2JZBB

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbB01
5KG5A 2J6SA 1KLNA 3UQ2A 1XO1A 3ZDEA 1NKEA 1KFTA 4PGQA 4F5RA 1Z00B 2FMQA 4DL6A 8ICWA 5KFKA 4YVZA 2R8GA 4KLDA 3N4MB 4LZGA 4YMOA 5KFAA 5KFMA 4UB5A 4J9RA 4J9PA 3MFIA 3G6YA 1V9PA 3E2EA 2HHUA 2ZUBA 4RU9A 5F9NA 2JZBA 1N48A 8ICEA 4RNNA 1XWLA 5IIMA 3NTUA 3MBYA 1PZNA 2ISOA 4B9MA 5J0WA 2C22A 1U48A 1XS9D 1D8YA 4PHAA 1B22A 4QWBA 8ICUA 5J0PA 4ED3A 3RB6A 1D8LA 3RH5A 2I9GA 4UAWA 2J6TA 4NM1A 1DGSA 5KT2A 5KFLA 5J0RA 3Q8QB 4BWJA 5KG7A 1RXVA 1KFSA 1KTQA 5J2AA 4B9SA 4M6WA 3OSNA 2LYHA 4DL4A 5DLFA 4B9VA 9ICXA 1ZJNA 4IRKA 2XCPA 4ED6A 8ICFA 2KTQA 4J9KA 5CWRA 1XSPA 4RQ6A 1CEZA 4UB1A 2BKEA 3N97B 3PR4A 2JEFA 9ICPA 3RJIA 2NRWA 5DQHA 4FO6A 4DF8A 4M9HA 4C8MA 1D9FA 2PI4A 4F4KA 1K1QA 4RPXA 1BPDA 1XU4A 3NGDA 5J2GA 2ZUCA 1BVSA 1EXNA 4QZBA 5DBBA 2C2EA 1X9SA 3GV5B 4YR2A 2RDJA 4DFJA 3SI8A 1S77D 4I2IA 4M9JA 4RQ5A 2ASLA 4PHPA 2ZTCA 4IR1A 3V6HA 2HHQA 3MDCA 4DWIA 2BPGA 2Q0ZX 1KSPA 4RQ7A 3H8WA 3OJUA 3M8SA 3EPGA 4R8UB 2F1IA 7ICQA 3JPQA 3Q8RB 1Z00A 1ZQMA 5J2HA 2UVVA 4YG2A 4QZDA 3M9OB 4ECSA 2IMWP 3ZD8A 2C2RA 5KTQA 4QZ8A 5KT3A 3PO5A 3M9MB 1T3NA 5HMMA 2W8LA 8ICCA 3MR6A 1XC9A 4JWMA 9ICOA 3BJYA 3RJHA 3THVA 4KLOA 4KLTA 2I1QA 3JPRA 9ICWA 1RPLA 5KG2A 7ICPA 2F1JA 5BPCA 1ZQCA 4IR9A 4FBUA 4O3PA 3PVXA 5J2IA 3KHRA 1WCLA 1XSLA 1JXLA 9ICLA 4Q45A 3JPPA 1CUKA 4XQ8A 4R63A 4UQGA 3V6JA 4PHEA 3EZ5A 4I2JA 2ZTEA 1X9MA 1C7YA 5J2EA 9ICBA 3MR2A 3TAQA 1UT8A 8ICSA 4F4XA 2BGWA 2IHNA 1TAQA 3Q8KA 1U45A 4IQTA 4DSLA 4QZFA 5J0SA 5DQIA 1RYSA 3ORYA 3ZD9A 5DB6A 1BPYA 2FMSA 4M9LA 4MFFA 5IIIA 1L5UA 5KT7A 2ASJA 9ICHA 4F5OA 4C8OA 3AUOA 4QWDA 2KN7A 5KFTA 3Q8PB 3H4DA 3V7LA 3RJGA 3ZDDA 4DL3A 2AGPA 4QWEA 4F92B 2KFNA 5DB9A 2BHNA 3UQ0A 4ECWA 4XRHA 5KG1A 2XY5A 8ICBA 2JEGA 5KFOA 3PO4A 5J0UA 1ZQFA 4UB4A 4I28A 4P4PA 8ICKA 4C8KA 1ZYQA 9ICTA 1NKBA 2BCRA 4DSJA 3AU6A 1ZQYA 1KRPA 1TV9A 1S0OA 4LZDA 5L9XA 4UB3A 4R8UA 5KFXA 1MQ2A 2H5XA 3MR3A 4I27A 5KFGA 1MQ3A 3FDSA 2ZTDA 4BDPA 4M9GA 5CB1A 3Q8MA 3H8SA 1ZETA 5J0YA 1QSSA 4QZAA 1HJPA 1Z3EB 5F9LA 9ICMA 1U47A 9ICQA 4O3NA 3SZ2A 4O3QA 7ICIA 1TK5A 4Q8EA 2HHXA 4DEZA 5L1IA 4GXJA 2DPIA 4IRCA 3PW4A 5IIKA 3K75D 4J9OA 4J9LA 2XGQA 1L3TA 1ZQLA 4ED1A 2UVWA 4M0AA 4KLFA 2HHSA 1ZQXA 2BPCA 4EEYA 1NK9A 2J6UA 1X9WA 5EWEA 1JX4A 4ELTA 4ED0A 4EZ6A 5D49A 5KFPA 3EW9A 3OHAA 2HVHA 4MFAA 3OSPA 4DQPA 3V6KA 4DQIA 3HW8A 1ZQDA 3TFSA 7ICEA 4RPZA 2ALZA 3RB0A 1HUZA 3GFKB 4JWNA 4F5QA 3PX6A 1S9FA 3RJFA 1L3SA 3BDPA 1A77A 4ECUA 1NK7A 4KLSA 3JPOA 2C2DA 4B9TA 3TQ1A 1SKSA 1BGXT 5KFFA 4M2YA 3MR5A 5L1KA 4J9MA 2AGOA 1QTMA 5DGAA 3IHQB 2W8KA 1K1SA 1NJXA 2AJQA 2P6RA 8ICLA 4GC6A 1S76D 4O5CA 3K4GA 2XCAA 3HWTA 4ED2A 2BQ3A 1ZQJA 5CJ7A 3OGUA 5DDYA 5DQGA 3BQ0A 3V72A 2BR0A 5KFJA 9ICSA 3C1YA 4RNMA 1QSLA 7ICVA 5CA7A 1NKCA 4F3OA 7ICUA 3T5HA 3GIKA 3C5GA 1IM4A 3HP6A 4JV1A 4ELVA 1IXRA 4RPYA 2NRTA 4PGXA 5L1JA 3RB3A 1MSWD 3GV7B 3C23A 5KT5A 4YFKA 4DQQA 4I2DA 4K4GA 1S0NA 1ZQAA 4QZHA 5J2KA 4DOBA 4KTQA 4KLLA 1L3VA 4KITB 4NLNA 3SYZA 1SZPA 3UPQA 8ICAA 4YD2A 4ECTA 1RXWA 5IIOA 3RAXA 4DSEA 3LDAA 4Z6EA 5D4BA 1ZJMA 4PGYA 4I2BA 4YR3A 4IQUA 5KFRA 5EOZA 3H4BA 8ICZA 3GQCA 1ZQKA 4QZCA 7ICGA 3QZ8A 4DS4A 3KHHA 4DLEA 4YQWA 4I2AA 5HHIA 3RBEA 4TUSA 3TFRA 5KFSA 4QZGA 3PMLA 3GIMA 3HT3A 2OWOA 3KHGA 3T3FA 4I29A 3ISDA 4YXJA 5KT6A 9ICRA 3UXPA 5J2DA 4M04A 4RUCA 4F5PA 4DL7A 7ICHA 3LWMA 4G3IA 9ICJA 3QEBZ 4R66A 3PR5B 5HMLA 3C2MA 2MUTB 3C21A 9ICAA 3SV3A 4YR0A 3ETLA 7ICJA 2AGQA 5DBCA 4DL2A 2XY7A 4KLHA 4C8NA 2W9BB 4TQRA 7ICTA 1SKWA 2DPJA 4MEXA 1AROP 2B21A 2PFNA 4QW8A 2HHWA 9ICCA 7ICKA 5L1LA 2R8KA 3RR7A 2HW3A 5KFCA 3ZDCA 3RBDA 4I2GA 4FS2A 4ECVA 5KFVA 1WCNA 4JUZA 4QW9A 4UAZA 4DFPA 1H38A 9ICVA 4KLJA 1X2IA 4EYHB 1NK8A 4J9QA 2GWSA 2KZ3A 2V4QA 4UAYA 4UBBA 5BOLA 4DO9A 1NK6A 8ICNA 2RDIA 4F2SA 2PFOA 3V7JA 4CCHA 2R8JA 2NRXA 3C5FA 4KLUA 3RJKA 4MEYA 2ISPA 5C5JA 1ZQPA 4DSFA 1KEJA 5HP4A 4BXOB 3RAQA 4K4IA 3ZDAA 4RQ1A 8ICGA 4QWAA 3T5KA 2JEIA 3RTVA 3RH4A 2XC9A 1LV5A 4ED7A 1U4BA 1SL2A 1L3UA 2W9CB 1TVAA 3IM1A 4F8RA 4P4MA 5J2FA 1TK8A 1ZQBA 4MF2A 4TQSA 2C28A 3RJEA 3RH6A 4DSKA 5HHHA 4O3RA 4J9NA 3BQ2A 4C8LA 5J2CA 4GLXA 4RT2A 1KFDA 4X5VA 4O3OA 4ELUA 3PMNA 1NJWA 4YN4A 1NK0A 4JV2A 7ICMA 2WTFA 4PPXA 4DF4A 3GIJA 9ICFA 4Z6DA 3H7IA 5J2JA 4DFKA 4Q44A 4ECQA 2MUTA 4ECXA 2VA2A 4JV0A 4ED8A 4YD1A 5DB7A 3BQ1A 1NJZA 2JEJA 3ISCA 4KLMA 7ICRA 2W9BA 1ZQHA 5KG6A 2FLPA 4BGDA 5J29A 2BQUA 3TI0A 7ICFA 1DOQA 4RQ0A 1TFRA 3MFHA 9ICEA 1MC8A 1RZTA 5DG9A 1S0MA 1JMSA 4UB2A 4I2FA 1HUOA 3OHBA 4FS1A 2AQ4A 1TK0A 1TKDA 4O5KA 2AQ0A 2KFZA 2BCVA 5IINA 2Y1IA 1SL0A 4EBDA 2PFQA 1N56A 3RRGA 4DS5A 4DQRA 4Z6CA 3BQTA 5KFBA 5DGBA 1KDHA 2IA6A 3PW2A 2HHVA 4KN4A 2BCUA 4DLGA 7ICLA 5CP2A 1A76A 2P6UA 3LWLA 2Y1JA 5TZVA 4EYIB 4BXOA 3M9NB 4NM2A 2P66A 5DB8A 4O5EA 4F2RA 3PW5A 4HYKA 5J0QA 5BOMA 8ICIA 5JUMA 3H8JA 9ICKA 4KMUA 5J0OA 4MF8A 2W9CA 5KFZA 3QEAZ 3T5JA 4DSIA 3PNCA 2R8IA 5KFEA 3Q8SB 2HHTA 1ZQUA 2ZUDA 4F4ZA 4IQVA 2KZMA 3GIIA 2R8HA 3TANA 1NK4A 7ICOA 3C2LA 3UXNA 4IQWA 3GDXA 4R64A 8ICPA 5J2BA 2A1JB 1BPBA 3KHLA 2BPFA 8ICTA 3MGIA 4KLGA 4F91B 8ICMA 1ZQVA 2BCSA 5IIJA 1ZQEA 9ICIA 4KLIA 3GV8B 4YMNA 2HVIA 4P2HA 2FPMA 3QZ7A 4KLQA 1U49A 7ICSA 3HX0A 1ZQGA 3RB4A 3PV8A 3RR8A 3LK9A 1NK5A 8ICRA 5EWGA 1ZQIA 5KFUA 1UA1A 2VA8A 2FLLA 8ICJA 4RQ2A 3JPNA 5KFQA 3OJSA 5KG4A 1ZQWA 5IILA 2F1HA 4NXZA 3EPIA 4B9LA 5CR0A 3MABA 7ICNA 2MAXA 3JPSA 4M47A 2ZJ5A 2V9WA 3FYHA 2XY6A 8ICXA 4PHDA 4E0DA 3EYZA 1TAUA 5DG8A 5J0TA 3PY8A 3QE9Y 3B0YA 1BPXA 4O9MA 1RYRA 4M9NA 2VA3A 4F4YA 1NOMA 1ZQTA 4RQ3A 3G6VA 5DBAA 5D46A 8ICQA 4J9SA 2BDPA 4RQ8A 4LVSA 4F4WA 3TARA 2PI5A 5J0XA 3EWAA 3PX0A 4NLKA 2W9MA 5DKWA 4KLEA 4I2EA 8ICOA 4XA5A 2AU0A 4F5NA 5KFHA 8ICVA 3MDAA 3ISBA 3PW7A 5KG0A 4IRDA 1ZQQA 3C1ZA 8ICHA 5KFYA 1ZQOA 1NJYA 4EZ9A 1UA0A 4I2HA 2XGPA 1T7PA 2A1JA 3AU2A 4I2CA 4RZRA 9ICGA 4K4HA 4ZH4A 3SV4A 2FLNA 2FMPA 1COOA 3TAPA 5KFNA 2PXIA 4MFCA 4TURA 1D9DA 4R65A 1T4GA 8ICYA 3RRHA 3V7KA 4PH5A 4Q43A 1S97A 4Q8FA 3H40A 5DLGA 2W9AA 5DG7A 3HPOA 3T5LA 5KFIA 1JN3A 3RJJA 4JK1A 4BWMA 2V4RA 3JPTA 3M8RA 4DFMA 1S10A 1S0VA 4RQ4A 2JZBB 5KG3A 1BPEA 4DL5A 4RUAA 3UXOA 4DOCA 4YMMA 5EWFA 4YCXA 2NRZA 4FBTA 5DDMA 4ECRA 4QWCA 1ZQZA 4EBCA 2UVRA 2XO7A 2ASDA 4UBCA 4B9UA 4EBEA 4NY8A 4NLZA 4YXMA 1QLNA 5KFDA 1UT5A 5KT4A 1U9LA 9ICUA 5KFWA 1B43A 2ZJ8A 4QZIA 1BPZA 4KN7A 1LB2B 2FPKA 4M6WB 4P4OA 4TUPA 2DFLA 4GC7A 3KTQA 2FPLA 3C2KA 4ECZA 1JXEA 4NLGA 1QSYA 4O0IA 3G6XA 4GXIA 4F50A 2VANA 4XUSA 2NRVA 2ZJAA 3PX4A 4QZEA 1T8EA 2BQRA 3B0XA 1Y88A 2M9NA 3GILA 1XSNA 3Q8LA 1SL1A 1ZQRA 4QZ9A 2UVUA 4DQSA 4Z6FA 4B9NA 4O3SA 4GXKA 2PFPA 1JIHA 4YP3A 4ECYA 1ZQSA 4F93B 1SKRA 2IHMA 4DOAA 2ATLA 2IBKA 4RNOA 9ICNA 2BCQA 3MGHA 4TUQA 1ZQNA 2KZZA 3PW0A 3ZDBA 5HNKA 4RT3A 5CHGA
