA 1NK8A 1PUZA 4I2IA 4F91B 4RQ7A 1L3SA 2LYAA 1X42A 1F5SA 2XIDA 2FE9A 2FMQA 4PHDA 3EWAA 4F50A 1FFUA 2N1RA 5DGAA 4Y2VA 1NK9A 1XSNA 1B43A 2KEYA 1D8LA 5J2CA 5IIMA 2EAMA 3M9NB 8ICHA 8ICQA 1B0XA 2FLPA 2PMZC 3CP8A 3C2KA 1SV0C 5KFCA 3MR6A 2KE7A 3C5FA 4ECZA 3MR2A 4GC6A 5DBBA 4ED0A 1T3QA 5ALRA 1OUQA 4DL3A 4B9VA 4IS7A 3KZIU 1CEZA 1BPZA 5C0YA 9ICGA 4PPXA 4P0PB 2EZXA 4NM2A 3PMLA 4B9MA 2PI4A 3RJGA 4FS2A 3MBYA 3C1ZA 5ALQA 1KKXA 4USAA 2BPCA 3UXPA 4KN7A 3U26A 2KZ3A 2WAQC 2K4HA 5KAFU 3PV8A 1LB2B 3NS1A 1TK8A 1SZPA 3KOOA 3QU4A 7ICLA 1NI3A 1KEJA 1UA0A 1A77A 4QWDA 1DGSA 2JRZA 2LYBA 2DF4B 2WFAA 2DUYA 5DDYA 3QNMA 2ZXIA 1IG6A 4R63A 3SYZA 1TFRA 2MUTB 2KG5A 1QQ6A 2ES6A 5KFKA 2KVSA 3H0RB 3RRGA 3RAXA 3BS5A 3NUQA 1HEKA 5J0TA 7ICGA 1ZQTA 2JH7A 4O5CA 4C8KA 1RYRA 3WKBA 4OJ5A 1T94A 3V7LA 1BPEA 1ZQGA 4RQ1A 2KICA 2PFPA 3LWMA 1WCNA 4BWMA 5J8YC 5ALSA 3QEBZ 2PI5A 4C80A 2OYYA 1N61A 1Z19A 2ALZA 2YX8A 4GXJA 3PX4A 3LVWA 2FI1A 1K5OA 4TURA 3RBEA 3IN5A 4FS1A 5AIBA 4NY8A 1X2IA 4F8RA 1RZTA 4Z6DA 5J0RA 5A0LA 4O0IA 1X9XA 5EWFA 1NK6A 3LWLA 3SI8A 3Q8RB 2OEHA 4LZDA 3C23A 2ZJ8A 3ZDBA 4UB1A 2ZUCA 9ICRA 5DBAA 4G9BA 4YXJA 2LMRA 4O5KA 2G08A 4M9NA 1QSYA 4TUPA 1PVPA 2NO4A 5KFBA 1JXEA 2FPKA 1J2NA 2PFOA 3RJKA 1IM4A 3AL0B 3ETRA 4C7YA 2R18A 3KHRA 4ZOHC 4QIWF 1U4BA 1MA7A 3ZD8A 2F77X 2KZZA 3NVZA 2W9AA 2DL0A 2MSNA 4Y2QA 1ZQPA 2A1AA 5DQGA 2I1QA 4F5PA 4E0DA 2ZIVA 2JH1A 1FIQA 3GV8B 4IQUA 3BQ7A 1CI4A 3RJJA 4XUSA 5CP2A 5KT4A 4O3OA 1V38A 3ALRA 7ICTA 2W9MA 5J8YA 2RDIA 4I2BA 4IRCA 5L1JA 1J97A 4GXIA 2BDPA 1YZ6A 4MEXA 3QU5A 3B0YA 1PK1B 1S97A 4P2HA 4RQ3A 1ZQSA 4ECRA 1ZOLA 2VIXA 5K4LA 1LVHA 1DRGA 2LPEA 1H38A 5J0SA 3BS5B 2Y9UA 3OHAA 2NV3A 2VA2A 3D2SA 2F44A 1Z4OA 2ISPA 5CB1A 3JPQA 4O3QA
chains in the Genus database with same CATH topology
7ICHA 4UQGA 5KFXA 4KLHA 4QZAA 2ATLA 1EXNA 4PGQA 3V72A 3C2MA 3THVA 2R8IA 4KLTA 2F1JA 5DBCA 3M8SA 3GV7B 1X9SA 1CUKA 4P4PA 1RXWA 8ICRA 2FMSA 3K4GA 3UXOA 5J0WA 2JZBA 3PX6A 2AU0A 1SKRA 4O3RA 4KLDA 5TZVA 2FLLA 1NJWA 4DL7A 2I9GA 7ICSA 1ZQVA 1L5UA 2RDJA 2P6RA 4I29A 2J6UA 4EBDA 1Z00A 1KFTA 4C8OA 3HWTA 2Y1JA 3PVXA 4KLEA 4PHPA 1RPLA 3RR7A 5J0QA 1KTQA 4J9RA 2GWSA 1MC8A 1Z00B 4DSLA 2BGWA 4F5NA 4NLGA 2W9CA 5EWEA 3V7KA 4F4YA 4J9NA 4ECSA 3FDSA 2BPGA 2IHMA 2R8GA 1ZQHA 2BR0A 5DB9A 3EPIA 1K1SA 4C8MA 3JPNA 1ZETA 4M9JA 4Q8EA 2BCUA 4RNNA 2W9CB 1KFSA 4RQ5A 4RT2A 5J29A 3V6JA 1IXRA 8ICFA 4HYKA 5DKWA 1TK0A 4M6WA 5KG7A 1KRPA 9ICMA 9ICOA 4ZH4A 4YP3A 1ZQIA 4F2RA 4R64A 4DOCA 2DFLA 2J6TA 5KG1A 4YR0A 7ICOA 2BCRA 2P6UA 1QLNA 4JV1A 3ORYA 1BPYA 2A1JA 4QZGA 4ECYA 4P4MA 4R8UA 1XWLA 1S0OA 4DQPA 7ICEA 8ICWA 4QZFA 4ED1A 2HVIA 2HW3A 4XA5A 3MABA 4YXMA 5BOLA 2ZTEA 2NRTA 1HJPA 5KFYA 5J2BA 5KFFA 4O3PA 4QZBA 4QWEA 3HP6A 3RR8A 5KFDA 2C2EA 4R8UB 4ED6A 5DB7A 4B9UA 4NM1A 5IIOA 4DSFA 4KLOA 4Z6CA 4DFPA 3NGDA 3UQ2A 3TAPA 3ZDDA 5DDMA 4P4OA 2Q0ZX 3ZDCA 3Q8LA 5J2JA 5CR0A 3PR5B 1SL0A 4I2JA 3BQ2A 1A76A 8ICXA 2FPMA 4KN4A 4YR2A 4CCHA 5KFVA 8ICZA 2ZUBA 3UQ0A 1ZQKA 8ICNA 4RPZA 3ISDA 4YMNA 4DQSA 4RZRA 3V7JA 3N97B 3IHQB 4J9KA 1S10A 3TQ1A 2OWOA 1S77D 5BPCA 2W8KA 1TKDA 2KFNA 1NJYA 3RB3A 4YG2A 2PFQA 4UAYA 2PXIA 1U48A 4NLZA 4O3NA 5KTQA 5KT3A 1ZQOA 3IM1A 4EZ9A 4DS4A 4Q44A 4KLJA 4F5OA 1C7YA 4KLUA 4I2EA 3ISCA 1S9FA 5KT7A 4KLSA 5HMMA 3Q8SB 2JEGA 1WCLA 2AGPA 2JEIA 5KFWA 3G6YA 8ICLA 4M2YA 4F5QA 2VA3A 1AROP 2XGQA 4RQ0A 4DSEA 4GC7A 8ICPA 4MF8A 4RQ8A 5J0YA 3V6KA 1JMSA 1LV5A 2UVRA 9ICXA 1B22A 4RNMA 2XO7A 1COOA 7ICFA 4IR1A 5KG6A 3E2EA 1XO1A 4F2SA 9ICHA 2IMWP 1JX4A 1ZQQA 3H40A 4J9PA 9ICUA 4RQ4A 1JXLA 3PO5A 4Q43A 9ICLA 3MGHA 9ICBA 4JK1A 5JUMA 3RB4A 1SKSA 4YD1A 1SL1A 2KFZA 4QWCA 5IIKA 3RJFA 4KLQA 1ZQXA 2IHNA 4QZIA 4YMMA 1MQ3A 1KFDA 4F4XA 4ECTA 1HUZA 7ICVA 3MFHA 5J0XA 4UAWA 5KT2A 2W9BA 4M0AA 3MGIA 5J2FA 4YMOA 3OSPA 8ICEA 3T3FA 5KT5A 1ZQFA 4LVSA 3T5KA 1NK0A 2ZJ5A 4K4IA 4K4HA 3ZDEA 3K75D 2W9BB 4XRHA 5KFIA 4RQ2A 3PW0A 4NLKA 5KT6A 4YD2A 4YQWA 4MFFA 4RNOA 3JPOA 4RQ6A 4RPXA 3EZ5A 1N48A 2NRZA 4ECUA 4YR3A 3RH5A 1ZQDA 9ICAA 4ED2A 4B9SA 4UB5A 4UB3A 3RJIA 2BPFA 4DSIA 3PMNA 5EOZA 5KG3A 3ISBA 4DL6A 1QSLA 2P66A 1NOMA 4O5EA 5CHGA 3MDCA 3OSNA 4F4WA 1ZQUA 2JZBB 2HHUA 3H4DA 8ICVA 2M9NA 2HHXA 1D9FA 2B21A 7ICPA 7ICUA 5KG5A 3H8SA 5KFEA 1X9WA 1ZQWA 3PW7A 5BOMA 4PHEA 3MFIA 3SV4A 5L1LA 2AQ0A 4NXZA 1MSWD 8ICKA 5CJ7A 1NKBA 8ICUA 2W8LA 5D46A 1V9PA 1K1QA 1NK8A 7ICIA 4I2DA 4IR9A 9ICCA 4I2IA 3C2LA 4F91B 4RQ7A 3G6XA 2WTFA 2HHSA 2HHQA 1L3SA 2KN7A 4O3SA 3RBDA 5EWGA 1ZQBA 3T5JA 1Y88A 5J0OA 3BJYA 4ED7A 2FMQA 4PHDA 3EWAA 4R65A 4XQ8A 4M6WB 3H7IA 4F50A 5DG7A 3JPTA 4QW8A 3LDAA 4PGXA 5DGAA 3OJUA 4DLEA 1XSNA 1B43A 1NK9A 4QZ9A 5KFPA 5J2GA 1D8LA 5J2CA 5IIMA 1NK7A 5J0PA 4I28A 3M9NB 2C2RA 1S0MA 5KFAA 4QW9A 4F93B 8ICQA 8ICHA 1N56A 3JPRA 2FLPA 9ICPA 2A1JB 3C2KA 2Y1IA 4JV0A 5KFTA 4B9TA 5KFCA 3EYZA 3MR6A 4DL2A 2HVHA 1HUOA 2BQRA 4TQRA 4J9SA 4F5RA 3RJEA 4UAZA 4PHAA 3C5FA 4UBCA 4ECZA 3MR2A 5C5JA 9ICFA 4GC6A 4IRKA 1ZJNA 5KFRA 5DBBA 4ED0A 5J2IA 2DPJA 2C22A 2LYHA 4UB4A 2ASJA 1NJZA 4DL3A 4B9VA 4KLGA 4MFCA 3PW5A 3GV5B 4TQSA 1T3NA 4YFKA 3HW8A 1CEZA 3GDXA 1BPZA 4M9HA 4QWAA 5KFZA 4Q8FA 9ICGA 4PPXA 4DFKA 3H8JA 1JN3A 3QZ7A 2XY5A 8ICOA 4NM2A 3PMLA 4EYIB 1UA1A 4J9OA 4DLGA 4G3IA 8ICYA 5KG4A 2VANA 4B9MA 2V9WA 3RRHA 4KTQA 1T4GA 2PI4A 3RJGA 4QWBA 4J9MA 4FS2A 3AU2A 3MBYA 4O9MA 3C1ZA 1T7PA 1KLNA 5DG8A 2IBKA 1ZQNA 1UT8A 1U49A 5J2KA 4I2CA 2BPCA 4DL4A 3QEAZ 3UXPA 4KN7A 1ZYQA 5DQIA 5IIJA 8ICJA 2KZ3A 1Z3EB 4IQTA 2AQ4A 9ICIA 3PV8A 5IIIA 3C1YA 5DGBA 4F3OA 5L1KA 2KTQA 1LB2B 1TK8A 4DEZA 2ASLA 2JEFA 1SZPA 4Z6FA 4DOAA 4NLNA 5KFHA 4QZCA 4MF2A 7ICLA 1KEJA 4EEYA 5J2EA 4ECXA 1UA0A 1A77A 4RT3A 1ZJMA 3OJSA 7ICRA 8ICGA 4QWDA 1DGSA 1NKCA 1ZQJA 5IILA 2MUTA 4QZEA 8ICAA 4EBCA 3TFRA 2J6SA 3EW9A 