2JZBB

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbB01
4DQSA 5F9LA 4M6WB 4R65A 3Q8KA 4IQVA 4I2BA 4IRCA 1ZQCA 3H4BA 3BQ1A 3MBYA 4Z6FA 3NGDA 4ECWA 1KFTA 5KFRA 5DQGA 4DWIA 3T3FA 1ZQYA 2ZUDA 5KFWA 5CHGA 1S97A 3K4GA 4ECRA 2FLPA 4R64A 2KN7A 5J0WA 4DSEA 4QZAA 2HHTA 5KFSA 2BCVA 3TFRA 3PW5A 1KTQA 1X9WA 3MFIA 1TVAA 4YD2A 4EBEA 4DEZA 1U9LA 3RH5A 1RYRA 1UT8A 4I2DA 1TAQA 4YR2A 4YMOA 2XCPA 4J9OA 3JPRA 2HHVA 1ZQPA 4J9LA 1U4BA 1CUKA 1BGXT 3IHQB 3C5FA 3PW2A 3GFKB 4BWMA 4J9PA 1NK4A 1SKSA 2VA3A 5J0PA 1XO1A 4GXJA 2XY5A 5IIJA 1C7YA 4PHDA 2PFPA 3C21A 4O3SA 1JIHA 4EEYA 4F5RA 7ICFA 4KLIA 9ICTA 3KHLA 3MGHA 1ZQLA 1ZQNA 4B9NA 5DBAA 1WCLA 2VA8A 3SZ2A 2KZ3A 4LZDA 1XWLA 4R8UB 2OWOA 4I2CA 5JUMA 3TFSA 3M9OB 2HHQA 1U47A 9ICGA 5HHHA 1KDHA 1DOQA 1UA0A 9ICHA 5J0YA 4BGDA 3OHBA 1A76A 4EYHB 1N56A 2PFOA 5DGBA 8ICSA 9ICWA 4FBUA 5DG8A 2AQ4A 2A1JB 5IILA 3SV3A 3PW4A 4M9GA 4Q8EA 2RDIA 2Q0ZX 1NK7A 8ICJA 4C8MA 5IINA 4TQSA 4O3OA 4QWAA 9ICFA 1JXEA 4UB1A 5J0TA 3ISBA 3QEAZ 3V72A 2NRXA 4F2RA 4Z6DA 4QZHA 4RU9A 5KFLA 4P4PA 4DL5A 3OSPA 2HVHA 4TUSA 4B9LA 4I2AA 9ICBA 5KFXA 3HX0A 2R8GA 2DPIA 3MDCA 3JPOA 4RUAA 3JPPA 4KTQA 1B22A 1SL2A 3BQTA 2GWSA 1Z3EB 3RJIA 2FMPA 1AROP 2C22A 5C5JA 4C8KA 3LDAA 4YCXA 3C2KA 2BPCA 4B9UA 4JUZA 4RQ6A 3M9MB 4KLOA 2UVUA 4E0DA 3PNCA 1U49A 4O3RA 1KEJA 3RTVA 9ICUA 5KFEA 3OSNA 2H5XA 4DSJA 4RT2A 4ECVA 4O0IA 4YMMA 5KT2A 2J6UA 4I2HA 4MFFA 4KLJA 7ICKA 3EPGA 5KFNA 5IIIA 4DOCA 4QW8A 1NK0A 5KFIA 1L3VA 3G6YA 1HUZA 2IHMA 4Q8FA 7ICOA 4QZ9A 1S10A 5DGAA 4P2HA 5KFMA 1RYSA 1ZQQA 2IBKA 3GV5B 7ICVA 4P4MA 3E2EA 1QSYA 3T5KA 2HHUA 5KFTA 4EZ6A 1T8EA 4I2FA 4Q45A 4DL4A 3RJGA 5KFOA 4KLQA 4YD1A 3K75D 8ICYA 4B9MA 4CCHA 7ICRA 1KSPA 2BGWA 4MFAA 5J0SA 4DQPA 4F50A 2PFQA 2FLLA 4NLGA 3LWMA 5J0XA 4RNNA 1KFDA 3OJUA 3ISCA 4NM2A 3EYZA 3EWAA 3EZ5A 3C5GA 3PW7A 3H8SA 1NK8A 3RJEA 5KT3A 8ICWA 1BPYA 4NY8A 4M9NA 4YQWA 2UVVA 1NKBA 9ICJA 4QZBA 3M8RA 2ZTEA 8ICIA 2ASJA 3QEBZ 4ELVA 3MABA 3GIMA 5L1JA 3JPQA 4DOAA 3T5JA 2ALZA 1TKDA 4TUPA 2AGQA 4ZH4A 2XO7A 3PVXA 5HP4A 1NJYA 3HW8A 4KLMA 4KLUA 1WCNA 4Z6CA 4BDPA 2HHXA 8ICFA 9ICAA 2JZBA 2NRWA 1CEZA 8ICQA 4KLFA 4F5QA 3Q8LA 4KLGA 1XSPA 1ZQDA 4YR0A 2LYHA 3RB3A 3RJFA 4PHPA 1MSWD 4FO6A 1ZQEA 4QWCA 8ICAA 4ED1A 4JV2A 5KTQA 9ICNA 4KN7A 4ECUA 3BQ2A 5KT7A 1ZQSA 4KLEA 4YXJA 4JWNA 4R63A 2FPLA 2ISOA 3ZDDA 1S0MA 2PI4A 4K4IA 3TAPA 2XGPA 5D46A 4QW9A 2R8JA 5KG3A 5CB1A 1T4GA 2P6RA 1B43A 1XU4A 2BCRA 1LB2B 4TQRA 3MDAA 4RUCA 9ICCA 4DSFA 1JXLA 5KFCA 3MR3A 4YXMA 5DQIA 5DB8A 4TURA 4ECYA 1ZYQA 4GC7A 3H4DA 4J9MA 1ZQRA 3PV8A 2AGOA 1NK9A 7ICHA 5J2CA 4F5PA 4DL2A 2W9CB 5J0OA 2XY7A 5J2EA 4GLXA 4O5EA 3MR6A 4DF8A 3UXNA 3Q8MA 2C28A 5KG4A 2I9GA 2ASDA 4P4OA 4DL3A 3BJYA 1ZQBA 7ICTA 8ICUA 1N48A 5J2GA 4M04A 5KT4A 1SL1A 2KFNA 2VANA 3C1ZA 3GQCA 5L1IA 3EPIA 4DS5A 1NJXA 1ZQJA 3V7KA 4RQ3A 3PX0A 5HMMA 1TV9A 1TK0A 1S0NA 4ELTA 2W9CA 3RRHA 3ZDEA 1NKEA 1BPXA 4Q43A 4J9QA 5DLGA 3IM1A 5L1KA 4F4KA 2BPGA 3C1YA 3UXPA 5BOMA 1L3UA 1L3SA 1NK6A 3RR8A 8ICCA 3PW0A 2J6TA 4RQ1A 4YR3A 4XQ8A 4F4XA 1SKWA 7ICUA 4PH5A 1U48A 3BDPA 4F8RA 4C8LA 2FPKA 2IHNA 5J0QA 2RDJA 4DOBA 1HJPA 4C8NA 2DFLA 3ORYA 2MUTA 8ICKA 4O3PA 5KFUA 4UB3A 5L1LA 1S9FA 4BXOA 5DG9A 5IIOA 5D49A 3RB6A 3C23A 4MF8A 5DBCA 8ICMA 4O3QA 4MEYA 4PGXA 5J2KA 4J9SA 4I28A 5KFAA 4M2YA 4UQGA 8ICRA 5KFQA 5J2HA 5DB9A 2PFNA 2HVIA 5EWGA 5BPCA 3PMNA 2W9BA 3V7JA 3RB0A 4IR1A 4EBCA 4ECTA 1ZQAA 5KT6A 4R66A 1IXRA 8ICXA 4BXOB 3PMLA 4QZ8A 1A77A 5KG1A 2R8HA 3UQ2A 2AU0A 4DQIA 4LZGA 4I2IA 8ICEA 2BQUA 2PXIA 4ED7A 5KFPA 5J0RA 2AGPA 4KLSA 3Q8PB 4DLGA 4DL7A 2KFZA 1S76D 1UA1A 4PHAA 3MFHA 1COOA 7ICIA 3ZDCA 3H40A 3FYHA 4TUQA 2UVRA 2BKEA 5EOZA 5J2DA 4DQRA 1RZTA 1SL0A 1K1SA 4JK1A 4DSKA 4UAYA 4ECZA 5KFDA 3KHGA 2Y1IA 4M9JA 4FS2A 9ICEA 1ZQWA 1S0OA 2KTQA 9ICLA 1QSLA 2BCQA 4NLNA 3MGIA 4F2SA 1ZQTA 3ZD8A 1MC8A 4QWDA 4Z6EA 5F9NA 4PGQA 4DO9A 4ED8A 2JEGA 1S77D 4NXZA 1Z00B 4FBTA 4O9MA 2IA6A 9ICVA 5DDMA 4YFKA 2HHSA 3G6XA 4M0AA 1MQ2A 4NM1A 4DLEA 1EXNA 5J2BA 1MQ3A 4KITB 2ZUBA 2F1HA 1D9DA 3GIKA 1NJWA 5EWEA 1NJZA 2UVWA 4NLKA 2PI5A 8ICZA 2NRZA 2ATLA 4O5CA 3C2MA 3Q8QB 3HP6A 3THVA 1ZJNA 3EW9A 4EBDA 4MFCA 3MR2A 5KFYA 3KHRA 4DS4A 1Z00A 4DF4A 2BQ3A 1X9MA 2R8KA 3ZDAA 1KLNA 2C2RA 2BDPA 2ZJ8A 5TZVA 4ED0A 4J9KA 1S0VA 4YVZA 3V6KA 1K1QA 2M9NA 5KG2A 3OJSA 3RB4A 4M9HA 8ICOA 2F1JA 4F5NA 3ISDA 2DPJA 3PY8A 4UBCA 4GC6A 2B21A 4ECSA 4DL6A 2BQRA 2I1QA 1BPZA 2V9WA 3TI0A 5J2AA 1NK5A 2JZBB 4I29A 5EWFA 4B9TA 4JWMA 4DFJA 8ICLA 2F1IA 3SI8A 4NLZA 5IIKA 4M47A 7ICNA 4M6WA 1T7PA 7ICJA 2Y1JA 5J0UA 3GV7B 7ICPA 5BOLA 2JEJA 3G6VA 5KG7A 2W8KA 5CP2A 5J29A 3SYZA 4R8UA 3Q8RB 3OGUA 5KFGA 3GIIA 1U45A 3RJHA 5HMLA 3AU6A 1RXVA 4MEXA 2J6SA 3T5HA 2C2DA 1XC9A 2FMQA 2FLNA 9ICXA 3SV4A 8ICHA 3TAQA 1ZQHA 4UAWA 8ICBA 3UXOA 9ICKA 4QZDA 5KFVA 3HT3A 4HYKA 4KMUA 4KLLA 5L9XA 4G3IA 3C2LA 5DQHA 2HW3A 4IRKA 3JPTA 1ZJMA 4JV1A 3Q8SB 4DFMA 4KN4A 4F4WA 3ETLA 1D8LA 3B0XA 1T3NA 2IMWP 4IR9A 9ICOA 9ICIA 4F91B 1BPDA 3FDSA 5KFHA 4YG2A 2XC9A 2AJQA 9ICQA 3BQ0A 1D9FA 3NTUA 2ASLA 4F93B 3V6HA 2R8IA 4EZ9A 3AUOA 4RQ8A 2C2EA 1V9PA 2BCUA 4IRDA 3GV8B 4IQUA 5D4BA 8ICGA 3PR5B 3RRGA 3N97B 8ICTA 7ICSA 3GILA 4QZFA 4K4HA 2BCSA 4KLTA 3B0YA 1X2IA 4KLDA 4ELUA 2XCAA 1QTMA 1DGSA 1PZNA 4XUSA 9ICSA 4I2GA 7ICQA 2BPFA 4RNMA 2ZUCA 4RQ5A 2W8LA 3TQ1A 3ZD9A 4LVSA 3TANA 4F4YA 5KG5A 4F5OA 4ECXA 1ZQFA 3MR5A 3RBEA 4RQ2A 3QZ7A 4JV0A 4J9NA 5HNKA 4F3OA 4QWEA 1RXWA 5KG6A 2FMSA 8ICVA 5KT5A 5DLFA 1NKCA 4XA5A 3ZDBA 4RZRA 2W9AA 3TARA 3RJJA 2W9MA 1UT5A 4I2JA 4DFKA 4UB2A 3LK9A 4RQ7A 7ICEA 2P66A 1QSSA 2FPMA 5KFJA 2V4RA 4BWJA 3RR7A 2NRVA 2ZTDA 2NRTA 2W9BB 5IIMA 1XSLA 5J2JA 4QZGA 4KLHA 1TAUA 2JEIA 1NOMA 2ZJ5A 3H8JA 2AQ0A 4ECQA 4DQQA 1L5UA 1HUOA 5CA7A 1X9SA 1LV5A 5DG7A 4F92B 4ED3A 1SKRA 3GDXA 5DB6A 3UQ0A 4RPYA 1L3TA 3OHAA 5KFZA 3V6JA 4ED2A 1KRPA 1KFSA 4I27A 1ZETA 4MF2A 1RPLA 3JPNA 3KTQA 5HHIA 7ICGA 4RQ0A 2MUTB 3RAXA 1JN3A 4DFPA 5DB7A 4IQTA 4K4GA 3GIJA 3T5LA 5DKWA 3RBDA 1TFRA 1ZQZA 4O3NA 4FS1A 2ZJAA 4B9VA 1BPEA 4XRHA 4C8OA 3PX6A 5J2IA 2KZZA 1ZQVA 4UAZA 4QZCA 2WTFA 2XY6A 3RJKA 3PO4A 3H8WA 4PPXA 4M9LA 1ZQOA 1BPBA 5KFBA 1ZQKA 2KZMA 8ICNA 7ICMA 1JX4A 8ICPA 2BHNA 4EYIB 5CWRA 4IQWA 4YMNA 2ISPA 3QE9Y 1XS9D 4RNOA 3UPQA 2V4QA 3PO5A 1Y88A 2P6UA 4QZEA 4GXKA 3PX4A 4RT3A 4RPZA 5DBBA 3N4MB 1TK5A 4YP3A 4UB5A 9ICMA 4Q44A 4GXIA 3V7LA 1ZQXA 5KFFA 4YN4A 1ZQIA 1ZQUA 4UB4A 1JMSA 7ICLA 2VA2A 3LWLA 3AU2A 4I2EA 1IM4A 1D8YA 9ICPA 2BR0A 4F4ZA 4J9RA 4QZIA 3M9NB 5J2FA 4B9SA 1H38A 4ED6A 5CJ7A 1XSNA 2A1JA 3H7IA 1BVSA 4PGYA 3PR4A 5DDYA 3JPSA 2ZTCA 4RQ4A 3KHHA 3HWTA 3M8SA 5CR0A 2MAXA 5KFKA 1SZPA 4O5KA 2XGQA 4UBBA 5KG0A 2HHWA 9ICRA 1ZQMA 3RAQA 4QWBA 3RH6A 1TK8A 1ZQGA 1QLNA 2JEFA 4DSLA 3QZ8A 4X5VA 4DSIA 4RPXA 4PHEA 3HPOA 3RH4A
chains in the Genus database with same CATH superfamily