chains in the Genus database with same CATH superfamily
5AK4A 3AL0B 3ZDEA 1NKEA 1RDFA 2F76X 2FMQA 2MRLA 2XVTA 4LZGA 4UB5A 5KFMA 3MFIA 1X40A 1V9PA 4Y2UA 8ICEA 5IIMA 3CW2C 2GLEA 2PKEA 2C22A 2WB1C 4PHAA 2KNJA 5J0PA 2XICA 5CEHA 5KT2A 5KFLA 2K8AA 3OSNA 4DL4A 5J8YA 4HAIA 2XCPA 8ICFA 3QXGA 2OHFA 5CWRA 1CEZA 1J2MA 1JUDA 1Z4NA 2BKEA 4NL9C 3D2NA 4FO6A 4C8MA 1D9FA 4F4KA 2H3ZA 4RPXA 3NGDA 2E3TA 5J2GA 1EXNA 1QQ6A 1X9SA 5JRTA 4M9JA 2ASLA 4PHPA 4DWIA 4GIBA 2Q0ZX 4Y2VA 1KSPA 3H8WA 7ICQA 3Q8RB 4YG2A 3M9OB 2ES6A 4OD0A 3ZD8A 3PO5A 5HMMA 2W8LA 3A0HU 8ICCA 1AQ6A 3BJYA 2AH5A 5KG2A 3SAFA 2F1JA 5BPCA 1XSLA 1SXEA 4R63A 2KVSA 2ZTEA 1X9MA 2LI6A 4U6PA 3PSFA 2BGWA 1TAQA 3Q8KA 4PJ0U 2KKVA 4C4RA 5DB6A 4MFFA 1L5UA 5KT7A 2KJ8A 3AMZA 4A8EA 4QWDA 1S8OA 2KN7A 1Z19A 5JTIA 3Q8PB 3V7LA 4IL6U 1JI7A 4F92B 2BHNA 4ECWA 8ICBA 4P4PA 4C8KA 9ICTA 4DSJA 5AKLA 1ZQYA 5KFXA 2E8NA 2JHDA 1MQ2A 5KFGA 1MQ3A 2W3SA 5AICA 3KFUF 1QH9A 1ZETA 3M6KA 3SZ2A 4Q8EA 2K4IA 2G5HB 5AI8A 4IRCA 2QKQA 4CRXA 2ZXIA 4M0AA 2UVWA 2HHSA 3IRUA 1ZQXA 1X9WA 5EWEA 4DFDA 4ED0A 5D49A 3EW9A 1NI3A 3OSPA 3V6KA 1ZQDA 2KP7A 5ALGA 2YX8A 3NVZA 2DGZA 3PX6A 1L3SA 2YMLA 3BDPA 4ECUA 1NK7A 2Q4TA 5ALOA 1SKSA 4B9TA 4J9MA 2AGOA 2P6RA 8ICLA 4GC6A 4GFJA 2EH9A 3K4GA 2XCAA 2KV2A 3V72A 4OJ5A 3BQ0A 2Y9TA 3C1YA 1TE2A 3T5HA 4JV1A 1IXRA 3RB3A 5L1JA 1T94A 1Q3VA 2JH7A 1S0NA 1ZQAA 2ZG6A 5J2KA 4KLLA 3D2SA 2W7OA 1N63A 1SZPA 5IIOA 3RAXA 2NO4A 3QYPA 3LDAA 4DSEA 2JV3A 1LKYB 4I2BA 4IQUA 7ICGA 3QZ8A 1YT3A 3KHHA 4DLEA 2YY6A 1Z1VA 3PMLA 3GIMA 2OWOA 5AHXA 3PR5B 4ZOHC 1KW4A 1X9XA 2KVCA 3WKEA 4YR0A 7ICJA 2AGQA 3UMCA 2BZFA 3D2QA 4KLHA 2DPJA 1AROP 1N62A 5B5EU 2R8KA 2HW3A 5KFCA 5KFVA 4UAZA 1JALA 4KLJA 1X2IA 4J9QA 2GWSA 4UBBA 5BOLA 4DO9A 5AM2A 2NRXA 4KLUA 1ZQPA 3ETRA 1XO0A 3QX7A 2K4EA 5EE9A 4QWAA 3RH4A 1J97A 1SL2A 1L3UA 2D6FC 4F8RA 3E0FA 3KZXA 5ALEA 2L5YA 1L8LA 4J9NA 4C8LA 4GLXA 2KMDA 4O3OA 3PMNA 1NJWA 1NK0A 3N28A 3GIJA 5J2JA 2H3QA 5DB7A 3TADA 2RHFA 1ZQHA 2FLPA 3TI0A 2HCFA 1TFRA 1RZTA 1S0MA 1JMSA 4I2FA 1HUOA 1TKDA 2KFZA 2KIVA 2BCVA 1X6JA 3ZI4A 3PW2A 2HHVA 4NM2A 3PW5A 4HYKA 4CF4A 1SXDA 3QEAZ 1V97A 3T5JA 4Y2RA 3PNCA 7ICOA 4IQVA 3M1YA 2MU2A 3C2LA 4IQWA 2BPFA 2A1JB 3KHLA 4F91B 3HX0A 3RB4A 3PV8A 2BDUA 2LPEA 1A0PA 5EWGA 2DKXA 1ZQIA 2VIXA 5KFUA 8ICJA 3OJSA 5KG4A 4CF3A 5CR0A 5ALDA 4NJ8A 3JPSA 3QUQA 2V9WA 1QQ7A 8ICXA 1ED1A 3EYZA 1WWUA 3CP8A 2F77X 3SD7A 3NVWA 2BDPA 3SR6A 4RQ8A 4LVSA 4F4WA 2PI5A 1SWWA 2Y0SF 2G06A 3FAHA 8ICOA 1UHUA 4F5NA 1X42A 4IRDA 3C1ZA 5KFYA 1NJYA 5ALYA 2XGPA 5ALJA 2A1JA 1T7PA 2WF9A 4IC9A 2PXIA 2B0CA 4TURA 4KMOB 3V7KA 4Q8FA 2G0AA 3H40A 2F44A 3HPOA 3IDWA 2JZBB 5KG3A 1BPEA 4P0PB 3UXOA 4YMMA 5EWFA 1VJ5A 3B9JA 2NRZA 4EBCA 4B9UA 3NVYA 3TACB 5AI9A 4YXMA 2H3FA 3WK7A 3MGVA 1QLNA 1U9LA 9ICUA 4KX5A 1LB2B 4P4OA 4M6WB 2DFLA 4GXIA 5C0YA 4QZEA 5ALMA 1XSNA 1Y88A 2UVUA 4B9NA 1URJA 4NLCA 4QZ9A 5AM5A 5AIBA 4NL9A 2DL0A 2ATLA 9ICNA 4TUQA 1L6NA 3PW0A 3ZDBA 3WK4A 2JRZA 4PGQA 4JMUA 1UQVA 4DL6A 1B4FA 5KAFU 2R8GA 5AI5A 2JMGA 2EZYA 2ZUBA 4RU9A 2JZBA 1DXSA 4RNNA 4P0PA 3MBYA 1PZNA 1B0XA 1XS9D 3MC1A 1MA7A 1B22A 2O6KA 4QWBA 2H3IA 3UMGA 3RB6A 5AM0A 2I9GA 2J6TA 1DGSA 4BWJA 1KFSA 1RXVA 1KTQA 4B9VA 4M6WA 2LYHA 9ICXA 5DLFA 4ED6A 2KTQA 4J9KA 3N97B 2W54A 3RJIA 2NRWA 5DQHA 4M9HA 3NRZA 2PI4A 2Y0SC 1FEZA 2C2EA 3SI8A 1S77D 3NVVA 1KL9A 2F2AB 2HMXA 2ZTCA 2HHQA 2BPGA 2F1IA 3QUCA 1ZRNA 5KTQA 4QZ8A 4C80A 3MR6A 1XC9A 3RJHA 1PVPA 4KLOA 4KLTA 2E8OA 9ICWA 7ICPA 4FBUA 4O3PA 3PVXA 3KHRA 9ICLA 5AK6A 1CUKA 4NV0A 2HI0A 1SGGA 3SMVA 2IHNA 4DSLA 2G08A 2RLTA 5J0SA 4QZFA 5DQIA 2FMSA 2ODGA 4M9LA 3CYMA 4Y2JA 2WF7A 4J03A 4USAA 2ASJA 3RFAA 3ZDDA 2PMZC 2RQ5A 3WK5A 2ZIVA 4U7CA 2XY5A 2EAMA 2GOLA 2JEGA 2KIWA 3PO4A 8ICKA 2KJ5A 1ZYQA 2IOFK 1TV9A 4M9GA 5CB1A 5J0YA 5AKZA 1Z3EB 4O3QA 1TK5A 5L1IA 3SAGA 1PUZA 5IIKA 4ED1A 2BPCA 3WU2U 4EEYA 1NK9A 2J6UA 3KOOA 1JX4A 2QLTA 2E5SA 2HVHA 2E8PA 4DQPA 4DQIA 2K60A 5ALSA 1QQ5A 4RPZA 3N7RC 1S9FA 3RJFA 1FO4A 2D8CA 5AIAA 2QARB 2LBOA 2E8MA 1YZ6A 3MR5A 5DGAA 1SV0C 3IG8A 3LVVA 1JROA 4AP9A 1S76D 4C4TA 2BQ3A 1SV4A 5CJ7A 2BR0A 5KFJA 4FZMA 1NKCA 5G5HA 7ICUA 3BQ7A 4C7YA 4RPYA 4PGXA 1DK3A 3GV7B 4AYBC 3C23A 4YFKA 4DQQA 4I2DA 4QZHA 4DOBA 4YD2A 1RXWA 2KK0A 4OJ6A 3I1YA 3QU7A 2LYAA 4YR3A 8ICZA 4EX7A 3TFRA 1NNLA 5TISU 3WKCA 9ICRA 5KT6A 4G3IA 3QEBZ 4R66A 3C2MA 4CDGA 9ICAA 3C21A 2CN1A 5AI6A 3F53A 2QARA 1K5OA 2JGAA 2W9BB 4TQRA 1SKWA 3C29A 2PFNA 2B21A 2HHWA 3RR7A 3ZDCA 4I2GA 3QNMA 1WCNA 4JUZA 2JXJA 5KAIU 9ICVA 2K8CB 4OCZA 4EYHB 4IS7A 4PZOA 2KZ3A 1NK6A 3RJKA 1N2XA 2YMMA 4Y2TA 4MEYA 5C5JA 4DSFA 3RAQA 2JEIA 3S6JA 1L7PA 2W9CB 1TK8A 1Z1BA 1N60A 4MF2A 4TQSA 2WFAA 3RH6A 5HHHA 4EEKA 1L7OA 4X5VA 4ELUA 4RQMA 2JH1A 4UAUA 5ALUA 1P7DA 3H7IA 2VA2A 4JV0A 4ED8A 1NJZA 2JEJA 1D8BA 2W9BA 5ALKA 4BGDA 3MFHA 9ICEA 5DG9A 3IP4B 3OHBA 1O08A 1TK0A 4O5KA 5IINA 3L4PA 1N56A 3BQTA 5ALLA 4DLGA 4Y2SA 2GO7A 5CP2A 2P6UA 3LWLA 1DRGA 7ICLA 4EYIB 3M9NB 5DB8A 4O5EA 4BUGA 5BOMA 8ICIA 3H8JA 9ICKA 4KMUA 2W9CA 4DSIA 4F4ZA 3GIIA 2R8HA 4R64A 8ICPA 5J2BA 1RQNA 1BPBA 4KLGA 1ZQVA 5IIJA 4Y2XA 3O0FA 2HVIA 3GV8B 4P2HA 4KLQA 1U49A 1IG6A 4NWIA 2QB0B 2FLLA 4RQ2A 1ZQWA 5IILA 4NXZA 4B9LA 1KN5A 2G5IB 7ICNA 2MAXA 4M47A 2WF8A 2ZJ5A 2CRXA 2G07A 1TAUA 4O9MA 4M9NA 1C20A 1NOMA 4RQ3A 4J9SA 4FFDA 3BS7A 3EWAA 5DKWA 1WG8A 4I2EA 5ALZA 2AU0A 3ISBA 5KG0A 1ZQQA 1DK2A 1ZQOA 4EZ9A 3AU2A 4RZRA 2FLNA 2FMPA 3WK8A 4F72A 5KFNA 1CI4A 1SZHA 2YMPA 4PH5A 5DG7A 5JU5A 4JK1A 3AEVA 2QB0A 5HR7A 4DL5A 4DOCA 4JB3A 1QCKA 2F8LA 4UBCA 1CRXA 4EBEA 4NLZA 5KFDA 3IV6A 5KFWA 4F71A 4KN7A 3KTQA 2FPLA 1L7MA 5ALFA 1DGJA 4O0IA 3G6XA 4PL2A 4XUSA 3PX4A 1ZD2P 2BQRA 1ZQRA 2YB1A 4DQSA 2HBLA 4GXKA 2PFPA 1JIHA 4YP3A 2Z7JA 4ECYA 5E79U 5EE1A 2BCQA 1NZBA 2KZZA 1NK8A 4RT3A 1N5WA 1KLNA 2KE7A 1XO1A 3UQ2A 3QUBA 1KFTA 3NASA 5KFKA 3N4MB 5KFAA 4J9PA 3E2EA 3G6YA 1N48A 3QUTA 1XWLA 3GZFA 4B9MA 1U48A 2EQYA 3CRXA 3PSTA 4UAWA 3Q8QB 1FIQA 4B9SA 2KD1A 1ZJNA 4IRKA 1XSPA 4RQ6A 3ED5A 9ICPA 2JEFA 1RQLA 5AKYA 2WAQF 1K1QA 1OUQA 1BPDA 1XU4A 2KHQA 3KZIU 3R9KA 5DBBA 4C4SA 3GV5B 1NZPA 4YR2A 2M0NA 2RDJA 4I2IA 2WF6A 3V6HA 1ZD4A 4RQ7A 3M8SA 3EPGA 4R8UB 3DV9A 