2JZBB

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbB01
5HNKA 2ISOA 4CCHA 7ICPA 5F9LA 7ICMA 3ISCA 4DL3A 4I2EA 1TK5A 2DPIA 4YR0A 3V6JA 5J2BA 5DB6A 1ZQKA 5DB9A 5KFXA 3OJUA 5KG3A 2KZMA 5KFRA 4M04A 5DLGA 2IHMA 2BHNA 1IXRA 2A1JB 4DQQA 1ZQZA 3MGIA 5D49A 4FS1A 5KG5A 3RB4A 1BPYA 4RUAA 2UVUA 3THVA 1NKCA 1ZQDA 4Z6CA 9ICRA 1L3TA 3PW5A 2C22A 5KFMA 3QZ7A 5EWGA 3M9MB 5IIJA 2BCSA 2HHVA 3HPOA 4PHAA 3MR6A 5KFTA 5DDYA 3V6HA 5CR0A 4YD1A 4YR3A 4B9TA 1KEJA 1UT5A 1ZYQA 4F93B 1NKBA 1ZQLA 5IINA 2BCUA 3RJJA 3PR4A 4O5EA 4Q44A 2HHWA 1HJPA 4X5VA 4DSLA 1A77A 8ICUA 5L9XA 1XS9D 4I27A 4Z6DA 4DF8A 3RJIA 3QEBZ 2BQ3A 5DBCA 4O5CA 2ASJA 4F5RA 5DG9A 4M9JA 1RZTA 3Q8LA 5BOMA 3EPGA 4RQ1A 2XCPA 2AQ4A 4RUCA 4M9GA 7ICSA 4IRDA 3RRHA 3C2KA 1SL0A 8ICRA 4NLGA 5F9NA 4M47A 5J0QA 1ZQEA 2ZTEA 2BPFA 5KFDA 4PHPA 1BPBA 5JUMA 5KFJA 3ZDAA 7ICLA 4K4IA 1S0MA 4YMOA 1KFSA 4DL2A 8ICFA 4QZHA 1ZJMA 3G6XA 2IBKA 4IQTA 2ASLA 4DL7A 4IR9A 4R65A 4I2GA 2W9MA 2W8KA 1U47A 4DSFA 4I2CA 1NK7A 4G3IA 4GC7A 4K4GA 4RT3A 3MR3A 3SV3A 1MC8A 3N4MB 2W9CB 3TI0A 1JX4A 4JWMA 1BPZA 2I9GA 2RDIA 4ZH4A 4O3QA 4F4WA 3T5JA 1ZQAA 8ICCA 1BPDA 2JEFA 4YFKA 3RBDA 2JEIA 4EEYA 2PFNA 5KTQA 3EYZA 3PX4A 3RJKA 1WCLA 4RPZA 4B9NA 4QZBA 3H40A 3RAQA 2DPJA 4F3OA 4ECZA 4F5NA 4I2JA 5KT3A 4I2FA 8ICIA 4MFCA 4RPYA 5EWEA 5J0YA 2XGPA 5KFHA 3Q8SB 1TAQA 3PMNA 2RDJA 2BQUA 1AROP 4QWBA 4XRHA 2PXIA 5IIKA 2JZBA 1COOA 3MR5A 2F1IA 3UPQA 4KLLA 5KFGA 4YMMA 4RQ4A 1IM4A 4DFKA 2FMPA 1SKSA 4DQRA 2A1JA 3V7JA 8ICJA 3V7KA 4R66A 1BPEA 3TFRA 4O3PA 8ICSA 3GV5B 2R8JA 1L3UA 3RH5A 5L1JA 1ZQGA 2NRTA 2HHXA 2BKEA 1L3SA 1JMSA 5J0PA 4DF4A 4B9SA 4C8NA 4KLUA 3BQ2A 2ISPA 5KFAA 3HW8A 4J9QA 1CUKA 5L1LA 3LWMA 5J2FA 3H4BA 2BR0A 4UB3A 4MEYA 2R8IA 3PMLA 3C2LA 4F4ZA 4BDPA 4RNNA 1TAUA 1TK0A 4YN4A 2C28A 3RH4A 4QZ9A 3NTUA 5CA7A 2ALZA 3RJFA 4TUPA 4B9LA 8ICGA 4J9NA 2BCVA 4EZ6A 1B22A 4ECRA 3LDAA 4I2DA 5KG1A 4YR2A 3ISDA 5J0SA 3Q8PB 3TANA 3HP6A 5J2HA 4IQVA 3GIKA 1XO1A 4KLIA 2ZUBA 2R8KA 1RPLA 2HHSA 4B9MA 4RPXA 4RNMA 1QSLA 3GV7B 5J2DA 4DFPA 2P6UA 2XC9A 3UXOA 1ZQYA 1ZQOA 7ICQA 3ZDEA 1ZQJA 3JPNA 2B21A 4ECTA 3JPRA 4YVZA 1HUZA 3JPPA 1A76A 3UXNA 4KLQA 4ECUA 9ICPA 5KFYA 5KG4A 8ICNA 5CWRA 3HWTA 4F2RA 3N97B 5IIOA 4RQ7A 3TAQA 4F8RA 5KFFA 8ICZA 4DOCA 5KFUA 2W9AA 3BJYA 4IQUA 4QZCA 4HYKA 1TK8A 2F1JA 2V4QA 4F91B 4M2YA 2JEJA 1CEZA 5J2CA 3H4DA 4DLEA 1S0OA 1NJXA 1MQ3A 4NLZA 4KLEA 4P2HA 3JPOA 1NJYA 2KN7A 1SKWA 2XY5A 1B43A 5KFLA 1NK8A 2KTQA 5KG7A 1XSPA 5J29A 1WCNA 5KT4A 2W9BA 2J6SA 7ICKA 7ICOA 3GILA 1ZQMA 4ELUA 4YMNA 3C1ZA 3EZ5A 5KFNA 3ZDBA 9ICKA 1N48A 5DGAA 7ICUA 4C8LA 3PR5B 1L5UA 3PW2A 7ICFA 3NGDA 8ICTA 1X2IA 2I1QA 4ECVA 4RQ5A 5EWFA 4F92B 5J2GA 1BVSA 5KFVA 4KLOA 1TV9A 9ICCA 3SZ2A 4F4KA 4NM1A 4O3OA 2FPMA 4ECSA 4KLFA 3MBYA 2IMWP 1RYSA 4I28A 4Q8FA 4DL6A 5CJ7A 5DB8A 1ZQSA 5J0XA 3PO5A 4EBCA 4TQSA 9ICTA 4ED1A 3M8RA 1D8YA 8ICWA 1JN3A 3OGUA 3T5LA 1XWLA 5L1IA 4F5QA 3HT3A 5KT2A 4F4XA 1H38A 4J9PA 2FPLA 9ICUA 8ICAA 4UBCA 4ELVA 9ICNA 4XQ8A 4JK1A 3GIMA 1K1QA 5KFPA 5KFCA 3PVXA 1U49A 5C5JA 5DG7A 4I2IA 4DSJA 1ZQNA 1U4BA 1KFDA 3B0XA 1LB2B 2P6RA 2UVWA 8ICQA 4ED7A 4ED0A 3ZDDA 4FBUA 4ECXA 2AU0A 5BPCA 1X9MA 4YD2A 5EOZA 3RB0A 1D9DA 4BGDA 2C2EA 2PI4A 3M8SA 8ICXA 4JUZA 4UBBA 1K1SA 4PGQA 4J9RA 3M9OB 3RR8A 1TVAA 2KFNA 5CB1A 4ED8A 4R8UB 3QE9Y 5DDMA 4BXOA 4MF8A 3BQ1A 4KLDA 7ICNA 5DLFA 1NK0A 5KG2A 2AGPA 2MUTB 5DQIA 1U48A 2FMQA 4NY8A 2ZJAA 3FYHA 4QZGA 1Z00B 3ORYA 1U9LA 4QWDA 5KFKA 4ECYA 2NRVA 4DS4A 4EBEA 1T8EA 1KTQA 1QSSA 7ICRA 2Y1IA 2ZUCA 4M0AA 9ICFA 4C8KA 4KLMA 3H7IA 4DFMA 4DSIA 2HHTA 3GV8B 2AGOA 3BQTA 3TARA 4PH5A 1TKDA 2VA2A 1ZQBA 4FO6A 2FLPA 3JPTA 3ZD9A 4QWCA 5J2JA 4ED3A 2XGQA 3PO4A 5DQGA 9ICBA 3RJEA 3C5GA 1NK6A 1Z3EB 3C1YA 1ZQRA 1SL1A 9ICLA 4C8OA 1NOMA 1N56A 3FDSA 3OSNA 4F5PA 5J2IA 1U45A 1SL2A 3V6KA 2JZBB 5KFOA 4O3SA 4O3RA 2F1HA 4FS2A 4UAYA 3HX0A 4ECQA 3MDCA 4M6WB 4F2SA 2IHNA 2MUTA 2ASDA 2BGWA 4NLKA 5DBBA 1NJZA 3T5HA 3K75D 7ICIA 7ICVA 3ZDCA 3V72A 5KG0A 4RT2A 4R64A 3RB6A 4R8UA 5CP2A 2HHQA 2NRXA 5KFZA 3G6VA 2DFLA 4F5OA 4QZDA 3BQ0A 3UQ0A 1ZQCA 1D8LA 4KN7A 4F50A 4NM2A 3PNCA 5J0TA 3MABA 2VANA 3M9NB 2FMSA 9ICHA 2XY6A 3PV8A 4FBTA 1ZQWA 9ICJA 3JPQA 9ICWA 2ATLA 9ICIA 4UB1A 3RAXA 2BCRA 4DQSA 3MGHA 4DOBA 4JV0A 4Q43A 2FLLA 5KFEA 3KHLA 3H8SA 4O5KA 4J9MA 4EYIB 3RRGA 1T4GA 4IRKA 3OJSA 1SZPA 2BPCA 2ZTDA 4IRCA 4RQ2A 5L1KA 4QZAA 3AU6A 4MF2A 4TQRA 3GIJA 4QWEA 4ELTA 2ZTCA 3UQ2A 2AGQA 4Q45A 1QLNA 5KFQA 2PFPA 4KMUA 2XY7A 7ICHA 3RJGA 3K4GA 3OHBA 3Q8MA 4LVSA 1D9FA 9ICSA 1QSYA 4MFAA 5KT7A 4XUSA 3PW4A 5D46A 1JIHA 4UQGA 3Q8QB 3ISBA 3BDPA 2AQ0A 4DO9A 1KSPA 4RQ0A 4PGYA 4YQWA 3RH6A 8ICHA 2ZJ5A 3RJHA 5IIMA 4Q8EA 3UXPA 2KZZA 4MFFA 1S9FA 5DKWA 3C23A 4NXZA 1S0NA 1LV5A 1EXNA 3KHHA 2J6UA 3TQ1A 1XSLA 4KITB 5KT5A 1DGSA 5IILA 5J0UA 1L3VA 1NK4A 1ZQIA 2UVVA 8ICKA 4XA5A 3TAPA 2P66A 4GC6A 5J2AA 1X9WA 2FPKA 5J0WA 4PPXA 3EW9A 2NRWA 1NKEA 4EZ9A 4Z6FA 4ED6A 2HHUA 3OHAA 3AUOA 4P4OA 4B9UA 4J9OA 1TFRA 3QZ8A 4ED2A 1S97A 3KHGA 5DBAA 1UA1A 2PFQA 5D4BA 4LZDA 5HP4A 4K4HA 4RQ8A 1ZQPA 4LZGA 2Q0ZX 3EPIA 2KZ3A 2V9WA 4ECWA 4QZ8A 2XO7A 1ZQVA 3GDXA 4Z6EA 3OSPA 2HW3A 8ICYA 2V4RA 4KN4A 4PHDA 8ICEA 8ICBA 3ETLA 4YXMA 1ZQXA 3RB3A 4YG2A 1S76D 3SV4A 4QZEA 7ICGA 4JWNA 3PX6A 5KFBA 4C8MA 4R63A 2C2DA 3PY8A 2WTFA 2HVIA 4DWIA 1KFTA 4DSEA 3IHQB 2BCQA 2J6TA 2PI5A 3C2MA 4IR1A 5KT6A 4QW9A 3MR2A 4M9HA 4O9MA 2KFZA 1Z00A 4O0IA 3V7LA 4BWMA 3MFIA 2OWOA 3IM1A 1BGXT 1ZQUA 3AU2A 4M6WA 3B0YA 4YXJA 5DG8A 3G6YA 3KHRA 1SKRA 4F4YA 4IQWA 3QEAZ 8ICVA 9ICVA 3GIIA 4J9SA 4DLGA 4DS5A 2HVHA 4RQ6A 4GXIA 5DQHA 4YP3A 2H5XA 2VA8A 1NK5A 4KLGA 3H8JA 4RNOA 2R8HA 2UVRA 2W9CA 2BPGA 1T7PA 4KTQA 4NLNA 4YCXA 4M9NA 3H8WA 2W8LA 3RTVA 4J9KA 4RU9A 2R8GA 4TURA 1JXLA 9ICMA 4EYHB 4GLXA 3EWAA 3LWLA 3MFHA 1XSNA 5KFSA 1RXVA 4KLHA 1C7YA 7ICJA 4EBDA 3RBEA 4I2HA 2FLNA 4UAZA 3JPSA 2ZJ8A 2XCAA 1ZQTA 3T5KA 1MSWD 3SI8A 1NJWA 3PW7A 4DL5A 4JV2A 4GXKA 8ICLA 5CHGA 7ICTA 1DOQA 4P4MA 4TUQA 4P4PA 1XU4A 4JV1A 1KRPA 4DEZA 2VA3A 2M9NA 3PW0A 2AJQA 3KTQA 2PFOA 4PHEA 1RXWA 4UB2A 4QZIA 4DQIA 4I2BA 2LYHA 5J2KA 3GFKB 4J9LA 5HHIA 4DL4A 3RR7A 4I29A 3Q8KA 9ICEA 1S10A 1S0VA 3GQCA 3Q8RB 4QZFA 2NRZA 4QW8A 2JEGA 5J2EA 5KG6A 4QWAA 5KFIA 2BDPA 3PX0A 4KLSA 1BPXA 4UB4A 1KLNA 4KLTA 4O3NA 2GWSA 2IA6A 1PZNA 5IIIA 2ZUDA 3MDAA 5HHHA 4BXOB 3E2EA 1NK9A 8ICOA 4DSKA 9ICAA 5HMLA 2BQRA 4DQPA 1ZJNA 7ICEA 8ICPA 9ICXA 1V9PA 1XC9A 5DGBA 9ICQA 4M9LA 1ZQFA 1JXEA 8ICMA 4UAWA 2W9BB 4UB5A 1ZQHA 5TZVA 1HUOA 3TFSA 2C2RA 1X9SA 3C21A 4DFJA 1RYRA 4E0DA 3LK9A 1T3NA 4RQ3A 5KFWA 1ZETA 1QTMA 1UT8A 4KLJA 3SYZA 3T3FA 4GXJA 5BOLA 1S77D 2MAXA 1KDHA 1UA0A 5HMMA 4DOAA 5J0OA 9ICGA 1ZQQA 5DB7A 4B9VA 4PGXA 1Y88A 4RZRA 4TUSA 5J0RA 4MEXA 9ICOA 3ZD8A 1MQ2A 4I2AA 2Y1JA 3C5FA 4BWJA
chains in the Genus database with same CATH superfamily