4DQSA 2E1EA 3Q8KA 4I2BA 3H4BA 2FJ6A 2KKVA 1DRGA 3QNMA 5CHGA 1S97A 3K4GA 1VJ5A 4QZAA 1TVAA 4GIBA 4YD2A 4EBEA 3RH5A 1SGGA 5FP0A 1TAQA 4J9OA 1ZQPA 1U4BA 1BGXT 3IHQB 1D8BA 4J9PA 1XO1A 2E8PA 1JIHA 4RQMA 2W54A 3MGVA 5AK5A 4KLIA 2EZYA 3SZ2A 1PK1A 3TFSA 2HHQA 5HHHA 4BGDA 1N56A 8ICSA 3B9JA 1N60A 4ZOHC 4FBUA 3TACB 5IILA 3T79A 2YQEA 3PW4A 1ECWA 8ICJA 1SV0A 2RLTA 5J0TA 2HVHA 3OSPA 2DPIA 4RUAA 2DQNB 1O08A 2Y9UA 2GWSA 3BQTA 3RJIA 1AROP 2C22A 4C8KA 2BPCA 4B9UA 4RQ6A 3J81j 4KLOA 4P0QB 4O3RA 1KEJA 5KFEA 3WK6A 3OSNA 4DSJA 4MFFA 2J6UA 4YMMA 7ICKA 2JRZA 4KLJA 5AKEA 5IIIA 2LKYA 2LPEA 1HUZA 3WKCA 3D2SA 2W3RA 3WKDA 3T5KA 4OCZA 4Q45A 4KLQA 3I1YA 4CDGA 7ICRA 2XI9A 2RRDA 2PMZC 3ISCA 4NM2A 3C5GA 1NK8A 1BNOA 5KT3A 8ICWA 3KOOA 2UVVA 1NKBA 4Y2QA 4TUPA 1NJYA 4KLMA 2HBMA 3BZCA 2NRWA 2G5IB 4PHPA 5ALTA 4KN7A 3L3FX 4ECUA 2OH2A 2ISOA 2PI4A 2XGPA 5KG3A 1M6YA 1N63A 5AM4A 2XIDA 1B43A 4TQRA 2W7PA 3N28A 4YXMA 4O3MA 4TURA 1ZYQA 4J9MA 1NK9A 2AXTU 5HR6A 5J0OA 5ALZA 2XY7A 3A0BU 3UXNA 2I9GA 4DL3A 3BJYA 1SV4A 2VANA 3C1ZA 3AEVA 4OJ6A 1Z4OA 4AP9A 3PX0A 4QJFB 2OM6A 2A3VA 5EE1A 1NKEA 5DLGA 2BPGA 3C1YA 5AI8A 4RQ1A 4YR3A 1JRPA 7ICUA 4PH5A 1U48A 1SXEA 4C8LA 2K4HA 2K89A 2MUTA 5KFUA 2ZXHA 3RB6A 5ALRA 4MF8A 2KJ5A 3AQFA 3D2NA 5K4LA 3RB0A 5KT6A 4R66A 4BXOB 4LZGA 2PXIA 2AGPA 1S76D 4TUQA 2UVRA 4DSKA 5KFDA 3KHGA 2Y1IA 4M9JA 4FS2A 1ZQWA 1QQ7A 3NVZA 2GLEA 3NRWA 3BS7A 4KX5A 1MN8A 1MC8A 2K60A 3QU7A 2JEGA 2EZZA 1S77D 4O9MA 4M0AA 4PZOA 4CNQA 2YN4A 4NLKA 5EWEA 2PI5A 2NRZA 4O5CA 3Q8QB 3EW9A 3KHRA 1Z00A 4DF4A 1O03A 3QU4A 2ZIUB 2BDPA 2ZJ8A 3QUQA 3N7PD 4J9KA 2JV3A 1N2XA 4YVZA 2IOHA 1X6IA 4NL9C 4F5NA 2DPJA 4UBCA 4GC6A 4ECSA 2BQRA 4DL6A 2V9WA 3WK7A 4I29A 3CYMA 4DFJA 5IIKA 4ICAA 1P7DA 2YMPA 7ICJA 2Y1JA 3HJEA 3G6VA 1PVQA 4R8UA 2MRLA 3Q8RB 3OGUA 3GIIA 3PZPA 1U45A 2J6SA 2C2DA 2FMQA 3SV4A 4UAWA 9ICKA 4KMUA 4KLLA 3HKZC 3C2LA 2AHOB 1J2MA 3Q8SB 3N7SC 4KN4A 4U7CA 5ALDA 3B0XA 1T3NA 9ICIA 2DKZA 4F91B 1BPDA 2A1AA 3R9KA 3NTUA 2R8IA 2IOFK 4RQ8A 2BCUA 4IRDA 5D4BA 3RRGA 5AICA 7ICSA 4K4HA 2BCSA 2HOIA 1KKXA 1X2IA 1KBUA 4ELUA 1NZBA 5ALXA 2W8LA 4LVSA 2BZFA 1RM6C 3TANA 1OUQA 3MR5A 3RBEA 4J9NA 8ICVA 5DLFA 1ZD4A 2W9AA 5AKIA 3TARA 4IL6U 3RJJA 2QB0A 2HOQA 5KNIA 3LK9A 2E1FA 4RQ7A 1QSSA 1J97A 2ZXIA 5KFJA 2V4RA 4UB8U 3RR7A 2NRVA 5AI6A 4QZGA 4JMUA 1UQVA 1TE2A 1HUOA 1X9SA 2H3VA 3FM9A 1L3TA 5KFZA 4MF2A 3OPXA 4RQ0A 1GO3F 2MUTB 4K4GA 3DEEA 3T5LA 2LM1A 3KBBA 1SIJA 2ZJAA 4FE3A 3PX6A 5ALIA 4UAZA 2XY6A 3H8WA 1WYGA 2WF7A 1N61A 1ZQOA 2KP7A 1JALA 2LM4A 2KZMA 2BHNA 5CWRA 2E8NA 3AL0B 2D3DA 4YMNA 3I76A 2P6UA 4GXKA 5AKGA 1TK5A 5AK3A 1AQ6A 2QARB 1ZQXA 2EAPA 2GH1A 1ZQUA 2VA2A 4F4ZA 2ZIUA 1HIWA 3M9NB 5J2FA 1BNPA 1H38A 4ED6A 1ZQGA 1XSNA 3H7IA 1RDFA 1ZQ1C 3HWTA 2MAXA 3RAQA 4QWBA 1TK8A 5JTIA 3QZ8A 4X5VA 5F9LA 2DBYA 2G0AA 5DQGA 4DWIA 3T3FA 4Y2YA 2KN7A 2QLTA 4IC9A 5AKJA 3TFRA 1KTQA 1X9WA 1RQLA 4DEZA 1U9LA 1RYRA 1Q3VA 1V85A 2KVSA 4YR2A 2KVCA 4YMOA 2XCPA 1CUKA 3H0RB 3CP8A 2VA3A 4GXJA 4PHDA 4O3SA 3UMBA 2HSZA 4HAIA 3KHLA 3MGHA 1ZQLA 1ZQNA 4B9NA 2VA8A 4KX3A 5JUMA 3M9OB 1U47A 1UPHA 3OHBA 4EYHB 3UMCA 5DGBA 2AQ4A 5CEHA 2A1JB 3IV6A 4M9GA 4Q8EA 3F5AA 2RDIA 2Q0ZX 5H2FU 4FZLA 9ICFA 1JXEA 2W03A 1ZOLA 2NRXA 2ZIVB 5GTHU 4P4PA 4DL5A 4C0ZA 4TUSA 3BZKA 2R8GA 3JPOA 3JPPA 1B22A 1F5SA 2FMPA 5C5JA 3M9MB 5AM2A 2UVUA 1QH9A 3PNCA 2I5HA 3RTVA 4J03A 9ICUA 3O0FA 4RT2A 4ECVA 4O0IA 5KT2A 3EPGA 2IHMA 7ICOA 2KHQA 5DGAA 2IBKA 4P4MA 4UW9A 2KIVA 3UM9A 1RG6A 3RJGA 5KFOA 4YD1A 3K75D 5HR7A 4MFAA 4NLGA 3EYZA 3EZ5A 3OJUA 3I28A 4M9NA 2KKPA 1FO4A 4NV0A 3BS5B 2HBJA 2ALZA 3JPQA 4DOAA 5ALUA 5KL8B 2AGQA 5AIBA 1WCNA 4Z6CA 1L7PA 3PSTA 4F5QA 4KLGA 1XSPA 4WJ3B 3RJFA 5JU5A 2CXYA 5KTQA 3BQ2A 1ZQSA 4KLEA 4JWNA 4UAVA 4QW9A 2R8JA 3FAHA 1T4GA 2P6RA 5G5HA 1NNLA 5EE9A 2BCRA 4FZNA 3MDAA 4DSFA 3MR3A 2AGOA 4RQNA 2W9CB 5J2EA 4O5EA 5KG4A 3VCBA 3ZI4A 8ICUA 1ZQBA 2ODGA 4M04A 5KT4A 1SL1A 2KFNA 4DS5A 3EPIA 3PSPA 2RQ5A 4BX9C 1S0NA 5ALEA 5AKXA 4Q43A 4J9QA 1PK3A 1RQNA 3UXPA 8ICCA 1NK6A 2KK0A 1KL9A 5AM3A 4F4XA 2ES6A 2VJ4A 3M6ZA 4NLBA 1J2NA 2DGZA 2OEHA 4UB3A 4BXOA 5DG9A 5KAFU 1B0XA 3A0HU 5JRTA 5ALJA 4O3QA 1L8LA 3KKAC 4J9SA 1X40A 5KFQA 5J2HA 2HVIA 3PMNA 3LVVA 1ZQAA 1FFUA 3UQ2A 2NO4A 2AU0A 4I2IA 2BQUA 2KSOB 4ED7A 5KFPA 5J0RA 2KFZA 1UA1A 4PHAA 3ZDCA 3FYHA 5EOZA 5J2DA 1SL0A 4JK1A 3AQEA 1YZ7A 2KTQA 1QSLA 5ALOA 4NLNA 3MGIA 1ZQTA 3LVWA 1ZD3A 3WKAA 4Y2PA 4DO9A 4PGQA 2YMQA 4NXZA 2HHSA 4CF5A 2M0NA 3G6XA 4NM1A 1MQ3A 1EXNA 5J2BA 2IA6A 2F8LA 1NJZA 8ICZA 3C2MA 5KFYA 3KZIU 1X9MA 1KLNA 2MU2A 2G5HB 5ALNA 3PSIA 1S0VA 5ALLA 5KG2A 3RB4A 4M9HA 1IG6A 3CW2C 1BPZA 4ACOA 1NK5A 2JZBB 5EWFA 2F1IA 4NLZA 2KICA 4M6WA 2HBKA 2LMRA 2WFAA 3EUB2 5BOLA 5CP2A 5J29A 3RJHA 5HMLA 1Z1BA 4UARA 4MEXA 1DXSA 1XC9A 9ICXA 8ICBA 1URJA 3D6JA 4HYKA 4G3IA 3GZFA 2HDOA 2HW3A 2YB4A 1ZJMA 4JV1A 2G09A 2L5YA 5ALQA 4IR9A 4GFJA 2H3IA 4YG2A 2C2EA 4P0QA 1X9XA 2ZIXA 2EDUA 3PR5B 2KG5A 1S5LU 3N97B 3GILA 4QZFA 3TADC 3SAFA 4KLDA 1DGSA 2BPFA 4RQ5A 2QARA 5E79U 4Y2JA 4F4YA 4F5OA 4ECXA 5ALYA 4RQ2A 4JV0A 3WK8A 5HNKA 4F3OA 4QWEA 2HI0A 1RXWA 5KG6A 2MSNA 2NYVA 2F2AB 4XA5A 2K8AA 1UT5A 4I2JA 1Z4NA 4OJLA 4DFKA 5L1MA 2P66A 4KLHA 2NRTA 1F0MA 1TAUA 1NOMA 2F44A 3H8JA 3CNHA 5G5GA 5DG7A 1SKRA 3GDXA 4OJOA 1FEZA 1RPLA 5HHIA 3IP4B 7ICGA 3RAXA 4IQTA 3RBDA 5DKWA 1SWWA 4FS1A 1BPEA 4UB6U 4XRHA 2YMLA 5J2IA 3PO4A 4PPXA 4CF4A 2B0CA 5KFBA 2WHEA 8ICNA 1JX4A 8ICPA 4EYIB 4IQWA 4RNOA 1PUZA 1CRXA 1KQQA 9ICMA 4GXIA 3V7LA 4YN4A 7ICLA 5AKLA 3AU2A 3VC8A 1IM4A 3KFUF 9ICPA 2BR0A 2EZXA 4QZIA 1X6JA 2P35A 5CJ7A 2N1RA 3M1YA 3JPSA 2ZTCA 3RF9A 2NV3A 2WF6A 1SZPA 4O5KA 2XGQA 1ZQMA 3RH6A 4DSLA 4R65A 4M6WB 4IQVA 4IRCA 2KEYA 2FDRA 3BQ1A 4Y2TA 4Z6FA 5AKKA 1KFTA 3GU3A 5KFRA 4U6PA 5KFWA 5KL1B 2D6FC 4DSEA 5J0WA 2HHTA 2KE7A 5KFSA 2BCVA 3PW5A 1UT8A 3JPRA 2HHVA 3PW2A 3C5FA 3GFKB 4BWMA 2DL0A 1DK2A 5J0PA 2XY5A 1C7YA 3NASA 3C21A 5GTIU 3NVYA 3IG5A 4EEYA 4F5RA 7ICFA 5DBAA 2KZ3A 1XWLA 5AK4A 5ALKA 9ICGA 1KDHA 1DOQA 9ICHA 2G07A 3N7RC 2PFOA 9ICWA 3SV3A 1L7OA 3BS5A 1NK7A 4C8MA 5IINA 4TQSA 3WK9A 4QWAA 4UB1A 2JXJA 3V72A 4Z6DA 4RU9A 2EAOA 2OYYA 4NJ8A 3HX0A 3MDCA 1Q3UA 4KTQA 1SL2A 1Z3EB 2JGAA 1V38A 5TISU 2OXOA 4YCXA 3C2KA 4US8A 4JUZA 4E0DA 3QUBA 1U49A 2H5XA 4I2HA 1L6NA 4G9BA 4DOCA 1NK0A 4QW8A 1L3VA 3G6YA 4QZ9A 3AMZA 1RYSA 2KOBA 3NRZA 2IOFA 3GV5B 3ICXA 7ICVA 2XVTA 3E2EA 1QSYA 5KFTA 1T8EA 4IS7A 4DL4A 3DDHA 3E58A 3RFAA 4B9MA 4CCHA 4QIWF 2F8KA 2BGWA 2FLLA 5J0XA 1T3QA 1KFDA 3PW7A 1BPYA 1VDVA 3E0FA 3ED5A 5AK6A 3HILA 4YQWA 4OJPA 2Y0SF 2F76X 2KIWA 9ICJA 4QZBA 3M8RA 2ZTEA 2WAQF 3QEBZ 4LJXA 1JUDA 3GIMA 3T5JA 2MA1A 1TKDA 5HP4A 3HW8A 4BDPA 4DCCA 8ICFA 1CEZA 3QUCA 8ICQA 4KLFA 3Q8LA 1ZQDA 3C29A 1HEKA 5AKZA 4YR0A 1ZQEA 1Z19A 3LYSA 9ICNA 5KT7A 4YXJA 3ZDDA 4K4IA 5D46A 1C20A 5AI4A 1XU4A 1LB2B 4F71A 9ICCA 5KFCA 5A0LA 4GC7A 3H4DA 3PV8A 4DFDA 7ICHA 5J2CA 4DL2A 2RHFA 4DF8A 3Q8MA 2C28A 2EAMA 2ASDA 4P4OA 7ICTA 1N48A 5L1IA 1NJXA 1ZQJA 1TV9A 5HMMA 1TK0A 2W9CA 2E5SA 5ALHA 3IM1A 1NI3A 5BOMA 1L3UA 1L3SA 2EH9A 2J6TA 1XO0A 4XQ8A 1SKWA 3BDPA 4Y2XA 4F8RA 3HRDD 2IHNA 5J0QA 3KKAA 2RDJA 4DOBA 1HJPA 4C8NA 2DFLA 3ORYA 4O3PA 2JR5A 1CI4A 5L1LA 1QCKA 3UMGA 1S9FA 5IIOA 5D49A 4C4TA 5DBCA 4PGXA 5KFAA 8ICRA 1PVPA 3NUQA 2W9BA 4EBCA 8ICXA 1IXRA 3PMLA 4QZ8A 3C28A 8ICEA 4KLSA 3Q8PB 4DL7A 4A8EA 3MFHA 1ZRMA 7ICIA 1JROA 1RZTA 1K1SA 4UAYA 2GO7A 2LYAA 1UHUA 1S0OA 9ICLA 3D2QA 3SR6A 4UATA 5F9NA 4ED8A 3K1ZA 5DDMA 5ALGA 2YX8A 4YFKA 2W55A 2PMZF 2ZUBA 2F1HA 4KITB 3GIKA 3HP6A 1ZJNA 4EBDA 2BDUA 2JHDA 5TZVA 2DF4B 4Y2RA 3V6KA 2WB1F 4QNLA 3OJSA 1NZPA 4UAUA 4C7YA 3ISDA 2HCFA 2I1QA 8ICLA 1K5OA 4PJ0U 3SI8A 4M47A 7ICNA 1T7PA 5J0UA 3GV7B 7ICPA 5B5EU 2H3QA 2KV2A 5KFGA 3T5HA 2FLNA 5J8YC 4QZDA 5KFVA 3HT3A 5L9XA 5DQHA 3JPTA 4DFMA 4F4WA 3ETLA 4USAA 9ICOA 3FDSA 5KFHA 3IRUA 2ASLA 4F93B 3V6HA 3IG8A 5CRXA 4EZ9A 2WB1C 1N62A 3GV8B 4IQUA 3NVVA 8ICTA 3B0YA 4C4SA 1UCVA 1LKYA 9ICSA 7ICQA 2ZUCA 5AIAA 1WWUA 3TQ1A 3ZD9A 5AI0A 2VJ5A 2FMSA 1XNSA 4RZRA 2W9MA 1A6SA 2QKQA 1OW5A 4EX7A 2FPMA 3NVWA 2Y0SC 2I6XA 5IIMA 2ZTDA 2W9BB 3SAHA 2ZJ5A 4ECQA 4DQQA 2F77X 5CA7A 1LV5A 4F92B 4RPYA 1IIPA 3V6JA 1KRPA 4ED2A 1ZETA 3KTQA 5ALMA 5B66U 1JN3A 4DFPA 2ZIVA 5DB7A 3IDWA 2KNJA 2FI1A 2HBLA 4F72A 2KZZA 2WTFA 3RJKA 1PVRA 2ZIXB 2YTUA 3F2BA 1A0PA 5AKYA 1BPBA 1ZQKA 5AM1A 3CRXA 1FFVA 3QE9Y 2K4PA 3UPQA 2V4QA 3PO5A 4QZEA 4RPZA 5DBBA 3N4MB 4YP3A 2W3SA 4UB5A 3SAGA 2Y9TA 4UB4A 2Z7JA 2JH7A 3SEIA 3IN5A 1RYUA 5KAIU 2HOFA 3PR4A 4PGYA 1BVSA 5DDYA 4BUGA 1SXDA 5ALVA 4RQ4A 5CR0A 5KFKA 3AM9A 4UBBA 5KG0A 9ICRA 3WK4A 4FZMA 2JEFA 2KHVA 4PHEA 4OO1J 3HPOA 3RH4A 3SMVA 1ZQCA 1WG8A 1QQ6A 3MBYA 3NGDA 1DK3A 4ECWA 2JH1A 1T94A 3S6JA 1ZQYA 2ZUDA 1LVHA 2K8CB 4ECRA 4Y2UA 2FLPA 4R64A 2E3TA 3MFIA 2KMDA 1N5WA 1YZ6A 4I2DA 5F3XB 1ZRNA 3M6KA 4J9LA 3SENA 1SKSA 1NK4A 3QUTA 5IIJA 2PFPA 1VLBA 