3JPQA 1ZQMA 5ALWA 4ECSA 2IMWP 2C2RA 1F5SA 3M9MB 9ICOA 4C0ZA 2VJ5A 3THVA 4OJLA 3A0BU 3HILA 1N5XA 5AM4A 1UPHA 2OYYA 3QU4A 4XQ8A 2IOFA 4UQGA 5B66U 4PHEA 5J2EA 3TAQA 1U45A 5AI0A 3ZD9A 1BPYA 2DQNB 3SEIA 5IIIA 4F5OA 4C8OA 5AKEA 1A6SA 1WYGA 1ZRMA 5KFTA 3H4DA 5AKXA 1X66A 1L8OA 2KFNA 3ALRA 3UQ0A 5DB9A 4XRHA 1V85A 5KFOA 5K4LA 5J0UA 1ZQFA 1S5LU 2W7PA 4UB4A 4I28A 1SV0A 5ALNA 1NKBA 2BCRA 3AU6A 1YZ7A 1KRPA 4UB3A 4R8UA 3AQFA 2H5XA 4I27A 3FDSA 4BDPA 3Q8MA 1QSSA 4KX3A 4QZAA 2VJ4A 5F9LA 2CXYA 5AM1A 5AK3A 2DPIA 2ZIXB 3PW4A 4J9LA 4P0QA 2XGQA 2W55A 1FFVA 5EE3A 2CPRA 4B6JA 4ELTA 4QIWF 4MFAA 1PK1B 3TFSA 7ICEA 3RB0A 3GFKB 4JWNA 4F5QA 3QU5A 3CNHA 1JRPA 4BX9C 4KLSA 3JPOA 1BGXT 5A0LA 3AQEA 3LYSA 5L1KA 1QTMA 3IHQB 3SENA 2W8KA 1K1SA 5AM3A 2AJQA 5ALTA 3F5AA 4ED2A 3KKAC 3OGUA 9ICSA 5F3XB 5CA7A 4F3OA 2W3RA 1KKXA 2DKZA 3GIKA 4UW9A 4ELVA 2HBJA 2XI9A 2DBYA 4K4GA 4KTQA 1L3VA 3SYZA 2ZIVB 2ZIUB 4ECTA 1HIWA 1O03A 2FJ6A 2ZIXA 4UB6U 5D4BA 1ZJMA 3H4BA 4QZCA 1VDVA 4I2AA 5HHIA 5KFSA 1TAMA 4QZGA 1PK1A 4C7ZA 3KHGA 3T3FA 4I29A 3ISDA 3UXPA 2W03A 7ICHA 9ICJA 5AKGA 2EAPA 5HMLA 2MUTB 1ZD3A 4DL2A 2XY7A 2K4PA 3M6ZA 2FDRA 4ECVA 4QW9A 4DFPA 3IG5A 1H38A 2WHEA 4UARA 4CF5A 5AI4A 2V4QA 4UAYA 1KQQA 2RDIA 4F2SA 2PFOA 4CCHA 2R8JA 3F5EA 4G9BA 2ISPA 5HP4A 1KEJA 4BXOB 4K4IA 8ICGA 2ZIUA 1LV5A 4ED7A 1U4BA 3IM1A 3PZPA 3GU3A 1ZQBA 2C28A 1ECWA 4O3RA 3BQ2A 4RT2A 4JV2A 4PPXA 9ICFA 2B6GA 2KSOB 4Q44A 4ECQA 2F8KA 2MUTA 4ECXA 1PK3A 1OXJA 4YD1A 1Q8KA 1IIPA 4KLMA 3K1ZA 7ICRA 3NRWA 1N61A 7ICFA 2OM6A 1T3QA 4WJ3B 4RQ0A 1BNOA 3QU2A 4UB2A 3I28A 5T14A 3M7DA 4FS1A 4UB8U 2AQ0A 5ALXA 4EBDA 3RRGA 4DS5A 2DUYA 5DGBA 2KKPA 4KN4A 3L3FX 2Y1JA 5TZVA 4BXOA 2P66A 2AXTU 3WK9A 5JUMA 5J0OA 2IOHA 2R8IA 1ZQUA 4PZNA 2KZMA 3TANA 1NK4A 8ICTA 3MGIA 3F2CA 2RP5A 1ZQEA 9ICIA 4KLIA 4YMNA 2LM1A 2KSOA 1L7NA 2I5HA 1UA1A 3JPNA 5KFQA 3EPIA 2ZIWB 5ALHA 3F2BA 3MABA 1M6YA 2KJ9A 2XY6A 4PHDA 4ACOA 3B0YA 1RYRA 2VA3A 3G6VA 8ICQA 2W9MA 4KLEA 4XA5A 8ICVA 3MDAA 3PW7A 4I2HA 5KL8B 2RRDA 4I2CA 9ICGA 4K4HA 3SV4A 2MA1A 2E1EA 3N7SC 1D9DA 1T4GA 3RRHA 1S97A 5DLGA 5KFIA 1JN3A 3DEEA 4EENA 4BWMA 2V4RA 3JPTA 1S10A 1S0VA 1SB3C 2LKYA 1MN8A 2LHTA 4FBTA 2ZIWA 2EAOA 1ZQZA 4QWCA 2UVRA 2XO7A 2ASDA 4CNQA 5KT4A 2ZJ8A 4QZIA 1BPZA 1J2NA 2FPKA 4ECZA 5G5GA 3LVWA 5AKJA 1PVRA 3B0XA 2M9NA 3K1RB 1ZOLA 3Q8LA 2KOBA 2OH2A 4BJQA 3SAHA 1ZQSA 2IHMA 3OTQA 4DOAA 2IBKA 3MGHA 1ZQNA 4RQNA 5HNKA 1C7YA 5KG5A 2OCEA 2J6SA 1X6IA 4F5RA 1Z00B 2EDUA 3H0RB 8ICWA 4YVZA 4KLDA 1COKA 4ICAA 4YMOA 4J9RA 2HHUA 2HOFA 1HEKA 5F9NA 5AK5A 4US9A 3NTUA 2ISOA 5J0WA 1D8YA 3VCBA 8ICUA 4ED3A 2HDOA 1ZQ1C 1D8LA 3WKAA 3RH5A 4NM1A 5J0RA 2MSNA 5KG7A 2YMQA 5J2AA 1WUDA 4UB1A 3PR4A 4DF8A 2EANA 3T79A 4DCCA 2HOIA 2ZUCA 1BVSA 3J81j 4QZBA 5ALPA 4UASA 4DFJA 4RQ5A 2NV3A 4IR1A 3MDCA 3KD3A 2HOQA 3OJUA 1Z00A 3IN5A 5J2HA 2UVVA 4QZDA 2YB4A 2YN4A 2N1RA 5KT3A 3TKAA 1T3NA 4JWMA 1V38A 2I1QA 3JPRA 1RPLA 4PL1A 5KNIA 1ZQCA 4IR9A 5J8YC 1JXLA 5J2IA 1WCLA 4Q45A 3JPPA 2D3DA 3V6JA 3EZ5A 4I2JA 3PSIA 9ICBA 3MR2A 1UT8A 8ICSA 4F4XA 4IQTA 1RYSA 3AM9A 3ORYA 1Q3UA 2HBMA 9ICHA 4FZLA 5CRXA 3AUOA 3UMBA 5L1MA 3RJGA 4DL3A 2AGPA 4QWEA 3PSPA 5KG1A 3BZKA 2OXOA 5EE0A 1RM6C 1LKYA 1S0OA 4LZDA 5L9XA 4QNLA 3MR3A 3KKAA 2ZTDA 2OEHA 3H8SA 1HJPA 1BNPA 9ICMA 1U47A 3SQIA 9ICQA 4O3NA 2AHOB 7ICIA 2HHXA 4GXJA 4DEZA 2KICA 1KBUA 2KEYA 3K75D 4J9OA 1ZQLA 1L3TA 5AKHA 4KLFA 3DDHA 3FC4A 4EZ6A 2DWQA 5KFPA 3OHAA 3D6JA 1RG6A 3HW8A 2ALZA 1HUZA 1VLBA 3BS5B 2HSZA 1A77A 3H0LB 2C2DA 3TQ1A 2GH1A 5KFFA 4M2YA 5ALRA 1IV8A 1NJXA 2A19A 4QJFB 4O5CA 2F3NA 2YTUA 3HWTA 1ZQJA 5DDYA 5DQGA 2Y9UA 4RNMA 7ICVA 1QSLA 2K4HA 2XIDA 3C5GA 1IM4A 3HP6A 1MSWD 2NRTA 4Y2YA 1LVHA 3QU9A 5KT5A 3WKDA 2G09A 2A3VA 3ICXA 4KITB 4NLNA 3UPQA 8ICAA 3F2DA 3N7PD 2WF5A 4Z6EA 4PGYA 5KFRA 4MHVA 5EOZA 3GQCA 4O3MA 1ZQKA 1OW5A 5ALVA 4DS4A 4YQWA 3RBEA 2K89A 4TUSA 3HT3A 4FE3A 4YXJA 5J2DA 4M04A 4RUCA 4F5PA 4DL7A 3LWMA 3BS5A 2EZXA 5AKIA 3SV3A 3ETLA 4P0QB 5DBCA 4EELA 4UAVA 4C8NA 7ICTA 3UM9A 3WKBA 4MEXA 2ESEA 4QW8A 9ICCA 7ICKA 2W43A 5L1LA 3RBDA 2FE9A 4FS2A 3KBBA 8ICNA 3V7JA 3C5FA 3HKZF 1SWVA 3ZDAA 4RQ1A 3T5KA 3RTVA 2XC9A 1TVAA 4P4MA 5J2FA 4OO1J 3RJEA 4DSKA 3BZCA 4LJXA 5J2CA 1KFDA 4YN4A 7ICMA 2WTFA 4DF4A 4Z6DA 1UCVA 4DFKA 4UATA 1GO3F 3BQ1A 3ISCA 2A1AA 5KG6A 5ALIA 5J29A 2BQUA 1Q46A 1FFUA 1DOQA 5GTHU 1MC8A 5ALQA 1WWVA 2AQ4A 2PMZF 1Z4OA 3U26A 1RYUA 2Y1IA 1SL0A 2PFQA 2WAQC 1ZXIA 4Y2PA 4Z6CA 5KFBA 4DQRA 1KDHA 2IA6A 2BCUA 2ZXHA 3E58A 1A76A 2EZZA 4F2RA 5J0QA 4MF8A 5KFZA 5KFEA 3Q8SB 2HHTA 2ZUDA 3UXNA 3GDXA 3HRDD 8ICMA 2BCSA 2KHVA 3C28A 2FPMA 3TADC 3QZ7A 7ICSA 1XNSA 1ZQGA 3I76A 2W04A 3RR8A 3LK9A 2P35A 1NK5A 8ICRA 2FI1A 2VA8A 3WK6A 2H3VA 2F1HA 2LMRA 2WB1F 2K8BB 4OJPA 5FP0A 3FYHA 5AKKA 4E0DA 3L5KA 2NYVA 2R18A 2KG5A 5DG8A 5J0TA 3PY8A 1F0MA 3QE9Y 1BPXA 1SIJA 2QB1A 3HKZC 4F4YA 1ZQTA 5DBAA 5D46A 5KL1B 2YQEA 2NO5A 4AYBF 3TARA 1PVQA 5J0XA 3PX0A 4NLKA 2HBKA 3VC8A 5KFHA 3H8MA 5H2FU 8ICHA 1ZD5A 1UA0A 2JR5A 4ZH4A 4NLBA 1COOA 2E1FA 3TAPA 2DF4B 4MFCA 4CGZA 4R65A 2W11A 3OPXA 4FZNA 8ICYA 4Q43A 3RJJA 2W9AA 3T5LA 4Y2QA 4DFMA 3M8RA 5GTIU 4RQ4A 2VKQA 2LYBA 4RUAA 3NS1A 3AN1A 5HR6A 4YCXA 5DDMA 2I6XA 4QIWC 4ECRA 2LM4A 4EX6A 4NY8A 3RF9A 1UT5A 1B43A 4US8A 4TUPA 4GC7A 3NUQA 3C2KA 1JXEA 4NLGA 1QSYA 3HJEA 3ONNA 4F50A 2VANA 2NRVA 2ZJAA 1T8EA 1SL1A 3GILA 4CE6A 3EUB2 4O3SA 4Z6FA 1F44A 4F93B 1SKRA 3FM9A 4RNOA 4OJOA 3H0MB 5CHGA
chains in the Genus database with same CATH topology
5KG5A 2J6SA 1KLNA 3UQ2A 1XO1A 3ZDEA 1NKEA 1KFTA 4PGQA 4F5RA 1Z00B 2FMQA 4DL6A 8ICWA 5KFKA 4YVZA 2R8GA 4KLDA 3N4MB 4LZGA 4YMOA 5KFAA 5KFMA 4UB5A 4J9RA 4J9PA 3MFIA 3G6YA 1V9PA 3E2EA 2HHUA 2ZUBA 4RU9A 5F9NA 2JZBA 1N48A 8ICEA 4RNNA 1XWLA 5IIMA 3NTUA 3MBYA 1PZNA 2ISOA 4B9MA 5J0WA 2C22A 1U48A 1XS9D 1D8YA 4PHAA 1B22A 4QWBA 8ICUA 5J0PA 4ED3A 3RB6A 1D8LA 3RH5A 2I9GA 4UAWA 2J6TA 4NM1A 1DGSA 5KT2A 5KFLA 5J0RA 3Q8QB 4BWJA 5KG7A 1RXVA 1KFSA 1KTQA 5J2AA 4B9SA 4M6WA 3OSNA 2LYHA 4DL4A 5DLFA 4B9VA 9ICXA 1ZJNA 4IRKA 2XCPA 4ED6A 8ICFA 2KTQA 4J9KA 5CWRA 1XSPA 4RQ6A 1CEZA 4UB1A 2BKEA 3N97B 3PR4A 2JEFA 9ICPA 3RJIA 2NRWA 5DQHA 4FO6A 4DF8A 4M9HA 4C8MA 1D9FA 2PI4A 4F4KA 1K1QA 4RPXA 1BPDA 1XU4A 3NGDA 5J2GA 2ZUCA 1BVSA 1EXNA 4QZBA 5DBBA 2C2EA 1X9SA 3GV5B 4YR2A 2RDJA 4DFJA 3SI8A 1S77D 4I2IA 4M9JA 4RQ5A 2ASLA 4PHPA 2ZTCA 4IR1A 3V6HA 2HHQA 3MDCA 4DWIA 2BPGA 2Q0ZX 1KSPA 4RQ7A 3H8WA 3OJUA 3M8SA 3EPGA 4R8UB 2F1IA 7ICQA 3JPQA 3Q8RB 