1L3UA 4KLFA 1D8YA 3AU6A 5DDYA 4C8LA 7ICNA 3PO4A 4IRDA 2MAXA 2NRVA 4R63A 1L3VA 4DFJA 3SYZA 1TFRA 2MUTB 1PZNA 3BQ0A 3Q8MA 5HNKA 2BKEA 5KFQA 4DQRA 4ECWA 2R8HA 4X5VA 5KFKA 4DL5A 3RRGA 1ZQCA 1XC9A 2XCPA 1ZQLA 3GFKB 3RAXA 4J9LA 3UPQA 3GQCA 1TV9A 1D9DA 5J0TA 3Q8KA 5KFOA 3KHHA 3T5HA 1ZQTA 7ICGA 3NTUA 1XSLA 2AGOA 4UB2A 1ZQMA 4C8KA 4O5CA 3N4MB 1RYRA 5D49A 4FO6A 2ZTDA 3HX0A 3TARA 7ICQA 3PW2A 4QZ8A 4DSKA 2F1IA 3C21A 3V7LA 4JUZA 1RXVA 1BPEA 1MQ2A 4RQ1A 1ZQGA 2FLNA 8ICCA 3T5LA 2PFPA 4KLIA 3LWMA 1WCNA 3Q8QB 4DS5A 4BWMA 2XGPA 4ELVA 4BXOA 4K4GA 4KLLA 3ETLA 3RTVA 5DQHA 2PFNA 1TK5A 1S0VA 3EPGA 3TI0A 3BQ1A 3QEBZ 2PI5A 4IQVA 3KTQA 3KHGA 3M8RA 4BXOB 4FBUA 3JPSA 2AJQA 3QE9Y 8ICMA 4DF8A 5L1IA 2ALZA 5HHHA 2JEJA 1KDHA 4GXJA 1NK4A 2BCVA 3PX4A 3TFSA 4DWIA 4Z6EA 4LZGA 2NRWA 4TURA 3RBEA 5KFSA 1ZQYA 4BGDA 4FS1A 2ZJAA 1UT5A 4NY8A 1X2IA 3OGUA 1TAUA 4F8RA 1RZTA 4Z6DA 2H5XA 3KHLA 2DPIA 2UVVA 5HHIA 9ICSA 5DB6A 5KFMA 4ECQA 4TUQA 4PH5A 4M47A 5J0RA 1U45A 4KLMA 5D4BA 2KZMA 4RU9A 9ICWA 4O0IA 3RB6A 5EWFA 1NK6A 3RB0A 3LK9A 3LWLA 3SI8A 4ED3A 2ISOA 3Q8RB 4JWNA 1XU4A 3PX0A 4LZDA 1ZQRA 3C23A 2ZJ8A 4I27A 5DB8A 4DO9A 1T8EA 3ZDBA 5F9LA 2IA6A 4UB1A 2NRXA 4B9NA 4KMUA 9ICTA 3BDPA 2ZUCA 2HHWA 2XY6A 1BPDA 1JIHA 2XY7A 3UXNA 4F4ZA 1TVAA 4ELUA 9ICRA 5DBAA 3TANA 8ICSA 1X9MA 9ICEA 1QTMA 1NJXA 5DLGA 2FMPA 4YXJA 4MFAA 2V4RA 4DF4A 4O5KA 4I2HA 3FYHA 4M9NA 4RPYA 4YN4A 4TUPA 5CA7A 1QSYA 2HHTA 9ICJA 3Q8PB 3GIJA 4IQWA 3H8WA 3BQTA 3H4BA 5KFBA 1JXEA 4J9QA 2FPKA 2BQ3A 1SKWA 1BGXT 5KG2A 3MR5A 4F4KA 2PFOA 3RJKA 2ZTCA 1IM4A 5CWRA 4B9LA 4M9LA 5KFLA 2UVUA 2R8JA 1XSPA 1BVSA 3KHRA 3HPOA 2C2DA 3PNCA 5DLFA 4DQQA 7ICJA 3RH6A 4M9GA 1U4BA 3PR4A 5L9XA 3ZD8A 2KZZA 2XCAA 2W9AA 3QZ8A 4EYHB 1BPXA 1ZQPA 4MEYA 4GXKA 1NKEA 9ICNA 3JPPA 7ICMA 3GIKA 1S76D 5DQGA 4KITB 2I1QA 4F5PA 4E0DA 5J0UA 4PGYA 5KFGA 4Q45A 3MDAA 5HMLA 2F1HA 5KFJA 3RH4A 5KFNA 2BQUA 4DQIA 4DSJA 4F92B 3M9OB 3GV8B 4IQUA 2UVWA 1XS9D 1S0NA 8ICTA 3MR3A 2HHVA 5KG0A 4R66A 3RJJA 4XUSA 5KT4A 4O3OA 1TAQA 5CP2A 1ZQZA 2VA8A 3ZDAA 1KSPA 7ICTA 2W9MA 4ELTA 4ED8A 4I2FA 2ZUDA 2RDIA 4GLXA 4EZ6A 2BCSA 5F9NA 4I2BA 4IRCA 5L1JA 4M04A 4GXIA 4FBTA 3PY8A 2BDPA 4JWMA 1ZQEA 1NK5A 9ICQA 1SL2A 2ASDA 4MEXA 3SZ2A 3GIIA 9ICKA 2AGQA 3GIMA 4UBBA 1L3TA 3B0YA 4P2HA 1S97A 4RQ3A 1ZQSA 8ICBA 1QSSA 5KFUA 8ICIA 4ECRA 9ICVA 2V4QA 1RYSA 7ICKA 4JV2A 4RUCA 4YCXA 1DOQA 4QZDA 4QZHA 4ECVA 5IINA 3HT3A 3SV3A 3ZD9A 3OHBA 4BWJA 2BCQA 2C28A 4RUAA 1H38A 5J0SA 5J2AA 4TUSA 1BPBA 3C5GA 1ZQAA 4DOBA 1U9LA 3V6HA 4I2AA 4C8NA 3RJHA 2XC9A 5J2DA 3OHAA 3RAQA 1U47A 3G6VA 5J2HA 4DFMA 3TAQA 2VA2A 4YVZA 4EBEA 2R8KA 2BHNA 3M9MB 2FPLA 3B0XA 2ISPA 4BDPA 4I2GA 5CB1A 5HP4A 5DG9A 3PW4A 3GILA 3JPQA 4O3QA 3AUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICH A;  4UQG A;  5KFX A;  4KLH A;  4QZA A;  2ATL A;  1EXN A;  4PGQ A;  3V72 A;  3C2M A;  3THV A;  2R8I A;  4KLT A;  2F1J A;  5DBC A;  3M8S A;  3GV7 B;  1X9S A;  1CUK A;  4P4P A;  1RXW A;  8ICR A;  2FMS A;  3K4G A;  3UXO A;  5J0W A;  2JZB A;  3PX6 A;  2AU0 A;  1SKR A;  4O3R A;  4KLD A;  5TZV A;  2FLL A;  1NJW A;  4DL7 A;  2I9G A;  7ICS A;  1ZQV A;  1L5U A;  2RDJ A;  2P6R A;  4I29 A;  2J6U A;  4EBD A;  1Z00 A;  1KFT A;  4C8O A;  3HWT A;  2Y1J A;  3PVX A;  4KLE A;  4PHP A;  1RPL A;  3RR7 A;  5J0Q A;  1KTQ A;  4J9R A;  2GWS A;  1MC8 A;  1Z00 B;  4DSL A;  2BGW A;  4F5N A;  4NLG A;  2W9C A;  5EWE A;  3V7K A;  4F4Y A;  4J9N A;  4ECS A;  3FDS A;  2BPG A;  2IHM A;  2R8G A;  1ZQH A;  2BR0 A;  5DB9 A;  3EPI A;  1K1S A;  4C8M A;  3JPN A;  1ZET A;  4M9J A;  4Q8E A;  2BCU A;  4RNN A;  2W9C B;  1KFS A;  4RQ5 A;  4RT2 A;  5J29 A;  3V6J A;  1IXR A;  8ICF A;  4HYK A;  5DKW A;  1TK0 A;  4M6W A;  5KG7 A;  1KRP A;  9ICM A;  9ICO A;  4ZH4 A;  4YP3 A;  1ZQI A;  4F2R A;  4R64 A;  4DOC A;  2DFL A;  2J6T A;  5KG1 A;  4YR0 A;  7ICO A;  2BCR A;  2P6U A;  1QLN A;  4JV1 A;  3ORY A;  1BPY A;  2A1J A;  4QZG A;  4ECY A;  4P4M A;  4R8U A;  1XWL A;  1S0O A;  4DQP A;  7ICE A;  8ICW A;  4QZF A;  4ED1 A;  2HVI A;  2HW3 A;  4XA5 A;  3MAB A;  4YXM A;  5BOL A;  2ZTE A;  2NRT A;  1HJP A;  5KFY A;  5J2B A;  5KFF A;  4O3P A;  4QZB A;  4QWE A;  3HP6 A;  3RR8 A;  5KFD A;  2C2E A;  4R8U B;  4ED6 A;  5DB7 A;  4B9U A;  4NM1 A;  5IIO A;  4DSF A;  4KLO A;  4Z6C A;  4DFP A;  3NGD A;  3UQ2 A;  3TAP A;  3ZDD A;  5DDM A;  4P4O A;  2Q0Z X;  3ZDC A;  3Q8L A;  5J2J A;  5CR0 A;  3PR5 B;  1SL0 A;  4I2J A;  3BQ2 A;  1A76 A;  8ICX A;  2FPM A;  4KN4 A;  4YR2 A;  4CCH A;  5KFV A;  8ICZ A;  2ZUB A;  3UQ0 A;  1ZQK A;  8ICN A;  4RPZ A;  3ISD A;  4YMN A;  4DQS A;  4RZR A;  3V7J A;  3N97 B;  3IHQ B;  4J9K A;  1S10 A;  3TQ1 A;  2OWO A;  1S77 D;  5BPC A;  2W8K A;  1TKD A;  2KFN A;  1NJY A;  3RB3 A;  4YG2 A;  2PFQ A;  4UAY A;  2PXI A;  1U48 A;  4NLZ A;  4O3N A;  5KTQ A;  5KT3 A;  1ZQO A;  3IM1 A;  4EZ9 A;  4DS4 A;  4Q44 A;  4KLJ A;  4F5O A;  1C7Y A;  4KLU A;  4I2E A;  3ISC A;  1S9F A;  5KT7 A;  4KLS A;  5HMM A;  3Q8S B;  2JEG A;  1WCL A;  2AGP A;  2JEI A;  5KFW A;  3G6Y A;  8ICL A;  4M2Y A;  4F5Q A;  2VA3 A;  1ARO P;  2XGQ A;  4RQ0 A;  4DSE A;  4GC7 A;  8ICP A;  4MF8 A;  4RQ8 A;  5J0Y A;  3V6K A;  1JMS A;  1LV5 A;  2UVR A;  9ICX A;  1B22 A;  4RNM A;  2XO7 A;  1COO A;  7ICF A;  4IR1 A;  5KG6 A;  3E2E A;  1XO1 A;  4F2S A;  9ICH A;  2IMW P;  1JX4 A;  1ZQQ A;  3H40 A;  4J9P A;  9ICU A;  4RQ4 A;  1JXL A;  3PO5 A;  4Q43 A;  9ICL A;  3MGH A;  9ICB A;  4JK1 A;  5JUM A;  3RB4 A;  1SKS A;  4YD1 A;  1SL1 A;  2KFZ A;  4QWC A;  5IIK A;  3RJF A;  4KLQ A;  1ZQX A;  2IHN A;  4QZI A;  4YMM A;  1MQ3 A;  1KFD A;  4F4X A;  4ECT A;  1HUZ A;  7ICV A;  3MFH A;  5J0X A;  4UAW A;  5KT2 A;  2W9B A;  4M0A A;  3MGI A;  5J2F