9ICTA 3QYPA 1WCLA 3WKBA 4LZDA 1SV0C 4R8UB 2KJ9A 2OWOA 4I2CA 1Q46A 1UA0A 5J0YA 3F5EA 1A76A 5DG8A 5AKHA 4QIWC 3DV9A 4AYBF 2W04A 4O3OA 2WF8A 3ISBA 1PK1B 1IV8A 3QEAZ 4F2RA 4QZHA 5KFLA 9ICBA 4B9LA 1SB3C 4I2AA 5KFXA 2YY6A 2ZG6A 3LDAA 2VIXA 2W43A 4EELA 1FIQA 4BJQA 3H0MB 5KFNA 9ICQA 5KFIA 3WU2U 4Q8FA 1S10A 4P2HA 4C80A 5KFMA 1ZQQA 2VKQA 3ALRA 2HHUA 4EZ6A 4I2FA 2H3ZA 2QB1A 3F2CA 2ZIWB 8ICYA 4EENA 2CN1A 3K1RB 1KSPA 4DQPA 5J0SA 4B6JA 4EX6A 4F50A 2PFQA 3LWMA 2WF5A 4RNNA 5AI5A 4CF3A 3RJEA 3EWAA 2EQYA 3H8SA 1Z1VA 4NY8A 2LBOA 4UASA 8ICIA 2NO5A 2ASJA 4ELVA 3MABA 5L1JA 4ZH4A 2XO7A 3PVXA 4KLUA 2HHXA 1S8OA 2Q4TA 9ICAA 2JZBA 1KN5A 2LYHA 3RB3A 2O6KA 1COKA 1MSWD 4FO6A 4QWCA 8ICAA 4ED1A 4R63A 2FPLA 3WKEA 1S0MA 3TAPA 2W11A 3ETRA 2E8MA 5CB1A 1KW4A 2KJ8A 5C0YA 2ESEA 5J8YA 4RUCA 4FFDA 1JXLA 5DQIA 5DB8A 4ECYA 1ZQRA 2D8CA 2KD1A 4F5PA 4GLXA 3MR6A 2LI6A 5ALPA 4KMOB 3H0LB 3BQ7A 5J2GA 4PZNA 3GQCA 3V7KA 4RQ3A 4ELTA 3RRHA 3ZDEA 1BPXA 5L1KA 4F4KA 1L8OA 2JMGA 3RR8A 3PW0A 2KSOA 5EE3A 2FPKA 1ZD5A 8ICKA 4AYBC 4PL2A 3C23A 2ZIWA 8ICMA 4MEYA 4I28A 5J2KA 4M2YA 4UQGA 5DB9A 2PFNA 5EWGA 5BPCA 3V7JA 4IR1A 1TAMA 4JV2A 4ECTA 2R8HA 1A77A 5KG1A 4DQIA 2K4EA 2R18A 1SWVA 1ZD2P 4DLGA 1COOA 4C4RA 3H40A 2A19A 2BKEA 2DWQA 4CRXA 4DQRA 3F53A 4NWIA 4ECZA 3MC1A 4P0PA 2AH5A 3ONNA 9ICEA 2DUYA 3FC4A 2BCQA 2OCEA 4F2SA 3ZD8A 4QWDA 3SQIA 2EANA 4Z6EA 1Z00B 3L4PA 4FBTA 1WUDA 1ZXIA 2RP5A 2B6GA 9ICVA 2HMXA 3QU9A 4CE6A 1L7NA 2DKXA 1MQ2A 4DLEA 1SZHA 1D9DA 2UVWA 1NJWA 4OJ5A 2ATLA 2K4IA 3THVA 4NL9A 2E8OA 2FE9A 4MFCA 3MR2A 3U26A 4DS4A 2BQ3A 2R8KA 3ZDAA 2GOLA 2C2RA 3AN1A 4ED0A 3KZXA 1K1QA 2M9NA 2OHFA 1MA7A 8ICOA 2F1JA 3PY8A 2B21A 3TKAA 3TI0A 5J2AA 1YT3A 4B9TA 4JWMA 1Q8KA 1ED1A 2W7OA 2JEJA 1WWVA 5KG7A 2W8KA 3WK5A 4NLCA 3SYZA 2CPRA 3AU6A 1RXVA 8ICHA 3TAQA 1ZQHA 3UXOA 2WAQC 5ALWA 5T14A 4IRKA 5AI9A 1D8LA 2IMWP 2XC9A 2AJQA 3BQ0A 1D9FA 3AUOA 5AM0A 1V9PA 3M7DA 8ICGA 4KLTA 3PSFA 2XCAA 1QTMA 1PZNA 4XUSA 4I2GA 4RNMA 3QX7A 5KG5A 1ZQFA 3QZ7A 5KT5A 1NKCA 3KD3A 3ZDBA 3F2DA 3QU2A 2G06A 4UB2A 1DGJA 4Y2VA 7ICEA 1X66A 2PKEA 4Y2SA 4BWJA 4EEKA 4OD0A 5ALFA 2F3NA 4JB3A 5J2JA 1XSLA 3NS1A 2JEIA 2AQ0A 1L5UA 2YB1A 4ED3A 5DB6A 1V97A 3UQ0A 3OHAA 4I27A 1KFSA 3OTQA 3JPNA 5EE0A 3SD7A 4PL1A 2CRXA 3GIJA 3TADA 3H8MA 1OXJA 1TFRA 1ZQZA 2LYBA 4O3NA 4B9VA 4C8OA 2XICA 4MHVA 1ZQVA 4QZCA 4M9LA 3HKZF 4C7ZA 1X42A 7ICMA 2ISPA 1XS9D 1LKYB 1Y88A 1L7MA 3PX4A 4RT3A 2K8BB 4Q44A 2H3FA 5KFFA 3QXGA 1ZQIA 3QU5A 1B4FA 1JMSA 2G08A 3LWLA 4I2EA 1D8YA 5ALSA 4P0PB 5AHXA 4J9RA 2WF9A 1QQ5A 4B9SA 2QB0B 2A1JA 3KHHA 1F44A 3M8SA 1JI7A 2HHWA 1N5XA 1QLNA 3L5KA 5AM5A 2YMMA 4US9A 4DSIA 2LHTA 4RPXA 4CGZA
chains in the Genus database with same CATH topology
4DQSA 5F9LA 4M6WB 4R65A 3Q8KA 4IQVA 4I2BA 4IRCA 1ZQCA 3H4BA 3BQ1A 3MBYA 4Z6FA 3NGDA 4ECWA 1KFTA 5KFRA 5DQGA 4DWIA 3T3FA 1ZQYA 2ZUDA 5KFWA 5CHGA 1S97A 3K4GA 4ECRA 2FLPA 4R64A 2KN7A 5J0WA 4DSEA 4QZAA 2HHTA 5KFSA 2BCVA 3TFRA 3PW5A 1KTQA 1X9WA 3MFIA 1TVAA 4YD2A 4EBEA 4DEZA 1U9LA 3RH5A 1RYRA 1UT8A 4I2DA 1TAQA 4YR2A 4YMOA 2XCPA 4J9OA 3JPRA 2HHVA 1ZQPA 4J9LA 1U4BA 1CUKA 1BGXT 3IHQB 3C5FA 3PW2A 3GFKB 4BWMA 4J9PA 1NK4A 1SKSA 2VA3A 5J0PA 1XO1A 4GXJA 2XY5A 5IIJA 1C7YA 4PHDA 2PFPA 3C21A 4O3SA 1JIHA 4EEYA 4F5RA 7ICFA 4KLIA 9ICTA 3KHLA 3MGHA 1ZQLA 1ZQNA 4B9NA 5DBAA 1WCLA 2VA8A 3SZ2A 2KZ3A 4LZDA 1XWLA 4R8UB 2OWOA 4I2CA 5JUMA 3TFSA 3M9OB 2HHQA 1U47A 9ICGA 5HHHA 1KDHA 1DOQA 1UA0A 9ICHA 5J0YA 4BGDA 3OHBA 1A76A 4EYHB 1N56A 2PFOA 5DGBA 8ICSA 9ICWA 4FBUA 5DG8A 2AQ4A 2A1JB 5IILA 3SV3A 3PW4A 4M9GA 4Q8EA 2RDIA 2Q0ZX 1NK7A 8ICJA 4C8MA 5IINA 4TQSA 4O3OA 4QWAA 9ICFA 1JXEA 4UB1A 5J0TA 3ISBA 3QEAZ 3V72A 2NRXA 4F2RA 4Z6DA 4QZHA 4RU9A 5KFLA 4P4PA 4DL5A 3OSPA 2HVHA 4TUSA 4B9LA 4I2AA 9ICBA 5KFXA 3HX0A 2R8GA 2DPIA 3MDCA 3JPOA 4RUAA 3JPPA 4KTQA 1B22A 1SL2A 3BQTA 2GWSA 1Z3EB 3RJIA 2FMPA 1AROP 2C22A 5C5JA 4C8KA 3LDAA 4YCXA 3C2KA 2BPCA 4B9UA 4JUZA 4RQ6A 3M9MB 4KLOA 2UVUA 4E0DA 3PNCA 1U49A 4O3RA 1KEJA 3RTVA 9ICUA 5KFEA 3OSNA 2H5XA 4DSJA 4RT2A 4ECVA 4O0IA 4YMMA 5KT2A 2J6UA 4I2HA 4MFFA 4KLJA 7ICKA 3EPGA 5KFNA 5IIIA 4DOCA 4QW8A 1NK0A 5KFIA 1L3VA 3G6YA 1HUZA 2IHMA 4Q8FA 7ICOA 4QZ9A 1S10A 5DGAA 4P2HA 5KFMA 1RYSA 1ZQQA 2IBKA 3GV5B 7ICVA 4P4MA 3E2EA 1QSYA 3T5KA 2HHUA 5KFTA 4EZ6A 1T8EA 4I2FA 4Q45A 4DL4A 3RJGA 5KFOA 4KLQA 4YD1A 3K75D 8ICYA 4B9MA 4CCHA 7ICRA 1KSPA 2BGWA 4MFAA 5J0SA 4DQPA 4F50A 2PFQA 2FLLA 4NLGA 3LWMA 5J0XA 4RNNA 1KFDA 3OJUA 3ISCA 4NM2A 3EYZA 3EWAA 3EZ5A 3C5GA 3PW7A 3H8SA 1NK8A 3RJEA 5KT3A 8ICWA 1BPYA 4NY8A 4M9NA 4YQWA 2UVVA 1NKBA 9ICJA 4QZBA 3M8RA 2ZTEA 8ICIA 2ASJA 3QEBZ 4ELVA 3MABA 3GIMA 5L1JA 3JPQA 4DOAA 3T5JA 2ALZA 1TKDA 4TUPA 2AGQA 4ZH4A 2XO7A 3PVXA 5HP4A 1NJYA 3HW8A 4KLMA 4KLUA 1WCNA 4Z6CA 4BDPA 2HHXA 8ICFA 9ICAA 2JZBA 2NRWA 1CEZA 8ICQA 4KLFA 4F5QA 3Q8LA 4KLGA 1XSPA 1ZQDA 4YR0A 2LYHA 3RB3A 3RJFA 4PHPA 1MSWD 4FO6A 1ZQEA 4QWCA 8ICAA 4ED1A 4JV2A 5KTQA 9ICNA 4KN7A 4ECUA 3BQ2A 5KT7A 1ZQSA 4KLEA 4YXJA 4JWNA 4R63A 2FPLA 2ISOA 3ZDDA 1S0MA 2PI4A 4K4IA 3TAPA 2XGPA 5D46A 4QW9A 2R8JA 5KG3A 5CB1A 1T4GA 2P6RA 1B43A 1XU4A 2BCRA 1LB2B 4TQRA 3MDAA 4RUCA 9ICCA 4DSFA 1JXLA 5KFCA 3MR3A 4YXMA 5DQIA 5DB8A 4TURA 4ECYA 1ZYQA 4GC7A 3H4DA 4J9MA 1ZQRA 3PV8A 2AGOA 1NK9A 7ICHA 5J2CA 4F5PA 4DL2A 2W9CB 5J0OA 2XY7A 5J2EA 4GLXA 4O5EA 3MR6A 4DF8A 3UXNA 3Q8MA 2C28A 5KG4A 2I9GA 2ASDA 4P4OA 4DL3A 3BJYA 1ZQBA 7ICTA 8ICUA 1N48A 5J2GA 4M04A 5KT4A 1SL1A 2KFNA 2VANA 3C1ZA 3GQCA 5L1IA 3EPIA 4DS5A 1NJXA 1ZQJA 3V7KA 4RQ3A 3PX0A 5HMMA 1TV9A 1TK0A 1S0NA 4ELTA 2W9CA 3RRHA 3ZDEA 1NKEA 1BPXA 4Q43A 4J9QA 5DLGA 3IM1A 5L1KA 4F4KA 2BPGA 3C1YA 3UXPA 5BOMA 1L3UA 1L3SA 1NK6A 3RR8A 8ICCA 3PW0A 2J6TA 4RQ1A 4YR3A 4XQ8A 4F4XA 1SKWA 7ICUA 4PH5A 1U48A 3BDPA 4F8RA 4C8LA 2FPKA 2IHNA 5J0QA 2RDJA 4DOBA 1HJPA 4C8NA 2DFLA 3ORYA 2MUTA 8ICKA 4O3PA 5KFUA 4UB3A 5L1LA 1S9FA 4BXOA 5DG9A 5IIOA 5D49A 3RB6A 3C23A 4MF8A 5DBCA 8ICMA 4O3QA 4MEYA 4PGXA 5J2KA 4J9SA 4I28A 5KFAA 4M2YA 4UQGA 8ICRA 5KFQA 5J2HA 5DB9A 2PFNA 2HVIA 5EWGA 5BPCA 3PMNA 2W9BA 3V7JA 3RB0A 4IR1A 4EBCA 4ECTA 1ZQAA 5KT6A 4R66A 1IXRA 8ICXA 4BXOB 3PMLA 4QZ8A 1A77A 5KG1A 2R8HA 3UQ2A 2AU0A 4DQIA 4LZGA 4I2IA 8ICEA 2BQUA 2PXIA 4ED7A 5KFPA 5J0RA 2AGPA 4KLSA 3Q8PB 4DLGA 4DL7A 2KFZA 1S76D 1UA1A 4PHAA 3MFHA 1COOA 7ICIA 3ZDCA 3H40A 3FYHA 4TUQA 2UVRA 2BKEA 5EOZA 5J2DA 4DQRA 1RZTA 1SL0A 1K1SA 4JK1A 4DSKA 4UAYA 4ECZA 5KFDA 3KHGA 2Y1IA 4M9JA 4FS2A 9ICEA 1ZQWA 1S0OA 2KTQA 9ICLA 1QSLA 2BCQA 4NLNA 3MGIA 4F2SA 1ZQTA 3ZD8A 1MC8A 4QWDA 4Z6EA 5F9NA 4PGQA 4DO9A 4ED8A 2JEGA 1S77D 4NXZA 1Z00B 4FBTA 4O9MA 2IA6A 9ICVA 5DDMA 4YFKA 2HHSA 3G6XA 4M0AA 1MQ2A 4NM1A 4DLEA 1EXNA 5J2BA 1MQ3A 4KITB 2ZUBA 2F1HA 1D9DA 3GIKA 1NJWA 5EWEA 1NJZA 2UVWA 4NLKA 2PI5A 8ICZA 2NRZA 2ATLA 4O5CA 3C2MA 3Q8QB 3HP6A 3THVA 1ZJNA 3EW9A 4EBDA 4MFCA 3MR2A 5KFYA 3KHRA 4DS4A 1Z00A 4DF4A 2BQ3A 1X9MA 2R8KA 3ZDAA 1KLNA 2C2RA 2BDPA 2ZJ8A 5TZVA 4ED0A 4J9KA 1S0VA 4YVZA 3V6KA 1K1QA 2M9NA 5KG2A 3OJSA 3RB4A 4M9HA 8ICOA 2F1JA 4F5NA 3ISDA 2DPJA 3PY8A 4UBCA 4GC6A 2B21A 4ECSA 4DL6A 2BQRA 2I1QA 1BPZA 2V9WA 3TI0A 5J2AA 1NK5A 2JZBB 4I29A 5EWFA 4B9TA 4JWMA 4DFJA 8ICLA 2F1IA 3SI8A 4NLZA 5IIKA 4M47A 7ICNA 4M6WA 1T7PA 7ICJA 2Y1JA 5J0UA 3GV7B 7ICPA 5BOLA 2JEJA 3G6VA 5KG7A 2W8KA 5CP2A 5J29A 3SYZA 4R8UA 3Q8RB 3OGUA 5KFGA 3GIIA 1U45A 3RJHA 5HMLA 3AU6A 1RXVA 4MEXA 2J6SA 3T5HA 2C2DA 1XC9A 2FMQA 2FLNA 9ICXA 3SV4A 8ICHA 3TAQA 1ZQHA 4UAWA 8ICBA 3UXOA 9ICKA 4QZDA 5KFVA 3HT3A 4HYKA 4KMUA 4KLLA 5L9XA 4G3IA 3C2LA 5DQHA 2HW3A 4IRKA 3JPTA 1ZJMA 4JV1A 3Q8SB 4DFMA 4KN4A 4F4WA 3ETLA 1D8LA 3B0XA 1T3NA 2IMWP 4IR9A 9ICOA 9ICIA 4F91B 1BPDA 3FDSA 5KFHA 4YG2A 2XC9A 2AJQA 9ICQA 3BQ0A 1D9FA 3NTUA 2ASLA 4F93B 3V6HA 2R8IA 4EZ9A 3AUOA 4RQ8A 2C2EA 1V9PA 2BCUA 4IRDA 3GV8B 4IQUA 5D4BA 8ICGA 3PR5B 3RRGA 3N97B 8ICTA 7ICSA 3GILA 