1Z00A 1ZQMA 5J2HA 2UVVA 4YG2A 4QZDA 3M9OB 4ECSA 2IMWP 3ZD8A 2C2RA 5KTQA 4QZ8A 5KT3A 3PO5A 3M9MB 1T3NA 5HMMA 2W8LA 8ICCA 3MR6A 1XC9A 4JWMA 9ICOA 3BJYA 3RJHA 3THVA 4KLOA 4KLTA 2I1QA 3JPRA 9ICWA 1RPLA 5KG2A 7ICPA 2F1JA 5BPCA 1ZQCA 4IR9A 4FBUA 4O3PA 3PVXA 5J2IA 3KHRA 1WCLA 1XSLA 1JXLA 9ICLA 4Q45A 3JPPA 1CUKA 4XQ8A 4R63A 4UQGA 3V6JA 4PHEA 3EZ5A 4I2JA 2ZTEA 1X9MA 1C7YA 5J2EA 9ICBA 3MR2A 3TAQA 1UT8A 8ICSA 4F4XA 2BGWA 2IHNA 1TAQA 3Q8KA 1U45A 4IQTA 4DSLA 4QZFA 5J0SA 5DQIA 1RYSA 3ORYA 3ZD9A 5DB6A 1BPYA 2FMSA 4M9LA 4MFFA 5IIIA 1L5UA 5KT7A 2ASJA 9ICHA 4F5OA 4C8OA 3AUOA 4QWDA 2KN7A 5KFTA 3Q8PB 3H4DA 3V7LA 3RJGA 3ZDDA 4DL3A 2AGPA 4QWEA 4F92B 2KFNA 5DB9A 2BHNA 3UQ0A 4ECWA 4XRHA 5KG1A 2XY5A 8ICBA 2JEGA 5KFOA 3PO4A 5J0UA 1ZQFA 4UB4A 4I28A 4P4PA 8ICKA 4C8KA 1ZYQA 9ICTA 1NKBA 2BCRA 4DSJA 3AU6A 1ZQYA 1KRPA 1TV9A 1S0OA 4LZDA 5L9XA 4UB3A 4R8UA 5KFXA 1MQ2A 2H5XA 3MR3A 4I27A 5KFGA 1MQ3A 3FDSA 2ZTDA 4BDPA 4M9GA 5CB1A 3Q8MA 3H8SA 1ZETA 5J0YA 1QSSA 4QZAA 1HJPA 1Z3EB 5F9LA 9ICMA 1U47A 9ICQA 4O3NA 3SZ2A 4O3QA 7ICIA 1TK5A 4Q8EA 2HHXA 4DEZA 5L1IA 4GXJA 2DPIA 4IRCA 3PW4A 5IIKA 3K75D 4J9OA 4J9LA 2XGQA 1L3TA 1ZQLA 4ED1A 2UVWA 4M0AA 4KLFA 2HHSA 1ZQXA 2BPCA 4EEYA 1NK9A 2J6UA 1X9WA 5EWEA 1JX4A 4ELTA 4ED0A 4EZ6A 5D49A 5KFPA 3EW9A 3OHAA 2HVHA 4MFAA 3OSPA 4DQPA 3V6KA 4DQIA 3HW8A 1ZQDA 3TFSA 7ICEA 4RPZA 2ALZA 3RB0A 1HUZA 3GFKB 4JWNA 4F5QA 3PX6A 1S9FA 3RJFA 1L3SA 3BDPA 1A77A 4ECUA 1NK7A 4KLSA 3JPOA 2C2DA 4B9TA 3TQ1A 1SKSA 1BGXT 5KFFA 4M2YA 3MR5A 5L1KA 4J9MA 2AGOA 1QTMA 5DGAA 3IHQB 2W8KA 1K1SA 1NJXA 2AJQA 2P6RA 8ICLA 4GC6A 1S76D 4O5CA 3K4GA 2XCAA 3HWTA 4ED2A 2BQ3A 1ZQJA 5CJ7A 3OGUA 5DDYA 5DQGA 3BQ0A 3V72A 2BR0A 5KFJA 9ICSA 3C1YA 4RNMA 1QSLA 7ICVA 5CA7A 1NKCA 4F3OA 7ICUA 3T5HA 3GIKA 3C5GA 1IM4A 3HP6A 4JV1A 4ELVA 1IXRA 4RPYA 2NRTA 4PGXA 5L1JA 3RB3A 1MSWD 3GV7B 3C23A 5KT5A 4YFKA 4DQQA 4I2DA 4K4GA 1S0NA 1ZQAA 4QZHA 5J2KA 4DOBA 4KTQA 4KLLA 1L3VA 4KITB 4NLNA 3SYZA 1SZPA 3UPQA 8ICAA 4YD2A 4ECTA 1RXWA 5IIOA 3RAXA 4DSEA 3LDAA 4Z6EA 5D4BA 1ZJMA 4PGYA 4I2BA 4YR3A 4IQUA 5KFRA 5EOZA 3H4BA 8ICZA 3GQCA 1ZQKA 4QZCA 7ICGA 3QZ8A 4DS4A 3KHHA 4DLEA 4YQWA 4I2AA 5HHIA 3RBEA 4TUSA 3TFRA 5KFSA 4QZGA 3PMLA 3GIMA 3HT3A 2OWOA 3KHGA 3T3FA 4I29A 3ISDA 4YXJA 5KT6A 9ICRA 3UXPA 5J2DA 4M04A 4RUCA 4F5PA 4DL7A 7ICHA 3LWMA 4G3IA 9ICJA 3QEBZ 4R66A 3PR5B 5HMLA 3C2MA 2MUTB 3C21A 9ICAA 3SV3A 4YR0A 3ETLA 7ICJA 2AGQA 5DBCA 4DL2A 2XY7A 4KLHA 4C8NA 2W9BB 4TQRA 7ICTA 1SKWA 2DPJA 4MEXA 1AROP 2B21A 2PFNA 4QW8A 2HHWA 9ICCA 7ICKA 5L1LA 2R8KA 3RR7A 2HW3A 5KFCA 3ZDCA 3RBDA 4I2GA 4FS2A 4ECVA 5KFVA 1WCNA 4JUZA 4QW9A 4UAZA 4DFPA 1H38A 9ICVA 4KLJA 1X2IA 4EYHB 1NK8A 4J9QA 2GWSA 2KZ3A 2V4QA 4UAYA 4UBBA 5BOLA 4DO9A 1NK6A 8ICNA 2RDIA 4F2SA 2PFOA 3V7JA 4CCHA 2R8JA 2NRXA 3C5FA 4KLUA 3RJKA 4MEYA 2ISPA 5C5JA 1ZQPA 4DSFA 1KEJA 5HP4A 4BXOB 3RAQA 4K4IA 3ZDAA 4RQ1A 8ICGA 4QWAA 3T5KA 2JEIA 3RTVA 3RH4A 2XC9A 1LV5A 4ED7A 1U4BA 1SL2A 1L3UA 2W9CB 1TVAA 3IM1A 4F8RA 4P4MA 5J2FA 1TK8A 1ZQBA 4MF2A 4TQSA 2C28A 3RJEA 3RH6A 4DSKA 5HHHA 4O3RA 4J9NA 3BQ2A 4C8LA 5J2CA 4GLXA 4RT2A 1KFDA 4X5VA 4O3OA 4ELUA 3PMNA 1NJWA 4YN4A 1NK0A 4JV2A 7ICMA 2WTFA 4PPXA 4DF4A 3GIJA 9ICFA 4Z6DA 3H7IA 5J2JA 4DFKA 4Q44A 4ECQA 2MUTA 4ECXA 2VA2A 4JV0A 4ED8A 4YD1A 5DB7A 3BQ1A 1NJZA 2JEJA 3ISCA 4KLMA 7ICRA 2W9BA 1ZQHA 5KG6A 2FLPA 4BGDA 5J29A 2BQUA 3TI0A 7ICFA 1DOQA 4RQ0A 1TFRA 3MFHA 9ICEA 1MC8A 1RZTA 5DG9A 1S0MA 1JMSA 4UB2A 4I2FA 1HUOA 3OHBA 4FS1A 2AQ4A 1TK0A 1TKDA 4O5KA 2AQ0A 2KFZA 2BCVA 5IINA 2Y1IA 1SL0A 4EBDA 2PFQA 1N56A 3RRGA 4DS5A 4DQRA 4Z6CA 3BQTA 5KFBA 5DGBA 1KDHA 2IA6A 3PW2A 2HHVA 4KN4A 2BCUA 4DLGA 7ICLA 5CP2A 1A76A 2P6UA 3LWLA 2Y1JA 5TZVA 4EYIB 4BXOA 3M9NB 4NM2A 2P66A 5DB8A 4O5EA 4F2RA 3PW5A 4HYKA 5J0QA 5BOMA 8ICIA 5JUMA 3H8JA 9ICKA 4KMUA 5J0OA 4MF8A 2W9CA 5KFZA 3QEAZ 3T5JA 4DSIA 3PNCA 2R8IA 5KFEA 3Q8SB 2HHTA 1ZQUA 2ZUDA 4F4ZA 4IQVA 2KZMA 3GIIA 2R8HA 3TANA 1NK4A 7ICOA 3C2LA 3UXNA 4IQWA 3GDXA 4R64A 8ICPA 5J2BA 2A1JB 1BPBA 3KHLA 2BPFA 8ICTA 3MGIA 4KLGA 4F91B 8ICMA 1ZQVA 2BCSA 5IIJA 1ZQEA 9ICIA 4KLIA 3GV8B 4YMNA 2HVIA 4P2HA 2FPMA 3QZ7A 4KLQA 1U49A 7ICSA 3HX0A 1ZQGA 3RB4A 3PV8A 3RR8A 3LK9A 1NK5A 8ICRA 5EWGA 1ZQIA 5KFUA 1UA1A 2VA8A 2FLLA 8ICJA 4RQ2A 3JPNA 5KFQA 3OJSA 5KG4A 1ZQWA 5IILA 2F1HA 4NXZA 3EPIA 4B9LA 5CR0A 3MABA 7ICNA 2MAXA 3JPSA 4M47A 2ZJ5A 2V9WA 3FYHA 2XY6A 8ICXA 4PHDA 4E0DA 3EYZA 1TAUA 5DG8A 5J0TA 3PY8A 3QE9Y 3B0YA 1BPXA 4O9MA 1RYRA 4M9NA 2VA3A 4F4YA 1NOMA 1ZQTA 4RQ3A 3G6VA 5DBAA 5D46A 8ICQA 4J9SA 2BDPA 4RQ8A 4LVSA 4F4WA 3TARA 2PI5A 5J0XA 3EWAA 3PX0A 4NLKA 2W9MA 5DKWA 4KLEA 4I2EA 8ICOA 4XA5A 2AU0A 4F5NA 5KFHA 8ICVA 3MDAA 3ISBA 3PW7A 5KG0A 4IRDA 1ZQQA 3C1ZA 8ICHA 5KFYA 1ZQOA 1NJYA 4EZ9A 1UA0A 4I2HA 2XGPA 1T7PA 2A1JA 3AU2A 4I2CA 4RZRA 9ICGA 4K4HA 4ZH4A 3SV4A 2FLNA 2FMPA 1COOA 3TAPA 5KFNA 2PXIA 4MFCA 4TURA 1D9DA 4R65A 1T4GA 8ICYA 3RRHA 3V7KA 4PH5A 4Q43A 1S97A 4Q8FA 3H40A 5DLGA 2W9AA 5DG7A 3HPOA 3T5LA 5KFIA 1JN3A 3RJJA 4JK1A 4BWMA 2V4RA 3JPTA 3M8RA 4DFMA 1S10A 1S0VA 4RQ4A 2JZBB 5KG3A 1BPEA 4DL5A 4RUAA 3UXOA 4DOCA 4YMMA 5EWFA 4YCXA 2NRZA 4FBTA 5DDMA 4ECRA 4QWCA 1ZQZA 4EBCA 2UVRA 2XO7A 2ASDA 4UBCA 4B9UA 4EBEA 4NY8A 4NLZA 4YXMA 1QLNA 5KFDA 1UT5A 5KT4A 1U9LA 9ICUA 5KFWA 1B43A 2ZJ8A 4QZIA 1BPZA 4KN7A 1LB2B 2FPKA 4M6WB 4P4OA 4TUPA 2DFLA 4GC7A 3KTQA 2FPLA 3C2KA 4ECZA 1JXEA 4NLGA 1QSYA 4O0IA 3G6XA 4GXIA 4F50A 2VANA 4XUSA 2NRVA 2ZJAA 3PX4A 4QZEA 1T8EA 2BQRA 3B0XA 1Y88A 2M9NA 3GILA 1XSNA 3Q8LA 1SL1A 1ZQRA 4QZ9A 2UVUA 4DQSA 4Z6FA 4B9NA 4O3SA 4GXKA 2PFPA 1JIHA 4YP3A 4ECYA 1ZQSA 4F93B 1SKRA 2IHMA 4DOAA 2ATLA 2IBKA 4RNOA 9ICNA 2BCQA 3MGHA 4TUQA 1ZQNA 2KZZA 3PW0A 3ZDBA 5HNKA 4RT3A 5CHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KG5 A;  2J6S A;  1KLN A;  3UQ2 A;  1XO1 A;  3ZDE A;  1NKE A;  1KFT A;  4PGQ A;  4F5R A;  1Z00 B;  2FMQ A;  4DL6 A;  8ICW A;  5KFK A;  4YVZ A;  2R8G A;  4KLD A;  3N4M B;  4LZG A;  4YMO A;  5KFA A;  5KFM A;  4UB5 A;  4J9R A;  4J9P A;  3MFI A;  3G6Y A;  1V9P A;  3E2E A;  2HHU A;  2ZUB A;  4RU9 A;  5F9N A;  2JZB A;  1N48 A;  8ICE A;  4RNN A;  1XWL A;  5IIM A;  3NTU A;  3MBY A;  1PZN A;  2ISO A;  4B9M A;  5J0W A;  2C22 A;  1U48 A;  1XS9 D;  1D8Y A;  4PHA A;  1B22 A;  4QWB A;  8ICU A;  5J0P A;  4ED3 A;  3RB6 A;  1D8L A;  3RH5 A;  2I9G A;  4UAW A;  2J6T A;  4NM1 A;  1DGS A;  5KT2 A;  5KFL A;  5J0R A;  3Q8Q B;  4BWJ A;  5KG7 A;  1RXV A;  1KFS A;  1KTQ A;  5J2A A;  4B9S A;  4M6W A;  3OSN A;  2LYH A;  4DL4 A;  5DLF A;  4B9V A;  9ICX A;  1ZJN A;  4IRK A;  2XCP A;  4ED6 A;  8ICF A;  2KTQ A;  4J9K A;  5CWR A;  1XSP A;  4RQ6 A;  1CEZ A;  4UB1 A;  2BKE A;  3N97 B;  3PR4 A;  2JEF A;  9ICP A;  3RJI A;  2NRW A;  5DQH A;  4FO6 A;  4DF8 A;  4M9H A;  4C8M A;  1D9F A;  2PI4 A;  4F4K A;  1K1Q A;  4RPX A;  1BPD A;  1XU4 A;  3NGD A;  5J2G A;  2ZUC A;  1BVS A;  1EXN A;  4QZB A;  5DBB A;  2C2E A;  1X9S A;  3GV5 B;  4YR2 A;  2RDJ A;  4DFJ A;  3SI8 A;  1S77 D;  4I2I A;  4M9J A;  4RQ5 A;  2ASL A;  4PHP A;  2ZTC A;  4IR1 A;  3V6H A;  2HHQ A;  3MDC A;  4DWI A;  2BPG A;  2Q0Z X;  1KSP A;  4RQ7 A;  3H8W A;  3OJU A;  3M8S A;  3EPG A;  4R8U B;  2F1I A;  7ICQ A;  3JPQ A;  3Q8R B;  1Z00 A;  1ZQM A;  5J2H A;  2UVV A;  4YG2 A;  4QZD A;  3M9O B;  4ECS A;  2IMW P;  3ZD8 A;  2C2R A;  5KTQ A;  4QZ8 A;  5KT3 A;  3PO5 A;  3M9M B;  1T3N A;  5HMM A;  2W8L A;  8ICC A;  3MR6 A;  1XC9 A;  4JWM A;  9ICO A;  3BJY A;  3RJH A;  3THV A;  4KLO A;  4KLT A;  2I1Q A;  3JPR A;  9ICW A;  1RPL A;  5KG2 A;  7ICP A;  2F1J A;  5BPC A;  1ZQC A;  4IR9 A;  4FBU A;  4O3P A;  3PVX A;  5J2I A;  3KHR A;  1WCL A;  1XSL A;  1JXL A;  9ICL A;  4Q45 A;  3JPP A;  1CUK A;  4XQ8 A;  4R63 A;  4UQG A;  3V6J A;  4PHE A;  3EZ5 A;  4I2J A;  2ZTE A;  1X9M A;  1C7Y A;  5J2E A;  9ICB A;  3MR2 A;  3TAQ A;  1UT8 A;  8ICS A;  4F4X A;  2BGW A;  2IHN A;  1TAQ A;  3Q8K A;  1U45 A;  4IQT A;  4DSL A;  4QZF A;  5J0S A;  5DQI A;  1RYS A;  3ORY A;  3ZD9 A;  5DB6 A;  1BPY A;  2FMS A;  4M9L A;  4MFF A;  5III A;  1L5U A;  5KT7 A;  2ASJ A;  9ICH A;  4F5O A;  4C8O A;  3AUO A;  4QWD A;  2KN7 A;  5KFT A;  3Q8P B;  3H4D A;  3V7L A;  3RJG A;  3ZDD A;  4DL3 A;  2AGP A;  4QWE A;  4F92 B;  2KFN A;  5DB9 A;  2BHN A;  3UQ0 A;  4ECW A;  4XRH A;  5KG1 A;  2XY5 A;  8ICB A;  2JEG A;  5KFO A;  3PO4 A;  5J0U A;  1ZQF A;  4UB4 A;  4I28 A;  4P4P A;  8ICK A;  4C8K A;  1ZYQ A;  9ICT A;  1NKB A;  2BCR A;  4DSJ A;  3AU6 A;  1ZQY A;  1KRP A;  1TV9 A;  1S0O A;  4LZD A;  5L9X A;  4UB3 A;  4R8U A;  5KFX A;  1MQ2 A;  2H5X A;  3MR3 A;  4I27 A;  5KFG A;  1MQ3 A;  3FDS A;  2ZTD A;  4BDP A;  4M9G A;  5CB1 A;  3Q8M A;  3H8S A;  1ZET A;  5J0Y A;  1QSS A;  4QZA A;  1HJP A;  1Z3E B;  5F9L A;  9ICM A;  1U47 A;  9ICQ A;  4O3N A;  3SZ2 A;  4O3Q A;  7ICI A;  1TK5 A;  4Q8E A;  2HHX A;  4DEZ A;  5L1I A;  4GXJ A;  2DPI A;  4IRC A;  3PW4 A;  5IIK A;  3K75 D;  4J9O A;  4J9L A;  2XGQ A;  1L3T A;  1ZQL A;  4ED1 A;  2UVW A;  4M0A A;  4KLF A;  2HHS A;  1ZQX A;  2BPC A;  4EEY A;  1NK9 A;  2J6U A;  1X9W A;  5EWE A;  1JX4 A;  4ELT A;  4ED0 A;  4EZ6 A;  5D49 A;  5KFP A;  3EW9 A;  3OHA A;  2HVH A;  4MFA A;  3OSP A;  4DQP A;  3V6K A;  4DQI A;  3HW8 A;  1ZQD A;  3TFS A;  7ICE A;  4RPZ A;  2ALZ A;  3RB0 A;  1HUZ A;  3GFK B;  4JWN A;  4F5Q A;  3PX6 A;  1S9F A;  3RJF A;  1L3S A;  3BDP A;  1A77 A;  4ECU A;  1NK7 A;  4KLS A;  3JPO A;  2C2D A;  4B9T A;  3TQ1 A;  1SKS A;  1BGX T;  5KFF A;  4M2Y A;  3MR5 A;  5L1K A;  4J9M A;  2AGO A;  1QTM A;  5DGA A;  3IHQ B;  2W8K A;  1K1S A;  1NJX A;  2AJQ A;  2P6R A;  8ICL A;  4GC6 A;  1S76 D;  4O5C A;  3K4G A;  2XCA A;  3HWT A;  4ED2 A;  2BQ3 A;  1ZQJ A;  5CJ7 A;  3OGU A;  5DDY A;  5DQG A;  3BQ0 A;  3V72 A;  2BR0 A;  5KFJ A;  9ICS A;  3C1Y A;  4RNM A;  1QSL A;  7ICV A;  5CA7 A;  1NKC A;  4F3O A;  7ICU A;  3T5H A;  3GIK A;  3C5G A;  1IM4 A;  3HP6 A;  4JV1 A;  4ELV A;  1IXR A;  4RPY A;  2NRT A;  4PGX A;  5L1J A;  3RB3 A;  1MSW D;  3GV7 B;  3C23 A;  5KT5 A;  4YFK A;  4DQQ A;  4I2D A;  4K4G A;  1S0N A;  1ZQA A;  4QZH A;  5J2K A;  4DOB A;  4KTQ A;  4KLL A;  1L3V A;  4KIT B;  4NLN A;  3SYZ A;  1SZP A;  3UPQ A;  8ICA A;  4YD2 A;  4ECT A;  1RXW A;  5IIO A;  3RAX A;  4DSE A;  3LDA A;  4Z6E A;  5D4B A;  1ZJM A;  4PGY A;  4I2B A;  4YR3 A;  4IQU A;  5KFR A;  5EOZ A;  3H4B A;  8ICZ A;  3GQC A;  1ZQK A;  4QZC A;  7ICG A;  3QZ8 A;  4DS4 A;  3KHH A;  4DLE A;  4YQW A;  4I2A A;  5HHI A;  3RBE A;  4TUS A;  3TFR A;  5KFS A;  4QZG A;  3PML A;  3GIM A;  3HT3 A;  2OWO A;  3KHG A;  3T3F A;  4I29 A;  3ISD A;  4YXJ A;  5KT6 A;  9ICR A;  3UXP A;  5J2D A;  4M04 A;  4RUC A;  4F5P A;  4DL7 A;  7ICH A;  3LWM A;  4G3I A;  9ICJ A;  3QEB Z;  4R66 A;  3PR5 B;  5HML A;  3C2M A;  2MUT B;  3C21 A;  9ICA A;  3SV3 A;  4YR0 A;  3ETL A;  7ICJ A;  2AGQ A;  5DBC A;  4DL2 A;  2XY7 A;  4KLH A;  4C8N A;  2W9B B;  4TQR A;  7ICT A;  1SKW A;  2DPJ A;  4MEX A;  1ARO P;  2B21 A;  2PFN A;  4QW8 A;  2HHW A;  9ICC A;  7ICK A;  5L1L A;  2R8K A;  3RR7 A;  2HW3 A;  5KFC A;  3ZDC A;  3RBD A;  4I2G A;  4FS2 A;  4ECV A;  5KFV A;  1WCN A;  4JUZ A;  4QW9 A;  4UAZ A;  4DFP A;  1H38 A;  9ICV A;  4KLJ A;  1X2I A;  4EYH B;  1NK8 A;  4J9Q A;  2GWS A;  2KZ3 A;  2V4Q A;  4UAY A;  4UBB A;  5BOL A;  4DO9 A;  1NK6 A;  8ICN A;  2RDI A;  4F2S A;  2PFO A;  3V7J A;  4CCH A;  2R8J A;  2NRX A;  3C5F A;  4KLU A;  3RJK A;  4MEY A;  2ISP A;  5C5J A;  1ZQP A;  4DSF A;  1KEJ A;  5HP4 A;  4BXO B;  3RAQ A;  4K4I A;  3ZDA A;  4RQ1 A;  8ICG A;  4QWA A;  3T5K A;  2JEI A;  3RTV A;  3RH4 A;  2XC9 A;  1LV5 A;  4ED7 A;  1U4B A;  1SL2 A;  1L3U A;  2W9C B;  1TVA A;  3IM1 A;  4F8R A;  4P4M A;  5J2F A;  1TK8 A;  1ZQB A;  4MF2 A;  4TQS A;  2C28 A;  3RJE A;  3RH6 A;  4DSK A;  5HHH A;  4O3R A;  4J9N A;  3BQ2 A;  4C8L A;  5J2C A;  4GLX A;  4RT2 A;  1KFD A;  4X5V A;  4O3O A;  4ELU A;  3PMN A;  1NJW A;  4YN4 A;  1NK0 A;  4JV2 A;  7ICM A;  2WTF A;  4PPX A;  4DF4 A;  3GIJ A;  9ICF A;  4Z6D A;  3H7I A;  5J2J A;  4DFK A;  4Q44 A;  4ECQ A;  2MUT A;  4ECX A;  2VA2 A;  4JV0 A;  4ED8 A;  4YD1 A;  5DB7 A;  3BQ1 A;  1NJZ A;  2JEJ A;  3ISC A;  4KLM A;  7ICR A;  2W9B A;  1ZQH A;  5KG6 A;  2FLP A;  4BGD A;  5J29 A;  2BQU A;  3TI0 A;  7ICF A;  1DOQ A;  4RQ0 A;  1TFR A;  3MFH A;  9ICE A;  1MC8 A;  1RZT A;  5DG9 A;  1S0M A;  1JMS A;  4UB2 A;  4I2F A;  1HUO A;  3OHB A;  4FS1 A;  2AQ4 A;  1TK0 A;  1TKD A;  4O5K A;  2AQ0 A;  2KFZ A;  2BCV A;  5IIN A;  2Y1I A;  1SL0 A;  4EBD A;  2PFQ A;  1N56 A;  3RRG A;  4DS5 A;  4DQR A;  4Z6C A;  3BQT A;  5KFB A;  5DGB A;  1KDH A;  2IA6 A;  3PW2 A;  2HHV A;  4KN4 A;  2BCU A;  4DLG A;  7ICL A;  5CP2 A;  1A76 A;  2P6U A;  3LWL A;  2Y1J A;  5TZV A;  4EYI B;  4BXO A;  3M9N B;  4NM2 A;  2P66 A;  5DB8 A;  4O5E A;  4F2R A;  3PW5 A;  4HYK A;  5J0Q A;  5BOM A;  8ICI A;  5JUM A;  