4DFDA 5AI8A 7ICPA 4OJ5A 3ISCA 4DL3A 4I2EA 1HEKA 3V6JA 5KFRA 4FFDA 2BHNA 2A1JB 4DQQA 3MGIA 1TAMA 1SXDA 4RUAA 1NKCA 5EWGA 4USAA 3HPOA 3A0HU 3V6HA 1S5LU 1UT5A 1ZQLA 5IINA 4O5EA 4C7ZA 1HJPA 1A77A 1SZHA 2WFAA 4C0ZA 3RJIA 5GTHU 4P0QA 2BQ3A 5DG9A 1PK1A 1IIPA 3OTQA 3O0FA 4M9GA 5ALZA 4RUCA 3C2KA 8ICRA 2KV2A 5F9NA 2BPFA 1F44A 2K89A 2HI0A 5JUMA 3ZDAA 3AM9A 4IQTA 3QU2A 4DL7A 5T14A 2W9MA 1U47A 4GC7A 4RT3A 1OXJA 3MR3A 2QKQA 5K4LA 3A0BU 4JWMA 5AKZA 2I9GA 2RDIA 2F8KA 1BPDA 3KKAA 5AM4A 4A8EA 3L3FX 5KTQA 1WCLA 5AM3A 4MFCA 3H8MA 3OPXA 5KFHA 1AROP 4XRHA 3KZXA 3F2CA 3ONNA 2F1IA 5ALFA 5KFGA 4DFKA 3F5AA 1SKSA 4DQRA 3V7KA 3TFRA 2EANA 8ICSA 3GV5B 2R8JA 5CRXA 1L3UA 2LM4A 3RH5A 2NRTA 2HHXA 2BKEA 4BJQA 1JMSA 5ALXA 3NASA 4J9QA 2IOHA 2E8NA 4MEYA 2YY6A 4RNNA 4C80A 2C28A 5KG1A 4YR2A 3Q8PB 2Y9TA 2XC9A 2QLTA 3JPNA 4Y2QA 3UXNA 5KFYA 5KG4A 4F2RA 3N97B 2LYBA 8ICZA 4DOCA 3HRDD 3BJYA 3SMVA 4M2YA 4F91B 2JEJA 3H4DA 4KLEA 2KN7A 2OYYA 1NK8A 5KFLA 1A0PA 5J29A 7ICKA 7ICOA 3GILA 5ALLA 3SQIA 1ZQMA 1KL9A 3EZ5A 1NI3A 1N48A 5DGAA 2QARB 5J2GA 5KFVA 4J03A 3SZ2A 1L6NA 2P35A 4CF5A 1T3QA 3LVWA 2FPMA 3MBYA 1RYSA 2DUYA 1ZQSA 1PVRA 4TQSA 8ICWA 1D8YA 3OGUA 1XWLA 3IG5A 5L1IA 5FP0A 3HT3A 2FPLA 3NVVA 2HSZA 4UBCA 2K8AA 5KAFU 1X6IA 4XQ8A 1U49A 2CPRA 4I2IA 4CE6A 3NUQA 2B6GA 2RLTA 2EQYA 1X9MA 8ICXA 4BGDA 2W11A 1Z1BA 1K1SA 4PGQA 4J9RA 3M9OB 2KFNA 5DLFA 3BS5A 1U48A 4PZNA 1Z00B 3NVYA 4QWDA 4NL9A 5KFKA 4ECYA 2F2AB 1T8EA 3KOOA 7ICRA 1ZRNA 4M0AA 3H7IA 4DSIA 3GV8B 4PH5A 2LM1A 5AKEA 2KKVA 2XGQA 1Z3EB 3C1YA 2YMLA 1ZQRA 5G5HA 1N56A 5ALSA 3OSNA 1U45A 3E0FA 4FS2A 4UAYA 2KEYA 2OHFA 4M6WB 3HKZC 4KMOB 3K75D 4CF3A 7ICIA 1Z4NA 4RT2A 5TISU 5CP2A 3D2QA 1X66A 5AKJA 5KFZA 3G6VA 2DFLA 4QZDA 3BQ0A 2MSNA 3MABA 3M9NB 3WKDA 3MC1A 1L7NA 3JPQA 2JGAA 9ICIA 3WK7A 1JI7A 3I76A 4DOBA 2FLLA 3FM9A 4EYIB 1SZPA 2BPCA 1Z19A 5L1KA 4QZAA 1Z1VA 4MF2A 2H3ZA 1ZD3A 1BNPA 4QWEA 2ZTCA 2AGQA 1D8BA 1QLNA 2PFPA 7ICHA 3ISBA 4YQWA 8ICHA 2ESEA 2ZJ5A 2KP7A 3RJHA 2KZZA 3QU7A 1EXNA 5AI0A 5ALIA 5IILA 2G0AA 1ZQIA 2P66A 1A6SA 5J2AA 3WKEA 2KIWA 3IN5A 2NRWA 4B9UA 2KJ9A 4P4OA 2PKEA 5DBAA 1ZQPA 4CNQA 1PUZA 2HW3A 8ICYA 4PHDA 1NNLA 3ETLA 3QUCA 3SV4A 4QZEA 7ICGA 5L1MA 1KFTA 2PI5A 3C2MA 2WF6A 2YMPA 5E79U 4Y2UA 3V7LA 2OWOA 1BGXT 1ZQUA 4YXJA 1CI4A 4J9SA 2HVHA 4AYBF 2IOFK 1NK5A 4GFJA 2R8HA 5AK4A 2BPGA 4KTQA 4M9NA 1DXSA 2E3TA 1O08A 9ICMA 3QUBA 2B0CA 4GLXA 3EWAA 1C20A 2KK0A 3MFHA 1XSNA 5HR6A 1RXVA 1C7YA 4I2HA 3WK5A 2ZJ8A 2XCAA 1ZQTA 3PW7A 3IG8A 4P4PA 2VA3A 1XO0A 4PHEA 2LYHA 5AI4A 3RR7A 5HHIA 4DL4A 3SAHA 3H0LB 2JEGA 4Y2VA 5KFIA 4O3NA 1PZNA 2ZUDA 3E2EA 4OJLA 2QB0B 2BQRA 4DQPA 1XC9A 1Q8KA 4NWIA 1ZQFA 3IP4B 1PK3A 8ICMA 3N7PD 3TFSA 2C2RA 3LK9A 1QTMA 4GXJA 5BOLA 5ALPA 5J0RA 3ZD8A 1QCKA 2EZZA 3VCBA 3MGVA 2ISOA 4Y2TA 1PK1B 2DPIA 4YR0A 5DB6A 2KZMA 1ZD2P 2KHVA 1IXRA 5D49A 2UVUA 2R18A 1L3TA 4OJPA 2C22A 3TKAA 3M9MB 5IIJA 2ZXIA 4YD1A 4B9TA 1KEJA 5AI6A 1ZYQA 1YT3A 1NKBA 3RJJA 2BCUA 3PR4A 2G09A 2HHWA 2VIXA 8ICUA 4I27A 1FIQA 4O5CA 3L4PA 2RHFA 4M9JA 5BOMA 7ICSA 4JB3A 3RRHA 1SL0A 5J0QA 1ZQEA 4QNLA 1M6YA 3M7DA 2OXOA 1S0MA 1KFSA 4QZHA 2IBKA 3ZI4A 4WJ3B 2W8KA 1NK7A 2YB1A 2O6KA 3SV3A 2W9CB 1JX4A 5AM5A 1BPZA 9ICPA 3T5JA 1ZQAA 2JEFA 4OCZA 2JEIA 5AM1A 3EYZA 3SENA 3I28A 3H40A 4F3OA 4ECZA 1L7OA 5KT3A 5AM0A 8ICIA 2XGPA 2BQUA 4AYBC 1WUDA 4QWBA 5IIKA 3F53A 3AL0B 1COOA 1X6JA 2E1FA 4BX9C 2KD1A 2FMPA 3V7JA 8ICJA 1BPEA 4O3PA 1WG8A 2EAPA 1RYUA 1ZQGA 5A0LA 4IS7A 5ALKA 4B9SA 4KLUA 3BQ2A 3HW8A 4MHVA 1CUKA 5L1LA 2BR0A 1SWWA 3PMLA 2HOFA 1RG6A 2Y9UA 3NTUA 4TUPA 2BCVA 1ZXIA 2Z7JA 1B22A 4I2DA 3ISDA 3HP6A 5J2HA 4KLIA 2R8KA 1RPLA 2HHSA 1IG6A 4RPXA 4RNMA 2H3VA 3GV7B 3QU9A 3NS1A 3QU4A 1ZQYA 3UXOA 1ZQOA 3ZDEA 1KQQA 1ZQJA 3D2SA 3JPRA 2GOLA 5AKHA 4KLQA 4ECUA 3HWTA 5IIOA 2JH1A 4IQUA 4HYKA 2V4QA 1TE2A 4P2HA 3SR6A 1SKWA 1B43A 1J2MA 1XSPA 2J6SA 9ICKA 2D6FC 5AKGA 1SV0C 7ICUA 3PR5B 3PW2A 3NGDA 2I1QA 2RRDA 4RQ5A 2WF5A 5B5EU 1BVSA 2DKZA 3KZIU 9ICCA 2A19A 4DL6A 4PL1A 5CJ7A 3PO5A 4EBCA 4Y2PA 9ICTA 3M8RA 2G06A 1DK3A 4F5QA 2HBMA 8ICAA 4NL9C 4ELVA 3GIMA 3PVXA 5KFPA 3GZFA 1KN5A 1U4BA 1V38A 1KFDA 3QU5A 5ALHA 2DKXA 3M6KA 1LB2B 3M1YA 2JXJA 4ED7A 3ZDDA 4FBUA 4ECXA 2FDRA 5BPCA 4YD2A 2C2EA 3M8SA 4JMUA 5CB1A 5AIBA 1JUDA 2KHQA 4MF8A 1N62A 3KBBA 2W43A 4ICAA 5DQIA 3WKBA 1VDVA 2ZIXB 2ZJAA 1U9LA 2NRVA 1QSSA 2Y1IA 2ZUCA 4DFMA 4RQMA 1ZQBA 4QWCA 4ED3A 3PO4A 5ALRA 9ICLA 1NOMA 1ZD4A 2K4PA 1GO3F 3V6KA 2JZBB 4O3RA 1YZ6A 2F1HA 1ZOLA 3HX0A 3MDCA 4F2SA 2ASDA 2BGWA 2AXTU 1F5SA 4NLCA 1DGJA 1ZQ1C 3ZDCA 2XVTA 2M0NA 4QIWF 2WB1F 1ZQCA 1D8LA 4KN7A 4F50A 3PV8A 2KVSA 4NLBA 9ICJA 9ICWA 2ATLA 4UB1A 4DQSA 1VJ5A 3MGHA 4JV0A 4O5KA 2ZIVB 3OJSA 2ZTDA 2KG5A 4RQ2A 4TQRA 3FC4A 3GIJA 1N61A 4Q45A 5C0YA 4KMUA 2XY7A 5KNIA 3RJGA 3K4GA 3Q8MA 2F77X 3WKCA 4O3MA 1COKA 1QSYA 4MFAA 5KT7A 4UQGA 1Q3UA 2KKPA 2AQ0A 4DO9A 1KSPA 5AKIA 4KX5A 1UCVA 4BUGA 3DV9A 5IIMA 4Q8EA 4MFFA 5DKWA 4NXZA 1LV5A 1S0NA 3TQ1A 2KVCA 1VLBA 1X9XA 1L3VA 2E8MA 4XA5A 2A1AA 1OUQA 3TAPA 4Y2XA 2DGZA 2CXYA 4F72A 4OJ6A 2XIDA 4ED2A 1DRGA 1UA1A 2PFQA 4LZDA 2DBYA 3EPIA 2V9WA 4ECWA 4QZ8A 2XO7A 1ZQVA 3FAHA 3GDXA 2YMQA 4Z6EA 3OSPA 3LVVA 2V4RA 8ICEA 2JMGA 1ZQXA 3PX6A 1L8OA 2WTFA 2HVIA 3RFAA 4DSEA 2J6TA 3MR2A 5KT6A 2HCFA 4O9MA 2KICA 3BZKA 2KFZA 4O0IA 3AMZA 2MRLA 3G6YA 3IM1A 3AU2A 4M6WA 1SKRA 5ALVA 4IQWA 3SAGA 4F4YA 8ICVA 1SIJA 3GIIA 1N63A 3PZPA 4RQ6A 2RP5A 2G5HB 1LKYA 4RNOA 2UVRA 2JRZA 2LKYA 1J2NA 3H8WA 2W8LA 2NO5A 4RU9A 5AM2A 4EBDA 2AHOB 2FLNA 2KOBA 4NV0A 1Q46A 4DL5A 4GXKA 4P4MA 1UQVA 2PMZC 1RXWA 4QJFB 5AKLA 2HBJA 5J2KA 9ICEA 3GQCA 2EZYA 2HBKA 5J2EA 2YMMA 1RDFA 3PX0A 3UMBA 4KLTA 2H3IA 3MDAA 5HHHA 4BXOB 8ICOA 5HMLA 2W7OA 9ICXA 1V9PA 1RM6C 5AK5A 4UB5A 1ZQHA 5TZVA 2E5SA 4QIWC 3C21A 3ALRA 4E0DA 3LYSA 4IC9A 5KFWA 3T3FA 4Y2SA 1KDHA 2DWQA 4DOAA 2ES6A 1ZQQA 1LVHA 4B9VA 1Y88A 1WWVA 2XI9A 4MEXA 4I2AA 2XICA 1RQLA 3CP8A 1MQ2A 5HNKA 3UMCA 5F9LA 7ICMA 1ZQKA 5J2BA 5ALQA 1L7PA 5DB9A 5ALWA 1N60A 3OJUA 3RF9A 2YQEA 4M04A 4OD0A 1ZQZA 4FS1A 1FFVA 3RB4A 5KG5A 2QARA 9ICRA 2F76X 2JV3A 5KFMA 5GTIU 5KFTA 3CNHA 1X42A 4F93B 3CYMA 4Q44A 3UM9A 4DSLA 4UASA 4Z6DA 4DF8A 5DBCA 2ASJA 4F5RA 4IL6U 1RZTA 2ZIWA 3Q8LA 4IRDA 4NLGA 5KFDA 4PHPA 1BPBA 5KFJA 7ICLA 4UB6U 3N28A 4R65A 4I2GA 3PSIA 1ZRMA 2FJ6A 3BS7A 3N4MB 4PL2A 3TI0A 1MN8A 4O3QA 4F4WA 2D8CA 8ICCA 4YFKA 3RJKA 3PX4A 4RPZA 3WK8A 2EDUA 4QZBA 3RAQA 2KE7A 2ODGA 2DPJA 4F5NA 4I2JA 4RPYA 5J0YA 3E58A 2WHEA 2RDJA 3Q8SB 4US8A 1FFUA 3UPQA 4YMMA 4RQ4A 1IM4A 1N5WA 5L1JA 1L3SA 4C8NA 2ISPA 4C4RA 2W04A 3H4BA 2R8IA 3C2LA 4BDPA 1QQ5A 3GU3A 1TK0A 4YN4A 3RH4A 2ALZA 5CA7A 3RJFA 4B9LA 4J9NA 4EZ6A 2JH7A 4FE3A 4ECRA 3LDAA 3TANA 1XO1A 2KJ8A 2ZUBA 2HOQA 2F44A 4Y2YA 1QSLA 5J2DA 3HJEA 7ICQA 2B21A 1S8OA 1HUZA 3JPPA 3EUB2 5KL1B 8ICNA 3KKAC 3N7RC 4F8RA 5AK3A 4ACOA 5KFUA 2W9AA 2H3QA 1TK8A 2F1JA 1WYGA 5J2CA 3SAFA 1MQ3A 3JPOA 2XY5A 2KMDA 2JR5A 5KG7A 3M6ZA 1WCNA 2ZIUA 4FZLA 2W9BA 3ZDBA 3C1ZA 4GIBA 5KFNA 2OM6A 4US9A 3KFUF 1X2IA 8ICTA 5EWFA 4F92B 3F5EA 3QXGA 4NM1A 4ECSA 2IMWP 1SXEA 1SGGA 5J0XA 3R9KA 1V97A 4ED1A 3WK9A 2W3SA 4F4XA 4J9PA 9ICUA 4OO1J 3N7SC 4JK1A 1K1QA 3QYPA 1JROA 2KSOA 4DSJA 2G08A 1ZQNA 3ICXA 2P6RA 4ED0A 4UATA 5ALYA 4C4SA 4JUZA 3RR8A 4R8UB 5DDMA 3BQ1A 4C7YA 1NK0A 2MUTB 4NY8A 2MA1A 4QZGA 4OJOA 9ICFA 4C8KA 2WF7A 5AKXA 2HHTA 3BQTA 5F3XB 4FO6A 5DQGA 9ICBA 3RJEA 4UW9A 4C8OA 5ALEA 4F5PA 1PVPA 5KFOA 4O3SA 2G5IB 4ECQA 3AN1A 3BS5B 2K4HA 2K8CB 5DBBA 3T5HA 7ICVA 5KG0A 4R64A 2HHQA 5AKYA 4F5OA 3UQ0A 3PNCA 2FMSA 4PZOA 2XY6A 4FBTA 1N5XA 5AI9A 3RAXA 2BCRA 2YB4A 2GO7A 4Q43A 3KHLA 3H8SA 4B6JA 4J9MA 2F8LA 1T4GA 4IRKA 1SV0A 2VJ5A 4IRCA 3UQ2A 9ICSA 4LVSA 4XUSA 3PW4A 3B9JA 5D46A 3Q8QB 3BDPA 4RQ0A 5AK6A 3UXPA 3KHHA 2OCEA 4KITB 1DGSA 1NK4A 3HILA 2W55A 4GC6A 1X9WA 2FPKA 2E8OA 2LPEA 4UARA 5J0WA 3EW9A 1CRXA 1NKEA 4EZ9A 4Z6FA 4ED6A 2HHUA 2I6XA 3F2DA 2OEHA 2N1RA 4DCCA 4LZGA 2Q0ZX 2KZ3A 2Y0SF 2ZG6A 5B66U 4YXMA 3UMGA 3RB3A 1KW4A 1SWVA 4RQNA 1S76D 2MU2A 2EZXA 4R63A 2C2DA 3PY8A 3HKZF 3NVWA 1QQ7A 5ALMA 2OH2A 3IHQB 2BCQA 4IR1A 2NYVA 4M9HA 2WAQF 5J8YC 1NZBA 3S6JA 2WF8A 5JRTA 1Z00A 3MFIA 3CW2C 5ALJA 2CN1A 3B0YA 3KHRA 4DLGA 1ECWA 4FZNA 3DDHA 4GXIA 5AI5A 3QX7A 4YP3A 2H5XA 4KLGA 3SEIA 2W9CA 1T7PA 4NLNA 4YCXA 1O03A 3T79A 4J9KA 1QH9A 4TURA 4EYHB 3LWLA 4UAZA 3JPSA 3BQ7A 2E8PA 3T5KA 4CDGA 1NJWA 8ICLA 4EELA 7ICTA 1DOQA 4TUQA 4JV1A 1KRPA 2BDUA 2M9NA 3PW0A 2PFOA 4UB2A 4KX3A 4DQIA 4I29A 1YZ7A 1S10A 3Q8RB 3ETRA 3D2NA 2NRZA 5H2FU 1J97A 4QWAA 5KG6A 4KLSA 1KBUA 1KLNA 2IA6A 3IV6A 4DSKA 9ICAA 7ICEA 2KNJA 5DGBA 4M9LA 4UAWA 3AEVA 2HDOA 1HUOA 4P0PB 1RYRA 2K8BB 2D3DA 1T3NA 4KLJA 1UT8A 1S77D 5HMMA 2EAOA 4PGXA 3AQEA 3IRUA 3WKAA 4RZRA 4TUSA 1Q3VA 1PVQA 9ICOA 3EPGA 4BWJA 5KL8B 4CCHA 1URJA 1TK5A 1FO4A 5KFXA 5KG3A 5DLGA 2K60A 2IHMA 1LKYB 2K4IA 2E1EA 1BPYA 3THVA 1ZQDA 3VC8A 4Z6CA 3PW5A 3QZ7A 5HR7A 2BCSA 2HHVA 4PHAA 3MR6A 5DDYA 5CR0A 5KAIU 2LHTA 5ALNA 4YR3A 5G5GA 4X5VA 2W7PA 5L9XA 1XS9D 1MA7A 3QEBZ 5ALGA 4RQ1A 2XCPA 2AQ4A 1XNSA 3D6JA 4M47A 2ZTEA 2G07A 4K4IA 1T94A 4YMOA 4DL2A 8ICFA 1ZJMA 3G6XA 2ASLA 4IR9A 5CEHA 4DSFA 4I2CA 4G3IA 3I1YA 4K4GA 1MC8A 4ZH4A 3WU2U 3RBDA 4EEYA 2PFNA 4B9NA 3PSFA 1RQNA 2GH1A 4I2FA 2GLEA 5EWEA 1TAQA 3PMNA 2PXIA 2KJ5A 2JZBA 2KIVA 3MR5A 4KLLA 4HAIA 5EE3A 2A1JA 2WAQC 4R66A 3C28A 5J0PA 2RQ5A 1IV8A 4DF4A 5KFAA 1UHUA 2ZIVA 3LWMA 5J2FA 4UB3A 4F4ZA 2LYAA 3TADC 1TAUA 8ICGA 4QZ9A 4Y2JA 2WB1C 1B4FA 5J0SA 1Z4OA 3BZCA 4IQVA 3GIKA 5ALOA 3QUQA 4B9MA 1UPHA 4DFPA 2P6UA 4ECTA 2HOIA 4YVZA 4CRXA 1A76A 4C4TA 1X40A 2DF4B 5CWRA 4RQ7A 3TAQA 2A3VA 3K1ZA 5KFFA 2W03A 4QZCA 1CEZA 4DLEA 1S0OA 1NJXA 4NLZA 1NJYA 3KD3A 2KTQA 4EENA 4EX6A 1WWUA 5KT4A 4UAUA 4ELUA 4YMNA 4FZMA 4CF4A 4C8LA 1L5UA 1JRPA 7ICFA 4ECVA 4KLOA 1TV9A 4F4KA 4O3OA 2Y0SC 4KLFA 4I28A 4Q8FA 2YTUA 3H0MB 2ZIWB 5DB8A 3SD7A 1JN3A 4Y2RA 3T5LA 4P0PA 5KT2A 1H38A 3QNMA 1V85A 9ICNA 5KFCA 5C5JA 5DG7A 1K5OA 2DQNB 3B0XA 4PJ0U 8ICQA 2UVWA 2DL0A 5ALUA 2AU0A 5EOZA 3RB0A 1D9DA 2PI4A 2YN4A 4UBBA 5EE1A 1TVAA 4ED8A 3QE9Y 1SV4A 3L5KA 4BXOA 4KLDA 7ICNA 1NZPA 3PSPA 5KG2A 2AGPA 2FMQA 2FE9A 3NVZA 3FYHA 3ORYA 4DS4A 4EBEA 1KTQA 3AQFA 2NV3A 3DEEA 4KLMA 4UB8U 2IOFA 3ED5A 2AGOA 3TARA 1TKDA 5EE0A 2VA2A 2FLPA 3JPTA 3ZD9A 5J2JA 3C5GA 3F2BA 1NK6A 5JU5A 1SL1A 2PMZF 3FDSA 4U7CA 5J2IA 1SL2A 2BZFA 2IHNA 2MUTA 4NLKA 1NJZA 3V72A 3RB6A 4R8UA 3C29A 2NRXA 1OW5A 2AH5A 2EH9A 4ZOHC 4NM2A 2VKQA 5J0TA 2VANA 9ICHA 2VJ4A 1ZQWA 2Q4TA 4F71A 3NRZA 1B0XA 5KFEA 3RRGA 2ZXHA 1ED1A 5ALTA 1AQ6A 2I5HA 3AU6A 3K1RB 4ELTA 2LMRA 5KFQA 2YX8A 4EX7A 3OHBA 1D9FA 2KSOB 2CRXA 1JIHA 1JALA 4PGYA 3RH6A 2F3NA 1S9FA 3C23A 2J6UA 1DK2A 1XSLA 5KT5A 5J0UA 2UVVA 8ICKA 2W54A 4G9BA 2W3RA 4PPXA 1QQ6A 3OHAA 3J81j 3AUOA 4J9OA 1TFRA 3QZ8A 1S97A 2HMXA 3KHGA 5D4BA 5HP4A 4K4HA 4RQ8A 3WK4A 4EEKA 5JTIA 4KN4A 8ICBA 1HIWA 3H0RB 4YG2A 3TADA 4JWNA 5KFBA 4C8MA 4DWIA 1L7MA 5AICA 5AIAA 4QW9A 1ZD5A 1L8LA 4BWMA 5ALDA 2QB1A 5DG8A 4NJ8A 9ICVA 3QEAZ 1N2XA 4LJXA 4DS5A 5DQHA 3CRXA 2VA8A 2NO4A 3H8JA 2WF9A 2FI1A 3U26A 3WK6A 3RTVA 2R8GA 1JXLA 3QUTA 3IDWA 4P0QB 2QB0A 5KFSA 4KLHA 7ICJA 3RBEA 2H3FA 2HBLA 5AKKA 5J8YA 1MSWD 3SI8A 4JV2A 5CHGA 1SB3C 1XU4A 4DEZA 2AJQA 3KTQA 5EE9A 1BNOA 3PSTA 4QZIA 4AP9A 4I2BA 2LBOA 3GFKB 4U6PA 4J9LA 2LI6A 3Q8KA 1S0VA 1P7DA 4QZFA 2K4EA 3TACB 4QW8A 3NRWA 2BDPA 2JHDA 1BPXA 4UB4A 5AHXA 2GWSA 5IIIA 1NK9A 1ZJNA 8ICPA 2ZIXA 9ICQA 1JXEA 1FEZA 2ZIUB 2W9BB 2L5YA 1F0MA 1X9SA 4DFJA 1KKXA 4RQ3A 1ZETA 3SYZA 2MAXA 1UA0A 5J0OA 9ICGA 4UAVA 5DB7A 4CGZA 2EAMA 2Y1JA 3C5FA
chains in the Genus database with same CATH topology
5HNKA 2ISOA 4CCHA 7ICPA 5F9LA 7ICMA 3ISCA 4DL3A 4I2EA 1TK5A 2DPIA 4YR0A 3V6JA 5J2BA 5DB6A 1ZQKA 5DB9A 5KFXA 3OJUA 5KG3A 2KZMA 5KFRA 4M04A 5DLGA 2IHMA 2BHNA 1IXRA 2A1JB 4DQQA 1ZQZA 3MGIA 5D49A 4FS1A 5KG5A 3RB4A 1BPYA 4RUAA 2UVUA 3THVA 1NKCA 1ZQDA 4Z6CA 9ICRA 1L3TA 3PW5A 2C22A 5KFMA 3QZ7A 5EWGA 3M9MB 5IIJA 2BCSA 2HHVA 3HPOA 4PHAA 3MR6A 5KFTA 5DDYA 3V6HA 5CR0A 4YD1A 4YR3A 4B9TA 1KEJA 1UT5A 1ZYQA 4F93B 1NKBA 1ZQLA 5IINA 2BCUA 3RJJA 3PR4A 4O5EA 4Q44A 2HHWA 1HJPA 4X5VA 4DSLA 1A77A 8ICUA 5L9XA 1XS9D 4I27A 4Z6DA 4DF8A 3RJIA 3QEBZ 2BQ3A 5DBCA 4O5CA 2ASJA 4F5RA 5DG9A 4M9JA 1RZTA 3Q8LA 5BOMA 3EPGA 4RQ1A 2XCPA 2AQ4A 4RUCA 4M9GA 7ICSA 4IRDA 3RRHA 3C2KA 1SL0A 8ICRA 4NLGA 5F9NA 4M47A 5J0QA 1ZQEA 2ZTEA 2BPFA 5KFDA 4PHPA 1BPBA 5JUMA 5KFJA 3ZDAA 7ICLA 4K4IA 1S0MA 4YMOA 1KFSA 4DL2A 8ICFA 4QZHA 1ZJMA 3G6XA 2IBKA 4IQTA 2ASLA 4DL7A 4IR9A 4R65A 4I2GA 2W9MA 2W8KA 1U47A 4DSFA 4I2CA 1NK7A 4G3IA 4GC7A 4K4GA 4RT3A 3MR3A 3SV3A 1MC8A 3N4MB 2W9CB 3TI0A 1JX4A 4JWMA 1BPZA 2I9GA 2RDIA 4ZH4A 4O3QA 4F4WA 3T5JA 1ZQAA 8ICCA 1BPDA 2JEFA 4YFKA 3RBDA 2JEIA 4EEYA 2PFNA 5KTQA 3EYZA 3PX4A 3RJKA 1WCLA 4RPZA 4B9NA 4QZBA 3H40A 3RAQA 2DPJA 4F3OA 4ECZA 4F5NA 4I2JA 5KT3A 4I2FA 8ICIA 4MFCA 4RPYA 5EWEA 5J0YA 2XGPA 5KFHA 3Q8SB 1TAQA 3PMNA 2RDJA 2BQUA 1AROP 4QWBA 4XRHA 2PXIA 5IIKA 2JZBA 1COOA 3MR5A 2F1IA 3UPQA 4KLLA 5KFGA 4YMMA 4RQ4A 1IM4A 4DFKA 2FMPA 1SKSA 4DQRA 2A1JA 3V7JA 8ICJA 3V7KA 4R66A 1BPEA 3TFRA 4O3PA 8ICSA 3GV5B 2R8JA 1L3UA 3RH5A 5L1JA 1ZQGA 2NRTA 2HHXA 2BKEA 1L3SA 1JMSA 5J0PA 4DF4A 4B9SA 4C8NA 4KLUA 3BQ2A 2ISPA 5KFAA 3HW8A 4J9QA 1CUKA 5L1LA 3LWMA 5J2FA 3H4BA 2BR0A 4UB3A 4MEYA 2R8IA 3PMLA 3C2LA 4F4ZA 4BDPA 4RNNA 1TAUA 1TK0A 4YN4A 2C28A 3RH4A 4QZ9A 3NTUA 5CA7A 2ALZA 3RJFA 4TUPA 4B9LA 8ICGA 4J9NA 2BCVA 4EZ6A 1B22A 4ECRA 3LDAA 4I2DA 5KG1A 4YR2A 3ISDA 5J0SA 3Q8PB 3TANA 3HP6A 5J2HA 4IQVA 3GIKA 1XO1A 4KLIA 2ZUBA 2R8KA 1RPLA 2HHSA 4B9MA 4RPXA 4RNMA 1QSLA 3GV7B 5J2DA 4DFPA 2P6UA 2XC9A 3UXOA 1ZQYA 1ZQOA 7ICQA 3ZDEA 1ZQJA 3JPNA 2B21A 4ECTA 3JPRA 4YVZA 1HUZA 3JPPA 1A76A 3UXNA 4KLQA 4ECUA 9ICPA 5KFYA 5KG4A 8ICNA 5CWRA 3HWTA 4F2RA 3N97B 5IIOA 4RQ7A 3TAQA 4F8RA 5KFFA 8ICZA 4DOCA 5KFUA 2W9AA 3BJYA 4IQUA 4QZCA 4HYKA 1TK8A 2F1JA 2V4QA 4F91B 4M2YA 2JEJA 1CEZA 5J2CA 3H4DA 4DLEA 1S0OA 1NJXA 1MQ3A 4NLZA 4KLEA 4P2HA 3JPOA 1NJYA 2KN7A 1SKWA 2XY5A 1B43A 5KFLA 1NK8A 2KTQA 5KG7A 1XSPA 5J29A 1WCNA 5KT4A 2W9BA 2J6SA 7ICKA 7ICOA 3GILA 1ZQMA 4ELUA 4YMNA 3C1ZA 3EZ5A 5KFNA 3ZDBA 9ICKA 1N48A 5DGAA 7ICUA 4C8LA 3PR5B 1L5UA 3PW2A 7ICFA 3NGDA 8ICTA 1X2IA 2I1QA 4ECVA 4RQ5A 5EWFA 4F92B 5J2GA 1BVSA 5KFVA 4KLOA 1TV9A 9ICCA 3SZ2A 4F4KA 4NM1A 4O3OA 2FPMA 4ECSA 4KLFA 3MBYA 2IMWP 1RYSA 4I28A 4Q8FA 4DL6A 5CJ7A 5DB8A 1ZQSA 5J0XA 3PO5A 4EBCA 4TQSA 9ICTA 4ED1A 3M8RA 1D8YA 8ICWA 1JN3A 3OGUA 3T5LA 1XWLA 5L1IA 4F5QA 3HT3A 5KT2A 4F4XA 1H38A 4J9PA 2FPLA 9ICUA 8ICAA 4UBCA 4ELVA 9ICNA 4XQ8A 4JK1A 3GIMA 1K1QA 5KFPA 5KFCA 3PVXA 1U49A 5C5JA 5DG7A 4I2IA 4DSJA 1ZQNA 1U4BA 1KFDA 3B0XA 1LB2B 2P6RA 2UVWA 8ICQA 4ED7A 4ED0A 3ZDDA 4FBUA 4ECXA 2AU0A 5BPCA 1X9MA 4YD2A 5EOZA 3RB0A 1D9DA 4BGDA 2C2EA 2PI4A 3M8SA 8ICXA 4JUZA 4UBBA 1K1SA 4PGQA 4J9RA 3M9OB 3RR8A 1TVAA 2KFNA 5CB1A 4ED8A 4R8UB 3QE9Y 5DDMA 4BXOA 4MF8A 3BQ1A 4KLDA 7ICNA 5DLFA 1NK0A 5KG2A 2AGPA 2MUTB 5DQIA 1U48A 2FMQA 4NY8A 2ZJAA 3FYHA 4QZGA 1Z00B 3ORYA 1U9LA 4QWDA 5KFKA 4ECYA 2NRVA 4DS4A 4EBEA 1T8EA 1KTQA 1QSSA 7ICRA 2Y1IA 2ZUCA 4M0AA 9ICFA 4C8KA 4KLMA 3H7IA 4DFMA 4DSIA 2HHTA 3GV8B 2AGOA 3BQTA 3TARA 4PH5A 1TKDA 2VA2A 1ZQBA 4FO6A 2FLPA 3JPTA 3ZD9A 4QWCA 5J2JA 4ED3A 2XGQA 3PO4A 5DQGA 9ICBA 3RJEA 3C5GA 1NK6A 1Z3EB 3C1YA 1ZQRA 1SL1A 9ICLA 4C8OA 1NOMA 1N56A 3FDSA 3OSNA 4F5PA 5J2IA 1U45A 1SL2A 3V6KA 2JZBB 5KFOA 4O3SA 4O3RA 2F1HA 4FS2A 4UAYA 3HX0A 4ECQA 3MDCA 4M6WB 4F2SA 2IHNA 2MUTA 2ASDA 2BGWA 4NLKA 5DBBA 1NJZA 3T5HA 3K75D 7ICIA 7ICVA 3ZDCA 3V72A 5KG0A 4RT2A 4R64A 3RB6A 4R8UA 5CP2A 2HHQA 2NRXA 5KFZA 3G6VA 2DFLA 4F5OA 4QZDA 3BQ0A 3UQ0A 1ZQCA 1D8LA 4KN7A 4F50A 4NM2A 3PNCA 5J0TA 3MABA 2VANA 3M9NB 2FMSA 9ICHA 2XY6A 3PV8A 4FBTA 1ZQWA 9ICJA 3JPQA 9ICWA 2ATLA 9ICIA 4UB1A 3RAXA 2BCRA 4DQSA 3MGHA 4DOBA 4JV0A 4Q43A 2FLLA 5KFEA 3KHLA 3H8SA 4O5KA 4J9MA 4EYIB 3RRGA 1T4GA 4IRKA 3OJSA 1SZPA 2BPCA 2ZTDA 4IRCA 4RQ2A 5L1KA 4QZAA 3AU6A 4MF2A 4TQRA 3GIJA 4QWEA 4ELTA 2ZTCA 3UQ2A 2AGQA 4Q45A 1QLNA 5KFQA 2PFPA 4KMUA 2XY7A 7ICHA 3RJGA 3K4GA 3OHBA 3Q8MA 4LVSA 1D9FA 9ICSA 1QSYA 4MFAA 5KT7A 4XUSA 3PW4A 5D46A 1JIHA 4UQGA 3Q8QB 3ISBA 3BDPA 2AQ0A 4DO9A 1KSPA 4RQ0A 4PGYA 4YQWA 3RH6A 8ICHA 2ZJ5A 3RJHA 5IIMA 4Q8EA 3UXPA 2KZZA 4MFFA 1S9FA 5DKWA 3C23A 4NXZA 1S0NA 1LV5A 1EXNA 3KHHA 2J6UA 3TQ1A 1XSLA 4KITB 5KT5A 1DGSA 5IILA 5J0UA 1L3VA 1NK4A 1ZQIA 2UVVA 8ICKA 4XA5A 3TAPA 2P66A 4GC6A 5J2AA 1X9WA 2FPKA 5J0WA 4PPXA 3EW9A 2NRWA 1NKEA 4EZ9A 4Z6FA 4ED6A 2HHUA 3OHAA 3AUOA 4P4OA 4B9UA 4J9OA 1TFRA 3QZ8A 4ED2A 1S97A 3KHGA 5DBAA 1UA1A 2PFQA 5D4BA 4LZDA 5HP4A 4K4HA 4RQ8A 1ZQPA 4LZGA 2Q0ZX 3EPIA 2KZ3A 2V9WA 4ECWA 4QZ8A 2XO7A 1ZQVA 3GDXA 4Z6EA 3OSPA 2HW3A 8ICYA 2V4RA 4KN4A 4PHDA 8ICEA 