4QZFA 4K4HA 2BCSA 4KLTA 3B0YA 1X2IA 4KLDA 4ELUA 2XCAA 1QTMA 1DGSA 1PZNA 4XUSA 9ICSA 4I2GA 7ICQA 2BPFA 4RNMA 2ZUCA 4RQ5A 2W8LA 3TQ1A 3ZD9A 4LVSA 3TANA 4F4YA 5KG5A 4F5OA 4ECXA 1ZQFA 3MR5A 3RBEA 4RQ2A 3QZ7A 4JV0A 4J9NA 5HNKA 4F3OA 4QWEA 1RXWA 5KG6A 2FMSA 8ICVA 5KT5A 5DLFA 1NKCA 4XA5A 3ZDBA 4RZRA 2W9AA 3TARA 3RJJA 2W9MA 1UT5A 4I2JA 4DFKA 4UB2A 3LK9A 4RQ7A 7ICEA 2P66A 1QSSA 2FPMA 5KFJA 2V4RA 4BWJA 3RR7A 2NRVA 2ZTDA 2NRTA 2W9BB 5IIMA 1XSLA 5J2JA 4QZGA 4KLHA 1TAUA 2JEIA 1NOMA 2ZJ5A 3H8JA 2AQ0A 4ECQA 4DQQA 1L5UA 1HUOA 5CA7A 1X9SA 1LV5A 5DG7A 4F92B 4ED3A 1SKRA 3GDXA 5DB6A 3UQ0A 4RPYA 1L3TA 3OHAA 5KFZA 3V6JA 4ED2A 1KRPA 1KFSA 4I27A 1ZETA 4MF2A 1RPLA 3JPNA 3KTQA 5HHIA 7ICGA 4RQ0A 2MUTB 3RAXA 1JN3A 4DFPA 5DB7A 4IQTA 4K4GA 3GIJA 3T5LA 5DKWA 3RBDA 1TFRA 1ZQZA 4O3NA 4FS1A 2ZJAA 4B9VA 1BPEA 4XRHA 4C8OA 3PX6A 5J2IA 2KZZA 1ZQVA 4UAZA 4QZCA 2WTFA 2XY6A 3RJKA 3PO4A 3H8WA 4PPXA 4M9LA 1ZQOA 1BPBA 5KFBA 1ZQKA 2KZMA 8ICNA 7ICMA 1JX4A 8ICPA 2BHNA 4EYIB 5CWRA 4IQWA 4YMNA 2ISPA 3QE9Y 1XS9D 4RNOA 3UPQA 2V4QA 3PO5A 1Y88A 2P6UA 4QZEA 4GXKA 3PX4A 4RT3A 4RPZA 5DBBA 3N4MB 1TK5A 4YP3A 4UB5A 9ICMA 4Q44A 4GXIA 3V7LA 1ZQXA 5KFFA 4YN4A 1ZQIA 1ZQUA 4UB4A 1JMSA 7ICLA 2VA2A 3LWLA 3AU2A 4I2EA 1IM4A 1D8YA 9ICPA 2BR0A 4F4ZA 4J9RA 4QZIA 3M9NB 5J2FA 4B9SA 1H38A 4ED6A 5CJ7A 1XSNA 2A1JA 3H7IA 1BVSA 4PGYA 3PR4A 5DDYA 3JPSA 2ZTCA 4RQ4A 3KHHA 3HWTA 3M8SA 5CR0A 2MAXA 5KFKA 1SZPA 4O5KA 2XGQA 4UBBA 5KG0A 2HHWA 9ICRA 1ZQMA 3RAQA 4QWBA 3RH6A 1TK8A 1ZQGA 1QLNA 2JEFA 4DSLA 3QZ8A 4X5VA 4DSIA 4RPXA 4PHEA 3HPOA 3RH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQS A;  5F9L A;  4M6W B;  4R65 A;  3Q8K A;  4IQV A;  4I2B A;  4IRC A;  1ZQC A;  3H4B A;  3BQ1 A;  3MBY A;  4Z6F A;  3NGD A;  4ECW A;  1KFT A;  5KFR A;  5DQG A;  4DWI A;  3T3F A;  1ZQY A;  2ZUD A;  5KFW A;  5CHG A;  1S97 A;  3K4G A;  4ECR A;  2FLP A;  4R64 A;  2KN7 A;  5J0W A;  4DSE A;  4QZA A;  2HHT A;  5KFS A;  2BCV A;  3TFR A;  3PW5 A;  1KTQ A;  1X9W A;  3MFI A;  1TVA A;  4YD2 A;  4EBE A;  4DEZ A;  1U9L A;  3RH5 A;  1RYR A;  1UT8 A;  4I2D A;  1TAQ A;  4YR2 A;  4YMO A;  2XCP A;  4J9O A;  3JPR A;  2HHV A;  1ZQP A;  4J9L A;  1U4B A;  1CUK A;  1BGX T;  3IHQ B;  3C5F A;  3PW2 A;  3GFK B;  4BWM A;  4J9P A;  1NK4 A;  1SKS A;  2VA3 A;  5J0P A;  1XO1 A;  4GXJ A;  2XY5 A;  5IIJ A;  1C7Y A;  4PHD A;  2PFP A;  3C21 A;  4O3S A;  1JIH A;  4EEY A;  4F5R A;  7ICF A;  4KLI A;  9ICT A;  3KHL A;  3MGH A;  1ZQL A;  1ZQN A;  4B9N A;  5DBA A;  1WCL A;  2VA8 A;  3SZ2 A;  2KZ3 A;  4LZD A;  1XWL A;  4R8U B;  2OWO A;  4I2C A;  5JUM A;  3TFS A;  3M9O B;  2HHQ A;  1U47 A;  9ICG A;  5HHH A;  1KDH A;  1DOQ A;  1UA0 A;  9ICH A;  5J0Y A;  4BGD A;  3OHB A;  1A76 A;  4EYH B;  1N56 A;  2PFO A;  5DGB A;  8ICS A;  9ICW A;  4FBU A;  5DG8 A;  2AQ4 A;  2A1J B;  5IIL A;  3SV3 A;  3PW4 A;  4M9G A;  4Q8E A;  2RDI A;  2Q0Z X;  1NK7 A;  8ICJ A;  4C8M A;  5IIN A;  4TQS A;  4O3O A;  4QWA A;  9ICF A;  1JXE A;  4UB1 A;  5J0T A;  3ISB A;  3QEA Z;  3V72 A;  2NRX A;  4F2R A;  4Z6D A;  4QZH A;  4RU9 A;  5KFL A;  4P4P A;  4DL5 A;  3OSP A;  2HVH A;  4TUS A;  4B9L A;  4I2A A;  9ICB A;  5KFX A;  3HX0 A;  2R8G A;  2DPI A;  3MDC A;  3JPO A;  4RUA A;  3JPP A;  4KTQ A;  1B22 A;  1SL2 A;  3BQT A;  2GWS A;  1Z3E B;  3RJI A;  2FMP A;  1ARO P;  2C22 A;  5C5J A;  4C8K A;  3LDA A;  4YCX A;  3C2K A;  2BPC A;  4B9U A;  4JUZ A;  4RQ6 A;  3M9M B;  4KLO A;  2UVU A;  4E0D A;  3PNC A;  1U49 A;  4O3R A;  1KEJ A;  3RTV A;  9ICU A;  5KFE A;  3OSN A;  2H5X A;  4DSJ A;  4RT2 A;  4ECV A;  4O0I A;  4YMM A;  5KT2 A;  2J6U A;  4I2H A;  4MFF A;  4KLJ A;  7ICK A;  3EPG A;  5KFN A;  5III A;  4DOC A;  4QW8 A;  1NK0 A;  5KFI A;  1L3V A;  3G6Y A;  1HUZ A;  2IHM A;  4Q8F A;  7ICO A;  4QZ9 A;  1S10 A;  5DGA A;  4P2H A;  5KFM A;  1RYS A;  1ZQQ A;  2IBK A;  3GV5 B;  7ICV A;  4P4M A;  3E2E A;  1QSY A;  3T5K A;  2HHU A;  5KFT A;  4EZ6 A;  1T8E A;  4I2F A;  4Q45 A;  4DL4 A;  3RJG A;  5KFO A;  4KLQ A;  4YD1 A;  3K75 D;  8ICY A;  4B9M A;  4CCH A;  7ICR A;  1KSP A;  2BGW A;  4MFA A;  5J0S A;  4DQP A;  4F50 A;  2PFQ A;  2FLL A;  4NLG A;  3LWM A;  5J0X A;  4RNN A;  1KFD A;  3OJU A;  3ISC A;  4NM2 A;  3EYZ A;  3EWA A;  3EZ5 A;  3C5G A;  3PW7 A;  3H8S A;  1NK8 A;  3RJE A;  5KT3 A;  8ICW A;  1BPY A;  4NY8 A;  4M9N A;  4YQW A;  2UVV A;  1NKB A;  9ICJ A;  4QZB A;  3M8R A;  2ZTE A;  8ICI A;  2ASJ A;  3QEB Z;  4ELV A;  3MAB A;  3GIM A;  5L1J A;  3JPQ A;  4DOA A;  3T5J A;  2ALZ A;  1TKD A;  4TUP A;  2AGQ A;  4ZH4 A;  2XO7 A;  3PVX A;  5HP4 A;  1NJY A;  3HW8 A;  4KLM A;  4KLU A;  1WCN A;  4Z6C A;  4BDP A;  2HHX A;  8ICF A;  9ICA A;  2JZB A;  2NRW A;  1CEZ A;  8ICQ A;  4KLF A;  4F5Q A;  3Q8L A;  4KLG A;  1XSP A;  1ZQD A;  4YR0 A;  2LYH A;  3RB3 A;  3RJF A;  4PHP A;  1MSW D;  4FO6 A;  1ZQE A;  4QWC A;  8ICA A;  4ED1 A;  4JV2 A;  5KTQ A;  9ICN A;  4KN7 A;  4ECU A;  3BQ2 A;  5KT7 A;  1ZQS A;  4KLE A;  4YXJ A;  4JWN A;  4R63 A;  2FPL A;  2ISO A;  3ZDD A;  1S0M A;  2PI4 A;  4K4I A;  3TAP A;  2XGP A;  5D46 A;  4QW9 A;  2R8J A;  5KG3 A;  5CB1 A;  1T4G A;  2P6R A;  1B43 A;  1XU4 A;  2BCR A;  1LB2 B;  4TQR A;  3MDA A;  4RUC A;  9ICC A;  4DSF A;  1JXL A;  5KFC A;  3MR3 A;  4YXM A;  5DQI A;  5DB8 A;  4TUR A;  4ECY A;  1ZYQ A;  4GC7 A;  3H4D A;  4J9M A;  1ZQR A;  3PV8 A;  2AGO A;  1NK9 A;  7ICH A;  5J2C A;  4F5P A;  4DL2 A;  2W9C B;  5J0O A;  2XY7 A;  5J2E A;  4GLX A;  4O5E A;  3MR6 A;  4DF8 A;  3UXN A;  3Q8M A;  2C28 A;  5KG4 A;  2I9G A;  2ASD A;  4P4O A;  4DL3 A;  3BJY A;  1ZQB A;  7ICT A;  8ICU A;  1N48 A;  5J2G A;  4M04 A;  5KT4 A;  1SL1 A;  2KFN A;  2VAN A;  3C1Z A;  3GQC A;  5L1I A;  3EPI A;  4DS5 A;  1NJX A;  1ZQJ A;  3V7K A;  4RQ3 A;  3PX0 A;  5HMM A;  1TV9 A;  1TK0 A;  1S0N A;  4ELT A;  2W9C A;  3RRH A;  3ZDE A;  1NKE A;  1BPX A;  4Q43 A;  4J9Q A;  5DLG A;  3IM1 A;  5L1K A;  4F4K A;  2BPG A;  3C1Y A;  3UXP A;  5BOM A;  1L3U A;  1L3S A;  1NK6 A;  3RR8 A;  8ICC A;  3PW0 A;  2J6T A;  4RQ1 A;  4YR3 A;  4XQ8 A;  4F4X A;  1SKW A;  7ICU A;  4PH5 A;  1U48 A;  3BDP A;  4F8R A;  4C8L A;  2FPK A;  2IHN A;  5J0Q A;  2RDJ A;  4DOB A;  1HJP A;  4C8N A;  2DFL A;  3ORY A;  2MUT A;  8ICK A;  4O3P A;  5KFU A;  4UB3 A;  5L1L A;  1S9F A;  4BXO A;  5DG9 A;  5IIO A;  5D49 A;  3RB6 A;  3C23 A;  4MF8 A;  5DBC A;  8ICM A;  4O3Q A;  4MEY A;  4PGX A;  5J2K A;  4J9S A;  4I28 A;  5KFA A;  4M2Y A;  4UQG A;  8ICR A;  5KFQ A;  5J2H A;  5DB9 A;  2PFN A;  2HVI A;  5EWG A;  5BPC A;  3PMN A;  2W9B A;  3V7J A;  3RB0 A;  4IR1 A;  4EBC A;  4ECT A;  1ZQA A;  5KT6 A;  4R66 A;  1IXR A;  8ICX A;  4BXO B;  3PML A;  4QZ8 A;  1A77 A;  5KG1 A;  2R8H A;  3UQ2 A;  2AU0 A;  4DQI A;  4LZG A;  4I2I A;  8ICE A;  2BQU A;  2PXI A;  4ED7 A;  5KFP A;  5J0R A;  2AGP A;  4KLS A;  3Q8P B;  4DLG A;  4DL7 A;  2KFZ A;  1S76 D;  1UA1 A;  4PHA A;  3MFH A;  1COO A;  7ICI A;  3ZDC A;  3H40 A;  3FYH A;  4TUQ A;  2UVR A;  2BKE A;  5EOZ A;  5J2D A;  4DQR A;  1RZT A;  1SL0 A;  1K1S A;  4JK1 A;  4DSK A;  4UAY A;  4ECZ A;  5KFD A;  3KHG A;  2Y1I A;  4M9J A;  4FS2 A;  9ICE A;  1ZQW A;  1S0O A;  2KTQ A;  9ICL A;  1QSL A;  2BCQ A;  4NLN A;  3MGI A;  4F2S A;  1ZQT A;  3ZD8 A;  1MC8 A;  4QWD A;  4Z6E A;  5F9N A;  4PGQ A;  4DO9 A;  4ED8 A;  2JEG A;  1S77 D;  4NXZ A;  1Z00 B;  4FBT A;  4O9M A;  2IA6 A;  9ICV A;  5DDM A;  4YFK A;  2HHS A;  3G6X A;  4M0A A;  1MQ2 A;  4NM1 A;  4DLE A;  1EXN A;  5J2B A;  1MQ3 A;  4KIT B;  2ZUB A;  2F1H A;  1D9D A;  3GIK A;  1NJW A;  5EWE A;  1NJZ A;  2UVW A;  4NLK A;  2PI5 A;  8ICZ A;  2NRZ A;  2ATL A;  4O5C A;  3C2M A;  3Q8Q B;  3HP6 A;  3THV A;  1ZJN A;  3EW9 A;  4EBD A;  4MFC A;  3MR2 A;  5KFY A;  3KHR A;  4DS4 A;  1Z00 A;  4DF4 