3H8J A;  9ICK A;  4KMU A;  5J0O A;  4MF8 A;  2W9C A;  5KFZ A;  3QEA Z;  3T5J A;  4DSI A;  3PNC A;  2R8I A;  5KFE A;  3Q8S B;  2HHT A;  1ZQU A;  2ZUD A;  4F4Z A;  4IQV A;  2KZM A;  3GII A;  2R8H A;  3TAN A;  1NK4 A;  7ICO A;  3C2L A;  3UXN A;  4IQW A;  3GDX A;  4R64 A;  8ICP A;  5J2B A;  2A1J B;  1BPB A;  3KHL A;  2BPF A;  8ICT A;  3MGI A;  4KLG A;  4F91 B;  8ICM A;  1ZQV A;  2BCS A;  5IIJ A;  1ZQE A;  9ICI A;  4KLI A;  3GV8 B;  4YMN A;  2HVI A;  4P2H A;  2FPM A;  3QZ7 A;  4KLQ A;  1U49 A;  7ICS A;  3HX0 A;  1ZQG A;  3RB4 A;  3PV8 A;  3RR8 A;  3LK9 A;  1NK5 A;  8ICR A;  5EWG A;  1ZQI A;  5KFU A;  1UA1 A;  2VA8 A;  2FLL A;  8ICJ A;  4RQ2 A;  3JPN A;  5KFQ A;  3OJS A;  5KG4 A;  1ZQW A;  5IIL A;  2F1H A;  4NXZ A;  3EPI A;  4B9L A;  5CR0 A;  3MAB A;  7ICN A;  2MAX A;  3JPS A;  4M47 A;  2ZJ5 A;  2V9W A;  3FYH A;  2XY6 A;  8ICX A;  4PHD A;  4E0D A;  3EYZ A;  1TAU A;  5DG8 A;  5J0T A;  3PY8 A;  3QE9 Y;  3B0Y A;  1BPX A;  4O9M A;  1RYR A;  4M9N A;  2VA3 A;  4F4Y A;  1NOM A;  1ZQT A;  4RQ3 A;  3G6V A;  5DBA A;  5D46 A;  8ICQ A;  4J9S A;  2BDP A;  4RQ8 A;  4LVS A;  4F4W A;  3TAR A;  2PI5 A;  5J0X A;  3EWA A;  3PX0 A;  4NLK A;  2W9M A;  5DKW A;  4KLE A;  4I2E A;  8ICO A;  4XA5 A;  2AU0 A;  4F5N A;  5KFH A;  8ICV A;  3MDA A;  3ISB A;  3PW7 A;  5KG0 A;  4IRD A;  1ZQQ A;  3C1Z A;  8ICH A;  5KFY A;  1ZQO A;  1NJY A;  4EZ9 A;  1UA0 A;  4I2H A;  2XGP A;  1T7P A;  2A1J A;  3AU2 A;  4I2C A;  4RZR A;  9ICG A;  4K4H A;  4ZH4 A;  3SV4 A;  2FLN A;  2FMP A;  1COO A;  3TAP A;  5KFN A;  2PXI A;  4MFC A;  4TUR A;  1D9D A;  4R65 A;  1T4G A;  8ICY A;  3RRH A;  3V7K A;  4PH5 A;  4Q43 A;  1S97 A;  4Q8F A;  3H40 A;  5DLG A;  2W9A A;  5DG7 A;  3HPO A;  3T5L A;  5KFI A;  1JN3 A;  3RJJ A;  4JK1 A;  4BWM A;  2V4R A;  3JPT A;  3M8R A;  4DFM A;  1S10 A;  1S0V A;  4RQ4 A;  2JZB B;  5KG3 A;  1BPE A;  4DL5 A;  4RUA A;  3UXO A;  4DOC A;  4YMM A;  5EWF A;  4YCX A;  2NRZ A;  4FBT A;  5DDM A;  4ECR A;  4QWC A;  1ZQZ A;  4EBC A;  2UVR A;  2XO7 A;  2ASD A;  4UBC A;  4B9U A;  4EBE A;  4NY8 A;  4NLZ A;  4YXM A;  1QLN A;  5KFD A;  1UT5 A;  5KT4 A;  1U9L A;  9ICU A;  5KFW A;  1B43 A;  2ZJ8 A;  4QZI A;  1BPZ A;  4KN7 A;  1LB2 B;  2FPK A;  4M6W B;  4P4O A;  4TUP A;  2DFL A;  4GC7 A;  3KTQ A;  2FPL A;  3C2K A;  4ECZ A;  1JXE A;  4NLG A;  1QSY A;  4O0I A;  3G6X A;  4GXI A;  4F50 A;  2VAN A;  4XUS A;  2NRV A;  2ZJA A;  3PX4 A;  4QZE A;  1T8E A;  2BQR A;  3B0X A;  1Y88 A;  2M9N A;  3GIL A;  1XSN A;  3Q8L A;  1SL1 A;  1ZQR A;  4QZ9 A;  2UVU A;  4DQS A;  4Z6F A;  4B9N A;  4O3S A;  4GXK A;  2PFP A;  1JIH A;  4YP3 A;  4ECY A;  1ZQS A;  4F93 B;  1SKR A;  2IHM A;  4DOA A;  2ATL A;  2IBK A;  4RNO A;  9ICN A;  2BCQ A;  3MGH A;  4TUQ A;  1ZQN A;  2KZZ A;  3PW0 A;  3ZDB A;  5HNK A;  4RT3 A;  5CHG A; 
#chains in the Genus database with same CATH topology
 5AK4 A;  3AL0 B;  3ZDE A;  1NKE A;  1RDF A;  2F76 X;  2FMQ A;  2MRL A;  2XVT A;  4LZG A;  4UB5 A;  5KFM A;  3MFI A;  1X40 A;  1V9P A;  4Y2U A;  8ICE A;  5IIM A;  3CW2 C;  2GLE A;  2PKE A;  2C22 A;  2WB1 C;  4PHA A;  2KNJ A;  5J0P A;  2XIC A;  5CEH A;  5KT2 A;  5KFL A;  2K8A A;  3OSN A;  4DL4 A;  5J8Y A;  4HAI A;  2XCP A;  8ICF A;  3QXG A;  2OHF A;  5CWR A;  1CEZ A;  1J2M A;  1JUD A;  1Z4N A;  2BKE A;  4NL9 C;  3D2N A;  4FO6 A;  4C8M A;  1D9F A;  4F4K A;  2H3Z A;  4RPX A;  3NGD A;  2E3T A;  5J2G A;  1EXN A;  1QQ6 A;  1X9S A;  5JRT A;  4M9J A;  2ASL A;  4PHP A;  4DWI A;  4GIB A;  2Q0Z X;  4Y2V A;  1KSP A;  3H8W A;  7ICQ A;  3Q8R B;  4YG2 A;  3M9O B;  2ES6 A;  4OD0 A;  3ZD8 A;  3PO5 A;  5HMM A;  2W8L A;  3A0H U;  8ICC A;  1AQ6 A;  3BJY A;  2AH5 A;  5KG2 A;  3SAF A;  2F1J A;  5BPC A;  1XSL A;  1SXE A;  4R63 A;  2KVS A;  2ZTE A;  1X9M A;  2LI6 A;  4U6P A;  3PSF A;  2BGW A;  1TAQ A;  3Q8K A;  4PJ0 U;  2KKV A;  4C4R A;  5DB6 A;  4MFF A;  1L5U A;  5KT7 A;  2KJ8 A;  3AMZ A;  4A8E A;  4QWD A;  1S8O A;  2KN7 A;  1Z19 A;  5JTI A;  3Q8P B;  3V7L A;  4IL6 U;  1JI7 A;  4F92 B;  2BHN A;  4ECW A;  8ICB A;  4P4P A;  4C8K A;  9ICT A;  4DSJ A;  5AKL A;  1ZQY A;  5KFX A;  2E8N A;  2JHD A;  1MQ2 A;  5KFG A;  1MQ3 A;  2W3S A;  5AIC A;  3KFU F;  1QH9 A;  1ZET A;  3M6K A;  3SZ2 A;  4Q8E A;  2K4I A;  2G5H B;  5AI8 A;  4IRC A;  2QKQ A;  4CRX A;  2ZXI A;  4M0A A;  2UVW A;  2HHS A;  3IRU A;  1ZQX A;  1X9W A;  5EWE A;  4DFD A;  4ED0 A;  5D49 A;  3EW9 A;  1NI3 A;  3OSP A;  3V6K A;  1ZQD A;  2KP7 A;  5ALG A;  2YX8 A;  3NVZ A;  2DGZ A;  3PX6 A;  1L3S A;  2YML A;  3BDP A;  4ECU A;  1NK7 A;  2Q4T A;  5ALO A;  1SKS A;  4B9T A;  4J9M A;  2AGO A;  2P6R A;  8ICL A;  4GC6 A;  4GFJ A;  2EH9 A;  3K4G A;  2XCA A;  2KV2 A;  3V72 A;  4OJ5 A;  3BQ0 A;  2Y9T A;  3C1Y A;  1TE2 A;  3T5H A;  4JV1 A;  1IXR A;  3RB3 A;  5L1J A;  1T94 A;  1Q3V A;  2JH7 A;  1S0N A;  1ZQA A;  2ZG6 A;  5J2K A;  4KLL A;  3D2S A;  2W7O A;  1N63 A;  1SZP A;  5IIO A;  3RAX A;  2NO4 A;  3QYP A;  3LDA A;  4DSE A;  2JV3 A;  1LKY B;  4I2B A;  4IQU A;  7ICG A;  3QZ8 A;  1YT3 A;  3KHH A;  4DLE A;  2YY6 A;  1Z1V A;  3PML A;  3GIM A;  2OWO A;  5AHX A;  3PR5 B;  4ZOH C;  1KW4 A;  1X9X A;  2KVC A;  3WKE A;  4YR0 A;  7ICJ A;  2AGQ A;  3UMC A;  2BZF A;  3D2Q A;  4KLH A;  2DPJ A;  1ARO P;  1N62 A;  5B5E U;  2R8K A;  2HW3 A;  5KFC A;  5KFV A;  4UAZ A;  1JAL A;  4KLJ A;  1X2I A;  4J9Q A;  2GWS A;  4UBB A;  5BOL A;  4DO9 A;  5AM2 A;  2NRX A;  4KLU A;  1ZQP A;  3ETR A;  1XO0 A;  3QX7 A;  2K4E A;  5EE9 A;  4QWA A;  3RH4 A;  1J97 A;  1SL2 A;  1L3U A;  2D6F C;  4F8R A;  3E0F A;  3KZX A;  5ALE A;  2L5Y A;  1L8L A;  4J9N A;  4C8L A;  4GLX A;  2KMD A;  4O3O A;  3PMN A;  1NJW A;  1NK0 A;  3N28 A;  3GIJ A;  5J2J A;  2H3Q A;  5DB7 A;  3TAD A;  2RHF A;  1ZQH A;  2FLP A;  3TI0 A;  2HCF A;  1TFR A;  1RZT A;  1S0M A;  1JMS A;  4I2F A;  1HUO A;  1TKD A;  2KFZ A;  2KIV A;  2BCV A;  1X6J A;  3ZI4 A;  3PW2 A;  2HHV A;  4NM2 A;  3PW5 A;  4HYK A;  4CF4 A;  1SXD A;  3QEA Z;  1V97 A;  3T5J A;  4Y2R A;  3PNC A;  7ICO A;  4IQV A;  3M1Y A;  2MU2 A;  3C2L A;  4IQW A;  2BPF A;  2A1J B;  3KHL A;  4F91 B;  3HX0 A;  3RB4 A;  3PV8 A;  2BDU A;  2LPE A;  1A0P A;  5EWG A;  2DKX A;  1ZQI A;  2VIX A;  5KFU A;  8ICJ A;  3OJS A;  5KG4 A;  4CF3 A;  5CR0 A;  5ALD A;  4NJ8 A;  3JPS A;  3QUQ A;  2V9W A;  1QQ7 A;  8ICX A;  1ED1 A;  3EYZ A;  1WWU A;  3CP8 A;  2F77 X;  3SD7 