A;  4YMO A;  3OSP A;  8ICE A;  3T3F A;  5KT5 A;  1ZQF A;  4LVS A;  3T5K A;  1NK0 A;  2ZJ5 A;  4K4I A;  4K4H A;  3ZDE A;  3K75 D;  2W9B B;  4XRH A;  5KFI A;  4RQ2 A;  3PW0 A;  4NLK A;  5KT6 A;  4YD2 A;  4YQW A;  4MFF A;  4RNO A;  3JPO A;  4RQ6 A;  4RPX A;  3EZ5 A;  1N48 A;  2NRZ A;  4ECU A;  4YR3 A;  3RH5 A;  1ZQD A;  9ICA A;  4ED2 A;  4B9S A;  4UB5 A;  4UB3 A;  3RJI A;  2BPF A;  4DSI A;  3PMN A;  5EOZ A;  5KG3 A;  3ISB A;  4DL6 A;  1QSL A;  2P66 A;  1NOM A;  4O5E A;  5CHG A;  3MDC A;  3OSN A;  4F4W A;  1ZQU A;  2JZB B;  2HHU A;  3H4D A;  8ICV A;  2M9N A;  2HHX A;  1D9F A;  2B21 A;  7ICP A;  7ICU A;  5KG5 A;  3H8S A;  5KFE A;  1X9W A;  1ZQW A;  3PW7 A;  5BOM A;  4PHE A;  3MFI A;  3SV4 A;  5L1L A;  2AQ0 A;  4NXZ A;  1MSW D;  8ICK A;  5CJ7 A;  1NKB A;  8ICU A;  2W8L A;  5D46 A;  1V9P A;  1K1Q A;  1NK8 A;  7ICI A;  4I2D A;  4IR9 A;  9ICC A;  4I2I A;  3C2L A;  4F91 B;  4RQ7 A;  3G6X A;  2WTF A;  2HHS A;  2HHQ A;  1L3S A;  2KN7 A;  4O3S A;  3RBD A;  5EWG A;  1ZQB A;  3T5J A;  1Y88 A;  5J0O A;  3BJY A;  4ED7 A;  2FMQ A;  4PHD A;  3EWA A;  4R65 A;  4XQ8 A;  4M6W B;  3H7I A;  4F50 A;  5DG7 A;  3JPT A;  4QW8 A;  3LDA A;  4PGX A;  5DGA A;  3OJU A;  4DLE A;  1XSN A;  1B43 A;  1NK9 A;  4QZ9 A;  5KFP A;  5J2G A;  1D8L A;  5J2C A;  5IIM A;  1NK7 A;  5J0P A;  4I28 A;  3M9N B;  2C2R A;  1S0M A;  5KFA A;  4QW9 A;  4F93 B;  8ICQ A;  8ICH A;  1N56 A;  3JPR A;  2FLP A;  9ICP A;  2A1J B;  3C2K A;  2Y1I A;  4JV0 A;  5KFT A;  4B9T A;  5KFC A;  3EYZ A;  3MR6 A;  4DL2 A;  2HVH A;  1HUO A;  2BQR A;  4TQR A;  4J9S A;  4F5R A;  3RJE A;  4UAZ A;  4PHA A;  3C5F A;  4UBC A;  4ECZ A;  3MR2 A;  5C5J A;  9ICF A;  4GC6 A;  4IRK A;  1ZJN A;  5KFR A;  5DBB A;  4ED0 A;  5J2I A;  2DPJ A;  2C22 A;  2LYH A;  4UB4 A;  2ASJ A;  1NJZ A;  4DL3 A;  4B9V A;  4KLG A;  4MFC A;  3PW5 A;  3GV5 B;  4TQS A;  1T3N A;  4YFK A;  3HW8 A;  1CEZ A;  3GDX A;  1BPZ A;  4M9H A;  4QWA A;  5KFZ A;  4Q8F A;  9ICG A;  4PPX A;  4DFK A;  3H8J A;  1JN3 A;  3QZ7 A;  2XY5 A;  8ICO A;  4NM2 A;  3PML A;  4EYI B;  1UA1 A;  4J9O A;  4DLG A;  4G3I A;  8ICY A;  5KG4 A;  2VAN A;  4B9M A;  2V9W A;  3RRH A;  4KTQ A;  1T4G A;  2PI4 A;  3RJG A;  4QWB A;  4J9M A;  4FS2 A;  3AU2 A;  3MBY A;  4O9M A;  3C1Z A;  1T7P A;  1KLN A;  5DG8 A;  2IBK A;  1ZQN A;  1UT8 A;  1U49 A;  5J2K A;  4I2C A;  2BPC A;  4DL4 A;  3QEA Z;  3UXP A;  4KN7 A;  1ZYQ A;  5DQI A;  5IIJ A;  8ICJ A;  2KZ3 A;  1Z3E B;  4IQT A;  2AQ4 A;  9ICI A;  3PV8 A;  5III A;  3C1Y A;  5DGB A;  4F3O A;  5L1K A;  2KTQ A;  1LB2 B;  1TK8 A;  4DEZ A;  2ASL A;  2JEF A;  1SZP A;  4Z6F A;  4DOA A;  4NLN A;  5KFH A;  4QZC A;  4MF2 A;  7ICL A;  1KEJ A;  4EEY A;  5J2E A;  4ECX A;  1UA0 A;  1A77 A;  4RT3 A;  1ZJM A;  3OJS A;  7ICR A;  8ICG A;  4QWD A;  1DGS A;  1NKC A;  1ZQJ A;  5IIL A;  2MUT A;  4QZE A;  8ICA A;  4EBC A;  3TFR A;  2J6S A;  3EW9 A;  1L3U A;  4KLF A;  1D8Y A;  3AU6 A;  5DDY A;  4C8L A;  7ICN A;  3PO4 A;  4IRD A;  2MAX A;  2NRV A;  4R63 A;  1L3V A;  4DFJ A;  3SYZ A;  1TFR A;  2MUT B;  1PZN A;  3BQ0 A;  3Q8M A;  5HNK A;  2BKE A;  5KFQ A;  4DQR A;  4ECW A;  2R8H A;  4X5V A;  5KFK A;  4DL5 A;  3RRG A;  1ZQC A;  1XC9 A;  2XCP A;  1ZQL A;  3GFK B;  3RAX A;  4J9L A;  3UPQ A;  3GQC A;  1TV9 A;  1D9D A;  5J0T A;  3Q8K A;  5KFO A;  3KHH A;  3T5H A;  1ZQT A;  7ICG A;  3NTU A;  1XSL A;  2AGO A;  4UB2 A;  1ZQM A;  4C8K A;  4O5C A;  3N4M B;  1RYR A;  5D49 A;  4FO6 A;  2ZTD A;  3HX0 A;  3TAR A;  7ICQ A;  3PW2 A;  4QZ8 A;  4DSK A;  2F1I A;  3C21 A;  3V7L A;  4JUZ A;  1RXV A;  1BPE A;  1MQ2 A;  4RQ1 A;  1ZQG A;  2FLN A;  8ICC A;  3T5L A;  2PFP A;  4KLI A;  3LWM A;  1WCN A;  3Q8Q B;  4DS5 A;  4BWM A;  2XGP A;  4ELV A;  4BXO A;  4K4G A;  4KLL A;  3ETL A;  3RTV A;  5DQH A;  2PFN A;  1TK5 A;  1S0V A;  3EPG A;  3TI0 A;  3BQ1 A;  3QEB Z;  2PI5 A;  4IQV A;  3KTQ A;  3KHG A;  3M8R A;  4BXO B;  4FBU A;  3JPS A;  2AJQ A;  3QE9 Y;  8ICM A;  4DF8 A;  5L1I A;  2ALZ A;  5HHH A;  2JEJ A;  1KDH A;  4GXJ A;  1NK4 A;  2BCV A;  3PX4 A;  3TFS A;  4DWI A;  4Z6E A;  4LZG A;  2NRW A;  4TUR A;  3RBE A;  5KFS A;  1ZQY A;  4BGD A;  4FS1 A;  2ZJA A;  1UT5 A;  4NY8 A;  1X2I A;  3OGU A;  1TAU A;  4F8R A;  1RZT A;  4Z6D A;  2H5X A;  3KHL A;  2DPI A;  2UVV A;  5HHI A;  9ICS A;  5DB6 A;  5KFM A;  4ECQ A;  4TUQ A;  4PH5 A;  4M47 A;  5J0R A;  1U45 A;  4KLM A;  5D4B A;  2KZM A;  4RU9 A;  9ICW A;  4O0I A;  3RB6 A;  5EWF A;  1NK6 A;  3RB0 A;  3LK9 A;  3LWL A;  3SI8 A;  4ED3 A;  2ISO A;  3Q8R B;  4JWN A;  1XU4 A;  3PX0 A;  4LZD A;  1ZQR A;  3C23 A;  2ZJ8 A;  4I27 A;  5DB8 A;  4DO9 A;  1T8E A;  3ZDB A;  5F9L A;  2IA6 A;  4UB1 A;  2NRX A;  4B9N A;  4KMU A;  9ICT A;  3BDP A;  2ZUC A;  2HHW A;  2XY6 A;  1BPD A;  1JIH A;  2XY7 A;  3UXN A;  4F4Z A;  1TVA A;  4ELU A;  9ICR A;  5DBA A;  3TAN A;  8ICS A;  1X9M A;  9ICE A;  1QTM A;  1NJX A;  5DLG A;  2FMP A;  4YXJ A;  4MFA A;  2V4R A;  4DF4 A;  4O5K A;  4I2H A;  3FYH A;  4M9N A;  4RPY A;  4YN4 A;  4TUP A;  5CA7 A;  1QSY A;  2HHT A;  9ICJ A;  3Q8P B;  3GIJ A;  4IQW A;  3H8W A;  3BQT A;  3H4B A;  5KFB A;  1JXE A;  4J9Q A;  2FPK A;  2BQ3 A;  1SKW A;  1BGX T;  5KG2 A;  3MR5 A;  4F4K A;  2PFO A;  3RJK A;  2ZTC A;  1IM4 A;  5CWR A;  4B9L A;  4M9L A;  5KFL A;  2UVU A;  2R8J A;  1XSP A;  1BVS A;  3KHR A;  3HPO A;  2C2D A;  3PNC A;  5DLF A;  4DQQ A;  7ICJ A;  3RH6 A;  4M9G A;  1U4B A;  3PR4 A;  5L9X A;  3ZD8 A;  2KZZ A;  2XCA A;  2W9A A;  3QZ8 A;  4EYH B;  1BPX A;  1ZQP A;  4MEY A;  4GXK A;  1NKE A;  9ICN A;  3JPP A;  7ICM A;  3GIK A;  1S76 D;  5DQG A;  4KIT B;  2I1Q A;  4F5P A;  4E0D A;  5J0U A;  4PGY A;  5KFG A;  4Q45 A;  