A;  2BQ3 A;  1X9M A;  2R8K A;  3ZDA A;  1KLN A;  2C2R A;  2BDP A;  2ZJ8 A;  5TZV A;  4ED0 A;  4J9K A;  1S0V A;  4YVZ A;  3V6K A;  1K1Q A;  2M9N A;  5KG2 A;  3OJS A;  3RB4 A;  4M9H A;  8ICO A;  2F1J A;  4F5N A;  3ISD A;  2DPJ A;  3PY8 A;  4UBC A;  4GC6 A;  2B21 A;  4ECS A;  4DL6 A;  2BQR A;  2I1Q A;  1BPZ A;  2V9W A;  3TI0 A;  5J2A A;  1NK5 A;  2JZB B;  4I29 A;  5EWF A;  4B9T A;  4JWM A;  4DFJ A;  8ICL A;  2F1I A;  3SI8 A;  4NLZ A;  5IIK A;  4M47 A;  7ICN A;  4M6W A;  1T7P A;  7ICJ A;  2Y1J A;  5J0U A;  3GV7 B;  7ICP A;  5BOL A;  2JEJ A;  3G6V A;  5KG7 A;  2W8K A;  5CP2 A;  5J29 A;  3SYZ A;  4R8U A;  3Q8R B;  3OGU A;  5KFG A;  3GII A;  1U45 A;  3RJH A;  5HML A;  3AU6 A;  1RXV A;  4MEX A;  2J6S A;  3T5H A;  2C2D A;  1XC9 A;  2FMQ A;  2FLN A;  9ICX A;  3SV4 A;  8ICH A;  3TAQ A;  1ZQH A;  4UAW A;  8ICB A;  3UXO A;  9ICK A;  4QZD A;  5KFV A;  3HT3 A;  4HYK A;  4KMU A;  4KLL A;  5L9X A;  4G3I A;  3C2L A;  5DQH A;  2HW3 A;  4IRK A;  3JPT A;  1ZJM A;  4JV1 A;  3Q8S B;  4DFM A;  4KN4 A;  4F4W A;  3ETL A;  1D8L A;  3B0X A;  1T3N A;  2IMW P;  4IR9 A;  9ICO A;  9ICI A;  4F91 B;  1BPD A;  3FDS A;  5KFH A;  4YG2 A;  2XC9 A;  2AJQ A;  9ICQ A;  3BQ0 A;  1D9F A;  3NTU A;  2ASL A;  4F93 B;  3V6H A;  2R8I A;  4EZ9 A;  3AUO A;  4RQ8 A;  2C2E A;  1V9P A;  2BCU A;  4IRD A;  3GV8 B;  4IQU A;  5D4B A;  8ICG A;  3PR5 B;  3RRG A;  3N97 B;  8ICT A;  7ICS A;  3GIL A;  4QZF A;  4K4H A;  2BCS A;  4KLT A;  3B0Y A;  1X2I A;  4KLD A;  4ELU A;  2XCA A;  1QTM A;  1DGS A;  1PZN A;  4XUS A;  9ICS A;  4I2G A;  7ICQ A;  2BPF A;  4RNM A;  2ZUC A;  4RQ5 A;  2W8L A;  3TQ1 A;  3ZD9 A;  4LVS A;  3TAN A;  4F4Y A;  5KG5 A;  4F5O A;  4ECX A;  1ZQF A;  3MR5 A;  3RBE A;  4RQ2 A;  3QZ7 A;  4JV0 A;  4J9N A;  5HNK A;  4F3O A;  4QWE A;  1RXW A;  5KG6 A;  2FMS A;  8ICV A;  5KT5 A;  5DLF A;  1NKC A;  4XA5 A;  3ZDB A;  4RZR A;  2W9A A;  3TAR A;  3RJJ A;  2W9M A;  1UT5 A;  4I2J A;  4DFK A;  4UB2 A;  3LK9 A;  4RQ7 A;  7ICE A;  2P66 A;  1QSS A;  2FPM A;  5KFJ A;  2V4R A;  4BWJ A;  3RR7 A;  2NRV A;  2ZTD A;  2NRT A;  2W9B B;  5IIM A;  1XSL A;  5J2J A;  4QZG A;  4KLH A;  1TAU A;  2JEI A;  1NOM A;  2ZJ5 A;  3H8J A;  2AQ0 A;  4ECQ A;  4DQQ A;  1L5U A;  1HUO A;  5CA7 A;  1X9S A;  1LV5 A;  5DG7 A;  4F92 B;  4ED3 A;  1SKR A;  3GDX A;  5DB6 A;  3UQ0 A;  4RPY A;  1L3T A;  3OHA A;  5KFZ A;  3V6J A;  4ED2 A;  1KRP A;  1KFS A;  4I27 A;  1ZET A;  4MF2 A;  1RPL A;  3JPN A;  3KTQ A;  5HHI A;  7ICG A;  4RQ0 A;  2MUT B;  3RAX A;  1JN3 A;  4DFP A;  5DB7 A;  4IQT A;  4K4G A;  3GIJ A;  3T5L A;  5DKW A;  3RBD A;  1TFR A;  1ZQZ A;  4O3N A;  4FS1 A;  2ZJA A;  4B9V A;  1BPE A;  4XRH A;  4C8O A;  3PX6 A;  5J2I A;  2KZZ A;  1ZQV A;  4UAZ A;  4QZC A;  2WTF A;  2XY6 A;  3RJK A;  3PO4 A;  3H8W A;  4PPX A;  4M9L A;  1ZQO A;  1BPB A;  5KFB A;  1ZQK A;  2KZM A;  8ICN A;  7ICM A;  1JX4 A;  8ICP A;  2BHN A;  4EYI B;  5CWR A;  4IQW A;  4YMN A;  2ISP A;  3QE9 Y;  1XS9 D;  4RNO A;  3UPQ A;  2V4Q A;  3PO5 A;  1Y88 A;  2P6U A;  4QZE A;  4GXK A;  3PX4 A;  4RT3 A;  4RPZ A;  5DBB A;  3N4M B;  1TK5 A;  4YP3 A;  4UB5 A;  9ICM A;  4Q44 A;  4GXI A;  3V7L A;  1ZQX A;  5KFF A;  4YN4 A;  1ZQI A;  1ZQU A;  4UB4 A;  1JMS A;  7ICL A;  2VA2 A;  3LWL A;  3AU2 A;  4I2E A;  1IM4 A;  1D8Y A;  9ICP A;  2BR0 A;  4F4Z A;  4J9R A;  4QZI A;  3M9N B;  5J2F A;  4B9S A;  1H38 A;  4ED6 A;  5CJ7 A;  1XSN A;  2A1J A;  3H7I A;  1BVS A;  4PGY A;  3PR4 A;  5DDY A;  3JPS A;  2ZTC A;  4RQ4 A;  3KHH A;  3HWT A;  3M8S A;  5CR0 A;  2MAX A;  5KFK A;  1SZP A;  4O5K A;  2XGQ A;  4UBB A;  5KG0 A;  2HHW A;  9ICR A;  1ZQM A;  3RAQ A;  4QWB A;  3RH6 A;  1TK8 A;  1ZQG A;  1QLN A;  2JEF A;  4DSL A;  3QZ8 A;  4X5V A;  4DSI A;  4RPX A;  4PHE A;  3HPO A;  3RH4 A; 
#chains in the Genus database with same CATH topology
 4DQS A;  2E1E A;  3Q8K A;  4I2B A;  3H4B A;  2FJ6 A;  2KKV A;  1DRG A;  3QNM A;  5CHG A;  1S97 A;  3K4G A;  1VJ5 A;  4QZA A;  1TVA A;  4GIB A;  4YD2 A;  4EBE A;  3RH5 A;  1SGG A;  5FP0 A;  1TAQ A;  4J9O A;  1ZQP A;  1U4B A;  1BGX T;  3IHQ B;  1D8B A;  4J9P A;  1XO1 A;  2E8P A;  1JIH A;  4RQM A;  2W54 A;  3MGV A;  5AK5 A;  4KLI A;  2EZY A;  3SZ2 A;  1PK1 A;  3TFS A;  2HHQ A;  5HHH A;  4BGD A;  1N56 A;  8ICS A;  3B9J A;  1N60 A;  4ZOH C;  4FBU A;  3TAC B;  5IIL A;  3T79 A;  2YQE A;  3PW4 A;  1ECW A;  8ICJ A;  1SV0 A;  2RLT A;  5J0T A;  2HVH A;  3OSP A;  2DPI A;  4RUA A;  2DQN B;  1O08 A;  2Y9U A;  2GWS A;  3BQT A;  3RJI A;  1ARO P;  2C22 A;  4C8K A;  2BPC A;  4B9U A;  4RQ6 A;  3J81 j;  4KLO A;  4P0Q B;  4O3R A;  1KEJ A;  5KFE A;  3WK6 A;  3OSN A;  4DSJ A;  4MFF A;  2J6U A;  4YMM A;  7ICK A;  2JRZ A;  4KLJ A;  5AKE A;  5III A;  2LKY A;  2LPE A;  1HUZ A;  3WKC A;  3D2S A;  2W3R A;  3WKD A;  3T5K A;  4OCZ A;  4Q45 A;  4KLQ A;  3I1Y A;  4CDG A;  7ICR A;  2XI9 A;  2RRD A;  2PMZ C;  3ISC A;  4NM2 A;  3C5G A;  1NK8 A;  1BNO A;  5KT3 A;  8ICW A;  3KOO A;  2UVV A;  1NKB A;  4Y2Q A;  4TUP A;  1NJY A;  4KLM A;  2HBM A;  3BZC A;  2NRW A;  2G5I B;  4PHP A;  5ALT A;  4KN7 A;  3L3F X;  4ECU A;  2OH2 A;  2ISO A;  2PI4 A;  2XGP A;  5KG3 A;  1M6Y A;  1N63 A;  5AM4 A;  2XID A;  1B43 A;  4TQR A;  2W7P A;  3N28 A;  4YXM A;  4O3M A;  4TUR A;  1ZYQ A;  4J9M A;  1NK9 A;  2AXT U;  5HR6 A;  5J0O A;  5ALZ A;  2XY7 A;  3A0B U;  3UXN A;  2I9G A;  4DL3 A;  3BJY A;  1SV4 A;  2VAN A;  3C1Z A;  3AEV A;  4OJ6 A;  1Z4O A;  4AP9 A;  3PX0 A;  4QJF B;  2OM6 A;  2A3V A;  5EE1 A;  1NKE A;  5DLG A;  2BPG A;  3C1Y A;  5AI8 A;  4RQ1 A;  4YR3 A;  1JRP A;  7ICU A;  4PH5 A;  1U48 A;  1SXE A;  4C8L A;  2K4H A;  2K89 A;  2MUT A;  5KFU A;  2ZXH A;  3RB6 A;  5ALR A;  4MF8 A;  2KJ5 A;  3AQF A;  3D2N A;  5K4L A;  3RB0 A;  5KT6 A;  4R66 A;  4BXO B;  4LZG A;  2PXI A;  2AGP A;  1S76 D;  4TUQ A;  2UVR A;  4DSK A;  5KFD A;  3KHG A;  2Y1I A;  4M9J A;  4FS2 A;  1ZQW A;  1QQ7 A;  3NVZ A;  2GLE A;  3NRW A;  3BS7 A;  4KX5 A;  1MN8 A;  1MC8 A;  2K60 A;  3QU7 A;  2JEG A;  2EZZ A;  1S77 D;  4O9M A;  4M0A A;  4PZO A;  4CNQ A;  2YN4 A;  4NLK A;  5EWE A;  2PI5 A;  2NRZ A;  4O5C A;  3Q8Q B;  3EW9 A;  3KHR A;  1Z00 A;  4DF4 A;  1O03 A;  3QU4 A;  2ZIU B;  2BDP A;  2ZJ8 A;  3QUQ A;  3N7P D;  4J9K A;  2JV3 A;  1N2X A;  4YVZ A;  2IOH A;  1X6I A;  4NL9 C;  4F5N A;  2DPJ A;  4UBC A;  4GC6 A;  4ECS A;  2BQR A;  4DL6 A;  2V9W A;  3WK7 A;  4I29 A;  3CYM A;  4DFJ A;  5IIK A;  4ICA A;  1P7D A;  2YMP A;  7ICJ A;  2Y1J A;  3HJE A;  3G6V A;  1PVQ A;  4R8U A;  2MRL A;  3Q8R B;  3OGU A;  3GII A;  3PZP A;  1U45 A;  2J6S A;  2C2D A;  2FMQ A;  3SV4 A;  4UAW A;  9ICK A;  4KMU A;  4KLL A;  3HKZ C;  3C2L A;  2AHO B;  1J2M A;  3Q8S B;  3N7S C;  4KN4 A;  4U7C A;  5ALD A;  3B0X A;  1T3N A;  9ICI A;  2DKZ A;  4F91 B;  1BPD A;  2A1A A;  3R9K A;  3NTU A;  2R8I A;  2IOF K;  4RQ8 A;  2BCU A;  4IRD A;  5D4B A;  3RRG A;  5AIC A;  7ICS A;  4K4H A;  2BCS A;  2HOI A;  1KKX A;  1X2I A;  1KBU A;  4ELU A;  1NZB A;  5ALX A;  2W8L A;  4LVS A;  2BZF A;  1RM6 C;  3TAN A;  1OUQ A;  3MR5 A;  3RBE A;  4J9N A;  8ICV A;  5DLF A;  1ZD4 A;  2W9A A;  5AKI A;  3TAR A;  4IL6 U;  3RJJ A;  2QB0 A;  2HOQ A;  5KNI A;  3LK9 A;  2E1F A;  4RQ7 A;  1QSS A;  1J97 A;  2ZXI A;  5KFJ A;  2V4R A;  4UB8 U;  3RR7 A;  2NRV A;  5AI6 A;  4QZG A;  4JMU A;  1UQV A;  1TE2 A;  1HUO A;  1X9S A;  2H3V A;  3FM9 A;  1L3T A;  5KFZ A;  4MF2 A;  3OPX A;  4RQ0 A;  1GO3 F;  2MUT B;  4K4G A;  3DEE A;  3T5L A;  2LM1 A;  3KBB A;  1SIJ A;  2ZJA A;  4FE3 A;  3PX6 A;  5ALI A;  4UAZ A;  2XY6 A;  3H8W A;  1WYG A;  2WF7 A;  1N61 A;  1ZQO A;  2KP7 A;  1JAL A;  2LM4 A;  2KZM A;  2BHN A;  5CWR A;  2E8N A;  3AL0 B;  2D3D A;  4YMN A;  3I76 A;  2P6U A;  4GXK A;  5AKG A;  1TK5 