8ICBA 3ETLA 4YXMA 1ZQXA 3RB3A 4YG2A 1S76D 3SV4A 4QZEA 7ICGA 4JWNA 3PX6A 5KFBA 4C8MA 4R63A 2C2DA 3PY8A 2WTFA 2HVIA 4DWIA 1KFTA 4DSEA 3IHQB 2BCQA 2J6TA 2PI5A 3C2MA 4IR1A 5KT6A 4QW9A 3MR2A 4M9HA 4O9MA 2KFZA 1Z00A 4O0IA 3V7LA 4BWMA 3MFIA 2OWOA 3IM1A 1BGXT 1ZQUA 3AU2A 4M6WA 3B0YA 4YXJA 5DG8A 3G6YA 3KHRA 1SKRA 4F4YA 4IQWA 3QEAZ 8ICVA 9ICVA 3GIIA 4J9SA 4DLGA 4DS5A 2HVHA 4RQ6A 4GXIA 5DQHA 4YP3A 2H5XA 2VA8A 1NK5A 4KLGA 3H8JA 4RNOA 2R8HA 2UVRA 2W9CA 2BPGA 1T7PA 4KTQA 4NLNA 4YCXA 4M9NA 3H8WA 2W8LA 3RTVA 4J9KA 4RU9A 2R8GA 4TURA 1JXLA 9ICMA 4EYHB 4GLXA 3EWAA 3LWLA 3MFHA 1XSNA 5KFSA 1RXVA 4KLHA 1C7YA 7ICJA 4EBDA 3RBEA 4I2HA 2FLNA 4UAZA 3JPSA 2ZJ8A 2XCAA 1ZQTA 3T5KA 1MSWD 3SI8A 1NJWA 3PW7A 4DL5A 4JV2A 4GXKA 8ICLA 5CHGA 7ICTA 1DOQA 4P4MA 4TUQA 4P4PA 1XU4A 4JV1A 1KRPA 4DEZA 2VA3A 2M9NA 3PW0A 2AJQA 3KTQA 2PFOA 4PHEA 1RXWA 4UB2A 4QZIA 4DQIA 4I2BA 2LYHA 5J2KA 3GFKB 4J9LA 5HHIA 4DL4A 3RR7A 4I29A 3Q8KA 9ICEA 1S10A 1S0VA 3GQCA 3Q8RB 4QZFA 2NRZA 4QW8A 2JEGA 5J2EA 5KG6A 4QWAA 5KFIA 2BDPA 3PX0A 4KLSA 1BPXA 4UB4A 1KLNA 4KLTA 4O3NA 2GWSA 2IA6A 1PZNA 5IIIA 2ZUDA 3MDAA 5HHHA 4BXOB 3E2EA 1NK9A 8ICOA 4DSKA 9ICAA 5HMLA 2BQRA 4DQPA 1ZJNA 7ICEA 8ICPA 9ICXA 1V9PA 1XC9A 5DGBA 9ICQA 4M9LA 1ZQFA 1JXEA 8ICMA 4UAWA 2W9BB 4UB5A 1ZQHA 5TZVA 1HUOA 3TFSA 2C2RA 1X9SA 3C21A 4DFJA 1RYRA 4E0DA 3LK9A 1T3NA 4RQ3A 5KFWA 1ZETA 1QTMA 1UT8A 4KLJA 3SYZA 3T3FA 4GXJA 5BOLA 1S77D 2MAXA 1KDHA 1UA0A 5HMMA 4DOAA 5J0OA 9ICGA 1ZQQA 5DB7A 4B9VA 4PGXA 1Y88A 4RZRA 4TUSA 5J0RA 4MEXA 9ICOA 3ZD8A 1MQ2A 4I2AA 2Y1JA 3C5FA 4BWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HNK A;  2ISO A;  4CCH A;  7ICP A;  5F9L A;  7ICM A;  3ISC A;  4DL3 A;  4I2E A;  1TK5 A;  2DPI A;  4YR0 A;  3V6J A;  5J2B A;  5DB6 A;  1ZQK A;  5DB9 A;  5KFX A;  3OJU A;  5KG3 A;  2KZM A;  5KFR A;  4M04 A;  5DLG A;  2IHM A;  2BHN A;  1IXR A;  2A1J B;  4DQQ A;  1ZQZ A;  3MGI A;  5D49 A;  4FS1 A;  5KG5 A;  3RB4 A;  1BPY A;  4RUA A;  2UVU A;  3THV A;  1NKC A;  1ZQD A;  4Z6C A;  9ICR A;  1L3T A;  3PW5 A;  2C22 A;  5KFM A;  3QZ7 A;  5EWG A;  3M9M B;  5IIJ A;  2BCS A;  2HHV A;  3HPO A;  4PHA A;  3MR6 A;  5KFT A;  5DDY A;  3V6H A;  5CR0 A;  4YD1 A;  4YR3 A;  4B9T A;  1KEJ A;  1UT5 A;  1ZYQ A;  4F93 B;  1NKB A;  1ZQL A;  5IIN A;  2BCU A;  3RJJ A;  3PR4 A;  4O5E A;  4Q44 A;  2HHW A;  1HJP A;  4X5V A;  4DSL A;  1A77 A;  8ICU A;  5L9X A;  1XS9 D;  4I27 A;  4Z6D A;  4DF8 A;  3RJI A;  3QEB Z;  2BQ3 A;  5DBC A;  4O5C A;  2ASJ A;  4F5R A;  5DG9 A;  4M9J A;  1RZT A;  3Q8L A;  5BOM A;  3EPG A;  4RQ1 A;  2XCP A;  2AQ4 A;  4RUC A;  4M9G A;  7ICS A;  4IRD A;  3RRH A;  3C2K A;  1SL0 A;  8ICR A;  4NLG A;  5F9N A;  4M47 A;  5J0Q A;  1ZQE A;  2ZTE A;  2BPF A;  5KFD A;  4PHP A;  1BPB A;  5JUM A;  5KFJ A;  3ZDA A;  7ICL A;  4K4I A;  1S0M A;  4YMO A;  1KFS A;  4DL2 A;  8ICF A;  4QZH A;  1ZJM A;  3G6X A;  2IBK A;  4IQT A;  2ASL A;  4DL7 A;  4IR9 A;  4R65 A;  4I2G A;  2W9M A;  2W8K A;  1U47 A;  4DSF A;  4I2C A;  1NK7 A;  4G3I A;  4GC7 A;  4K4G A;  4RT3 A;  3MR3 A;  3SV3 A;  1MC8 A;  3N4M B;  2W9C B;  3TI0 A;  1JX4 A;  4JWM A;  1BPZ A;  2I9G A;  2RDI A;  4ZH4 A;  4O3Q A;  4F4W A;  3T5J A;  1ZQA A;  8ICC A;  1BPD A;  2JEF A;  4YFK A;  3RBD A;  2JEI A;  4EEY A;  2PFN A;  5KTQ A;  3EYZ A;  3PX4 A;  3RJK A;  1WCL A;  4RPZ A;  4B9N A;  4QZB A;  3H40 A;  3RAQ A;  2DPJ A;  4F3O A;  4ECZ A;  4F5N A;  4I2J A;  5KT3 A;  4I2F A;  8ICI A;  4MFC A;  4RPY A;  5EWE A;  5J0Y A;  2XGP A;  5KFH A;  3Q8S B;  1TAQ A;  3PMN A;  2RDJ A;  2BQU A;  1ARO P;  4QWB A;  4XRH A;  2PXI A;  5IIK A;  2JZB A;  1COO A;  3MR5 A;  2F1I A;  3UPQ A;  4KLL A;  5KFG A;  4YMM A;  4RQ4 A;  1IM4 A;  4DFK A;  2FMP A;  1SKS A;  4DQR A;  2A1J A;  3V7J A;  8ICJ A;  3V7K A;  4R66 A;  1BPE A;  3TFR A;  4O3P A;  8ICS A;  3GV5 B;  2R8J A;  1L3U A;  3RH5 A;  5L1J A;  1ZQG A;  2NRT A;  2HHX A;  2BKE A;  1L3S A;  1JMS A;  5J0P A;  4DF4 A;  4B9S A;  4C8N A;  4KLU A;  3BQ2 A;  2ISP A;  5KFA A;  3HW8 A;  4J9Q A;  1CUK A;  5L1L A;  3LWM A;  5J2F A;  3H4B A;  2BR0 A;  4UB3 A;  4MEY A;  2R8I A;  3PML A;  3C2L A;  4F4Z A;  4BDP A;  4RNN A;  1TAU A;  1TK0 A;  4YN4 A;  2C28 A;  3RH4 A;  4QZ9 A;  3NTU A;  5CA7 A;  2ALZ A;  3RJF A;  4TUP A;  4B9L A;  8ICG A;  4J9N A;  2BCV A;  4EZ6 A;  1B22 A;  4ECR A;  3LDA A;  4I2D A;  5KG1 A;  4YR2 A;  3ISD A;  5J0S A;  3Q8P B;  3TAN A;  3HP6 A;  5J2H A;  4IQV A;  3GIK A;  1XO1 A;  4KLI A;  2ZUB A;  2R8K A;  1RPL A;  2HHS A;  4B9M A;  4RPX A;  4RNM A;  1QSL A;  3GV7 B;  5J2D A;  4DFP A;  2P6U A;  2XC9 A;  3UXO A;  1ZQY A;  1ZQO A;  7ICQ A;  3ZDE A;  1ZQJ A;  3JPN A;  2B21 A;  4ECT A;  3JPR A;  4YVZ A;  1HUZ A;  3JPP A;  1A76 A;  3UXN A;  4KLQ A;  4ECU A;  9ICP A;  5KFY A;  5KG4 A;  8ICN A;  5CWR A;  3HWT A;  4F2R A;  3N97 B;  5IIO A;  4RQ7 A;  3TAQ A;  4F8R A;  5KFF A;  8ICZ A;  4DOC A;  5KFU A;  2W9A A;  3BJY A;  4IQU A;  4QZC A;  4HYK A;  1TK8 A;  2F1J A;  2V4Q A;  4F91 B;  4M2Y A;  2JEJ A;  1CEZ A;  5J2C A;  3H4D A;  4DLE A;  1S0O A;  1NJX A;  1MQ3 A;  4NLZ A;  4KLE A;  4P2H A;  3JPO A;  1NJY A;  2KN7 A;  1SKW A;  2XY5 A;  1B43 A;  5KFL A;  1NK8 A;  2KTQ A;  5KG7 A;  1XSP A;  5J29 A;  1WCN A;  5KT4 A;  2W9B A;  2J6S A;  7ICK A;  7ICO A;  3GIL A;  1ZQM A;  4ELU A;  4YMN A;  3C1Z A;  3EZ5 A;  5KFN A;  3ZDB A;  9ICK A;  1N48 A;  5DGA A;  7ICU A;  4C8L A;  3PR5 B;  1L5U A;  3PW2 A;  7ICF A;  3NGD A;  8ICT A;  1X2I A;  2I1Q A;  4ECV A;  4RQ5 A;  5EWF A;  4F92 B;  5J2G A;  1BVS A;  5KFV A;  4KLO A;  1TV9 A;  9ICC A;  3SZ2 A;  4F4K A;  4NM1 A;  4O3O A;  2FPM A;  4ECS A;  4KLF A;  3MBY A;  2IMW P;  1RYS A;  4I28 A;  4Q8F A;  4DL6 A;  5CJ7 A;  5DB8 A;  1ZQS A;  5J0X A;  3PO5 A;  4EBC A;  4TQS A;  9ICT A;  4ED1 A;  3M8R A;  1D8Y A;  8ICW A;  1JN3 A;  3OGU A;  3T5L A;  1XWL A;  5L1I A;  4F5Q A;  3HT3 A;  5KT2 A;  4F4X A;  1H38 A;  4J9P A;  2FPL A;  9ICU A;  8ICA A;  4UBC A;  4ELV A;  9ICN A;  4XQ8 A;  4JK1 A;  3GIM A;  1K1Q A;  5KFP A;  5KFC A;  3PVX A;  1U49 A;  5C5J A;  5DG7 A;  4I2I A;  4DSJ A;  1ZQN A;  1U4B A;  1KFD A;  3B0X A;  1LB2 B;  2P6R A;  2UVW A;  8ICQ A;  4ED7 A;  4ED0 A;  3ZDD A;  4FBU A;  4ECX A;  2AU0 A;  5BPC A;  1X9M A;  4YD2 A;  5EOZ A;  3RB0 A;  1D9D A;  4BGD A;  2C2E A;  2PI4 A;  3M8S A;  8ICX A;  4JUZ A;  4UBB A;  1K1S A;  4PGQ A;  4J9R A;  3M9O B;  3RR8 A;  1TVA A;  2KFN A;  5CB1 A;  4ED8 A;  4R8U B;  3QE9 Y;  5DDM A;  4BXO A;  4MF8 A;  3BQ1 A;  4KLD A;  7ICN A;  5DLF A;  1NK0 A;  5KG2 A;  2AGP A;  2MUT B;  5DQI A;  1U48 A;  2FMQ A;  4NY8 A;  2ZJA A;  3FYH A;  4QZG A;  1Z00 B;  3ORY A;  1U9L A;  4QWD A;  5KFK A;  4ECY A;  2NRV A;  4DS4 A;  4EBE A;  1T8E A;  1KTQ A;  1QSS A;  7ICR A;  2Y1I A;  2ZUC A;  4M0A A;  9ICF A;  4C8K A;  4KLM A;  3H7I A;  4DFM A;  4DSI A;  2HHT A;  3GV8 B;  2AGO A;  3BQT A;  3TAR A;  4PH5 A;  1TKD A;  2VA2 A;  1ZQB A;  4FO6 A;  2FLP A;  3JPT A;  3ZD9 A;  4QWC A;  5J2J A;  4ED3 A;  2XGQ A;  3PO4 A;  5DQG A;  9ICB A;  3RJE A;  3C5G A;  1NK6 A;  1Z3E B;  3C1Y A;  1ZQR A;  1SL1 A;  9ICL A;  4C8O A;  1NOM A;  1N56 A;  3FDS A;  3OSN A;  4F5P A;  5J2I A;  1U45 A;  1SL2 A;  3V6K A;  2JZB B;  5KFO A;  4O3S A;  4O3R A;  2F1H A;  4FS2 A;  4UAY A;  3HX0 A;  4ECQ A;  3MDC A;  4M6W B;  4F2S A;  2IHN A;  2MUT A;  2ASD A;  2BGW A;  4NLK A;  5DBB A;  1NJZ A;  3T5H A;  3K75 D;  7ICI A;  7ICV A;  3ZDC A;  3V72 A;  5KG0 A;  4RT2 A;  4R64 A;  3RB6 A;  4R8U A;  5CP2 A;  2HHQ A;  2NRX A;  5KFZ A;  3G6V A;  2DFL A;  4F5O A;  4QZD A;  3BQ0 A;  3UQ0 A;  1ZQC A;  1D8L A;  4KN7 A;  4F50 A;  4NM2 A;  3PNC A;  5J0T A;  3MAB A;  2VAN A;  3M9N B;  2FMS A;  9ICH A;  2XY6 A;  3PV8 A;  4FBT A;  1ZQW A;  9ICJ A;  3JPQ A;  9ICW