3MDA A;  5HML A;  2F1H A;  5KFJ A;  3RH4 A;  5KFN A;  2BQU A;  4DQI A;  4DSJ A;  4F92 B;  3M9O B;  3GV8 B;  4IQU A;  2UVW A;  1XS9 D;  1S0N A;  8ICT A;  3MR3 A;  2HHV A;  5KG0 A;  4R66 A;  3RJJ A;  4XUS A;  5KT4 A;  4O3O A;  1TAQ A;  5CP2 A;  1ZQZ A;  2VA8 A;  3ZDA A;  1KSP A;  7ICT A;  2W9M A;  4ELT A;  4ED8 A;  4I2F A;  2ZUD A;  2RDI A;  4GLX A;  4EZ6 A;  2BCS A;  5F9N A;  4I2B A;  4IRC A;  5L1J A;  4M04 A;  4GXI A;  4FBT A;  3PY8 A;  2BDP A;  4JWM A;  1ZQE A;  1NK5 A;  9ICQ A;  1SL2 A;  2ASD A;  4MEX A;  3SZ2 A;  3GII A;  9ICK A;  2AGQ A;  3GIM A;  4UBB A;  1L3T A;  3B0Y A;  4P2H A;  1S97 A;  4RQ3 A;  1ZQS A;  8ICB A;  1QSS A;  5KFU A;  8ICI A;  4ECR A;  9ICV A;  2V4Q A;  1RYS A;  7ICK A;  4JV2 A;  4RUC A;  4YCX A;  1DOQ A;  4QZD A;  4QZH A;  4ECV A;  5IIN A;  3HT3 A;  3SV3 A;  3ZD9 A;  3OHB A;  4BWJ A;  2BCQ A;  2C28 A;  4RUA A;  1H38 A;  5J0S A;  5J2A A;  4TUS A;  1BPB A;  3C5G A;  1ZQA A;  4DOB A;  1U9L A;  3V6H A;  4I2A A;  4C8N A;  3RJH A;  2XC9 A;  5J2D A;  3OHA A;  3RAQ A;  1U47 A;  3G6V A;  5J2H A;  4DFM A;  3TAQ A;  2VA2 A;  4YVZ A;  4EBE A;  2R8K A;  2BHN A;  3M9M B;  2FPL A;  3B0X A;  2ISP A;  4BDP A;  4I2G A;  5CB1 A;  5HP4 A;  5DG9 A;  3PW4 A;  3GIL A;  3JPQ A;  4O3Q A;  3AUO A; 
#chains in the Genus database with same CATH topology
 7ICH A;  4UQG A;  2ATL A;  3THV A;  4KLT A;  2EAN A;  2F1J A;  3TAD C;  5DBC A;  4OJP A;  4P4P A;  8ICR A;  2FMS A;  2JZB A;  2E8M A;  5AKL A;  4KLD A;  4DL7 A;  1ZQ1 C;  7ICS A;  2LM1 A;  2QB0 A;  2RDJ A;  2P6R A;  1F0M A;  4KLE A;  2LM4 A;  1BNO A;  1RPL A;  1RQL A;  3RR7 A;  4NLG A;  2KHQ A;  2R8G A;  4ECS A;  2Z7J A;  3EPI A;  4C8M A;  2HOI A;  5AM1 A;  4M9J A;  1KFS A;  2W9C B;  5AKI A;  4RQ5 A;  4RT2 A;  4C0Z A;  5J29 A;  3V6J A;  4HYK A;  2H3F A;  5DKW A;  5KG7 A;  2A3V A;  9ICO A;  4R64 A;  5AK4 A;  2DFL A;  4Y2P A;  3SAH A;  2RQ5 A;  5ALZ A;  1IIP A;  2HBM A;  1BPY A;  2A1J A;  4QZG A;  2HVI A;  4YXM A;  4QWE A;  3HJE A;  2RP5 A;  4R8U B;  2Y0S C;  1QCK A;  4DSF A;  4KLO A;  5DDM A;  5J2J A;  2JMG A;  2ZIW A;  3BQ2 A;  5KFV A;  2ZUB A;  1WUD A;  4RPZ A;  3IHQ B;  5KL8 B;  1S77 D;  2ZIU A;  2DBY A;  1NJY A;  3RB3 A;  1U48 A;  4NLZ A;  5KT3 A;  5AM5 A;  4KLU A;  3ISC A;  2ZIV B;  3Q8S B;  3UMC A;  2JEI A;  2VA3 A;  3TAD A;  4DSE A;  4IC9 A;  4RQ8 A;  2EZZ A;  9ICX A;  4NWI A;  2XO7 A;  2OCE A;  4IR1 A;  5KG6 A;  1NNL A;  2IMW P;  2YTU A;  1ZQQ A;  3H40 A;  3O0F A;  5B5E U;  4OD0 A;  9ICU A;  1JXL A;  3PO5 A;  1JRP A;  2DKX A;  4QJF B;  1RG6 A;  1SL1 A;  2F8K A;  4KLQ A;  4Y2T A;  1MQ3 A;  4ECT A;  1HUZ A;  3MFH A;  5AI8 A;  5KT2 A;  3CW2 C;  2JGA A;  5J2F A;  4YMO A;  1N2X A;  4NLK A;  2W9B B;  4RQ2 A;  5KT6 A;  4YQW A;  4RNO A;  1X6I A;  9ICA A;  4B9S A;  1VJ5 A;  4UB5 A;  5KG3 A;  3MDC A;  2JZB B;  5ALY A;  8ICV A;  3J81 j;  7ICP A;  5KG5 A;  2LBO A;  1X9W A;  5BOM A;  2AQ0 A;  1MSW D;  5CJ7 A;  3AMZ A;  2NO5 A;  1V9P A;  2F3N A;  3B9J A;  2WTF A;  2KN7 A;  5EWG A;  1N62 A;  3N7P D;  3UMG A;  1Y88 A;  3BJY A;  3T5J A;  2LHT A;  5EE3 A;  4R65 A;  5DG7 A;  3H7I A;  4J03 A;  4QW8 A;  3LDA A;  3EUB 2;  3OJU A;  2EAO A;  2C2R A;  1S0M A;  3S6J A;  4F93 B;  3NRW A;  2G5H B;  2A1J B;  1A0P A;  4JV0 A;  1DK3 A;  3EYZ A;  2HVH A;  4F5R A;  1PVQ A;  3RJE A;  5ALD A;  2WF5 A;  2YN4 A;  4IRK A;  2DPJ A;  4DCC A;  4UB4 A;  2ASJ A;  5ALK A;  4KLG A;  2E3T A;  5AIA A;  3GV5 B;  5GTI U;  3HW8 A;  3SR6 A;  4CF5 A;  3GDX A;  4M9H A;  4Q8F A;  5KFZ A;  4UW9 A;  3SQI A;  8ICO A;  3A0H U;  1UA1 A;  4NV0 A;  5KG4 A;  2VAN A;  4KTQ A;  2XI9 A;  1T4G A;  4QWB A;  4O9M A;  1YZ7 A;  3ZI4 A;  3OPX A;  1UT8 A;  4FZM A;  5ALO A;  1Z3E B;  4IQT A;  2AQ4 A;  2K4P A;  2WF9 A;  5DGB A;  5L1K A;  2KTQ A;  2E5S A;  2ZIX B;  4DOA A;  4NLB A;  3ONN A;  5ALI A;  4QZC A;  4KMO B;  4ECX A;  1KL9 A;  2D3D A;  1ZJM A;  2BDU A;  2MUT A;  2J6S A;  3WKA A;  4KLF A;  2MAX A;  1L3V A;  1PZN A;  3Q8M A;  1ZD3 A;  5KFQ A;  4ECW A;  4X5V A;  2HSZ A;  1ZQC A;  1ZQL A;  3GFK B;  1D9D A;  2KP7 A;  3T5H A;  3T79 A;  4AP9 A;  4DSK A;  2F1I A;  4C4T A;  5ALW A;  4PJ0 U;  3Q8Q B;  1NZB A;  4DS5 A;  1DGJ A;  3RTV A;  2PFN A;  3IDW A;  2CXY A;  1S0V A;  4JMU A;  3EPG A;  3BQ1 A;  3TI0 A;  1VDV A;  4IQV A;  3M8R A;  4FBU A;  3JPS A;  2AJQ A;  3QE9 Y;  4DF8 A;  5L1I A;  4Z6E A;  2NRW A;  3QUT A;  5KL1 B;  5KFS A;  1ZQY A;  1SV4 A;  2H5X A;  3IP4 B;  3HKZ F;  3KHL A;  2DPI A;  3NVW A;  2UVV A;  3PZP A;  4PH5 A;  2RRD A;  3E0F A;  4RU9 A;  9ICW A;  3AN1 A;  4UAV A;  3RB0 A;  2ISO A;  3LVV A;  1ZQR A;  2RLT A;  2K8C B;  4EEL A;  4Y2U A;  2KHV A;  4PL2 A;  2DQN B;  5AKZ A;  2HHW A;  2XY6 A;  2WB1 F;  2XY7 A;  8ICS A;  1RDF A;  3WKE A;  3KD3 A;  2FMP A;  4MFA A;  2V4R A;  4RPY A;  2HHT A;  2CPR A;  3GIJ A;  4J9Q A;  3H8W A;  1L5U A;  1SKW A;  5KG2 A;  1XSP A;  2EDU A;  5KAI U;  4EEN A;  4DQQ A;  2HCF A;  4M9G A;  3I1Y A;  3QZ8 A;  1BPX A;  1S5L U;  1WWU A;  5KFG A;  2QAR B;  5HML A;  3RH4 A;  3WK4 A;  4DQI A;  3M9O B;  1XS9 D;  1S0N A;  5T14 A;  1TAQ A;  3H8M A;  4ED8 A;  2ZUD A;  4EZ6 A;  2BCS A;  2KKV A;  1PK1 A;  4M04 A;  2W04 A;  4FBT A;  5G5H A;  3PY8 A;  4JWM A;  4KX5 A;  3QU9 A;  2BZF A;  2PMZ F;  8ICB A;  9ICV A;  4CE6 A;  3HIL A;  2V4Q A;  2W3S A;  1DOQ A;  4QZD A;  4QZH A;  4NLC A;  2E8P A;  1Q3U A;  4RUA A;  4TUS A;  1BPB A;  4AYB C;  2XC9 A;  3G6V A;  4EBE A;  3VCB A;  2FPL A;  1T8E A;  1EXN A;  4PGQ A;  2R8I A;  3R9K A;  3M8S A;  3K4G A;  3UXO A;  4US8 A;  5HR7 A;  2HI0 A;  4O3R A;  1NJW A;  2G07 A;  4MHV A;  4U7C A;  2WAQ F;  4EBD A;  5J0Q A;  1ZD4 A;  1MC8 A;  2W9C A;  2IHM A;  