A;  5AK3 A;  1AQ6 A;  2QAR B;  1ZQX A;  2EAP A;  2GH1 A;  1ZQU A;  2VA2 A;  4F4Z A;  2ZIU A;  1HIW A;  3M9N B;  5J2F A;  1BNP A;  1H38 A;  4ED6 A;  1ZQG A;  1XSN A;  3H7I A;  1RDF A;  1ZQ1 C;  3HWT A;  2MAX A;  3RAQ A;  4QWB A;  1TK8 A;  5JTI A;  3QZ8 A;  4X5V A;  5F9L A;  2DBY A;  2G0A A;  5DQG A;  4DWI A;  3T3F A;  4Y2Y A;  2KN7 A;  2QLT A;  4IC9 A;  5AKJ A;  3TFR A;  1KTQ A;  1X9W A;  1RQL A;  4DEZ A;  1U9L A;  1RYR A;  1Q3V A;  1V85 A;  2KVS A;  4YR2 A;  2KVC A;  4YMO A;  2XCP A;  1CUK A;  3H0R B;  3CP8 A;  2VA3 A;  4GXJ A;  4PHD A;  4O3S A;  3UMB A;  2HSZ A;  4HAI A;  3KHL A;  3MGH A;  1ZQL A;  1ZQN A;  4B9N A;  2VA8 A;  4KX3 A;  5JUM A;  3M9O B;  1U47 A;  1UPH A;  3OHB A;  4EYH B;  3UMC A;  5DGB A;  2AQ4 A;  5CEH A;  2A1J B;  3IV6 A;  4M9G A;  4Q8E A;  3F5A A;  2RDI A;  2Q0Z X;  5H2F U;  4FZL A;  9ICF A;  1JXE A;  2W03 A;  1ZOL A;  2NRX A;  2ZIV B;  5GTH U;  4P4P A;  4DL5 A;  4C0Z A;  4TUS A;  3BZK A;  2R8G A;  3JPO A;  3JPP A;  1B22 A;  1F5S A;  2FMP A;  5C5J A;  3M9M B;  5AM2 A;  2UVU A;  1QH9 A;  3PNC A;  2I5H A;  3RTV A;  4J03 A;  9ICU A;  3O0F A;  4RT2 A;  4ECV A;  4O0I A;  5KT2 A;  3EPG A;  2IHM A;  7ICO A;  2KHQ A;  5DGA A;  2IBK A;  4P4M A;  4UW9 A;  2KIV A;  3UM9 A;  1RG6 A;  3RJG A;  5KFO A;  4YD1 A;  3K75 D;  5HR7 A;  4MFA A;  4NLG A;  3EYZ A;  3EZ5 A;  3OJU A;  3I28 A;  4M9N A;  2KKP A;  1FO4 A;  4NV0 A;  3BS5 B;  2HBJ A;  2ALZ A;  3JPQ A;  4DOA A;  5ALU A;  5KL8 B;  2AGQ A;  5AIB A;  1WCN A;  4Z6C A;  1L7P A;  3PST A;  4F5Q A;  4KLG A;  1XSP A;  4WJ3 B;  3RJF A;  5JU5 A;  2CXY A;  5KTQ A;  3BQ2 A;  1ZQS A;  4KLE A;  4JWN A;  4UAV A;  4QW9 A;  2R8J A;  3FAH A;  1T4G A;  2P6R A;  5G5H A;  1NNL A;  5EE9 A;  2BCR A;  4FZN A;  3MDA A;  4DSF A;  3MR3 A;  2AGO A;  4RQN A;  2W9C B;  5J2E A;  4O5E A;  5KG4 A;  3VCB A;  3ZI4 A;  8ICU A;  1ZQB A;  2ODG A;  4M04 A;  5KT4 A;  1SL1 A;  2KFN A;  4DS5 A;  3EPI A;  3PSP A;  2RQ5 A;  4BX9 C;  1S0N A;  5ALE A;  5AKX A;  4Q43 A;  4J9Q A;  1PK3 A;  1RQN A;  3UXP A;  8ICC A;  1NK6 A;  2KK0 A;  1KL9 A;  5AM3 A;  4F4X A;  2ES6 A;  2VJ4 A;  3M6Z A;  4NLB A;  1J2N A;  2DGZ A;  2OEH A;  4UB3 A;  4BXO A;  5DG9 A;  5KAF U;  1B0X A;  3A0H U;  5JRT A;  5ALJ A;  4O3Q A;  1L8L A;  3KKA C;  4J9S A;  1X40 A;  5KFQ A;  5J2H A;  2HVI A;  3PMN A;  3LVV A;  1ZQA A;  1FFU A;  3UQ2 A;  2NO4 A;  2AU0 A;  4I2I A;  2BQU A;  2KSO B;  4ED7 A;  5KFP A;  5J0R A;  2KFZ A;  1UA1 A;  4PHA A;  3ZDC A;  3FYH A;  5EOZ A;  5J2D A;  1SL0 A;  4JK1 A;  3AQE A;  1YZ7 A;  2KTQ A;  1QSL A;  5ALO A;  4NLN A;  3MGI A;  1ZQT A;  3LVW A;  1ZD3 A;  3WKA A;  4Y2P A;  4DO9 A;  4PGQ A;  2YMQ A;  4NXZ A;  2HHS A;  4CF5 A;  2M0N A;  3G6X A;  4NM1 A;  1MQ3 A;  1EXN A;  5J2B A;  2IA6 A;  2F8L A;  1NJZ A;  8ICZ A;  3C2M A;  5KFY A;  3KZI U;  1X9M A;  1KLN A;  2MU2 A;  2G5H B;  5ALN A;  3PSI A;  1S0V A;  5ALL A;  5KG2 A;  3RB4 A;  4M9H A;  1IG6 A;  3CW2 C;  1BPZ A;  4ACO A;  1NK5 A;  2JZB B;  5EWF A;  2F1I A;  4NLZ A;  2KIC A;  4M6W A;  2HBK A;  2LMR A;  2WFA A;  3EUB 2;  5BOL A;  5CP2 A;  5J29 A;  3RJH A;  5HML A;  1Z1B A;  4UAR A;  4MEX A;  1DXS A;  1XC9 A;  9ICX A;  8ICB A;  1URJ A;  3D6J A;  4HYK A;  4G3I A;  3GZF A;  2HDO A;  2HW3 A;  2YB4 A;  1ZJM A;  4JV1 A;  2G09 A;  2L5Y A;  5ALQ A;  4IR9 A;  4GFJ A;  2H3I A;  4YG2 A;  2C2E A;  4P0Q A;  1X9X A;  2ZIX A;  2EDU A;  3PR5 B;  2KG5 A;  1S5L U;  3N97 B;  3GIL A;  4QZF A;  3TAD C;  3SAF A;  4KLD A;  1DGS A;  2BPF A;  4RQ5 A;  2QAR A;  5E79 U;  4Y2J A;  4F4Y A;  4F5O A;  4ECX A;  5ALY A;  4RQ2 A;  4JV0 A;  3WK8 A;  5HNK A;  4F3O A;  4QWE A;  2HI0 A;  1RXW A;  5KG6 A;  2MSN A;  2NYV A;  2F2A B;  4XA5 A;  2K8A A;  1UT5 A;  4I2J A;  1Z4N A;  4OJL A;  4DFK A;  5L1M A;  2P66 A;  4KLH A;  2NRT A;  1F0M A;  1TAU A;  1NOM A;  2F44 A;  3H8J A;  3CNH A;  5G5G A;  5DG7 A;  1SKR A;  3GDX A;  4OJO A;  1FEZ A;  1RPL A;  5HHI A;  3IP4 B;  7ICG A;  3RAX A;  4IQT A;  3RBD A;  5DKW A;  1SWW A;  4FS1 A;  1BPE A;  4UB6 U;  4XRH A;  2YML A;  5J2I A;  3PO4 A;  4PPX A;  4CF4 A;  2B0C A;  5KFB A;  2WHE A;  8ICN A;  1JX4 A;  8ICP A;  4EYI B;  4IQW A;  4RNO A;  1PUZ A;  1CRX A;  1KQQ A;  9ICM A;  4GXI A;  3V7L A;  4YN4 A;  7ICL A;  5AKL A;  3AU2 A;  3VC8 A;  1IM4 A;  3KFU F;  9ICP A;  2BR0 A;  2EZX A;  4QZI A;  1X6J A;  2P35 A;  5CJ7 A;  2N1R A;  3M1Y A;  3JPS A;  2ZTC A;  3RF9 A;  2NV3 A;  2WF6 A;  1SZP A;  4O5K A;  2XGQ A;  1ZQM A;  3RH6 A;  4DSL A;  4R65 A;  4M6W B;  4IQV A;  4IRC A;  2KEY A;  2FDR A;  3BQ1 A;  4Y2T A;  4Z6F A;  5AKK A;  1KFT A;  3GU3 A;  5KFR A;  4U6P A;  5KFW A;  5KL1 B;  2D6F C;  4DSE A;  5J0W A;  2HHT A;  2KE7 A;  5KFS A;  2BCV A;  3PW5 A;  1UT8 A;  3JPR A;  2HHV A;  3PW2 A;  3C5F A;  3GFK B;  4BWM A;  2DL0 A;  1DK2 A;  5J0P A;  2XY5 A;  1C7Y A;  3NAS A;  3C21 A;  5GTI U;  3NVY A;  3IG5 A;  4EEY A;  4F5R A;  7ICF A;  5DBA A;  2KZ3 A;  1XWL A;  5AK4 A;  5ALK A;  9ICG A;  1KDH A;  1DOQ A;  9ICH A;  2G07 A;  3N7R C;  2PFO A;  9ICW A;  3SV3 A;  1L7O A;  3BS5 A;  1NK7 A;  4C8M A;  5IIN A;  4TQS A;  3WK9 A;  4QWA A;  4UB1 A;  2JXJ A;  3V72 A;  4Z6D A;  4RU9 A;  2EAO A;  2OYY A;  4NJ8 A;  3HX0 A;  3MDC A;  1Q3U A;  4KTQ A;  1SL2 A;  1Z3E B;  2JGA A;  1V38 A;  5TIS U;  2OXO A;  4YCX A;  3C2K A;  4US8 A;  4JUZ A;  4E0D A;  3QUB A;  1U49 A;  2H5X A;  4I2H A;  1L6N A;  4G9B A;  4DOC A;  1NK0 A;  4QW8 A;  1L3V A;  3G6Y A;  4QZ9 A;  3AMZ A;  1RYS A;  2KOB A;  3NRZ A;  2IOF A;  3GV5 B;  3ICX A;  7ICV A;  2XVT A;  3E2E A;  1QSY A;  5KFT A;  1T8E A;  4IS7 A;  4DL4 A;  3DDH A;  3E58 A;  3RFA A;  4B9M A;  4CCH A;  4QIW F;  2F8K A;  2BGW A;  2FLL A;  5J0X A;  1T3Q A;  1KFD A;  3PW7 A;  1BPY A;  1VDV A;  3E0F A;  3ED5 A;  5AK6 A;  3HIL A;  4YQW A;  4OJP A;  2Y0S F;  2F76 X;  2KIW A;  9ICJ A;  4QZB A;  3M8R A;  2ZTE A;  2WAQ F;  3QEB Z;  4LJX A;  1JUD A;  3GIM A;  3T5J A;  2MA1 A;  1TKD A;  5HP4 A;  3HW8 A;  4BDP A;  4DCC A;  8ICF A;  1CEZ A;  3QUC A;  8ICQ A;  4KLF A;  3Q8L A;  1ZQD A;  3C29 A;  1HEK A;  5AKZ A;  4YR0 A;  1ZQE A;  1Z19 A;  3LYS A;  9ICN A;  5KT7 A;  4YXJ A;  3ZDD A;  4K4I A;  5D46 A;  1C20 A;  5AI4 A;  1XU4 A;  1LB2 B;  4F71 A;  9ICC A;  5KFC A;  5A0L A;  4GC7 A;  3H4D A;  3PV8 A;  4DFD A;  7ICH A;  5J2C A;  4DL2 A;  2RHF A;  4DF8 A;  3Q8M A;  2C28 A;  2EAM A;  2ASD A;  4P4O A;  7ICT A;  1N48 A;  5L1I A;  1NJX A;  1ZQJ A;  1TV9 A;  5HMM A;  1TK0 A;  2W9C A;  2E5S A;  5ALH A;  3IM1 A;  1NI3 A;  5BOM A;  1L3U A;  1L3S A;  2EH9 A;  2J6T A;  1XO0 A;  4XQ8 A;  1SKW A;  3BDP A;  4Y2X A;  4F8R A;  3HRD D;  2IHN A;  5J0Q A;  3KKA A;  2RDJ A;  4DOB A;  1HJP A;  4C8N A;  2DFL A;  3ORY A;  4O3P A;  2JR5 A;  1CI4 A;  5L1L A;  1QCK A;  3UMG A;  1S9F A;  5IIO A;  5D49 A;  4C4T A;  5DBC A;  4PGX A;  5KFA A;  8ICR A;  1PVP A;  3NUQ A;  2W9B A;  4EBC A;  8ICX A;  1IXR A;  3PML A;  4QZ8 A;  3C28 A;  8ICE A;  4KLS A;  3Q8P B;  4DL7 A;  4A8E A;  3MFH A;  1ZRM A;  7ICI A;  1JRO A;  1RZT A;  1K1S A;  4UAY A;  2GO7 A;  2LYA A;  1UHU A;  1S0O A;  9ICL A;  3D2Q A;  3SR6 A;  4UAT A;  5F9N A;  4ED8 A;  3K1Z A;  5DDM A;  5ALG A;  2YX8 A;  4YFK A;  2W55 A;  2PMZ F;  2ZUB A;  2F1H A;  4KIT B;  3GIK A;  3HP6 A;  1ZJN A;  4EBD A;  2BDU A;  2JHD A;  5TZV A;  2DF4 B;  4Y2R A;  3V6K A;  2WB1 F;  4QNL A;  3OJS A;  1NZP A;  4UAU A;  4C7Y A;  3ISD A;  2HCF A;  2I1Q A;  8ICL A;  1K5O A;  4PJ0 U;  3SI8 A;  4M47 A;  7ICN A;  1T7P A;  5J0U A;  3GV7 B;  7ICP A;  5B5E U;  2H3Q A;  2KV2 A;  5KFG A;  3T5H A;  2FLN A;  5J8Y C;  4QZD A;  5KFV A;  3HT3 A;  5L9X A;  5DQH A;  3JPT A;  4DFM A;  4F4W A;  3ETL A;  4USA A;  9ICO A;  3FDS A;  5KFH A;  3IRU A;  2ASL A;  4F93 B;  3V6H A;  3IG8 