A;  2ATL A;  9ICI A;  4UB1 A;  3RAX A;  2BCR A;  4DQS A;  3MGH A;  4DOB A;  4JV0 A;  4Q43 A;  2FLL A;  5KFE A;  3KHL A;  3H8S A;  4O5K A;  4J9M A;  4EYI B;  3RRG A;  1T4G A;  4IRK A;  3OJS A;  1SZP A;  2BPC A;  2ZTD A;  4IRC A;  4RQ2 A;  5L1K A;  4QZA A;  3AU6 A;  4MF2 A;  4TQR A;  3GIJ A;  4QWE A;  4ELT A;  2ZTC A;  3UQ2 A;  2AGQ A;  4Q45 A;  1QLN A;  5KFQ A;  2PFP A;  4KMU A;  2XY7 A;  7ICH A;  3RJG A;  3K4G A;  3OHB A;  3Q8M A;  4LVS A;  1D9F A;  9ICS A;  1QSY A;  4MFA A;  5KT7 A;  4XUS A;  3PW4 A;  5D46 A;  1JIH A;  4UQG A;  3Q8Q B;  3ISB A;  3BDP A;  2AQ0 A;  4DO9 A;  1KSP A;  4RQ0 A;  4PGY A;  4YQW A;  3RH6 A;  8ICH A;  2ZJ5 A;  3RJH A;  5IIM A;  4Q8E A;  3UXP A;  2KZZ A;  4MFF A;  1S9F A;  5DKW A;  3C23 A;  4NXZ A;  1S0N A;  1LV5 A;  1EXN A;  3KHH A;  2J6U A;  3TQ1 A;  1XSL A;  4KIT B;  5KT5 A;  1DGS A;  5IIL A;  5J0U A;  1L3V A;  1NK4 A;  1ZQI A;  2UVV A;  8ICK A;  4XA5 A;  3TAP A;  2P66 A;  4GC6 A;  5J2A A;  1X9W A;  2FPK A;  5J0W A;  4PPX A;  3EW9 A;  2NRW A;  1NKE A;  4EZ9 A;  4Z6F A;  4ED6 A;  2HHU A;  3OHA A;  3AUO A;  4P4O A;  4B9U A;  4J9O A;  1TFR A;  3QZ8 A;  4ED2 A;  1S97 A;  3KHG A;  5DBA A;  1UA1 A;  2PFQ A;  5D4B A;  4LZD A;  5HP4 A;  4K4H A;  4RQ8 A;  1ZQP A;  4LZG A;  2Q0Z X;  3EPI A;  2KZ3 A;  2V9W A;  4ECW A;  4QZ8 A;  2XO7 A;  1ZQV A;  3GDX A;  4Z6E A;  3OSP A;  2HW3 A;  8ICY A;  2V4R A;  4KN4 A;  4PHD A;  8ICE A;  8ICB A;  3ETL A;  4YXM A;  1ZQX A;  3RB3 A;  4YG2 A;  1S76 D;  3SV4 A;  4QZE A;  7ICG A;  4JWN A;  3PX6 A;  5KFB A;  4C8M A;  4R63 A;  2C2D A;  3PY8 A;  2WTF A;  2HVI A;  4DWI A;  1KFT A;  4DSE A;  3IHQ B;  2BCQ A;  2J6T A;  2PI5 A;  3C2M A;  4IR1 A;  5KT6 A;  4QW9 A;  3MR2 A;  4M9H A;  4O9M A;  2KFZ A;  1Z00 A;  4O0I A;  3V7L A;  4BWM A;  3MFI A;  2OWO A;  3IM1 A;  1BGX T;  1ZQU A;  3AU2 A;  4M6W A;  3B0Y A;  4YXJ A;  5DG8 A;  3G6Y A;  3KHR A;  1SKR A;  4F4Y A;  4IQW A;  3QEA Z;  8ICV A;  9ICV A;  3GII A;  4J9S A;  4DLG A;  4DS5 A;  2HVH A;  4RQ6 A;  4GXI A;  5DQH A;  4YP3 A;  2H5X A;  2VA8 A;  1NK5 A;  4KLG A;  3H8J A;  4RNO A;  2R8H A;  2UVR A;  2W9C A;  2BPG A;  1T7P A;  4KTQ A;  4NLN A;  4YCX A;  4M9N A;  3H8W A;  2W8L A;  3RTV A;  4J9K A;  4RU9 A;  2R8G A;  4TUR A;  1JXL A;  9ICM A;  4EYH B;  4GLX A;  3EWA A;  3LWL A;  3MFH A;  1XSN A;  5KFS A;  1RXV A;  4KLH A;  1C7Y A;  7ICJ A;  4EBD A;  3RBE A;  4I2H A;  2FLN A;  4UAZ A;  3JPS A;  2ZJ8 A;  2XCA A;  1ZQT A;  3T5K A;  1MSW D;  3SI8 A;  1NJW A;  3PW7 A;  4DL5 A;  4JV2 A;  4GXK A;  8ICL A;  5CHG A;  7ICT A;  1DOQ A;  4P4M A;  4TUQ A;  4P4P A;  1XU4 A;  4JV1 A;  1KRP A;  4DEZ A;  2VA3 A;  2M9N A;  3PW0 A;  2AJQ A;  3KTQ A;  2PFO A;  4PHE A;  1RXW A;  4UB2 A;  4QZI A;  4DQI A;  4I2B A;  2LYH A;  5J2K A;  3GFK B;  4J9L A;  5HHI A;  4DL4 A;  3RR7 A;  4I29 A;  3Q8K A;  9ICE A;  1S10 A;  1S0V A;  3GQC A;  3Q8R B;  4QZF A;  2NRZ A;  4QW8 A;  2JEG A;  5J2E A;  5KG6 A;  4QWA A;  5KFI A;  2BDP A;  3PX0 A;  4KLS A;  1BPX A;  4UB4 A;  1KLN A;  4KLT A;  4O3N A;  2GWS A;  2IA6 A;  1PZN A;  5III A;  2ZUD A;  3MDA A;  5HHH A;  4BXO B;  3E2E A;  1NK9 A;  8ICO A;  4DSK A;  9ICA A;  5HML A;  2BQR A;  4DQP A;  1ZJN A;  7ICE A;  8ICP A;  9ICX A;  1V9P A;  1XC9 A;  5DGB A;  9ICQ A;  4M9L A;  1ZQF A;  1JXE A;  8ICM A;  4UAW A;  2W9B B;  4UB5 A;  1ZQH A;  5TZV A;  1HUO A;  3TFS A;  2C2R A;  1X9S A;  3C21 A;  4DFJ A;  1RYR A;  4E0D A;  3LK9 A;  1T3N A;  4RQ3 A;  5KFW A;  1ZET A;  1QTM A;  1UT8 A;  4KLJ A;  3SYZ A;  3T3F A;  4GXJ A;  5BOL A;  1S77 D;  2MAX A;  1KDH A;  1UA0 A;  5HMM A;  4DOA A;  5J0O A;  9ICG A;  1ZQQ A;  5DB7 A;  4B9V A;  4PGX A;  1Y88 A;  4RZR A;  4TUS A;  5J0R A;  4MEX A;  9ICO A;  3ZD8 A;  1MQ2 A;  4I2A A;  2Y1J A;  3C5F A;  4BWJ A; 
#chains in the Genus database with same CATH topology
 4DFD A;  5AI8 A;  7ICP A;  4OJ5 A;  3ISC A;  4DL3 A;  4I2E A;  1HEK A;  3V6J A;  5KFR A;  4FFD A;  2BHN A;  2A1J B;  4DQQ A;  3MGI A;  1TAM A;  1SXD A;  4RUA A;  1NKC A;  5EWG A;  4USA A;  3HPO A;  3A0H U;  3V6H A;  1S5L U;  1UT5 A;  1ZQL A;  5IIN A;  4O5E A;  4C7Z A;  1HJP A;  1A77 A;  1SZH A;  2WFA A;  4C0Z A;  3RJI A;  5GTH U;  4P0Q A;  2BQ3 A;  5DG9 A;  1PK1 A;  1IIP A;  3OTQ A;  3O0F A;  4M9G A;  5ALZ A;  4RUC A;  3C2K A;  8ICR A;  2KV2 A;  5F9N A;  2BPF A;  1F44 A;  2K89 A;  2HI0 A;  5JUM A;  3ZDA A;  3AM9 A;  4IQT A;  3QU2 A;  4DL7 A;  5T14 A;  2W9M A;  1U47 A;  4GC7 A;  4RT3 A;  1OXJ A;  3MR3 A;  2QKQ A;  5K4L A;  3A0B U;  4JWM A;  5AKZ A;  2I9G A;  2RDI A;  2F8K A;  1BPD A;  3KKA A;  5AM4 A;  4A8E A;  3L3F X;  5KTQ A;  1WCL A;  5AM3 A;  4MFC A;  3H8M A;  3OPX A;  5KFH A;  1ARO P;  4XRH A;  3KZX A;  3F2C A;  3ONN A;  2F1I A;  5ALF A;  5KFG A;  4DFK A;  3F5A A;  1SKS A;  4DQR A;  3V7K A;  3TFR A;  2EAN A;  8ICS A;  3GV5 B;  2R8J A;  5CRX A;  1L3U A;  2LM4 A;  3RH5 A;  2NRT A;  2HHX A;  2BKE A;  4BJQ A;  1JMS A;  5ALX A;  3NAS A;  4J9Q A;  2IOH A;  2E8N A;  4MEY A;  2YY6 A;  4RNN A;  4C80 A;  2C28 A;  5KG1 A;  4YR2 A;  3Q8P B;  2Y9T A;  2XC9 A;  2QLT A;  3JPN A;  4Y2Q A;  3UXN A;  5KFY A;  5KG4 A;  4F2R A;  3N97 B;  2LYB A;  8ICZ A;  4DOC A;  3HRD D;  3BJY A;  3SMV A;  4M2Y A;  4F91 B;  2JEJ A;  3H4D A;  4KLE A;  2KN7 A;  2OYY A;  1NK8 A;  5KFL A;  1A0P A;  5J29 A;  7ICK A;  7ICO A;  3GIL A;  5ALL A;  3SQI A;  1ZQM A;  1KL9 A;  3EZ5 A;  1NI3 A;  1N48 A;  5DGA A;  2QAR B;  5J2G A;  5KFV A;  4J03 A;  3SZ2 A;  1L6N A;  2P35 A;  4CF5 A;  1T3Q A;  3LVW A;  2FPM A;  3MBY A;  1RYS A;  2DUY A;  1ZQS A;  1PVR A;  4TQS A;  8ICW A;  1D8Y A;  3OGU A;  1XWL A;  3IG5 A;  5L1I A;  5FP0 A;  3HT3 A;  2FPL A;  3NVV A;  2HSZ A;  4UBC A;  2K8A A;  5KAF U;  1X6I A;  4XQ8 A;  1U49 A;  2CPR A;  4I2I A;  4CE6 A;  3NUQ A;  2B6G A;  2RLT A;  2EQY A;  1X9M A;  8ICX A;  4BGD A;  2W11 A;  1Z1B A;  1K1S A;  4PGQ A;  4J9R A;  3M9O B;  2KFN A;  5DLF A;  3BS5 A;  1U48 A;  4PZN A;  1Z00 B;  3NVY A;  4QWD A;  4NL9 A;  5KFK A;  4ECY A;  2F2A B;  1T8E A;  3KOO A;  7ICR A;  1ZRN A;  4M0A A;  3H7I A;  4DSI A;  3GV8 B;  4PH5 A;  2LM1 A;  5AKE A;  2KKV A;  2XGQ A;  1Z3E B;  3C1Y A;  2YML A;  1ZQR A;  5G5H A;  1N56 A;  5ALS A;  3OSN A;  1U45 A;  3E0F A;  4FS2 A;  4UAY A;  2KEY A;  2OHF A;  4M6W B;  3HKZ C;  4KMO B;  3K75 D;  4CF3 A;  7ICI A;  1Z4N A;  4RT2 A;  5TIS U;  5CP2 A;  3D2Q A;  1X66 A;  5AKJ A;  5KFZ A;  3G6V A;  2DFL A;  4QZD A;  3BQ0 A;  2MSN A;  3MAB A;  3M9N B;  3WKD A;  3MC1 A;  1L7N A;  3JPQ A;  2JGA A;  9ICI A;  3WK7 A;  1JI7 A;  3I76 A;  4DOB A;  2FLL A;  3FM9 A;  4EYI B;  1SZP A;  2BPC A;  1Z19 A;  5L1K A;  4QZA A;  1Z1V A;  4MF2 A;  2H3Z A;  1ZD3 A;  1BNP A;  4QWE A;  2ZTC A;  2AGQ A;  1D8B A;  1QLN A;  2PFP A;  7ICH A;  3ISB A;  4YQW A;  8ICH A;  2ESE A;  2ZJ5 A;  2KP7 A;  3RJH A;  2KZZ A;  3QU7 A;  1EXN A;  5AI0 A;  5ALI A;  5IIL A;  2G0A A;  1ZQI A;  2P66 A;  1A6S A;  5J2A A;  3WKE A;  2KIW A;  3IN5 A;  2NRW A;  4B9U A;  2KJ9 A;  4P4O A;  2PKE A;  5DBA A;  1ZQP A;  4CNQ A;  1PUZ A;  2HW3 A;  8ICY A;  4PHD A;  1NNL A;  3ETL A;  3QUC A;  3SV4 A;  4QZE A;  7ICG A;  5L1M A;  1KFT A;  2PI5 A;  3C2M A;  2WF6 A;  2YMP A;  5E79 U;  4Y2U A;  3V7L A;  2OWO A;  1BGX T;  1ZQU A;  4YXJ A;  1CI4 A;  4J9S A;  2HVH A;  4AYB F;  2IOF K;  1NK5 A;  4GFJ A;  2R8H A;  5AK4 A;  2BPG A;  4KTQ A;  4M9N A;  1DXS A;  2E3T A;  1O08 A;  9ICM A;  3QUB A;  2B0C A;  4GLX A;  3EWA A;  1C20 A;  2KK0 A;  3MFH A;  1XSN A;  5HR6 A;  1RXV A;  1C7Y A;  4I2H A;  3WK5 A;  2ZJ8 A;  2XCA A;  1ZQT A;  3PW7 A;  3IG8 A;  4P4P A;  2VA3 A;  1XO0 A;  4PHE A;  2LYH A;  5AI4 A;  3RR7 A;  5HHI A;  4DL4 A;  3SAH A;  3H0L B;  2JEG A;  4Y2V A;  5KFI A;  4O3N A;  1PZN A;  2ZUD