2BPG A;  2BR0 A;  5DB9 A;  4OO1 J;  4UB8 U;  1K1S A;  1ZET A;  1MN8 A;  2BCU A;  2W03 A;  1IXR A;  1TK0 A;  4WJ3 B;  4CF3 A;  9ICM A;  5ALT A;  2J6T A;  5KG1 A;  4YR0 A;  5AKE A;  4JV1 A;  1UQV A;  3QU2 A;  4R8U A;  1XWL A;  7ICE A;  3NAS A;  4QZF A;  2HW3 A;  5AKH A;  2NRT A;  1HJP A;  5KFF A;  3PST A;  5KFD A;  5DB7 A;  4Z6C A;  2W7O A;  2RHF A;  4DFP A;  3UQ2 A;  3AQE A;  3ZDC A;  2KVC A;  3Q8L A;  1V97 A;  3PR5 B;  2D6F C;  4I2J A;  4KN4 A;  8ICN A;  2MU2 A;  4YMN A;  2HBL A;  3V7J A;  3TQ1 A;  5BPC A;  4UAY A;  1L7N A;  1X66 A;  4KLJ A;  3SAF A;  5HMM A;  1WCL A;  4O3M A;  2AGP A;  5AK3 A;  2XGQ A;  2GLE A;  2UVR A;  1B22 A;  1L6N A;  1COO A;  1UPH A;  2KSO B;  2YY6 A;  1ZXI A;  2VJ4 A;  9ICL A;  9ICB A;  4JK1 A;  4A8E A;  1SKS A;  2KFZ A;  4QWC A;  4QZI A;  2CRX A;  3WK9 A;  3FC4 A;  1Q3V A;  2W9B A;  1URJ A;  2MRL A;  3OSP A;  1ZQF A;  4LVS A;  2ZJ5 A;  2KKP A;  4K4H A;  4XRH A;  5KFI A;  3PW0 A;  1KFT A;  2AH5 A;  4MFF A;  4RQ6 A;  4RPX A;  3EZ5 A;  2NRZ A;  3MC1 A;  4ED2 A;  3E58 A;  1JI7 A;  2P66 A;  3PSI A;  4F4W A;  2HHU A;  4CNQ A;  3H4D A;  2YMM A;  2HHX A;  5AK6 A;  1L8L A;  1ZRN A;  1O03 A;  1ZD2 P;  8ICU A;  1UHU A;  5D46 A;  1CRX A;  7ICI A;  3OTQ A;  4I2D A;  4IR9 A;  2DKZ A;  3FAH A;  3RBD A;  5J0O A;  4ED7 A;  2KJ5 A;  2XVT A;  3H0L B;  4XQ8 A;  2YB1 A;  3JPT A;  2QB1 A;  4PGX A;  2JEF A;  4QZ9 A;  5J2G A;  1VLB A;  1DXS A;  5KFA A;  9ICP A;  1N56 A;  2Y1I A;  4B9T A;  2IOH A;  4J9S A;  9ICF A;  1ZJN A;  5KFR A;  5J2I A;  1NJZ A;  3PW5 A;  4TQS A;  1T3N A;  3L5K A;  4QWA A;  2FJ6 A;  4DFK A;  3H8J A;  4BUG A;  2K89 A;  1JN3 A;  4ICA A;  4J9O A;  4DLG A;  3DEE A;  2V9W A;  3RRH A;  4J9M A;  3AU2 A;  3M6Z A;  1T7P A;  1KLN A;  2EAP A;  5DG8 A;  4I2C A;  1TAM A;  4DL4 A;  1QQ7 A;  4GIB A;  1ZYQ A;  1SIJ A;  2ZIX A;  3IG8 A;  5IIJ A;  3NVY A;  9ICI A;  3C1Y A;  4F3O A;  4DEZ A;  4Z6F A;  3TAC B;  4OJL A;  3PSP A;  4MF2 A;  1PK3 A;  4EEY A;  3WK6 A;  4RT3 A;  2OXO A;  3OJS A;  7ICR A;  1ECW A;  4Y2J A;  5IIL A;  4QZE A;  5JRT A;  2KNJ A;  1L3U A;  4Y2X A;  3SEN A;  3PO4 A;  4IRD A;  1FEZ A;  2NRV A;  3BQ0 A;  1SWV A;  5HNK A;  2Y0S F;  2BKE A;  4DQR A;  1XC9 A;  4J9L A;  3UPQ A;  3GQC A;  1TV9 A;  5KFO A;  3KHH A;  3M1Y A;  1XSL A;  4UB2 A;  2JV3 A;  5D49 A;  4FO6 A;  2ZTD A;  3PW2 A;  4QZ8 A;  3C21 A;  4KX3 A;  1M6Y A;  1N5W A;  2VKQ A;  3T5L A;  4KLI A;  3VC8 A;  2HBK A;  2XGP A;  4ELV A;  1SGG A;  5EE9 A;  4GFJ A;  1TK5 A;  3KTQ A;  2WF8 A;  3KHG A;  4BXO B;  5AKJ A;  3TFS A;  1KBU A;  5AI5 A;  2Q4T A;  3KKA A;  4QNL A;  4BGD A;  3ICX A;  1UT5 A;  3PSF A;  2HOQ A;  1ED1 A;  5AM0 A;  5DB6 A;  2A19 A;  1U45 A;  1L8O A;  5D4B A;  3RB6 A;  2K8B B;  4JWN A;  4F72 A;  5E79 U;  1XU4 A;  5F9L A;  2IA6 A;  9ICT A;  2NRX A;  1LKY B;  3BDP A;  2KOB A;  3UXN A;  4F4Z A;  1TVA A;  3TAN A;  2O6K A;  1X9M A;  1QTM A;  5AI4 A;  2HDO A;  2QKQ A;  4IQW A;  3H4B A;  4BJQ A;  1B4F A;  2BQ3 A;  1N63 A;  9ICJ A;  2EH9 A;  3QXG A;  3C28 A;  4M9L A;  2R8J A;  1BVS A;  3HPO A;  2C2D A;  4BX9 C;  3PNC A;  5DLF A;  7ICJ A;  2ZXH A;  2QAR A;  1SZH A;  2XCA A;  3DDH A;  4EYH B;  4GXK A;  1S76 D;  4KIT B;  4PGY A;  5J0U A;  4Q45 A;  2FDR A;  2BQU A;  1ZD5 A;  3D2Q A;  4F92 B;  2UVW A;  1SB3 C;  8ICT A;  3MR3 A;  5KG0 A;  4R66 A;  2G06 A;  2P35 A;  3ZDA A;  1KSP A;  4ELT A;  4GLX A;  4CDG A;  5F9N A;  4P0Q A;  3AQF A;  1ZQE A;  2DGZ A;  3SZ2 A;  9ICK A;  2AGQ A;  3GIM A;  4UBB A;  1UCV A;  1QSS A;  2F76 X;  1COK A;  5AK5 A;  4YCX A;  1JAL A;  4F71 A;  3HT3 A;  3SV3 A;  2NYV A;  4FFD A;  2BCQ A;  2H3Z A;  2ESE A;  5J2A A;  5ALG A;  4Y2R A;  3V6H A;  4I2A A;  4C8N A;  3RJH A;  2WF6 A;  4CRX A;  1JRO A;  3MGV A;  5J2H A;  4DFM A;  3TAQ A;  4YVZ A;  2GO7 A;  2BHN A;  3M9M B;  4NL9 A;  5HP4 A;  3PW4 A;  2ASD A;  8ICX A;  3AUO A;  2EZY A;  4QZA A;  3GV7 B;  1HIW A;  5J0W A;  1KW4 A;  3PX6 A;  2AU0 A;  3CNH A;  5TZV A;  2FLL A;  2I9G A;  2K8A A;  4PZN A;  1ZQV A;  2J6U A;  2H3I A;  1F44 A;  3HWT A;  3PVX A;  4J9R A;  1Z00 B;  2BGW A;  4F5N A;  4F4Y A;  3V7K A;  4J9N A;  2WHE A;  1ZQH A;  5AKG A;  3JPN A;  4Q8E A;  4RNN A;  8ICF A;  4M6W A;  1KRP A;  3DV9 A;  5F3X B;  4ZH4 A;  4YP3 A;  1ZQI A;  4F2R A;  2YMP A;  1BNP A;  2F8L A;  2B0C A;  2BCR A;  2P6U A;  1QLN A;  2QLT A;  3WK8 A;  3ORY A;  2H3V A;  2G0A A;  4DQP A;  8ICW A;  1S0O A;  1J2M A;  3N7S C;  2ZG6 A;  2G5I B;  4ED1 A;  3WU2 U;  3MAB A;  7ICM A;  4MFC A;  2W7P A;  5J2B A;  4QZB A;  4O3P A;  3HP6 A;  3RR8 A;  4B9U A;  2D8C A;  3TAP A;  5AHX A;  4P4O A;  2Q0Z X;  3H0M B;  5CR0 A;  3QYP A;  2KJ9 A;  1SL0 A;  1A76 A;  5ALH A;  2FPM A;  4YR2 A;  4CCH A;  4EX6 A;  3UQ0 A;  4NJ8 A;  1S10 A;  4PZO A;  4J9K A;  8ICM A;  2W8K A;  1TKD A;  4YG2 A;  2PFQ A;  2PXI A;  1YT3 A;  4O3N A;  5KTQ A;  4ACO A;  4EZ9 A;  3QU7 A;  4F5O A;  4C4S A;  1C7Y A;  5L1M A;  4I2E A;  1S9F A;  3SAG A;  1OXJ A;  5KT7 A;  2JEG A;  1SXD A;  5KFW A;  3G6Y A;  3C29 A;  8ICL A;  1GO3 F;  2ODG A;  8ICP A;  4MF8 A;  3TKA A;  4DFD A;  2KSO A;  1JMS A;  1LV5 A;  1N60 A;  1PVR A;  4RNM A;  4UAU A;  7ICF A;  4P0Q B;  2JHD A;  3CRX A;  2KIW A;  9ICH A;  4J9P A;  3D2N A;  4RQ4 A;  5B66 U;  4FE3 A;  5JUM A;  3WK5 A;  1RQN A;  5IIK A;  4YMM A;  1KFD A;  2K4E A;  4F4X A;  3QUC A;  3UMB A;  1X40 A;  7ICV A;  5AI9 A;  4UAW A;  2OHF A;  1SXE A;  3F53 A;  4M0A A;  4CF4 A;  8ICE A;  3NVV A;  4Y2Y A;  3K75 D;  3I76 A;  1N48 A;  1Z4N A;  4ECU A;  4YR3 A;  1ZQD A;  4LJX A;  4UB3 A;  3RJI A;  5AI0 A;  2I5H A;  3KBB A;  4DL6 A;  1QQ5 A;  5CHG A;  1ZQU A;  1SV0 A;  2M9N A;  5ALU A;  4OCZ A;  2XIC