A;  5CRX A;  4EZ9 A;  2WB1 C;  1N62 A;  3GV8 B;  4IQU A;  3NVV A;  8ICT A;  3B0Y A;  4C4S A;  1UCV A;  1LKY A;  9ICS A;  7ICQ A;  2ZUC A;  5AIA A;  1WWU A;  3TQ1 A;  3ZD9 A;  5AI0 A;  2VJ5 A;  2FMS A;  1XNS A;  4RZR A;  2W9M A;  1A6S A;  2QKQ A;  1OW5 A;  4EX7 A;  2FPM A;  3NVW A;  2Y0S C;  2I6X A;  5IIM A;  2ZTD A;  2W9B B;  3SAH A;  2ZJ5 A;  4ECQ A;  4DQQ A;  2F77 X;  5CA7 A;  1LV5 A;  4F92 B;  4RPY A;  1IIP A;  3V6J A;  1KRP A;  4ED2 A;  1ZET A;  3KTQ A;  5ALM A;  5B66 U;  1JN3 A;  4DFP A;  2ZIV A;  5DB7 A;  3IDW A;  2KNJ A;  2FI1 A;  2HBL A;  4F72 A;  2KZZ A;  2WTF A;  3RJK A;  1PVR A;  2ZIX B;  2YTU A;  3F2B A;  1A0P A;  5AKY A;  1BPB A;  1ZQK A;  5AM1 A;  3CRX A;  1FFV A;  3QE9 Y;  2K4P A;  3UPQ A;  2V4Q A;  3PO5 A;  4QZE A;  4RPZ A;  5DBB A;  3N4M B;  4YP3 A;  2W3S A;  4UB5 A;  3SAG A;  2Y9T A;  4UB4 A;  2Z7J A;  2JH7 A;  3SEI A;  3IN5 A;  1RYU A;  5KAI U;  2HOF A;  3PR4 A;  4PGY A;  1BVS A;  5DDY A;  4BUG A;  1SXD A;  5ALV A;  4RQ4 A;  5CR0 A;  5KFK A;  3AM9 A;  4UBB A;  5KG0 A;  9ICR A;  3WK4 A;  4FZM A;  2JEF A;  2KHV A;  4PHE A;  4OO1 J;  3HPO A;  3RH4 A;  3SMV A;  1ZQC A;  1WG8 A;  1QQ6 A;  3MBY A;  3NGD A;  1DK3 A;  4ECW A;  2JH1 A;  1T94 A;  3S6J A;  1ZQY A;  2ZUD A;  1LVH A;  2K8C B;  4ECR A;  4Y2U A;  2FLP A;  4R64 A;  2E3T A;  3MFI A;  2KMD A;  1N5W A;  1YZ6 A;  4I2D A;  5F3X B;  1ZRN A;  3M6K A;  4J9L A;  3SEN A;  1SKS A;  1NK4 A;  3QUT A;  5IIJ A;  2PFP A;  1VLB A;  9ICT A;  3QYP A;  1WCL A;  3WKB A;  4LZD A;  1SV0 C;  4R8U B;  2KJ9 A;  2OWO A;  4I2C A;  1Q46 A;  1UA0 A;  5J0Y A;  3F5E A;  1A76 A;  5DG8 A;  5AKH A;  4QIW C;  3DV9 A;  4AYB F;  2W04 A;  4O3O A;  2WF8 A;  3ISB A;  1PK1 B;  1IV8 A;  3QEA Z;  4F2R A;  4QZH A;  5KFL A;  9ICB A;  4B9L A;  1SB3 C;  4I2A A;  5KFX A;  2YY6 A;  2ZG6 A;  3LDA A;  2VIX A;  2W43 A;  4EEL A;  1FIQ A;  4BJQ A;  3H0M B;  5KFN A;  9ICQ A;  5KFI A;  3WU2 U;  4Q8F A;  1S10 A;  4P2H A;  4C80 A;  5KFM A;  1ZQQ A;  2VKQ A;  3ALR A;  2HHU A;  4EZ6 A;  4I2F A;  2H3Z A;  2QB1 A;  3F2C A;  2ZIW B;  8ICY A;  4EEN A;  2CN1 A;  3K1R B;  1KSP A;  4DQP A;  5J0S A;  4B6J A;  4EX6 A;  4F50 A;  2PFQ A;  3LWM A;  2WF5 A;  4RNN A;  5AI5 A;  4CF3 A;  3RJE A;  3EWA A;  2EQY A;  3H8S A;  1Z1V A;  4NY8 A;  2LBO A;  4UAS A;  8ICI A;  2NO5 A;  2ASJ A;  4ELV A;  3MAB A;  5L1J A;  4ZH4 A;  2XO7 A;  3PVX A;  4KLU A;  2HHX A;  1S8O A;  2Q4T A;  9ICA A;  2JZB A;  1KN5 A;  2LYH A;  3RB3 A;  2O6K A;  1COK A;  1MSW D;  4FO6 A;  4QWC A;  8ICA A;  4ED1 A;  4R63 A;  2FPL A;  3WKE A;  1S0M A;  3TAP A;  2W11 A;  3ETR A;  2E8M A;  5CB1 A;  1KW4 A;  2KJ8 A;  5C0Y A;  2ESE A;  5J8Y A;  4RUC A;  4FFD A;  1JXL A;  5DQI A;  5DB8 A;  4ECY A;  1ZQR A;  2D8C A;  2KD1 A;  4F5P A;  4GLX A;  3MR6 A;  2LI6 A;  5ALP A;  4KMO B;  3H0L B;  3BQ7 A;  5J2G A;  4PZN A;  3GQC A;  3V7K A;  4RQ3 A;  4ELT A;  3RRH A;  3ZDE A;  1BPX A;  5L1K A;  4F4K A;  1L8O A;  2JMG A;  3RR8 A;  3PW0 A;  2KSO A;  5EE3 A;  2FPK A;  1ZD5 A;  8ICK A;  4AYB C;  4PL2 A;  3C23 A;  2ZIW A;  8ICM A;  4MEY A;  4I28 A;  5J2K A;  4M2Y A;  4UQG A;  5DB9 A;  2PFN A;  5EWG A;  5BPC A;  3V7J A;  4IR1 A;  1TAM A;  4JV2 A;  4ECT A;  2R8H A;  1A77 A;  5KG1 A;  4DQI A;  2K4E A;  2R18 A;  1SWV A;  1ZD2 P;  4DLG A;  1COO A;  4C4R A;  3H40 A;  2A19 A;  2BKE A;  2DWQ A;  4CRX A;  4DQR A;  3F53 A;  4NWI A;  4ECZ A;  3MC1 A;  4P0P A;  2AH5 A;  3ONN A;  9ICE A;  2DUY A;  3FC4 A;  2BCQ A;  2OCE A;  4F2S A;  3ZD8 A;  4QWD A;  3SQI A;  2EAN A;  4Z6E A;  1Z00 B;  3L4P A;  4FBT A;  1WUD A;  1ZXI A;  2RP5 A;  2B6G A;  9ICV A;  2HMX A;  3QU9 A;  4CE6 A;  1L7N A;  2DKX A;  1MQ2 A;  4DLE A;  1SZH A;  1D9D A;  2UVW A;  1NJW A;  4OJ5 A;  2ATL A;  2K4I A;  3THV A;  4NL9 A;  2E8O A;  2FE9 A;  4MFC A;  3MR2 A;  3U26 A;  4DS4 A;  2BQ3 A;  2R8K A;  3ZDA A;  2GOL A;  2C2R A;  3AN1 A;  4ED0 A;  3KZX A;  1K1Q A;  2M9N A;  2OHF A;  1MA7 A;  8ICO A;  2F1J A;  3PY8 A;  2B21 A;  3TKA A;  3TI0 A;  5J2A A;  1YT3 A;  4B9T A;  4JWM A;  1Q8K A;  1ED1 A;  2W7O A;  2JEJ A;  1WWV A;  5KG7 A;  2W8K A;  3WK5 A;  4NLC A;  3SYZ A;  2CPR A;  3AU6 A;  1RXV A;  8ICH A;  3TAQ A;  1ZQH A;  3UXO A;  2WAQ C;  5ALW A;  5T14 A;  4IRK A;  5AI9 A;  1D8L A;  2IMW P;  2XC9 A;  2AJQ A;  3BQ0 A;  1D9F A;  3AUO A;  5AM0 A;  1V9P A;  3M7D A;  8ICG A;  4KLT A;  3PSF A;  2XCA A;  1QTM A;  1PZN A;  4XUS A;  4I2G A;  4RNM A;  3QX7 A;  5KG5 A;  1ZQF A;  3QZ7 A;  5KT5 A;  1NKC A;  3KD3 A;  3ZDB A;  3F2D A;  3QU2 A;  2G06 A;  4UB2 A;  1DGJ A;  4Y2V A;  7ICE A;  1X66 A;  2PKE A;  4Y2S A;  4BWJ A;  4EEK A;  4OD0 A;  5ALF A;  2F3N A;  4JB3 A;  5J2J A;  1XSL A;  3NS1 A;  2JEI A;  2AQ0 A;  1L5U A;  2YB1 A;  4ED3 A;  5DB6 A;  1V97 A;  3UQ0 A;  3OHA A;  4I27 A;  1KFS A;  3OTQ A;  3JPN A;  5EE0 A;  3SD7 A;  4PL1 A;  2CRX A;  3GIJ A;  3TAD A;  3H8M A;  1OXJ A;  1TFR A;  1ZQZ A;  2LYB A;  4O3N A;  4B9V A;  4C8O A;  2XIC A;  4MHV A;  1ZQV A;  4QZC A;  4M9L A;  3HKZ F;  4C7Z A;  1X42 A;  7ICM A;  2ISP A;  1XS9 D;  1LKY B;  1Y88 A;  1L7M A;  3PX4 A;  4RT3 A;  2K8B B;  4Q44 A;  2H3F A;  5KFF A;  3QXG A;  1ZQI A;  3QU5 A;  1B4F A;  1JMS A;  2G08 A;  3LWL A;  4I2E A;  1D8Y A;  5ALS A;  4P0P B;  5AHX A;  4J9R A;  2WF9 A;  1QQ5 A;  4B9S A;  2QB0 B;  2A1J A;  3KHH A;  1F44 A;  3M8S A;  1JI7 A;  2HHW A;  1N5X A;  1QLN A;  3L5K A;  5AM5 A;  2YMM A;  4US9 A;  4DSI A;  2LHT A;  4RPX A;  4CGZ A; 
#chains in the Genus database with same CATH homology
 4DQS A;  5F9L A;  4M6W B;  4R65 A;  3Q8K A;  4IQV A;  4I2B A;  4IRC A;  1ZQC A;  3H4B A;  3BQ1 A;  3MBY A;  4Z6F A;  3NGD A;  4ECW A;  1KFT A;  5KFR A;  5DQG A;  4DWI A;  3T3F A;  1ZQY A;  2ZUD A;  5KFW A;  5CHG A;  1S97 A;  3K4G A;  4ECR A;  2FLP A;  4R64 A;  2KN7 A;  5J0W A;  4DSE A;  4QZA A;  2HHT A;  5KFS A;  2BCV A;  3TFR A;  3PW5 A;  1KTQ A;  1X9W A;  3MFI A;  1TVA A;  4YD2 A;  4EBE A;  4DEZ A;  1U9L A;  3RH5 A;  1RYR A;  1UT8 A;  4I2D A;  1TAQ A;  4YR2 A;  4YMO A;  2XCP A;  4J9O A;  3JPR A;  2HHV A;  1ZQP A;  4J9L A;  1U4B A;  1CUK A;  1BGX T;  3IHQ B;  3C5F A;  3PW2 A;  3GFK B;  4BWM A;  4J9P A;  1NK4 A;  1SKS A;  2VA3 A;  5J0P A;  1XO1 A;  4GXJ A;  2XY5 A;  5IIJ A;  1C7Y A;  4PHD A;  2PFP A;  3C21 A;  4O3S A;  1JIH A;  4EEY A;  4F5R A;  7ICF A;  4KLI A;  9ICT A;  3KHL A;  3MGH A;  1ZQL A;  1ZQN A;  4B9N A;  5DBA A;  1WCL A;  2VA8 A;  3SZ2 A;  2KZ3 A;  4LZD A;  1XWL A;  4R8U B;  2OWO A;  4I2C A;  5JUM A;  3TFS A;  3M9O B;  2HHQ A;  1U47 A;  9ICG A;  5HHH A;  1KDH A;  1DOQ A;  1UA0 A;  9ICH A;  5J0Y A;  4BGD A;  3OHB A;  1A76 A;  4EYH B;  1N56 A;  2PFO A;  5DGB A;  8ICS A;  9ICW A;  4FBU A;  5DG8 A;  2AQ4 A;  2A1J B;  5IIL A;  3SV3 A;  3PW4 A;  4M9G A;  4Q8E A;  2RDI A;  2Q0Z X;  1NK7 A;  8ICJ A;  4C8M A;  5IIN A;  4TQS A;  4O3O A;  4QWA A;  9ICF A;  1JXE A;  4UB1 A;  5J0T A;  3ISB A;  3QEA Z;  3V72 A;  2NRX A;  4F2R A;  4Z6D A;  4QZH A;  4RU9 A;  5KFL A;  4P4P A;  4DL5 A;  3OSP A;  2HVH A;  4TUS A;  4B9L A;  4I2A A;  9ICB A;  5KFX A;  3HX0 A;  2R8G A;  2DPI A;  3MDC A;  3JPO A;  4RUA A;  3JPP A;  4KTQ A;  1B22 A;  1SL2 A;  3BQT A;  2GWS A;  1Z3E B;  3RJI A;  2FMP A;  1ARO P;  2C22 A;  5C5J A;  4C8K A;  3LDA A;  4YCX A;  3C2K A;  2BPC A;  4B9U A;  4JUZ A;  4RQ6 A;  3M9M B;  4KLO A;  2UVU A;  4E0D A;  3PNC A;  1U49 A;  4O3R A;  1KEJ A;  3RTV A;  9ICU A;  5KFE A;  3OSN A;  2H5X A;  4DSJ A;  4RT2 A;  4ECV A;  4O0I A;  4YMM A;  5KT2 A;  2J6U A;  4I2H A;  4MFF A;  4KLJ A;  7ICK A;  3EPG A;  5KFN A;  5III A;  4DOC A;  4QW8 A;  1NK0 A;  5KFI A;  1L3V A;  3G6Y A;  1HUZ A;  2IHM A;  4Q8F A;  7ICO A;  4QZ9 A;  1S10 A;  5DGA A;  4P2H A;  5KFM A;  1RYS A;  1ZQQ A;  2IBK