A;  3E2E A;  4OJL A;  2QB0 B;  2BQR A;  4DQP A;  1XC9 A;  1Q8K A;  4NWI A;  1ZQF A;  3IP4 B;  1PK3 A;  8ICM A;  3N7P D;  3TFS A;  2C2R A;  3LK9 A;  1QTM A;  4GXJ A;  5BOL A;  5ALP A;  5J0R A;  3ZD8 A;  1QCK A;  2EZZ A;  3VCB A;  3MGV A;  2ISO A;  4Y2T A;  1PK1 B;  2DPI A;  4YR0 A;  5DB6 A;  2KZM A;  1ZD2 P;  2KHV A;  1IXR A;  5D49 A;  2UVU A;  2R18 A;  1L3T A;  4OJP A;  2C22 A;  3TKA A;  3M9M B;  5IIJ A;  2ZXI A;  4YD1 A;  4B9T A;  1KEJ A;  5AI6 A;  1ZYQ A;  1YT3 A;  1NKB A;  3RJJ A;  2BCU A;  3PR4 A;  2G09 A;  2HHW A;  2VIX A;  8ICU A;  4I27 A;  1FIQ A;  4O5C A;  3L4P A;  2RHF A;  4M9J A;  5BOM A;  7ICS A;  4JB3 A;  3RRH A;  1SL0 A;  5J0Q A;  1ZQE A;  4QNL A;  1M6Y A;  3M7D A;  2OXO A;  1S0M A;  1KFS A;  4QZH A;  2IBK A;  3ZI4 A;  4WJ3 B;  2W8K A;  1NK7 A;  2YB1 A;  2O6K A;  3SV3 A;  2W9C B;  1JX4 A;  5AM5 A;  1BPZ A;  9ICP A;  3T5J A;  1ZQA A;  2JEF A;  4OCZ A;  2JEI A;  5AM1 A;  3EYZ A;  3SEN A;  3I28 A;  3H40 A;  4F3O A;  4ECZ A;  1L7O A;  5KT3 A;  5AM0 A;  8ICI A;  2XGP A;  2BQU A;  4AYB C;  1WUD A;  4QWB A;  5IIK A;  3F53 A;  3AL0 B;  1COO A;  1X6J A;  2E1F A;  4BX9 C;  2KD1 A;  2FMP A;  3V7J A;  8ICJ A;  1BPE A;  4O3P A;  1WG8 A;  2EAP A;  1RYU A;  1ZQG A;  5A0L A;  4IS7 A;  5ALK A;  4B9S A;  4KLU A;  3BQ2 A;  3HW8 A;  4MHV A;  1CUK A;  5L1L A;  2BR0 A;  1SWW A;  3PML A;  2HOF A;  1RG6 A;  2Y9U A;  3NTU A;  4TUP A;  2BCV A;  1ZXI A;  2Z7J A;  1B22 A;  4I2D A;  3ISD A;  3HP6 A;  5J2H A;  4KLI A;  2R8K A;  1RPL A;  2HHS A;  1IG6 A;  4RPX A;  4RNM A;  2H3V A;  3GV7 B;  3QU9 A;  3NS1 A;  3QU4 A;  1ZQY A;  3UXO A;  1ZQO A;  3ZDE A;  1KQQ A;  1ZQJ A;  3D2S A;  3JPR A;  2GOL A;  5AKH A;  4KLQ A;  4ECU A;  3HWT A;  5IIO A;  2JH1 A;  4IQU A;  4HYK A;  2V4Q A;  1TE2 A;  4P2H A;  3SR6 A;  1SKW A;  1B43 A;  1J2M A;  1XSP A;  2J6S A;  9ICK A;  2D6F C;  5AKG A;  1SV0 C;  7ICU A;  3PR5 B;  3PW2 A;  3NGD A;  2I1Q A;  2RRD A;  4RQ5 A;  2WF5 A;  5B5E U;  1BVS A;  2DKZ A;  3KZI U;  9ICC A;  2A19 A;  4DL6 A;  4PL1 A;  5CJ7 A;  3PO5 A;  4EBC A;  4Y2P A;  9ICT A;  3M8R A;  2G06 A;  1DK3 A;  4F5Q A;  2HBM A;  8ICA A;  4NL9 C;  4ELV A;  3GIM A;  3PVX A;  5KFP A;  3GZF A;  1KN5 A;  1U4B A;  1V38 A;  1KFD A;  3QU5 A;  5ALH A;  2DKX A;  3M6K A;  1LB2 B;  3M1Y A;  2JXJ A;  4ED7 A;  3ZDD A;  4FBU A;  4ECX A;  2FDR A;  5BPC A;  4YD2 A;  2C2E A;  3M8S A;  4JMU A;  5CB1 A;  5AIB A;  1JUD A;  2KHQ A;  4MF8 A;  1N62 A;  3KBB A;  2W43 A;  4ICA A;  5DQI A;  3WKB A;  1VDV A;  2ZIX B;  2ZJA A;  1U9L A;  2NRV A;  1QSS A;  2Y1I A;  2ZUC A;  4DFM A;  4RQM A;  1ZQB A;  4QWC A;  4ED3 A;  3PO4 A;  5ALR A;  9ICL A;  1NOM A;  1ZD4 A;  2K4P A;  1GO3 F;  3V6K A;  2JZB B;  4O3R A;  1YZ6 A;  2F1H A;  1ZOL A;  3HX0 A;  3MDC A;  4F2S A;  2ASD A;  2BGW A;  2AXT U;  1F5S A;  4NLC A;  1DGJ A;  1ZQ1 C;  3ZDC A;  2XVT A;  2M0N A;  4QIW F;  2WB1 F;  1ZQC A;  1D8L A;  4KN7 A;  4F50 A;  3PV8 A;  2KVS A;  4NLB A;  9ICJ A;  9ICW A;  2ATL A;  4UB1 A;  4DQS A;  1VJ5 A;  3MGH A;  4JV0 A;  4O5K A;  2ZIV B;  3OJS A;  2ZTD A;  2KG5 A;  4RQ2 A;  4TQR A;  3FC4 A;  3GIJ A;  1N61 A;  4Q45 A;  5C0Y A;  4KMU A;  2XY7 A;  5KNI A;  3RJG A;  3K4G A;  3Q8M A;  2F77 X;  3WKC A;  4O3M A;  1COK A;  1QSY A;  4MFA A;  5KT7 A;  4UQG A;  1Q3U A;  2KKP A;  2AQ0 A;  4DO9 A;  1KSP A;  5AKI A;  4KX5 A;  1UCV A;  4BUG A;  3DV9 A;  5IIM A;  4Q8E A;  4MFF A;  5DKW A;  4NXZ A;  1LV5 A;  1S0N A;  3TQ1 A;  2KVC A;  1VLB A;  1X9X A;  1L3V A;  2E8M A;  4XA5 A;  2A1A A;  1OUQ A;  3TAP A;  4Y2X A;  2DGZ A;  2CXY A;  4F72 A;  4OJ6 A;  2XID A;  4ED2 A;  1DRG A;  1UA1 A;  2PFQ A;  4LZD A;  2DBY A;  3EPI A;  2V9W A;  4ECW A;  4QZ8 A;  2XO7 A;  1ZQV A;  3FAH A;  3GDX A;  2YMQ A;  4Z6E A;  3OSP A;  3LVV A;  2V4R A;  8ICE A;  2JMG A;  1ZQX A;  3PX6 A;  1L8O A;  2WTF A;  2HVI A;  3RFA A;  4DSE A;  2J6T A;  3MR2 A;  5KT6 A;  2HCF A;  4O9M A;  2KIC A;  3BZK A;  2KFZ A;  4O0I A;  3AMZ A;  2MRL A;  3G6Y A;  3IM1 A;  3AU2 A;  4M6W A;  1SKR A;  5ALV A;  4IQW A;  3SAG A;  4F4Y A;  8ICV A;  1SIJ A;  3GII A;  1N63 A;  3PZP A;  4RQ6 A;  2RP5 A;  2G5H B;  1LKY A;  4RNO A;  2UVR A;  2JRZ A;  2LKY A;  1J2N A;  3H8W A;  2W8L A;  2NO5 A;  4RU9 A;  5AM2 A;  4EBD A;  2AHO B;  2FLN A;  2KOB A;  4NV0 A;  1Q46 A;  4DL5 A;  4GXK A;  4P4M A;  1UQV A;  2PMZ C;  1RXW A;  4QJF B;  5AKL A;  2HBJ A;  5J2K A;  9ICE A;  3GQC A;  2EZY A;  2HBK A;  5J2E A;  2YMM A;  1RDF A;  3PX0 A;  3UMB A;  4KLT A;  2H3I A;  3MDA A;  5HHH A;  4BXO B;  8ICO A;  5HML A;  2W7O A;  9ICX A;  1V9P A;  1RM6 C;  5AK5 A;  4UB5 A;  1ZQH A;  5TZV A;  2E5S A;  4QIW C;  3C21 A;  3ALR A;  4E0D A;  3LYS A;  4IC9 A;  5KFW A;  3T3F A;  4Y2S A;  1KDH A;  2DWQ A;  4DOA A;  2ES6 A;  1ZQQ A;  1LVH A;  4B9V A;  1Y88 A;  1WWV A;  2XI9 A;  4MEX A;  4I2A A;  2XIC A;  1RQL A;  3CP8 A;  1MQ2 A;  5HNK A;  3UMC A;  5F9L A;  7ICM A;  1ZQK A;  5J2B A;  5ALQ A;  1L7P A;  5DB9 A;  5ALW A;  1N60 A;  3OJU A;  3RF9 A;  2YQE A;  4M04 A;  4OD0 A;  1ZQZ A;  4FS1 A;  1FFV A;  3RB4 A;  5KG5 A;  2QAR A;  9ICR A;  2F76 X;  2JV3 A;  5KFM A;  5GTI U;  5KFT A;  3CNH A;  1X42 A;  4F93 B;  3CYM A;  4Q44 A;  3UM9 A;  4DSL A;  4UAS A;  4Z6D A;  4DF8 A;  5DBC A;  2ASJ A;  4F5R A;  4IL6 U;  1RZT A;  2ZIW A;  3Q8L A;  4IRD A;  4NLG A;  5KFD A;  4PHP A;  1BPB A;  5KFJ A;  7ICL A;  4UB6 U;  3N28 A;  4R65 A;  4I2G A;  3PSI A;  1ZRM A;  2FJ6 A;  3BS7 A;  3N4M B;  4PL2 A;  3TI0 A;  1MN8 A;  4O3Q A;  4F4W A;  2D8C A;  8ICC A;  4YFK A;  3RJK A;  3PX4 A;  4RPZ A;  3WK8 A;  2EDU A;  4QZB A;  3RAQ A;  2KE7 A;  2ODG A;  2DPJ A;  4F5N A;  4I2J A;  4RPY A;  5J0Y A;  3E58 A;  2WHE A;  2RDJ A;  3Q8S B;  4US8 A;  1FFU A;  3UPQ A;  4YMM A;  4RQ4 A;  1IM4 A;  1N5W A;  5L1J A;  1L3S A;  4C8N A;  2ISP A;  4C4R A;  2W04 A;  3H4B A;  2R8I A;  3C2L A;  4BDP A;  1QQ5 A;  3GU3 A;  1TK0 A;  4YN4 A;  3RH4 A;  2ALZ A;  5CA7 A;  3RJF A;  4B9L A;  4J9N A;  4EZ6 A;  2JH7 A;  4FE3 A;  4ECR A;  3LDA A;  3TAN A;  1XO1 A;  2KJ8 A;  2ZUB A;  2HOQ A;  2F44 A;  4Y2Y A;  1QSL A;  5J2D A;  3HJE A;  7ICQ A;  2B21 A;  1S8O A;  1HUZ A;  3JPP A;  3EUB 2;  5KL1 B;  8ICN A;  3KKA C;  3N7R C;  4F8R A;  5AK3 A;  4ACO A;  5KFU A;  2W9A A;  2H3Q A;  1TK8 A;  2F1J A;  1WYG A;  5J2C A;  3SAF A;  1MQ3 A;  3JPO A;  2XY5 A;  2KMD A;  2JR5 A;  5KG7 A;  3M6Z A;  1WCN A;  2ZIU A;  4FZL A;  2W9B A;  3ZDB A;  3C1Z A;  4GIB A;  5KFN A;  2OM6 A;  4US9 A;  3KFU F;  1X2I A;  8ICT A;  5EWF A;  4F92 B;  3F5E A;  3QXG A;  4NM1 A;  4ECS A;  2IMW P;  1SXE A;  1SGG A;  5J0X A;  3R9K A;  1V97 A;  4ED1 A;  3WK9 A;  2W3S A;  4F4X A;  4J9P A;  9ICU A;  4OO1 J;  3N7S C;  4JK1 A;  1K1Q A;  3QYP A;  1JRO A;  2KSO A;  4DSJ A;  2G08 A;  1ZQN A;  3ICX A;  2P6R A;  4ED0 A;  4UAT A;  5ALY A;  4C4S A;  4JUZ A;  3RR8 A;  4R8U B;  5DDM A;  3BQ1 A;  4C7Y A;  1NK0 A;  2MUT B;  4NY8 A;  2MA1 A;  4QZG A;  4OJO A;  9ICF A;  4C8K A;  2WF7 A;  5AKX A;  2HHT A;  3BQT A;  5F3X B;  4FO6 A;  5DQG A;  9ICB A;  3RJE A;  4UW9 A;  4C8O A;  5ALE A;  4F5P A;  1PVP A;  5KFO A;  4O3S A;  2G5I B;  4ECQ A;  3AN1 A;  3BS5 B;  2K4H A;  2K8C B;  5DBB A;  3T5H A;  7ICV A;  5KG0 A;  4R64 A;  2HHQ A;  5AKY A;  4F5O A;  3UQ0 A;  3PNC A;  2FMS A;  4PZO A;  2XY6 A;  4FBT A;  1N5X A;  5AI9 A;  3RAX A;  2BCR A;  2YB4 A;  2GO7 A;  4Q43 A;  3KHL A;  3H8S A;  4B6J A;  4J9M A;  2F8L A;  1T4G A;  4IRK A;  1SV0 A;  2VJ5 A;  4IRC A;  3UQ2 A;  9ICS A;  4LVS A;  4XUS A;  3PW4 A;  3B9J A;  5D46 A;  3Q8Q B;  3BDP A;  4RQ0 A;  5AK6 A;  3UXP A;  3KHH A;  2OCE A;  4KIT B;  1DGS A;  1NK4 A;  3HIL A;  2W55 A;  4GC6 A;  1X9W A;  2FPK A;  2E8O A;  2LPE A;  4UAR A;  5J0W A;  3EW9 A;  1CRX A;  1NKE A;  4EZ9 