A;  2B21 A;  7ICU A;  4QIW C;  2KK0 A;  5KFE A;  2EQY A;  3PW7 A;  1L7M A;  3MFI A;  5L1L A;  4NXZ A;  8ICK A;  1NKB A;  3SMV A;  1XO0 A;  1K1Q A;  9ICC A;  3F2D A;  3G6X A;  2HHS A;  2HHQ A;  4O3S A;  1O08 A;  1ZQB A;  3HRD D;  4UAS A;  4M6W B;  4DLE A;  5KFP A;  1NK7 A;  5J0P A;  4I28 A;  4AYB F;  4QW9 A;  3JPR A;  3BZK A;  5KFT A;  4DL2 A;  1HUO A;  2BQR A;  3IRU A;  4TQR A;  4UAZ A;  2IOF A;  2YB4 A;  4PHA A;  2HMX A;  4UBC A;  5AI6 A;  5C5J A;  2K4I A;  3N7R C;  2C22 A;  2LYH A;  2KV2 A;  2JR5 A;  4YFK A;  1DK2 A;  3QZ7 A;  2XY5 A;  4EYI B;  5AM4 A;  4G3I A;  8ICY A;  2PKE A;  4CGZ A;  1S8O A;  3I28 A;  4UAR A;  2IBK A;  1ZQN A;  1U49 A;  5J2K A;  3L3F X;  3QEA Z;  2W3R A;  5DQI A;  8ICJ A;  3UM9 A;  5III A;  2KJ8 A;  5ALX A;  2ASL A;  4PL1 A;  2W55 A;  4NLN A;  5KFH A;  2GOL A;  5J2E A;  4US9 A;  2DWQ A;  8ICG A;  1NKC A;  1ZQJ A;  8ICA A;  4EBC A;  3TFR A;  3EW9 A;  1D8Y A;  3AU6 A;  4C8L A;  7ICN A;  3AM9 A;  4DFJ A;  2W11 A;  2CN1 A;  2R8H A;  1SWW A;  4DL5 A;  2XCP A;  3Q8K A;  3NTU A;  2AGO A;  1ZQM A;  3N4M B;  2L5Y A;  3M6K A;  3HX0 A;  3TAR A;  7ICQ A;  4FZL A;  1RXV A;  4JUZ A;  4UB6 U;  1MQ2 A;  2FLN A;  8ICC A;  4IL6 U;  1FO4 A;  2F2A B;  2E1F A;  4BXO A;  4K4G A;  4KLL A;  3A0B U;  1D8B A;  3ETL A;  5H2F U;  5DQH A;  1XNS A;  1WYG A;  5ALN A;  5HHH A;  2KIV A;  2JEJ A;  2YQE A;  1KDH A;  1NK4 A;  3CYM A;  2BCV A;  4DWI A;  4LZG A;  2KD1 A;  4RQM A;  2Y9T A;  4C7Z A;  2ZJA A;  3OGU A;  1TAU A;  5HHI A;  9ICS A;  5KFM A;  4ECQ A;  4TUQ A;  4M47 A;  4KLM A;  2KZM A;  3GZF A;  4U6P A;  1LKY A;  5AM2 A;  3LK9 A;  4ED3 A;  3PX0 A;  4C4R A;  4I27 A;  5DB8 A;  4DO9 A;  4B9N A;  4KMU A;  3ED5 A;  1BPD A;  1JIH A;  2I6X A;  4ELU A;  3F2B A;  1AQ6 A;  9ICE A;  1NJX A;  2M0N A;  2AXT U;  5DLG A;  4DF4 A;  4I2H A;  3FYH A;  4YN4 A;  5CA7 A;  3Q8P B;  1OW5 A;  3BQT A;  1BGX T;  3RFA A;  3MR5 A;  4F4K A;  3KKA C;  2ZTC A;  5CWR A;  4B9L A;  5KFL A;  2UVU A;  5AKX A;  3RH6 A;  4JB3 A;  3PR4 A;  5L9X A;  3WK7 A;  5TIS U;  4MEY A;  1Q46 A;  1NKE A;  9ICN A;  3JPP A;  3GIK A;  3F5A A;  1L7O A;  3MDA A;  2F1H A;  5KFJ A;  5KFN A;  4DSJ A;  4FZN A;  2B6G A;  2HHV A;  1N5X A;  4OJO A;  1ZQZ A;  2VA8 A;  3BZC A;  4I2F A;  2OH2 A;  1NZP A;  1QH9 A;  1NK5 A;  9ICQ A;  1SL2 A;  1ZRM A;  5CRX A;  3GII A;  1L3T A;  3WKC A;  5KFU A;  8ICI A;  1RYS A;  7ICK A;  4JV2 A;  4RUC A;  4ECV A;  5IIN A;  5AIC A;  2HOF A;  3ZD9 A;  4EX7 A;  3OHB A;  4BWJ A;  2GH1 A;  2C28 A;  1JUD A;  1L7P A;  1WG8 A;  3C5G A;  4DOB A;  3KZX A;  1U9L A;  1ZQA A;  4B6J A;  2LKY A;  5J2D A;  3RAQ A;  1U47 A;  2OM6 A;  2R8K A;  1FFV A;  3B0X A;  4I2G A;  4BDP A;  5DG9 A;  3GIL A;  3KFU F;  5KFX A;  4KLH A;  3V72 A;  3C2M A;  2JXJ A;  1RXW A;  1X9S A;  1CUK A;  5HR6 A;  2MA1 A;  2E1E A;  1SKR A;  3RF9 A;  1V85 A;  4I29 A;  3LYS A;  1Z00 A;  3QUB A;  1C20 A;  3L4P A;  4C8O A;  3FM9 A;  2Y1J A;  4PHP A;  2QB0 B;  5JU5 A;  1KTQ A;  2GWS A;  4DSL A;  1TE2 A;  5EWE A;  3FDS A;  4OJ6 A;  3GU3 A;  5EE1 A;  1IV8 A;  2KMD A;  2IOF K;  1KQQ A;  1X6J A;  4NL9 C;  3K1R B;  2AHO B;  4DOC A;  7ICO A;  3SEI A;  3N28 A;  3IV6 A;  4ECY A;  4P4M A;  3F2C A;  5ALE A;  1P7D A;  4XA5 A;  3K1Z A;  2G09 A;  2ZTE A;  5KFY A;  5BOL A;  3C2L A;  2C2E A;  4HAI A;  4ED6 A;  4NM1 A;  5IIO A;  5CEH A;  3NGD A;  3ZDD A;  2E8O A;  5ALV A;  5G5G A;  8ICZ A;  1ZQK A;  2W43 A;  4P0P A;  3ISD A;  2OWO A;  5ALM A;  3WKD A;  4RZR A;  4DQS A;  3N97 B;  2KFN A;  1WWV A;  2ZIW B;  3IG5 A;  1Q8K A;  1RYU A;  2E8N A;  1ZQO A;  3IM1 A;  4DS4 A;  4Q44 A;  3D6J A;  2ZIU B;  1KN5 A;  4KLS A;  2YML A;  3QX7 A;  1Z1B A;  4M2Y A;  4EEK A;  5ALJ A;  4F5Q A;  1ARO P;  4RQ0 A;  4GC7 A;  5J0Y A;  3V6K A;  5KNI A;  5ALP A;  3E2E A;  1XO1 A;  4F2S A;  1JX4 A;  5AKY A;  1Z1V A;  5FP0 A;  3HKZ C;  4Q43 A;  5EE0 A;  3MGH A;  3RB4 A;  4YD1 A;  2VJ5 A;  3NRZ A;  5ALL A;  3RJF A;  1ZQX A;  2IHN A;  3M7D A;  2YMQ A;  4Y2S A;  5J0X A;  3BS7 A;  2W54 A;  3MGI A;  2WF7 A;  3T3F A;  5KT5 A;  2WB1 C;  3T5K A;  5ALF A;  1NK0 A;  4K4I A;  4UAT A;  3ZDE A;  2HBJ A;  3SD7 A;  1A6S A;  4YD2 A;  3JPO A;  1RM6 C;  5AM3 A;  3RH5 A;  3F5E A;  2BPF A;  4DSI A;  3PMN A;  5EOZ A;  1QSL A;  3ISB A;  1NOM A;  2LI6 A;  4O5E A;  5JTI A;  3OSN A;  2H3Q A;  5AKK A;  5GTH U;  1D9F A;  3QUQ A;  3H8S A;  3AEV A;  2K60 A;  1ZQW A;  4PHE A;  3SV4 A;  2W8L A;  4RQN A;  1NK8 A;  1PUZ A;  4I2I A;  4F91 B;  4RQ7 A;  1L3S A;  2LYA A;  1X42 A;  1F5S A;  2XID A;  2FE9 A;  2FMQ A;  4PHD A;  3EWA A;  4F50 A;  1FFU A;  2N1R A;  5DGA A;  4Y2V A;  1NK9 A;  1XSN A;  1B43 A;  2KEY A;  1D8L A;  5J2C A;  5IIM A;  2EAM A;  3M9N B;  8ICH A;  8ICQ A;  1B0X A;  2FLP A;  2PMZ C;  3CP8 A;  3C2K A;  1SV0 C;  5KFC A;  3MR6 A;  2KE7 A;  3C5F A;  4ECZ A;  3MR2 A;  4GC6 A;  5DBB A;  4ED0 A;  1T3Q A;  5ALR A;  1OUQ A;  4DL3 A;  4B9V A;  4IS7 A;  3KZI U;  1CEZ A;  1BPZ A;  5C0Y A;  9ICG A;  4PPX A;  4P0P B;  2EZX A;  4NM2 A;  3PML A;  4B9M A;  2PI4 A;  3RJG A;  4FS2 A;  3MBY A;  3C1Z A;  5ALQ A;  1KKX A;  4USA A;  2BPC A;  3UXP A;  4KN7 A;  3U26 A;  2KZ3 A;  2WAQ C;  2K4H A;  5KAF U;  3PV8 A;  1LB2 B;  3NS1 A;  1TK8 A;  1SZP A;  3KOO A;  3QU4 A;  7ICL A;  1NI3 A;  1KEJ A;  1UA0 A;  1A77 A;  4QWD A;  1DGS A;  2JRZ A;  2LYB A;  2DF4 B;  2WFA A;  2DUY A;  5DDY A;  3QNM A;  2ZXI A;  1IG6 A;  4R63 A;  3SYZ A;  1TFR A;  2MUT B;  2KG5 A;  1QQ6 A;  2ES6 A;  5KFK A;  2KVS A;  3H0R B;  3RRG A;  3RAX A;  3BS5 A;  3NUQ A;  1HEK A;  5J0T A;  7ICG A;  1ZQT A;  2JH7 A;  4O5C A;  4C8K A;  1RYR A;  3WKB A;  4OJ5 A;  1T94 A;  3V7L A;  1BPE A;  1ZQG A;  