A;  3GV5 B;  7ICV A;  4P4M A;  3E2E A;  1QSY A;  3T5K A;  2HHU A;  5KFT A;  4EZ6 A;  1T8E A;  4I2F A;  4Q45 A;  4DL4 A;  3RJG A;  5KFO A;  4KLQ A;  4YD1 A;  3K75 D;  8ICY A;  4B9M A;  4CCH A;  7ICR A;  1KSP A;  2BGW A;  4MFA A;  5J0S A;  4DQP A;  4F50 A;  2PFQ A;  2FLL A;  4NLG A;  3LWM A;  5J0X A;  4RNN A;  1KFD A;  3OJU A;  3ISC A;  4NM2 A;  3EYZ A;  3EWA A;  3EZ5 A;  3C5G A;  3PW7 A;  3H8S A;  1NK8 A;  3RJE A;  5KT3 A;  8ICW A;  1BPY A;  4NY8 A;  4M9N A;  4YQW A;  2UVV A;  1NKB A;  9ICJ A;  4QZB A;  3M8R A;  2ZTE A;  8ICI A;  2ASJ A;  3QEB Z;  4ELV A;  3MAB A;  3GIM A;  5L1J A;  3JPQ A;  4DOA A;  3T5J A;  2ALZ A;  1TKD A;  4TUP A;  2AGQ A;  4ZH4 A;  2XO7 A;  3PVX A;  5HP4 A;  1NJY A;  3HW8 A;  4KLM A;  4KLU A;  1WCN A;  4Z6C A;  4BDP A;  2HHX A;  8ICF A;  9ICA A;  2JZB A;  2NRW A;  1CEZ A;  8ICQ A;  4KLF A;  4F5Q A;  3Q8L A;  4KLG A;  1XSP A;  1ZQD A;  4YR0 A;  2LYH A;  3RB3 A;  3RJF A;  4PHP A;  1MSW D;  4FO6 A;  1ZQE A;  4QWC A;  8ICA A;  4ED1 A;  4JV2 A;  5KTQ A;  9ICN A;  4KN7 A;  4ECU A;  3BQ2 A;  5KT7 A;  1ZQS A;  4KLE A;  4YXJ A;  4JWN A;  4R63 A;  2FPL A;  2ISO A;  3ZDD A;  1S0M A;  2PI4 A;  4K4I A;  3TAP A;  2XGP A;  5D46 A;  4QW9 A;  2R8J A;  5KG3 A;  5CB1 A;  1T4G A;  2P6R A;  1B43 A;  1XU4 A;  2BCR A;  1LB2 B;  4TQR A;  3MDA A;  4RUC A;  9ICC A;  4DSF A;  1JXL A;  5KFC A;  3MR3 A;  4YXM A;  5DQI A;  5DB8 A;  4TUR A;  4ECY A;  1ZYQ A;  4GC7 A;  3H4D A;  4J9M A;  1ZQR A;  3PV8 A;  2AGO A;  1NK9 A;  7ICH A;  5J2C A;  4F5P A;  4DL2 A;  2W9C B;  5J0O A;  2XY7 A;  5J2E A;  4GLX A;  4O5E A;  3MR6 A;  4DF8 A;  3UXN A;  3Q8M A;  2C28 A;  5KG4 A;  2I9G A;  2ASD A;  4P4O A;  4DL3 A;  3BJY A;  1ZQB A;  7ICT A;  8ICU A;  1N48 A;  5J2G A;  4M04 A;  5KT4 A;  1SL1 A;  2KFN A;  2VAN A;  3C1Z A;  3GQC A;  5L1I A;  3EPI A;  4DS5 A;  1NJX A;  1ZQJ A;  3V7K A;  4RQ3 A;  3PX0 A;  5HMM A;  1TV9 A;  1TK0 A;  1S0N A;  4ELT A;  2W9C A;  3RRH A;  3ZDE A;  1NKE A;  1BPX A;  4Q43 A;  4J9Q A;  5DLG A;  3IM1 A;  5L1K A;  4F4K A;  2BPG A;  3C1Y A;  3UXP A;  5BOM A;  1L3U A;  1L3S A;  1NK6 A;  3RR8 A;  8ICC A;  3PW0 A;  2J6T A;  4RQ1 A;  4YR3 A;  4XQ8 A;  4F4X A;  1SKW A;  7ICU A;  4PH5 A;  1U48 A;  3BDP A;  4F8R A;  4C8L A;  2FPK A;  2IHN A;  5J0Q A;  2RDJ A;  4DOB A;  1HJP A;  4C8N A;  2DFL A;  3ORY A;  2MUT A;  8ICK A;  4O3P A;  5KFU A;  4UB3 A;  5L1L A;  1S9F A;  4BXO A;  5DG9 A;  5IIO A;  5D49 A;  3RB6 A;  3C23 A;  4MF8 A;  5DBC A;  8ICM A;  4O3Q A;  4MEY A;  4PGX A;  5J2K A;  4J9S A;  4I28 A;  5KFA A;  4M2Y A;  4UQG A;  8ICR A;  5KFQ A;  5J2H A;  5DB9 A;  2PFN A;  2HVI A;  5EWG A;  5BPC A;  3PMN A;  2W9B A;  3V7J A;  3RB0 A;  4IR1 A;  4EBC A;  4ECT A;  1ZQA A;  5KT6 A;  4R66 A;  1IXR A;  8ICX A;  4BXO B;  3PML A;  4QZ8 A;  1A77 A;  5KG1 A;  2R8H A;  3UQ2 A;  2AU0 A;  4DQI A;  4LZG A;  4I2I A;  8ICE A;  2BQU A;  2PXI A;  4ED7 A;  5KFP A;  5J0R A;  2AGP A;  4KLS A;  3Q8P B;  4DLG A;  4DL7 A;  2KFZ A;  1S76 D;  1UA1 A;  4PHA A;  3MFH A;  1COO A;  7ICI A;  3ZDC A;  3H40 A;  3FYH A;  4TUQ A;  2UVR A;  2BKE A;  5EOZ A;  5J2D A;  4DQR A;  1RZT A;  1SL0 A;  1K1S A;  4JK1 A;  4DSK A;  4UAY A;  4ECZ A;  5KFD A;  3KHG A;  2Y1I A;  4M9J A;  4FS2 A;  9ICE A;  1ZQW A;  1S0O A;  2KTQ A;  9ICL A;  1QSL A;  2BCQ A;  4NLN A;  3MGI A;  4F2S A;  1ZQT A;  3ZD8 A;  1MC8 A;  4QWD A;  4Z6E A;  5F9N A;  4PGQ A;  4DO9 A;  4ED8 A;  2JEG A;  1S77 D;  4NXZ A;  1Z00 B;  4FBT A;  4O9M A;  2IA6 A;  9ICV A;  5DDM A;  4YFK A;  2HHS A;  3G6X A;  4M0A A;  1MQ2 A;  4NM1 A;  4DLE A;  1EXN A;  5J2B A;  1MQ3 A;  4KIT B;  2ZUB A;  2F1H A;  1D9D A;  3GIK A;  1NJW A;  5EWE A;  1NJZ A;  2UVW A;  4NLK A;  2PI5 A;  8ICZ A;  2NRZ A;  2ATL A;  4O5C A;  3C2M A;  3Q8Q B;  3HP6 A;  3THV A;  1ZJN A;  3EW9 A;  4EBD A;  4MFC A;  3MR2 A;  5KFY A;  3KHR A;  4DS4 A;  1Z00 A;  4DF4 A;  2BQ3 A;  1X9M A;  2R8K A;  3ZDA A;  1KLN A;  2C2R A;  2BDP A;  2ZJ8 A;  5TZV A;  4ED0 A;  4J9K A;  1S0V A;  4YVZ A;  3V6K A;  1K1Q A;  2M9N A;  5KG2 A;  3OJS A;  3RB4 A;  4M9H A;  8ICO A;  2F1J A;  4F5N A;  3ISD A;  2DPJ A;  3PY8 A;  4UBC A;  4GC6 A;  2B21 A;  4ECS A;  4DL6 A;  2BQR A;  2I1Q A;  1BPZ A;  2V9W A;  3TI0 A;  5J2A A;  1NK5 A;  2JZB B;  4I29 A;  5EWF A;  4B9T A;  4JWM A;  4DFJ A;  8ICL A;  2F1I A;  3SI8 A;  4NLZ A;  5IIK A;  4M47 A;  7ICN A;  4M6W A;  1T7P A;  7ICJ A;  2Y1J A;  5J0U A;  3GV7 B;  7ICP A;  5BOL A;  2JEJ A;  3G6V A;  5KG7 A;  2W8K A;  5CP2 A;  5J29 A;  3SYZ A;  4R8U A;  3Q8R B;  3OGU A;  5KFG A;  3GII A;  1U45 A;  3RJH A;  5HML A;  3AU6 A;  1RXV A;  4MEX A;  2J6S A;  3T5H A;  2C2D A;  1XC9 A;  2FMQ A;  2FLN A;  9ICX A;  3SV4 A;  8ICH A;  3TAQ A;  1ZQH A;  4UAW A;  8ICB A;  3UXO A;  9ICK A;  4QZD A;  5KFV A;  3HT3 A;  4HYK A;  4KMU A;  4KLL A;  5L9X A;  4G3I A;  3C2L A;  5DQH A;  2HW3 A;  4IRK A;  3JPT A;  1ZJM A;  4JV1 A;  3Q8S B;  4DFM A;  4KN4 A;  4F4W A;  3ETL A;  1D8L A;  3B0X A;  1T3N A;  2IMW P;  4IR9 A;  9ICO A;  9ICI A;  4F91 B;  1BPD A;  3FDS A;  5KFH A;  4YG2 A;  2XC9 A;  2AJQ A;  9ICQ A;  3BQ0 A;  1D9F A;  3NTU A;  2ASL A;  4F93 B;  3V6H A;  2R8I A;  4EZ9 A;  3AUO A;  4RQ8 A;  2C2E A;  1V9P A;  2BCU A;  4IRD A;  3GV8 B;  4IQU A;  5D4B A;  8ICG A;  3PR5 B;  3RRG A;  3N97 B;  8ICT A;  7ICS A;  3GIL A;  4QZF A;  4K4H A;  2BCS A;  4KLT A;  3B0Y A;  1X2I A;  4KLD A;  4ELU A;  2XCA A;  1QTM A;  1DGS A;  1PZN A;  4XUS A;  9ICS A;  4I2G A;  7ICQ A;  2BPF A;  4RNM A;  2ZUC A;  4RQ5 A;  2W8L A;  3TQ1 A;  3ZD9 A;  4LVS A;  3TAN A;  4F4Y A;  5KG5 A;  4F5O A;  4ECX A;  1ZQF A;  3MR5 A;  3RBE A;  4RQ2 A;  3QZ7 A;  4JV0 A;  4J9N A;  5HNK A;  4F3O A;  4QWE A;  1RXW A;  5KG6 A;  2FMS A;  8ICV A;  5KT5 A;  5DLF A;  1NKC A;  4XA5 A;  3ZDB A;  4RZR A;  2W9A A;  3TAR A;  3RJJ A;  2W9M A;  1UT5 A;  4I2J A;  4DFK A;  4UB2 A;  3LK9 A;  4RQ7 A;  7ICE A;  2P66 A;  1QSS A;  2FPM A;  5KFJ A;  2V4R A;  4BWJ A;  3RR7 A;  2NRV A;  2ZTD A;  2NRT A;  2W9B B;  5IIM A;  1XSL A;  5J2J A;  4QZG A;  4KLH A;  1TAU A;  2JEI A;  1NOM A;  2ZJ5 A;  3H8J A;  2AQ0 A;  4ECQ A;  4DQQ A;  1L5U A;  1HUO A;  5CA7 A;  1X9S A;  1LV5 A;  5DG7 A;  4F92 B;  4ED3 A;  1SKR A;  3GDX A;  5DB6 A;  3UQ0 A;  4RPY A;  1L3T A;  3OHA A;  5KFZ A;  3V6J A;  4ED2 A;  1KRP A;  1KFS A;  4I27 A;  1ZET A;  4MF2 A;  1RPL A;  3JPN A;  3KTQ A;  5HHI A;  7ICG A;  4RQ0 A;  2MUT B;  3RAX A;  1JN3 A;  4DFP A;  5DB7 A;  4IQT A;  4K4G A;  3GIJ A;  3T5L A;  5DKW A;  3RBD A;  1TFR A;  1ZQZ A;  4O3N A;  4FS1 A;  2ZJA A;  4B9V A;  1BPE A;  4XRH A;  4C8O A;  3PX6 A;  5J2I A;  2KZZ A;  1ZQV A;  4UAZ A;  4QZC A;  2WTF A;  2XY6 A;  3RJK A;  3PO4 A;  3H8W A;  4PPX A;  4M9L A;  1ZQO A;  1BPB A;  5KFB A;  1ZQK A;  2KZM A;  8ICN A;  7ICM A;  1JX4 A;  8ICP A;  2BHN A;  4EYI B;  5CWR A;  4IQW A;  4YMN A;  2ISP A;  3QE9 Y;  1XS9 D;  4RNO A;  3UPQ A;  2V4Q A;  3PO5 A;  1Y88 A;  2P6U A;  4QZE A;  4GXK A;  3PX4 A;  4RT3 A;  4RPZ A;  5DBB A;  3N4M B;  1TK5 A;  4YP3 A;  4UB5 A;  9ICM A;  4Q44 A;  4GXI A;  3V7L A;  1ZQX A;  5KFF A;  4YN4 A;  1ZQI A;  1ZQU A;  4UB4 A;  1JMS A;  7ICL A;  2VA2 A;  3LWL A;  3AU2 A;  4I2E A;  1IM4 A;  1D8Y A;  9ICP A;  2BR0 A;  4F4Z A;  4J9R A;  4QZI A;  3M9N B;  5J2F A;  4B9S A;  1H38 A;  4ED6 A;  5CJ7 A;  1XSN A;  2A1J A;  3H7I A;  1BVS A;  4PGY A;  3PR4 A;  5DDY A;  3JPS A;  2ZTC A;  4RQ4 A;  3KHH A;  3HWT A;  3M8S A;  5CR0 A;  2MAX A;  5KFK A;  1SZP A;  4O5K A;  2XGQ A;  4UBB A;  5KG0 A;  2HHW A;  9ICR A;  1ZQM A;  3RAQ A;  4QWB A;  3RH6 A;  1TK8 A;  1ZQG A;  1QLN A;  2JEF A;  4DSL A;  3QZ8 A;  4X5V A;  4DSI A;  4RPX A;  4PHE A;  3HPO A;  3RH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...