A;  4Z6F A;  4ED6 A;  2HHU A;  2I6X A;  3F2D A;  2OEH A;  2N1R A;  4DCC A;  4LZG A;  2Q0Z X;  2KZ3 A;  2Y0S F;  2ZG6 A;  5B66 U;  4YXM A;  3UMG A;  3RB3 A;  1KW4 A;  1SWV A;  4RQN A;  1S76 D;  2MU2 A;  2EZX A;  4R63 A;  2C2D A;  3PY8 A;  3HKZ F;  3NVW A;  1QQ7 A;  5ALM A;  2OH2 A;  3IHQ B;  2BCQ A;  4IR1 A;  2NYV A;  4M9H A;  2WAQ F;  5J8Y C;  1NZB A;  3S6J A;  2WF8 A;  5JRT A;  1Z00 A;  3MFI A;  3CW2 C;  5ALJ A;  2CN1 A;  3B0Y A;  3KHR A;  4DLG A;  1ECW A;  4FZN A;  3DDH A;  4GXI A;  5AI5 A;  3QX7 A;  4YP3 A;  2H5X A;  4KLG A;  3SEI A;  2W9C A;  1T7P A;  4NLN A;  4YCX A;  1O03 A;  3T79 A;  4J9K A;  1QH9 A;  4TUR A;  4EYH B;  3LWL A;  4UAZ A;  3JPS A;  3BQ7 A;  2E8P A;  3T5K A;  4CDG A;  1NJW A;  8ICL A;  4EEL A;  7ICT A;  1DOQ A;  4TUQ A;  4JV1 A;  1KRP A;  2BDU A;  2M9N A;  3PW0 A;  2PFO A;  4UB2 A;  4KX3 A;  4DQI A;  4I29 A;  1YZ7 A;  1S10 A;  3Q8R B;  3ETR A;  3D2N A;  2NRZ A;  5H2F U;  1J97 A;  4QWA A;  5KG6 A;  4KLS A;  1KBU A;  1KLN A;  2IA6 A;  3IV6 A;  4DSK A;  9ICA A;  7ICE A;  2KNJ A;  5DGB A;  4M9L A;  4UAW A;  3AEV A;  2HDO A;  1HUO A;  4P0P B;  1RYR A;  2K8B B;  2D3D A;  1T3N A;  4KLJ A;  1UT8 A;  1S77 D;  5HMM A;  2EAO A;  4PGX A;  3AQE A;  3IRU A;  3WKA A;  4RZR A;  4TUS A;  1Q3V A;  1PVQ A;  9ICO A;  3EPG A;  4BWJ A;  5KL8 B;  4CCH A;  1URJ A;  1TK5 A;  1FO4 A;  5KFX A;  5KG3 A;  5DLG A;  2K60 A;  2IHM A;  1LKY B;  2K4I A;  2E1E A;  1BPY A;  3THV A;  1ZQD A;  3VC8 A;  4Z6C A;  3PW5 A;  3QZ7 A;  5HR7 A;  2BCS A;  2HHV A;  4PHA A;  3MR6 A;  5DDY A;  5CR0 A;  5KAI U;  2LHT A;  5ALN A;  4YR3 A;  5G5G A;  4X5V A;  2W7P A;  5L9X A;  1XS9 D;  1MA7 A;  3QEB Z;  5ALG A;  4RQ1 A;  2XCP A;  2AQ4 A;  1XNS A;  3D6J A;  4M47 A;  2ZTE A;  2G07 A;  4K4I A;  1T94 A;  4YMO A;  4DL2 A;  8ICF A;  1ZJM A;  3G6X A;  2ASL A;  4IR9 A;  5CEH A;  4DSF A;  4I2C A;  4G3I A;  3I1Y A;  4K4G A;  1MC8 A;  4ZH4 A;  3WU2 U;  3RBD A;  4EEY A;  2PFN A;  4B9N A;  3PSF A;  1RQN A;  2GH1 A;  4I2F A;  2GLE A;  5EWE A;  1TAQ A;  3PMN A;  2PXI A;  2KJ5 A;  2JZB A;  2KIV A;  3MR5 A;  4KLL A;  4HAI A;  5EE3 A;  2A1J A;  2WAQ C;  4R66 A;  3C28 A;  5J0P A;  2RQ5 A;  1IV8 A;  4DF4 A;  5KFA A;  1UHU A;  2ZIV A;  3LWM A;  5J2F A;  4UB3 A;  4F4Z A;  2LYA A;  3TAD C;  1TAU A;  8ICG A;  4QZ9 A;  4Y2J A;  2WB1 C;  1B4F A;  5J0S A;  1Z4O A;  3BZC A;  4IQV A;  3GIK A;  5ALO A;  3QUQ A;  4B9M A;  1UPH A;  4DFP A;  2P6U A;  4ECT A;  2HOI A;  4YVZ A;  4CRX A;  1A76 A;  4C4T A;  1X40 A;  2DF4 B;  5CWR A;  4RQ7 A;  3TAQ A;  2A3V A;  3K1Z A;  5KFF A;  2W03 A;  4QZC A;  1CEZ A;  4DLE A;  1S0O A;  1NJX A;  4NLZ A;  1NJY A;  3KD3 A;  2KTQ A;  4EEN A;  4EX6 A;  1WWU A;  5KT4 A;  4UAU A;  4ELU A;  4YMN A;  4FZM A;  4CF4 A;  4C8L A;  1L5U A;  1JRP A;  7ICF A;  4ECV A;  4KLO A;  1TV9 A;  4F4K A;  4O3O A;  2Y0S C;  4KLF A;  4I28 A;  4Q8F A;  2YTU A;  3H0M B;  2ZIW B;  5DB8 A;  3SD7 A;  1JN3 A;  4Y2R A;  3T5L A;  4P0P A;  5KT2 A;  1H38 A;  3QNM A;  1V85 A;  9ICN A;  5KFC A;  5C5J A;  5DG7 A;  1K5O A;  2DQN B;  3B0X A;  4PJ0 U;  8ICQ A;  2UVW A;  2DL0 A;  5ALU A;  2AU0 A;  5EOZ A;  3RB0 A;  1D9D A;  2PI4 A;  2YN4 A;  4UBB A;  5EE1 A;  1TVA A;  4ED8 A;  3QE9 Y;  1SV4 A;  3L5K A;  4BXO A;  4KLD A;  7ICN A;  1NZP A;  3PSP A;  5KG2 A;  2AGP A;  2FMQ A;  2FE9 A;  3NVZ A;  3FYH A;  3ORY A;  4DS4 A;  4EBE A;  1KTQ A;  3AQF A;  2NV3 A;  3DEE A;  4KLM A;  4UB8 U;  2IOF A;  3ED5 A;  2AGO A;  3TAR A;  1TKD A;  5EE0 A;  2VA2 A;  2FLP A;  3JPT A;  3ZD9 A;  5J2J A;  3C5G A;  3F2B A;  1NK6 A;  5JU5 A;  1SL1 A;  2PMZ F;  3FDS A;  4U7C A;  5J2I A;  1SL2 A;  2BZF A;  2IHN A;  2MUT A;  4NLK A;  1NJZ A;  3V72 A;  3RB6 A;  4R8U A;  3C29 A;  2NRX A;  1OW5 A;  2AH5 A;  2EH9 A;  4ZOH C;  4NM2 A;  2VKQ A;  5J0T A;  2VAN A;  9ICH A;  2VJ4 A;  1ZQW A;  2Q4T A;  4F71 A;  3NRZ A;  1B0X A;  5KFE A;  3RRG A;  2ZXH A;  1ED1 A;  5ALT A;  1AQ6 A;  2I5H A;  3AU6 A;  3K1R B;  4ELT A;  2LMR A;  5KFQ A;  2YX8 A;  4EX7 A;  3OHB A;  1D9F A;  2KSO B;  2CRX A;  1JIH A;  1JAL A;  4PGY A;  3RH6 A;  2F3N A;  1S9F A;  3C23 A;  2J6U A;  1DK2 A;  1XSL A;  5KT5 A;  5J0U A;  2UVV A;  8ICK A;  2W54 A;  4G9B A;  2W3R A;  4PPX A;  1QQ6 A;  3OHA A;  3J81 j;  3AUO A;  4J9O A;  1TFR A;  3QZ8 A;  1S97 A;  2HMX A;  3KHG A;  5D4B A;  5HP4 A;  4K4H A;  4RQ8 A;  3WK4 A;  4EEK A;  5JTI A;  4KN4 A;  8ICB A;  1HIW A;  3H0R B;  4YG2 A;  3TAD A;  4JWN A;  5KFB A;  4C8M A;  4DWI A;  1L7M A;  5AIC A;  5AIA A;  4QW9 A;  1ZD5 A;  1L8L A;  4BWM A;  5ALD A;  2QB1 A;  5DG8 A;  4NJ8 A;  9ICV A;  3QEA Z;  1N2X A;  4LJX A;  4DS5 A;  5DQH A;  3CRX A;  2VA8 A;  2NO4 A;  3H8J A;  2WF9 A;  2FI1 A;  3U26 A;  3WK6 A;  3RTV A;  2R8G A;  1JXL A;  3QUT A;  3IDW A;  4P0Q B;  2QB0 A;  5KFS A;  4KLH A;  7ICJ A;  3RBE A;  2H3F A;  2HBL A;  5AKK A;  5J8Y A;  1MSW D;  3SI8 A;  4JV2 A;  5CHG A;  1SB3 C;  1XU4 A;  4DEZ A;  2AJQ A;  3KTQ A;  5EE9 A;  1BNO A;  3PST A;  4QZI A;  4AP9 A;  4I2B A;  2LBO A;  3GFK B;  4U6P A;  4J9L A;  2LI6 A;  3Q8K A;  1S0V A;  1P7D A;  4QZF A;  2K4E A;  3TAC B;  4QW8 A;  3NRW A;  2BDP A;  2JHD A;  1BPX A;  4UB4 A;  5AHX A;  2GWS A;  5III A;  1NK9 A;  1ZJN A;  8ICP A;  2ZIX A;  9ICQ A;  1JXE A;  1FEZ A;  2ZIU B;  2W9B B;  2L5Y A;  1F0M A;  1X9S A;  4DFJ A;  1KKX A;  4RQ3 A;  1ZET A;  3SYZ A;  2MAX A;  1UA0 A;  5J0O A;  9ICG A;  4UAV A;  5DB7 A;  4CGZ A;  2EAM A;  2Y1J A;  3C5F A; 
#chains in the Genus database with same CATH homology
 5HNK A;  2ISO A;  4CCH A;  7ICP A;  5F9L A;  7ICM A;  3ISC A;  4DL3 A;  4I2E A;  1TK5 A;  2DPI A;  4YR0 A;  3V6J A;  5J2B A;  5DB6 A;  1ZQK A;  5DB9 A;  5KFX A;  3OJU A;  5KG3 A;  2KZM A;  5KFR A;  4M04 A;  5DLG A;  2IHM A;  2BHN A;  1IXR A;  2A1J B;  4DQQ A;  1ZQZ A;  3MGI A;  5D49 A;  4FS1 A;  5KG5 A;  3RB4 A;  1BPY A;  4RUA A;  2UVU A;  3THV A;  1NKC A;  1ZQD A;  4Z6C A;  9ICR A;  1L3T A;  3PW5 A;  2C22 A;  5KFM A;  3QZ7 A;  5EWG A;  3M9M B;  5IIJ A;  2BCS A;  2HHV A;  3HPO A;  4PHA A;  3MR6 A;  5KFT A;  5DDY A;  3V6H A;  5CR0 A;  4YD1 A;  4YR3 A;  4B9T A;  1KEJ A;  1UT5 A;  1ZYQ A;  4F93 B;  1NKB A;  1ZQL A;  5IIN A;  2BCU A;  3RJJ A;  3PR4 A;  4O5E A;  4Q44 A;  2HHW A;  1HJP A;  4X5V A;  4DSL A;  1A77 A;  8ICU A;  5L9X A;  1XS9 D;  4I27 A;  4Z6D A;  4DF8 A;  3RJI A;  3QEB Z;  2BQ3 A;  5DBC A;  4O5C A;  2ASJ A;  4F5R A;  5DG9 A;  4M9J A;  1RZT A;  3Q8L A;  5BOM A;  3EPG A;  4RQ1 A;  2XCP A;  2AQ4 A;  4RUC A;  4M9G A;  7ICS A;  4IRD A;  3RRH A;  3C2K A;  1SL0 A;  8ICR A;  4NLG A;  5F9N A;  4M47 A;  5J0Q A;  1ZQE A;  2ZTE A;  2BPF A;  5KFD A;  4PHP A;  1BPB A;  5JUM A;  5KFJ A;  3ZDA A;  7ICL A;  4K4I A;  1S0M A;  4YMO A;  1KFS A;  4DL2 A;  8ICF A;  4QZH A;  1ZJM A;  3G6X A;  2IBK A;  4IQT A;  2ASL A;  4DL7 A;  4IR9 A;  4R65 A;  4I2G A;  2W9M A;  2W8K A;  1U47 A;  4DSF A;  4I2C A;  1NK7 A;  4G3I A;  4GC7 A;  4K4G A;  4RT3 A;  3MR3 A;  3SV3 A;  1MC8 A;  3N4M B;  2W9C B;  3TI0 A;  1JX4 A;  4JWM A;  1BPZ A;  2I9G A;  2RDI A;  4ZH4 A;  4O3Q A;  4F4W A;  3T5J A;  1ZQA A;  8ICC A;  1BPD A;  2JEF A;  4YFK A;  3RBD A;  2JEI A;  4EEY A;  2PFN A;  5KTQ A;  3EYZ A;  3PX4 A;  3RJK A;  1WCL A;  4RPZ A;  4B9N A;  4QZB A;  3H40 A;  3RAQ A;  2DPJ A;  4F3O A;  4ECZ A;  4F5N A;  4I2J A;  5KT3 A;  4I2F A;  8ICI A;  4MFC A;  4RPY A;  5EWE A;  5J0Y A;  2XGP A;  5KFH A;  3Q8S B;  1TAQ A;  3PMN A;  2RDJ A;  2BQU A;  1ARO P;  4QWB A;  4XRH A;  2PXI A;  5IIK A;  2JZB A;  1COO A;  3MR5 A;  2F1I A;  3UPQ A;  4KLL A;  5KFG A;  4YMM A;  4RQ4 A;  1IM4 A;  4DFK A;  2FMP A;  1SKS A;  4DQR A;  2A1J A;  3V7J A;  8ICJ A;  3V7K A;  4R66 A;  1BPE A;  3TFR A;  4O3P A;  8ICS A;  3GV5 B;  2R8J A;  1L3U