4RQ1 A;  2KIC A;  2PFP A;  3LWM A;  1WCN A;  4BWM A;  5J8Y C;  5ALS A;  3QEB Z;  2PI5 A;  4C80 A;  2OYY A;  1N61 A;  1Z19 A;  2ALZ A;  2YX8 A;  4GXJ A;  3PX4 A;  3LVW A;  2FI1 A;  1K5O A;  4TUR A;  3RBE A;  3IN5 A;  4FS1 A;  5AIB A;  4NY8 A;  1X2I A;  4F8R A;  1RZT A;  4Z6D A;  5J0R A;  5A0L A;  4O0I A;  1X9X A;  5EWF A;  1NK6 A;  3LWL A;  3SI8 A;  3Q8R B;  2OEH A;  4LZD A;  3C23 A;  2ZJ8 A;  3ZDB A;  4UB1 A;  2ZUC A;  9ICR A;  5DBA A;  4G9B A;  4YXJ A;  2LMR A;  4O5K A;  2G08 A;  4M9N A;  1QSY A;  4TUP A;  1PVP A;  2NO4 A;  5KFB A;  1JXE A;  2FPK A;  1J2N A;  2PFO A;  3RJK A;  1IM4 A;  3AL0 B;  3ETR A;  4C7Y A;  2R18 A;  3KHR A;  4ZOH C;  4QIW F;  1U4B A;  1MA7 A;  3ZD8 A;  2F77 X;  2KZZ A;  3NVZ A;  2W9A A;  2DL0 A;  2MSN A;  4Y2Q A;  1ZQP A;  2A1A A;  5DQG A;  2I1Q A;  4F5P A;  4E0D A;  2ZIV A;  2JH1 A;  1FIQ A;  3GV8 B;  4IQU A;  3BQ7 A;  1CI4 A;  3RJJ A;  4XUS A;  5CP2 A;  5KT4 A;  4O3O A;  1V38 A;  3ALR A;  7ICT A;  2W9M A;  5J8Y A;  2RDI A;  4I2B A;  4IRC A;  5L1J A;  1J97 A;  4GXI A;  2BDP A;  1YZ6 A;  4MEX A;  3QU5 A;  3B0Y A;  1PK1 B;  1S97 A;  4P2H A;  4RQ3 A;  1ZQS A;  4ECR A;  1ZOL A;  2VIX A;  5K4L A;  1LVH A;  1DRG A;  2LPE A;  1H38 A;  5J0S A;  3BS5 B;  2Y9U A;  3OHA A;  2NV3 A;  2VA2 A;  3D2S A;  2F44 A;  1Z4O A;  2ISP A;  5CB1 A;  3JPQ A;  4O3Q A; 
#chains in the Genus database with same CATH homology
 7ICH A;  4UQG A;  5KFX A;  4KLH A;  4QZA A;  2ATL A;  1EXN A;  4PGQ A;  3V72 A;  3C2M A;  3THV A;  2R8I A;  4KLT A;  2F1J A;  5DBC A;  3M8S A;  3GV7 B;  1X9S A;  1CUK A;  4P4P A;  1RXW A;  8ICR A;  2FMS A;  3K4G A;  3UXO A;  5J0W A;  2JZB A;  3PX6 A;  2AU0 A;  1SKR A;  4O3R A;  4KLD A;  5TZV A;  2FLL A;  1NJW A;  4DL7 A;  2I9G A;  7ICS A;  1ZQV A;  1L5U A;  2RDJ A;  2P6R A;  4I29 A;  2J6U A;  4EBD A;  1Z00 A;  1KFT A;  4C8O A;  3HWT A;  2Y1J A;  3PVX A;  4KLE A;  4PHP A;  1RPL A;  3RR7 A;  5J0Q A;  1KTQ A;  4J9R A;  2GWS A;  1MC8 A;  1Z00 B;  4DSL A;  2BGW A;  4F5N A;  4NLG A;  2W9C A;  5EWE A;  3V7K A;  4F4Y A;  4J9N A;  4ECS A;  3FDS A;  2BPG A;  2IHM A;  2R8G A;  1ZQH A;  2BR0 A;  5DB9 A;  3EPI A;  1K1S A;  4C8M A;  3JPN A;  1ZET A;  4M9J A;  4Q8E A;  2BCU A;  4RNN A;  2W9C B;  1KFS A;  4RQ5 A;  4RT2 A;  5J29 A;  3V6J A;  1IXR A;  8ICF A;  4HYK A;  5DKW A;  1TK0 A;  4M6W A;  5KG7 A;  1KRP A;  9ICM A;  9ICO A;  4ZH4 A;  4YP3 A;  1ZQI A;  4F2R A;  4R64 A;  4DOC A;  2DFL A;  2J6T A;  5KG1 A;  4YR0 A;  7ICO A;  2BCR A;  2P6U A;  1QLN A;  4JV1 A;  3ORY A;  1BPY A;  2A1J A;  4QZG A;  4ECY A;  4P4M A;  4R8U A;  1XWL A;  1S0O A;  4DQP A;  7ICE A;  8ICW A;  4QZF A;  4ED1 A;  2HVI A;  2HW3 A;  4XA5 A;  3MAB A;  4YXM A;  5BOL A;  2ZTE A;  2NRT A;  1HJP A;  5KFY A;  5J2B A;  5KFF A;  4O3P A;  4QZB A;  4QWE A;  3HP6 A;  3RR8 A;  5KFD A;  2C2E A;  4R8U B;  4ED6 A;  5DB7 A;  4B9U A;  4NM1 A;  5IIO A;  4DSF A;  4KLO A;  4Z6C A;  4DFP A;  3NGD A;  3UQ2 A;  3TAP A;  3ZDD A;  5DDM A;  4P4O A;  2Q0Z X;  3ZDC A;  3Q8L A;  5J2J A;  5CR0 A;  3PR5 B;  1SL0 A;  4I2J A;  3BQ2 A;  1A76 A;  8ICX A;  2FPM A;  4KN4 A;  4YR2 A;  4CCH A;  5KFV A;  8ICZ A;  2ZUB A;  3UQ0 A;  1ZQK A;  8ICN A;  4RPZ A;  3ISD A;  4YMN A;  4DQS A;  4RZR A;  3V7J A;  3N97 B;  3IHQ B;  4J9K A;  1S10 A;  3TQ1 A;  2OWO A;  1S77 D;  5BPC A;  2W8K A;  1TKD A;  2KFN A;  1NJY A;  3RB3 A;  4YG2 A;  2PFQ A;  4UAY A;  2PXI A;  1U48 A;  4NLZ A;  4O3N A;  5KTQ A;  5KT3 A;  1ZQO A;  3IM1 A;  4EZ9 A;  4DS4 A;  4Q44 A;  4KLJ A;  4F5O A;  1C7Y A;  4KLU A;  4I2E A;  3ISC A;  1S9F A;  5KT7 A;  4KLS A;  5HMM A;  3Q8S B;  2JEG A;  1WCL A;  2AGP A;  2JEI A;  5KFW A;  3G6Y A;  8ICL A;  4M2Y A;  4F5Q A;  2VA3 A;  1ARO P;  2XGQ A;  4RQ0 A;  4DSE A;  4GC7 A;  8ICP A;  4MF8 A;  4RQ8 A;  5J0Y A;  3V6K A;  1JMS A;  1LV5 A;  2UVR A;  9ICX A;  1B22 A;  4RNM A;  2XO7 A;  1COO A;  7ICF A;  4IR1 A;  5KG6 A;  3E2E A;  1XO1 A;  4F2S A;  9ICH A;  2IMW P;  1JX4 A;  1ZQQ A;  3H40 A;  4J9P A;  9ICU A;  4RQ4 A;  1JXL A;  3PO5 A;  4Q43 A;  9ICL A;  3MGH A;  9ICB A;  4JK1 A;  5JUM A;  3RB4 A;  1SKS A;  4YD1 A;  1SL1 A;  2KFZ A;  4QWC A;  5IIK A;  3RJF A;  4KLQ A;  1ZQX A;  2IHN A;  4QZI A;  4YMM A;  1MQ3 A;  1KFD A;  4F4X A;  4ECT A;  1HUZ A;  7ICV A;  3MFH A;  5J0X A;  4UAW A;  5KT2 A;  2W9B A;  4M0A A;  3MGI A;  5J2F A;  4YMO A;  3OSP A;  8ICE A;  3T3F A;  5KT5 A;  1ZQF A;  4LVS A;  3T5K A;  1NK0 A;  2ZJ5 A;  4K4I A;  4K4H A;  3ZDE A;  3K75 D;  2W9B B;  4XRH A;  5KFI A;  4RQ2 A;  3PW0 A;  4NLK A;  5KT6 A;  4YD2 A;  4YQW A;  4MFF A;  4RNO A;  3JPO A;  4RQ6 A;  4RPX A;  3EZ5 A;  1N48 A;  2NRZ A;  4ECU A;  4YR3 A;  3RH5 A;  1ZQD A;  9ICA A;  4ED2 A;  4B9S A;  4UB5 A;  4UB3 A;  3RJI A;  2BPF A;  4DSI A;  3PMN A;  5EOZ A;  5KG3 A;  3ISB A;  4DL6 A;  1QSL A;  2P66 A;  1NOM A;  4O5E A;  5CHG A;  3MDC A;  3OSN A;  4F4W A;  1ZQU A;  2JZB B;  2HHU A;  3H4D A;  8ICV A;  2M9N A;  2HHX A;  1D9F A;  2B21 A;  7ICP A;  7ICU A;  5KG5 A;  3H8S A;  5KFE A;  1X9W A;  1ZQW A;  3PW7 A;  5BOM A;  4PHE A;  3MFI A;  3SV4 A;  5L1L A;  2AQ0 A;  4NXZ A;  1MSW D;  8ICK A;  5CJ7 A;  1NKB A;  8ICU A;  2W8L A;  5D46 A;  1V9P A;  1K1Q A;  1NK8 A;  7ICI A;  4I2D A;  4IR9 A;  9ICC A;  4I2I A;  3C2L A;  4F91 B;  4RQ7 A;  3G6X A;  2WTF A;  2HHS A;  2HHQ A;  1L3S A;  2KN7 A;  4O3S A;  3RBD A;  5EWG A;  1ZQB A;  3T5J A;  1Y88 A;  5J0O A;  3BJY A;  4ED7 A;  2FMQ A;  4PHD A;  3EWA A;  4R65 A;  4XQ8 A;  4M6W B;  3H7I A;  4F50 A;  5DG7 A;  3JPT A;  4QW8 A;  3LDA A;  4PGX A;  5DGA A;  3OJU A;  4DLE A;  1XSN A;  1B43 A;  1NK9 A;  4QZ9 A;  5KFP A;  5J2G A;  1D8L A;  5J2C A;  5IIM A;  1NK7 A;  5J0P A;  