A;  3NVW A;  2BDP A;  3SR6 A;  4RQ8 A;  4LVS A;  4F4W A;  2PI5 A;  1SWW A;  2Y0S F;  2G06 A;  3FAH A;  8ICO A;  1UHU A;  4F5N A;  1X42 A;  4IRD A;  3C1Z A;  5KFY A;  1NJY A;  5ALY A;  2XGP A;  5ALJ A;  2A1J A;  1T7P A;  2WF9 A;  4IC9 A;  2PXI A;  2B0C A;  4TUR A;  4KMO B;  3V7K A;  4Q8F A;  2G0A A;  3H40 A;  2F44 A;  3HPO A;  3IDW A;  2JZB B;  5KG3 A;  1BPE A;  4P0P B;  3UXO A;  4YMM A;  5EWF A;  1VJ5 A;  3B9J A;  2NRZ A;  4EBC A;  4B9U A;  3NVY A;  3TAC B;  5AI9 A;  4YXM A;  2H3F A;  3WK7 A;  3MGV A;  1QLN A;  1U9L A;  9ICU A;  4KX5 A;  1LB2 B;  4P4O A;  4M6W B;  2DFL A;  4GXI A;  5C0Y A;  4QZE A;  5ALM A;  1XSN A;  1Y88 A;  2UVU A;  4B9N A;  1URJ A;  4NLC A;  4QZ9 A;  5AM5 A;  5AIB A;  4NL9 A;  2DL0 A;  2ATL A;  9ICN A;  4TUQ A;  1L6N A;  3PW0 A;  3ZDB A;  3WK4 A;  2JRZ A;  4PGQ A;  4JMU A;  1UQV A;  4DL6 A;  1B4F A;  5KAF U;  2R8G A;  5AI5 A;  2JMG A;  2EZY A;  2ZUB A;  4RU9 A;  2JZB A;  1DXS A;  4RNN A;  4P0P A;  3MBY A;  1PZN A;  1B0X A;  1XS9 D;  3MC1 A;  1MA7 A;  1B22 A;  2O6K A;  4QWB A;  2H3I A;  3UMG A;  3RB6 A;  5AM0 A;  2I9G A;  2J6T A;  1DGS A;  4BWJ A;  1KFS A;  1RXV A;  1KTQ A;  4B9V A;  4M6W A;  2LYH A;  9ICX A;  5DLF A;  4ED6 A;  2KTQ A;  4J9K A;  3N97 B;  2W54 A;  3RJI A;  2NRW A;  5DQH A;  4M9H A;  3NRZ A;  2PI4 A;  2Y0S C;  1FEZ A;  2C2E A;  3SI8 A;  1S77 D;  3NVV A;  1KL9 A;  2F2A B;  2HMX A;  2ZTC A;  2HHQ A;  2BPG A;  2F1I A;  3QUC A;  1ZRN A;  5KTQ A;  4QZ8 A;  4C80 A;  3MR6 A;  1XC9 A;  3RJH A;  1PVP A;  4KLO A;  4KLT A;  2E8O A;  9ICW A;  7ICP A;  4FBU A;  4O3P A;  3PVX A;  3KHR A;  9ICL A;  5AK6 A;  1CUK A;  4NV0 A;  2HI0 A;  1SGG A;  3SMV A;  2IHN A;  4DSL A;  2G08 A;  2RLT A;  5J0S A;  4QZF A;  5DQI A;  2FMS A;  2ODG A;  4M9L A;  3CYM A;  4Y2J A;  2WF7 A;  4J03 A;  4USA A;  2ASJ A;  3RFA A;  3ZDD A;  2PMZ C;  2RQ5 A;  3WK5 A;  2ZIV A;  4U7C A;  2XY5 A;  2EAM A;  2GOL A;  2JEG A;  2KIW A;  3PO4 A;  8ICK A;  2KJ5 A;  1ZYQ A;  2IOF K;  1TV9 A;  4M9G A;  5CB1 A;  5J0Y A;  5AKZ A;  1Z3E B;  4O3Q A;  1TK5 A;  5L1I A;  3SAG A;  1PUZ A;  5IIK A;  4ED1 A;  2BPC A;  3WU2 U;  4EEY A;  1NK9 A;  2J6U A;  3KOO A;  1JX4 A;  2QLT A;  2E5S A;  2HVH A;  2E8P A;  4DQP A;  4DQI A;  2K60 A;  5ALS A;  1QQ5 A;  4RPZ A;  3N7R C;  1S9F A;  3RJF A;  1FO4 A;  2D8C A;  5AIA A;  2QAR B;  2LBO A;  2E8M A;  1YZ6 A;  3MR5 A;  5DGA A;  1SV0 C;  3IG8 A;  3LVV A;  1JRO A;  4AP9 A;  1S76 D;  4C4T A;  2BQ3 A;  1SV4 A;  5CJ7 A;  2BR0 A;  5KFJ A;  4FZM A;  1NKC A;  5G5H A;  7ICU A;  3BQ7 A;  4C7Y A;  4RPY A;  4PGX A;  1DK3 A;  3GV7 B;  4AYB C;  3C23 A;  4YFK A;  4DQQ A;  4I2D A;  4QZH A;  4DOB A;  4YD2 A;  1RXW A;  2KK0 A;  4OJ6 A;  3I1Y A;  3QU7 A;  2LYA A;  4YR3 A;  8ICZ A;  4EX7 A;  3TFR A;  1NNL A;  5TIS U;  3WKC A;  9ICR A;  5KT6 A;  4G3I A;  3QEB Z;  4R66 A;  3C2M A;  4CDG A;  9ICA A;  3C21 A;  2CN1 A;  5AI6 A;  3F53 A;  2QAR A;  1K5O A;  2JGA A;  2W9B B;  4TQR A;  1SKW A;  3C29 A;  2PFN A;  2B21 A;  2HHW A;  3RR7 A;  3ZDC A;  4I2G A;  3QNM A;  1WCN A;  4JUZ A;  2JXJ A;  5KAI U;  9ICV A;  2K8C B;  4OCZ A;  4EYH B;  4IS7 A;  4PZO A;  2KZ3 A;  1NK6 A;  3RJK A;  1N2X A;  2YMM A;  4Y2T A;  4MEY A;  5C5J A;  4DSF A;  3RAQ A;  2JEI A;  3S6J A;  1L7P A;  2W9C B;  1TK8 A;  1Z1B A;  1N60 A;  4MF2 A;  4TQS A;  2WFA A;  3RH6 A;  5HHH A;  4EEK A;  1L7O A;  4X5V A;  4ELU A;  4RQM A;  2JH1 A;  4UAU A;  5ALU A;  1P7D A;  3H7I A;  2VA2 A;  4JV0 A;  4ED8 A;  1NJZ A;  2JEJ A;  1D8B A;  2W9B A;  5ALK A;  4BGD A;  3MFH A;  9ICE A;  5DG9 A;  3IP4 B;  3OHB A;  1O08 A;  1TK0 A;  4O5K A;  5IIN A;  3L4P A;  1N56 A;  3BQT A;  5ALL A;  4DLG A;  4Y2S A;  2GO7 A;  5CP2 A;  2P6U A;  3LWL A;  1DRG A;  7ICL A;  4EYI B;  3M9N B;  5DB8 A;  4O5E A;  4BUG A;  5BOM A;  8ICI A;  3H8J A;  9ICK A;  4KMU A;  2W9C A;  4DSI A;  4F4Z A;  3GII A;  2R8H A;  4R64 A;  8ICP A;  5J2B A;  1RQN A;  1BPB A;  4KLG A;  1ZQV A;  5IIJ A;  4Y2X A;  3O0F A;  2HVI A;  3GV8 B;  4P2H A;  4KLQ A;  1U49 A;  1IG6 A;  4NWI A;  2QB0 B;  2FLL A;  4RQ2 A;  1ZQW A;  5IIL A;  4NXZ A;  4B9L A;  1KN5 A;  2G5I B;  7ICN A;  2MAX A;  4M47 A;  2WF8 A;  2ZJ5 A;  2CRX A;  2G07 A;  1TAU A;  4O9M A;  4M9N A;  1C20 A;  1NOM A;  4RQ3 A;  4J9S A;  4FFD A;  3BS7 A;  3EWA A;  5DKW A;  1WG8 A;  4I2E A;  5ALZ A;  2AU0 A;  3ISB A;  5KG0 A;  1ZQQ A;  1DK2 A;  1ZQO A;  4EZ9 A;  3AU2 A;  4RZR A;  2FLN A;  2FMP A;  3WK8 A;  4F72 A;  5KFN A;  1CI4 A;  1SZH A;  2YMP A;  4PH5 A;  5DG7 A;  5JU5 A;  4JK1 A;  3AEV A;  2QB0 A;  5HR7 A;  4DL5 A;  4DOC A;  4JB3 A;  1QCK A;  2F8L A;  4UBC A;  1CRX A;  4EBE A;  4NLZ A;  5KFD A;  3IV6 A;  5KFW A;  4F71 A;  4KN7 A;  3KTQ A;  2FPL A;  1L7M A;  5ALF A;  1DGJ A;  4O0I A;  3G6X A;  4PL2 A;  4XUS A;  3PX4 A;  1ZD2 P;  2BQR A;  1ZQR A;  2YB1 A;  4DQS A;  2HBL A;  4GXK A;  2PFP A;  1JIH A;  4YP3 A;  2Z7J A;  4ECY A;  5E79 U;  5EE1 A;  2BCQ A;  1NZB A;  2KZZ A;  1NK8 A;  4RT3 A;  1N5W A;  1KLN A;  2KE7 A;  1XO1 A;  3UQ2 A;  3QUB A;  1KFT A;  3NAS A;  5KFK A;  3N4M B;  5KFA A;  4J9P A;  3E2E A;  3G6Y A;  1N48 A;  3QUT A;  1XWL A;  3GZF A;  4B9M A;  1U48 A;  2EQY A;  3CRX A;  3PST A;  4UAW A;  3Q8Q B;  1FIQ A;  4B9S A;  2KD1 A;  1ZJN A;  4IRK A;  1XSP A;  4RQ6 A;  3ED5 A;  9ICP A;  2JEF A;  1RQL A;  5AKY A;  2WAQ F;  1K1Q A;  1OUQ A;  1BPD A;  1XU4 A;  2KHQ A;  3KZI U;  3R9K A;  5DBB A;  4C4S A;  3GV5 B;  1NZP A;  4YR2 A;  2M0N A;  2RDJ A;  4I2I A;  2WF6 A;  3V6H A;  1ZD4 A;  4RQ7 A;  3M8S A;  3EPG A;  4R8U B;  3DV9 A;  3JPQ A;  1ZQM A;  5ALW A;  4ECS A;  2IMW P;  2C2R A;  1F5S A;  3M9M B;  9ICO A;  4C0Z A;  2VJ5 A;  3THV A;  4OJL A;  3A0B U;  3HIL A;  1N5X A;  5AM4 A;  1UPH A;  2OYY A;  3QU4 A;  4XQ8 A;  2IOF A;  4UQG A;  5B66 U;  4PHE A;  5J2E A;  3TAQ A;  1U45 A;  5AI0 A;  3ZD9 A;  1BPY A;  2DQN B;  3SEI A;  5III A;  4F5O A;  4C8O A;  5AKE A;  1A6S A;  1WYG A;  1ZRM A;  5KFT A;  3H4D A;  5AKX A;  1X66 A;  1L8O A;  2KFN A;  3ALR A;  3UQ0 A;  5DB9 A;  4XRH A;  1V85 A;  5KFO A;  5K4L A;  5J0U A;  1ZQF A;  1S5L U;  2W7P A;  4UB4 A;  4I28 A;  1SV0 A;  5ALN A;  1NKB A;  2BCR A;  3AU6 A;  1YZ7 A;  1KRP A;  4UB3 A;  4R8U A;  3AQF A;  2H5X A;  4I27 A;  3FDS A;  4BDP A;  3Q8M A;  1QSS A;  4KX3 A;  4QZA A;  2VJ4 A;  5F9L A;  2CXY A;  5AM1 A;  5AK3 A;  2DPI A;  2ZIX B;  3PW4 A;  4J9L A;  4P0Q A;  