A;  3RH5 A;  5L1J A;  1ZQG A;  2NRT A;  2HHX A;  2BKE A;  1L3S A;  1JMS A;  5J0P A;  4DF4 A;  4B9S A;  4C8N A;  4KLU A;  3BQ2 A;  2ISP A;  5KFA A;  3HW8 A;  4J9Q A;  1CUK A;  5L1L A;  3LWM A;  5J2F A;  3H4B A;  2BR0 A;  4UB3 A;  4MEY A;  2R8I A;  3PML A;  3C2L A;  4F4Z A;  4BDP A;  4RNN A;  1TAU A;  1TK0 A;  4YN4 A;  2C28 A;  3RH4 A;  4QZ9 A;  3NTU A;  5CA7 A;  2ALZ A;  3RJF A;  4TUP A;  4B9L A;  8ICG A;  4J9N A;  2BCV A;  4EZ6 A;  1B22 A;  4ECR A;  3LDA A;  4I2D A;  5KG1 A;  4YR2 A;  3ISD A;  5J0S A;  3Q8P B;  3TAN A;  3HP6 A;  5J2H A;  4IQV A;  3GIK A;  1XO1 A;  4KLI A;  2ZUB A;  2R8K A;  1RPL A;  2HHS A;  4B9M A;  4RPX A;  4RNM A;  1QSL A;  3GV7 B;  5J2D A;  4DFP A;  2P6U A;  2XC9 A;  3UXO A;  1ZQY A;  1ZQO A;  7ICQ A;  3ZDE A;  1ZQJ A;  3JPN A;  2B21 A;  4ECT A;  3JPR A;  4YVZ A;  1HUZ A;  3JPP A;  1A76 A;  3UXN A;  4KLQ A;  4ECU A;  9ICP A;  5KFY A;  5KG4 A;  8ICN A;  5CWR A;  3HWT A;  4F2R A;  3N97 B;  5IIO A;  4RQ7 A;  3TAQ A;  4F8R A;  5KFF A;  8ICZ A;  4DOC A;  5KFU A;  2W9A A;  3BJY A;  4IQU A;  4QZC A;  4HYK A;  1TK8 A;  2F1J A;  2V4Q A;  4F91 B;  4M2Y A;  2JEJ A;  1CEZ A;  5J2C A;  3H4D A;  4DLE A;  1S0O A;  1NJX A;  1MQ3 A;  4NLZ A;  4KLE A;  4P2H A;  3JPO A;  1NJY A;  2KN7 A;  1SKW A;  2XY5 A;  1B43 A;  5KFL A;  1NK8 A;  2KTQ A;  5KG7 A;  1XSP A;  5J29 A;  1WCN A;  5KT4 A;  2W9B A;  2J6S A;  7ICK A;  7ICO A;  3GIL A;  1ZQM A;  4ELU A;  4YMN A;  3C1Z A;  3EZ5 A;  5KFN A;  3ZDB A;  9ICK A;  1N48 A;  5DGA A;  7ICU A;  4C8L A;  3PR5 B;  1L5U A;  3PW2 A;  7ICF A;  3NGD A;  8ICT A;  1X2I A;  2I1Q A;  4ECV A;  4RQ5 A;  5EWF A;  4F92 B;  5J2G A;  1BVS A;  5KFV A;  4KLO A;  1TV9 A;  9ICC A;  3SZ2 A;  4F4K A;  4NM1 A;  4O3O A;  2FPM A;  4ECS A;  4KLF A;  3MBY A;  2IMW P;  1RYS A;  4I28 A;  4Q8F A;  4DL6 A;  5CJ7 A;  5DB8 A;  1ZQS A;  5J0X A;  3PO5 A;  4EBC A;  4TQS A;  9ICT A;  4ED1 A;  3M8R A;  1D8Y A;  8ICW A;  1JN3 A;  3OGU A;  3T5L A;  1XWL A;  5L1I A;  4F5Q A;  3HT3 A;  5KT2 A;  4F4X A;  1H38 A;  4J9P A;  2FPL A;  9ICU A;  8ICA A;  4UBC A;  4ELV A;  9ICN A;  4XQ8 A;  4JK1 A;  3GIM A;  1K1Q A;  5KFP A;  5KFC A;  3PVX A;  1U49 A;  5C5J A;  5DG7 A;  4I2I A;  4DSJ A;  1ZQN A;  1U4B A;  1KFD A;  3B0X A;  1LB2 B;  2P6R A;  2UVW A;  8ICQ A;  4ED7 A;  4ED0 A;  3ZDD A;  4FBU A;  4ECX A;  2AU0 A;  5BPC A;  1X9M A;  4YD2 A;  5EOZ A;  3RB0 A;  1D9D A;  4BGD A;  2C2E A;  2PI4 A;  3M8S A;  8ICX A;  4JUZ A;  4UBB A;  1K1S A;  4PGQ A;  4J9R A;  3M9O B;  3RR8 A;  1TVA A;  2KFN A;  5CB1 A;  4ED8 A;  4R8U B;  3QE9 Y;  5DDM A;  4BXO A;  4MF8 A;  3BQ1 A;  4KLD A;  7ICN A;  5DLF A;  1NK0 A;  5KG2 A;  2AGP A;  2MUT B;  5DQI A;  1U48 A;  2FMQ A;  4NY8 A;  2ZJA A;  3FYH A;  4QZG A;  1Z00 B;  3ORY A;  1U9L A;  4QWD A;  5KFK A;  4ECY A;  2NRV A;  4DS4 A;  4EBE A;  1T8E A;  1KTQ A;  1QSS A;  7ICR A;  2Y1I A;  2ZUC A;  4M0A A;  9ICF A;  4C8K A;  4KLM A;  3H7I A;  4DFM A;  4DSI A;  2HHT A;  3GV8 B;  2AGO A;  3BQT A;  3TAR A;  4PH5 A;  1TKD A;  2VA2 A;  1ZQB A;  4FO6 A;  2FLP A;  3JPT A;  3ZD9 A;  4QWC A;  5J2J A;  4ED3 A;  2XGQ A;  3PO4 A;  5DQG A;  9ICB A;  3RJE A;  3C5G A;  1NK6 A;  1Z3E B;  3C1Y A;  1ZQR A;  1SL1 A;  9ICL A;  4C8O A;  1NOM A;  1N56 A;  3FDS A;  3OSN A;  4F5P A;  5J2I A;  1U45 A;  1SL2 A;  3V6K A;  2JZB B;  5KFO A;  4O3S A;  4O3R A;  2F1H A;  4FS2 A;  4UAY A;  3HX0 A;  4ECQ A;  3MDC A;  4M6W B;  4F2S A;  2IHN A;  2MUT A;  2ASD A;  2BGW A;  4NLK A;  5DBB A;  1NJZ A;  3T5H A;  3K75 D;  7ICI A;  7ICV A;  3ZDC A;  3V72 A;  5KG0 A;  4RT2 A;  4R64 A;  3RB6 A;  4R8U A;  5CP2 A;  2HHQ A;  2NRX A;  5KFZ A;  3G6V A;  2DFL A;  4F5O A;  4QZD A;  3BQ0 A;  3UQ0 A;  1ZQC A;  1D8L A;  4KN7 A;  4F50 A;  4NM2 A;  3PNC A;  5J0T A;  3MAB A;  2VAN A;  3M9N B;  2FMS A;  9ICH A;  2XY6 A;  3PV8 A;  4FBT A;  1ZQW A;  9ICJ A;  3JPQ A;  9ICW A;  2ATL A;  9ICI A;  4UB1 A;  3RAX A;  2BCR A;  4DQS A;  3MGH A;  4DOB A;  4JV0 A;  4Q43 A;  2FLL A;  5KFE A;  3KHL A;  3H8S A;  4O5K A;  4J9M A;  4EYI B;  3RRG A;  1T4G A;  4IRK A;  3OJS A;  1SZP A;  2BPC A;  2ZTD A;  4IRC A;  4RQ2 A;  5L1K A;  4QZA A;  3AU6 A;  4MF2 A;  4TQR A;  3GIJ A;  4QWE A;  4ELT A;  2ZTC A;  3UQ2 A;  2AGQ A;  4Q45 A;  1QLN A;  5KFQ A;  2PFP A;  4KMU A;  2XY7 A;  7ICH A;  3RJG A;  3K4G A;  3OHB A;  3Q8M A;  4LVS A;  1D9F A;  9ICS A;  1QSY A;  4MFA A;  5KT7 A;  4XUS A;  3PW4 A;  5D46 A;  1JIH A;  4UQG A;  3Q8Q B;  3ISB A;  3BDP A;  2AQ0 A;  4DO9 A;  1KSP A;  4RQ0 A;  4PGY A;  4YQW A;  3RH6 A;  8ICH A;  2ZJ5 A;  3RJH A;  5IIM A;  4Q8E A;  3UXP A;  2KZZ A;  4MFF A;  1S9F A;  5DKW A;  3C23 A;  4NXZ A;  1S0N A;  1LV5 A;  1EXN A;  3KHH A;  2J6U A;  3TQ1 A;  1XSL A;  4KIT B;  5KT5 A;  1DGS A;  5IIL A;  5J0U A;  1L3V A;  1NK4 A;  1ZQI A;  2UVV A;  8ICK A;  4XA5 A;  3TAP A;  2P66 A;  4GC6 A;  5J2A A;  1X9W A;  2FPK A;  5J0W A;  4PPX A;  3EW9 A;  2NRW A;  1NKE A;  4EZ9 A;  4Z6F A;  4ED6 A;  2HHU A;  3OHA A;  3AUO A;  4P4O A;  4B9U A;  4J9O A;  1TFR A;  3QZ8 A;  4ED2 A;  1S97 A;  3KHG A;  5DBA A;  1UA1 A;  2PFQ A;  5D4B A;  4LZD A;  5HP4 A;  4K4H A;  4RQ8 A;  1ZQP A;  4LZG A;  2Q0Z X;  3EPI A;  2KZ3 A;  2V9W A;  4ECW A;  4QZ8 A;  2XO7 A;  1ZQV A;  3GDX A;  4Z6E A;  3OSP A;  2HW3 A;  8ICY A;  2V4R A;  4KN4 A;  4PHD A;  8ICE A;  8ICB A;  3ETL A;  4YXM A;  1ZQX A;  3RB3 A;  4YG2 A;  1S76 D;  3SV4 A;  4QZE A;  7ICG A;  4JWN A;  3PX6 A;  5KFB A;  4C8M A;  4R63 A;  2C2D A;  3PY8 A;  2WTF A;  2HVI A;  4DWI A;  1KFT A;  4DSE A;  3IHQ B;  2BCQ A;  2J6T A;  2PI5 A;  3C2M A;  4IR1 A;  5KT6 A;  4QW9 A;  3MR2 A;  4M9H A;  4O9M A;  2KFZ A;  1Z00 A;  4O0I A;  3V7L A;  4BWM A;  3MFI A;  2OWO A;  3IM1 A;  1BGX T;  1ZQU A;  3AU2 A;  4M6W A;  3B0Y A;  4YXJ A;  5DG8 A;  3G6Y A;  3KHR A;  1SKR A;  4F4Y A;  4IQW A;  3QEA Z;  8ICV A;  9ICV A;  3GII A;  4J9S A;  4DLG A;  4DS5 A;  2HVH A;  4RQ6 A;  4GXI A;  5DQH A;  4YP3 A;  2H5X A;  2VA8 A;  1NK5 A;  4KLG A;  3H8J A;  4RNO A;  2R8H A;  2UVR A;  2W9C A;  2BPG A;  1T7P A;  4KTQ A;  4NLN A;  4YCX A;  4M9N A;  3H8W A;  2W8L A;  3RTV A;  4J9K A;  4RU9 A;  2R8G A;  4TUR A;  1JXL A;  9ICM A;  4EYH B;  4GLX A;  3EWA A;  3LWL A;  3MFH A;  1XSN A;  5KFS A;  1RXV A;  4KLH A;  1C7Y A;  7ICJ A;  4EBD A;  3RBE A;  4I2H A;  2FLN A;  4UAZ A;  3JPS A;  2ZJ8 A;  2XCA A;  1ZQT A;  3T5K A;  1MSW D;  3SI8 A;  1NJW A;  3PW7 A;  4DL5 A;  4JV2 A;  4GXK A;  8ICL A;  5CHG A;  7ICT A;  1DOQ A;  4P4M A;  4TUQ A;  4P4P A;  1XU4 A;  4JV1 A;  1KRP A;  4DEZ A;  2VA3 A;  2M9N A;  3PW0 A;  2AJQ A;  3KTQ A;  2PFO A;  4PHE A;  1RXW A;  4UB2 A;  4QZI A;  4DQI A;  4I2B A;  2LYH A;  5J2K A;  3GFK B;  4J9L A;  5HHI A;  4DL4 A;  3RR7 A;  4I29 A;  3Q8K A;  9ICE A;  1S10 A;  1S0V A;  3GQC A;  3Q8R B;  4QZF A;  2NRZ A;  4QW8 A;  2JEG A;  5J2E A;  5KG6 A;  4QWA A;  5KFI A;  2BDP A;  3PX0 A;  4KLS A;  1BPX A;  4UB4 A;  1KLN A;  4KLT A;  4O3N A;  2GWS A;  2IA6 A;  1PZN A;  5III A;  2ZUD A;  3MDA A;  5HHH A;  4BXO B;  3E2E A;  1NK9 A;  8ICO A;  4DSK A;  9ICA A;  5HML A;  2BQR A;  4DQP A;  1ZJN A;  7ICE A;  8ICP A;  9ICX A;  1V9P A;  1XC9 A;  5DGB A;  9ICQ A;  4M9L A;  1ZQF A;  1JXE A;  8ICM A;  4UAW A;  2W9B B;  4UB5 A;  1ZQH A;  5TZV A;  1HUO A;  3TFS A;  2C2R A;  1X9S A;  3C21 A;  4DFJ A;  1RYR A;  4E0D A;  3LK9 A;  1T3N A;  4RQ3 A;  5KFW A;  1ZET A;  1QTM A;  1UT8 A;  4KLJ A;  3SYZ A;  3T3F A;  4GXJ A;  5BOL A;  1S77 D;  2MAX A;  1KDH A;  1UA0 A;  5HMM A;  4DOA A;  5J0O A;  9ICG A;  1ZQQ A;  5DB7 A;  4B9V A;  4PGX A;  1Y88 A;  4RZR A;  4TUS A;  5J0R A;  4MEX A;  9ICO A;  3ZD8 A;  1MQ2 A;  4I2A A;  2Y1J A;  3C5F A;  4BWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...