4I28 A;  3M9N B;  2C2R A;  1S0M A;  5KFA A;  4QW9 A;  4F93 B;  8ICQ A;  8ICH A;  1N56 A;  3JPR A;  2FLP A;  9ICP A;  2A1J B;  3C2K A;  2Y1I A;  4JV0 A;  5KFT A;  4B9T A;  5KFC A;  3EYZ A;  3MR6 A;  4DL2 A;  2HVH A;  1HUO A;  2BQR A;  4TQR A;  4J9S A;  4F5R A;  3RJE A;  4UAZ A;  4PHA A;  3C5F A;  4UBC A;  4ECZ A;  3MR2 A;  5C5J A;  9ICF A;  4GC6 A;  4IRK A;  1ZJN A;  5KFR A;  5DBB A;  4ED0 A;  5J2I A;  2DPJ A;  2C22 A;  2LYH A;  4UB4 A;  2ASJ A;  1NJZ A;  4DL3 A;  4B9V A;  4KLG A;  4MFC A;  3PW5 A;  3GV5 B;  4TQS A;  1T3N A;  4YFK A;  3HW8 A;  1CEZ A;  3GDX A;  1BPZ A;  4M9H A;  4QWA A;  5KFZ A;  4Q8F A;  9ICG A;  4PPX A;  4DFK A;  3H8J A;  1JN3 A;  3QZ7 A;  2XY5 A;  8ICO A;  4NM2 A;  3PML A;  4EYI B;  1UA1 A;  4J9O A;  4DLG A;  4G3I A;  8ICY A;  5KG4 A;  2VAN A;  4B9M A;  2V9W A;  3RRH A;  4KTQ A;  1T4G A;  2PI4 A;  3RJG A;  4QWB A;  4J9M A;  4FS2 A;  3AU2 A;  3MBY A;  4O9M A;  3C1Z A;  1T7P A;  1KLN A;  5DG8 A;  2IBK A;  1ZQN A;  1UT8 A;  1U49 A;  5J2K A;  4I2C A;  2BPC A;  4DL4 A;  3QEA Z;  3UXP A;  4KN7 A;  1ZYQ A;  5DQI A;  5IIJ A;  8ICJ A;  2KZ3 A;  1Z3E B;  4IQT A;  2AQ4 A;  9ICI A;  3PV8 A;  5III A;  3C1Y A;  5DGB A;  4F3O A;  5L1K A;  2KTQ A;  1LB2 B;  1TK8 A;  4DEZ A;  2ASL A;  2JEF A;  1SZP A;  4Z6F A;  4DOA A;  4NLN A;  5KFH A;  4QZC A;  4MF2 A;  7ICL A;  1KEJ A;  4EEY A;  5J2E A;  4ECX A;  1UA0 A;  1A77 A;  4RT3 A;  1ZJM A;  3OJS A;  7ICR A;  8ICG A;  4QWD A;  1DGS A;  1NKC A;  1ZQJ A;  5IIL A;  2MUT A;  4QZE A;  8ICA A;  4EBC A;  3TFR A;  2J6S A;  3EW9 A;  1L3U A;  4KLF A;  1D8Y A;  3AU6 A;  5DDY A;  4C8L A;  7ICN A;  3PO4 A;  4IRD A;  2MAX A;  2NRV A;  4R63 A;  1L3V A;  4DFJ A;  3SYZ A;  1TFR A;  2MUT B;  1PZN A;  3BQ0 A;  3Q8M A;  5HNK A;  2BKE A;  5KFQ A;  4DQR A;  4ECW A;  2R8H A;  4X5V A;  5KFK A;  4DL5 A;  3RRG A;  1ZQC A;  1XC9 A;  2XCP A;  1ZQL A;  3GFK B;  3RAX A;  4J9L A;  3UPQ A;  3GQC A;  1TV9 A;  1D9D A;  5J0T A;  3Q8K A;  5KFO A;  3KHH A;  3T5H A;  1ZQT A;  7ICG A;  3NTU A;  1XSL A;  2AGO A;  4UB2 A;  1ZQM A;  4C8K A;  4O5C A;  3N4M B;  1RYR A;  5D49 A;  4FO6 A;  2ZTD A;  3HX0 A;  3TAR A;  7ICQ A;  3PW2 A;  4QZ8 A;  4DSK A;  2F1I A;  3C21 A;  3V7L A;  4JUZ A;  1RXV A;  1BPE A;  1MQ2 A;  4RQ1 A;  1ZQG A;  2FLN A;  8ICC A;  3T5L A;  2PFP A;  4KLI A;  3LWM A;  1WCN A;  3Q8Q B;  4DS5 A;  4BWM A;  2XGP A;  4ELV A;  4BXO A;  4K4G A;  4KLL A;  3ETL A;  3RTV A;  5DQH A;  2PFN A;  1TK5 A;  1S0V A;  3EPG A;  3TI0 A;  3BQ1 A;  3QEB Z;  2PI5 A;  4IQV A;  3KTQ A;  3KHG A;  3M8R A;  4BXO B;  4FBU A;  3JPS A;  2AJQ A;  3QE9 Y;  8ICM A;  4DF8 A;  5L1I A;  2ALZ A;  5HHH A;  2JEJ A;  1KDH A;  4GXJ A;  1NK4 A;  2BCV A;  3PX4 A;  3TFS A;  4DWI A;  4Z6E A;  4LZG A;  2NRW A;  4TUR A;  3RBE A;  5KFS A;  1ZQY A;  4BGD A;  4FS1 A;  2ZJA A;  1UT5 A;  4NY8 A;  1X2I A;  3OGU A;  1TAU A;  4F8R A;  1RZT A;  4Z6D A;  2H5X A;  3KHL A;  2DPI A;  2UVV A;  5HHI A;  9ICS A;  5DB6 A;  5KFM A;  4ECQ A;  4TUQ A;  4PH5 A;  4M47 A;  5J0R A;  1U45 A;  4KLM A;  5D4B A;  2KZM A;  4RU9 A;  9ICW A;  4O0I A;  3RB6 A;  5EWF A;  1NK6 A;  3RB0 A;  3LK9 A;  3LWL A;  3SI8 A;  4ED3 A;  2ISO A;  3Q8R B;  4JWN A;  1XU4 A;  3PX0 A;  4LZD A;  1ZQR A;  3C23 A;  2ZJ8 A;  4I27 A;  5DB8 A;  4DO9 A;  1T8E A;  3ZDB A;  5F9L A;  2IA6 A;  4UB1 A;  2NRX A;  4B9N A;  4KMU A;  9ICT A;  3BDP A;  2ZUC A;  2HHW A;  2XY6 A;  1BPD A;  1JIH A;  2XY7 A;  3UXN A;  4F4Z A;  1TVA A;  4ELU A;  9ICR A;  5DBA A;  3TAN A;  8ICS A;  1X9M A;  9ICE A;  1QTM A;  1NJX A;  5DLG A;  2FMP A;  4YXJ A;  4MFA A;  2V4R A;  4DF4 A;  4O5K A;  4I2H A;  3FYH A;  4M9N A;  4RPY A;  4YN4 A;  4TUP A;  5CA7 A;  1QSY A;  2HHT A;  9ICJ A;  3Q8P B;  3GIJ A;  4IQW A;  3H8W A;  3BQT A;  3H4B A;  5KFB A;  1JXE A;  4J9Q A;  2FPK A;  2BQ3 A;  1SKW A;  1BGX T;  5KG2 A;  3MR5 A;  4F4K A;  2PFO A;  3RJK A;  2ZTC A;  1IM4 A;  5CWR A;  4B9L A;  4M9L A;  5KFL A;  2UVU A;  2R8J A;  1XSP A;  1BVS A;  3KHR A;  3HPO A;  2C2D A;  3PNC A;  5DLF A;  4DQQ A;  7ICJ A;  3RH6 A;  4M9G A;  1U4B A;  3PR4 A;  5L9X A;  3ZD8 A;  2KZZ A;  2XCA A;  2W9A A;  3QZ8 A;  4EYH B;  1BPX A;  1ZQP A;  4MEY A;  4GXK A;  1NKE A;  9ICN A;  3JPP A;  7ICM A;  3GIK A;  1S76 D;  5DQG A;  4KIT B;  2I1Q A;  4F5P A;  4E0D A;  5J0U A;  4PGY A;  5KFG A;  4Q45 A;  3MDA A;  5HML A;  2F1H A;  5KFJ A;  3RH4 A;  5KFN A;  2BQU A;  4DQI A;  4DSJ A;  4F92 B;  3M9O B;  3GV8 B;  4IQU A;  2UVW A;  1XS9 D;  1S0N A;  8ICT A;  3MR3 A;  2HHV A;  5KG0 A;  4R66 A;  3RJJ A;  4XUS A;  5KT4 A;  4O3O A;  1TAQ A;  5CP2 A;  1ZQZ A;  2VA8 A;  3ZDA A;  1KSP A;  7ICT A;  2W9M A;  4ELT A;  4ED8 A;  4I2F A;  2ZUD A;  2RDI A;  4GLX A;  4EZ6 A;  2BCS A;  5F9N A;  4I2B A;  4IRC A;  5L1J A;  4M04 A;  4GXI A;  4FBT A;  3PY8 A;  2BDP A;  4JWM A;  1ZQE A;  1NK5 A;  9ICQ A;  1SL2 A;  2ASD A;  4MEX A;  3SZ2 A;  3GII A;  9ICK A;  2AGQ A;  3GIM A;  4UBB A;  1L3T A;  3B0Y A;  4P2H A;  1S97 A;  4RQ3 A;  1ZQS A;  8ICB A;  1QSS A;  5KFU A;  8ICI A;  4ECR A;  9ICV A;  2V4Q A;  1RYS A;  7ICK A;  4JV2 A;  4RUC A;  4YCX A;  1DOQ A;  4QZD A;  4QZH A;  4ECV A;  5IIN A;  3HT3 A;  3SV3 A;  3ZD9 A;  3OHB A;  4BWJ A;  2BCQ A;  2C28 A;  4RUA A;  1H38 A;  5J0S A;  5J2A A;  4TUS A;  1BPB A;  3C5G A;  1ZQA A;  4DOB A;  1U9L A;  3V6H A;  4I2A A;  4C8N A;  3RJH A;  2XC9 A;  5J2D A;  3OHA A;  3RAQ A;  1U47 A;  3G6V A;  5J2H A;  4DFM A;  3TAQ A;  2VA2 A;  4YVZ A;  4EBE A;  2R8K A;  2BHN A;  3M9M B;  2FPL A;  3B0X A;  2ISP A;  4BDP A;  4I2G A;  5CB1 A;  5HP4 A;  5DG9 A;  3PW4 A;  3GIL A;  3JPQ A;  4O3Q A;  3AUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...