2XGQ A;  2W55 A;  1FFV A;  5EE3 A;  2CPR A;  4B6J A;  4ELT A;  4QIW F;  4MFA A;  1PK1 B;  3TFS A;  7ICE A;  3RB0 A;  3GFK B;  4JWN A;  4F5Q A;  3QU5 A;  3CNH A;  1JRP A;  4BX9 C;  4KLS A;  3JPO A;  1BGX T;  5A0L A;  3AQE A;  3LYS A;  5L1K A;  1QTM A;  3IHQ B;  3SEN A;  2W8K A;  1K1S A;  5AM3 A;  2AJQ A;  5ALT A;  3F5A A;  4ED2 A;  3KKA C;  3OGU A;  9ICS A;  5F3X B;  5CA7 A;  4F3O A;  2W3R A;  1KKX A;  2DKZ A;  3GIK A;  4UW9 A;  4ELV A;  2HBJ A;  2XI9 A;  2DBY A;  4K4G A;  4KTQ A;  1L3V A;  3SYZ A;  2ZIV B;  2ZIU B;  4ECT A;  1HIW A;  1O03 A;  2FJ6 A;  2ZIX A;  4UB6 U;  5D4B A;  1ZJM A;  3H4B A;  4QZC A;  1VDV A;  4I2A A;  5HHI A;  5KFS A;  1TAM A;  4QZG A;  1PK1 A;  4C7Z A;  3KHG A;  3T3F A;  4I29 A;  3ISD A;  3UXP A;  2W03 A;  7ICH A;  9ICJ A;  5AKG A;  2EAP A;  5HML A;  2MUT B;  1ZD3 A;  4DL2 A;  2XY7 A;  2K4P A;  3M6Z A;  2FDR A;  4ECV A;  4QW9 A;  4DFP A;  3IG5 A;  1H38 A;  2WHE A;  4UAR A;  4CF5 A;  5AI4 A;  2V4Q A;  4UAY A;  1KQQ A;  2RDI A;  4F2S A;  2PFO A;  4CCH A;  2R8J A;  3F5E A;  4G9B A;  2ISP A;  5HP4 A;  1KEJ A;  4BXO B;  4K4I A;  8ICG A;  2ZIU A;  1LV5 A;  4ED7 A;  1U4B A;  3IM1 A;  3PZP A;  3GU3 A;  1ZQB A;  2C28 A;  1ECW A;  4O3R A;  3BQ2 A;  4RT2 A;  4JV2 A;  4PPX A;  9ICF A;  2B6G A;  2KSO B;  4Q44 A;  4ECQ A;  2F8K A;  2MUT A;  4ECX A;  1PK3 A;  1OXJ A;  4YD1 A;  1Q8K A;  1IIP A;  4KLM A;  3K1Z A;  7ICR A;  3NRW A;  1N61 A;  7ICF A;  2OM6 A;  1T3Q A;  4WJ3 B;  4RQ0 A;  1BNO A;  3QU2 A;  4UB2 A;  3I28 A;  5T14 A;  3M7D A;  4FS1 A;  4UB8 U;  2AQ0 A;  5ALX A;  4EBD A;  3RRG A;  4DS5 A;  2DUY A;  5DGB A;  2KKP A;  4KN4 A;  3L3F X;  2Y1J A;  5TZV A;  4BXO A;  2P66 A;  2AXT U;  3WK9 A;  5JUM A;  5J0O A;  2IOH A;  2R8I A;  1ZQU A;  4PZN A;  2KZM A;  3TAN A;  1NK4 A;  8ICT A;  3MGI A;  3F2C A;  2RP5 A;  1ZQE A;  9ICI A;  4KLI A;  4YMN A;  2LM1 A;  2KSO A;  1L7N A;  2I5H A;  1UA1 A;  3JPN A;  5KFQ A;  3EPI A;  2ZIW B;  5ALH A;  3F2B A;  3MAB A;  1M6Y A;  2KJ9 A;  2XY6 A;  4PHD A;  4ACO A;  3B0Y A;  1RYR A;  2VA3 A;  3G6V A;  8ICQ A;  2W9M A;  4KLE A;  4XA5 A;  8ICV A;  3MDA A;  3PW7 A;  4I2H A;  5KL8 B;  2RRD A;  4I2C A;  9ICG A;  4K4H A;  3SV4 A;  2MA1 A;  2E1E A;  3N7S C;  1D9D A;  1T4G A;  3RRH A;  1S97 A;  5DLG A;  5KFI A;  1JN3 A;  3DEE A;  4EEN A;  4BWM A;  2V4R A;  3JPT A;  1S10 A;  1S0V A;  1SB3 C;  2LKY A;  1MN8 A;  2LHT A;  4FBT A;  2ZIW A;  2EAO A;  1ZQZ A;  4QWC A;  2UVR A;  2XO7 A;  2ASD A;  4CNQ A;  5KT4 A;  2ZJ8 A;  4QZI A;  1BPZ A;  1J2N A;  2FPK A;  4ECZ A;  5G5G A;  3LVW A;  5AKJ A;  1PVR A;  3B0X A;  2M9N A;  3K1R B;  1ZOL A;  3Q8L A;  2KOB A;  2OH2 A;  4BJQ A;  3SAH A;  1ZQS A;  2IHM A;  3OTQ A;  4DOA A;  2IBK A;  3MGH A;  1ZQN A;  4RQN A;  5HNK A;  1C7Y A;  5KG5 A;  2OCE A;  2J6S A;  1X6I A;  4F5R A;  1Z00 B;  2EDU A;  3H0R B;  8ICW A;  4YVZ A;  4KLD A;  1COK A;  4ICA A;  4YMO A;  4J9R A;  2HHU A;  2HOF A;  1HEK A;  5F9N A;  5AK5 A;  4US9 A;  3NTU A;  2ISO A;  5J0W A;  1D8Y A;  3VCB A;  8ICU A;  4ED3 A;  2HDO A;  1ZQ1 C;  1D8L A;  3WKA A;  3RH5 A;  4NM1 A;  5J0R A;  2MSN A;  5KG7 A;  2YMQ A;  5J2A A;  1WUD A;  4UB1 A;  3PR4 A;  4DF8 A;  2EAN A;  3T79 A;  4DCC A;  2HOI A;  2ZUC A;  1BVS A;  3J81 j;  4QZB A;  5ALP A;  4UAS A;  4DFJ A;  4RQ5 A;  2NV3 A;  4IR1 A;  3MDC A;  3KD3 A;  2HOQ A;  3OJU A;  1Z00 A;  3IN5 A;  5J2H A;  2UVV A;  4QZD A;  2YB4 A;  2YN4 A;  2N1R A;  5KT3 A;  3TKA A;  1T3N A;  4JWM A;  1V38 A;  2I1Q A;  3JPR A;  1RPL A;  4PL1 A;  5KNI A;  1ZQC A;  4IR9 A;  5J8Y C;  1JXL A;  5J2I A;  1WCL A;  4Q45 A;  3JPP A;  2D3D A;  3V6J A;  3EZ5 A;  4I2J A;  3PSI A;  9ICB A;  3MR2 A;  1UT8 A;  8ICS A;  4F4X A;  4IQT A;  1RYS A;  3AM9 A;  3ORY A;  1Q3U A;  2HBM A;  9ICH A;  4FZL A;  5CRX A;  3AUO A;  3UMB A;  5L1M A;  3RJG A;  4DL3 A;  2AGP A;  4QWE A;  3PSP A;  5KG1 A;  3BZK A;  2OXO A;  5EE0 A;  1RM6 C;  1LKY A;  1S0O A;  4LZD A;  5L9X A;  4QNL A;  3MR3 A;  3KKA A;  2ZTD A;  2OEH A;  3H8S A;  1HJP A;  1BNP A;  9ICM A;  1U47 A;  3SQI A;  9ICQ A;  4O3N A;  2AHO B;  7ICI A;  2HHX A;  4GXJ A;  4DEZ A;  2KIC A;  1KBU A;  2KEY A;  3K75 D;  4J9O A;  1ZQL A;  1L3T A;  5AKH A;  4KLF A;  3DDH A;  3FC4 A;  4EZ6 A;  2DWQ A;  5KFP A;  3OHA A;  3D6J A;  1RG6 A;  3HW8 A;  2ALZ A;  1HUZ A;  1VLB A;  3BS5 B;  2HSZ A;  1A77 A;  3H0L B;  2C2D A;  3TQ1 A;  2GH1 A;  5KFF A;  4M2Y A;  5ALR A;  1IV8 A;  1NJX A;  2A19 A;  4QJF B;  4O5C A;  2F3N A;  2YTU A;  3HWT A;  1ZQJ A;  5DDY A;  5DQG A;  2Y9U A;  4RNM A;  7ICV A;  1QSL A;  2K4H A;  2XID A;  3C5G A;  1IM4 A;  3HP6 A;  1MSW D;  2NRT A;  4Y2Y A;  1LVH A;  3QU9 A;  5KT5 A;  3WKD A;  2G09 A;  2A3V A;  3ICX A;  4KIT B;  4NLN A;  3UPQ A;  8ICA A;  3F2D A;  3N7P D;  2WF5 A;  4Z6E A;  4PGY A;  5KFR A;  4MHV A;  5EOZ A;  3GQC A;  4O3M A;  1ZQK A;  1OW5 A;  5ALV A;  4DS4 A;  4YQW A;  3RBE A;  2K89 A;  4TUS A;  3HT3 A;  4FE3 A;  4YXJ A;  5J2D A;  4M04 A;  4RUC A;  4F5P A;  4DL7 A;  3LWM A;  3BS5 A;  2EZX A;  5AKI A;  3SV3 A;  3ETL A;  4P0Q B;  5DBC A;  4EEL A;  4UAV A;  4C8N A;  7ICT A;  3UM9 A;  3WKB A;  4MEX A;  2ESE A;  4QW8 A;  9ICC A;  7ICK A;  2W43 A;  5L1L A;  3RBD A;  2FE9 A;  4FS2 A;  3KBB A;  8ICN A;  3V7J A;  3C5F A;  3HKZ F;  1SWV A;  3ZDA A;  4RQ1 A;  3T5K A;  3RTV A;  2XC9 A;  1TVA A;  4P4M A;  5J2F A;  4OO1 J;  3RJE A;  4DSK A;  3BZC A;  4LJX A;  5J2C A;  1KFD A;  4YN4 A;  7ICM A;  2WTF A;  4DF4 A;  4Z6D A;  1UCV A;  4DFK A;  4UAT A;  1GO3 F;  3BQ1 A;  3ISC A;  2A1A A;  5KG6 A;  5ALI A;  5J29 A;  2BQU A;  1Q46 A;  1FFU A;  1DOQ A;  5GTH U;  1MC8 A;  5ALQ A;  1WWV A;  2AQ4 A;  2PMZ F;  1Z4O A;  3U26 A;  1RYU A;  2Y1I A;  1SL0 A;  2PFQ A;  2WAQ C;  1ZXI A;  4Y2P A;  4Z6C A;  5KFB A;  4DQR A;  1KDH A;  2IA6 A;  2BCU A;  2ZXH A;  3E58 A;  1A76 A;  2EZZ A;  4F2R A;  5J0Q A;  4MF8 A;  5KFZ A;  5KFE A;  3Q8S B;  2HHT A;  2ZUD A;  3UXN A;  3GDX A;  3HRD D;  8ICM A;  2BCS A;  2KHV A;  3C28 A;  2FPM A;  3TAD C;  3QZ7 A;  7ICS A;  1XNS A;  1ZQG A;  3I76 A;  2W04 A;  3RR8 A;  3LK9 A;  2P35 A;  1NK5 A;  8ICR A;  2FI1 A;  2VA8 A;  3WK6 A;  2H3V A;  2F1H A;  2LMR A;  2WB1 F;  2K8B B;  4OJP A;  5FP0 A;  3FYH A;  5AKK A;  4E0D A;  3L5K A;  2NYV A;  2R18 A;  2KG5 A;  5DG8 A;  5J0T A;  3PY8 A;  1F0M A;  3QE9 Y;  1BPX A;  1SIJ A;  2QB1 A;  3HKZ C;  4F4Y A;  1ZQT A;  5DBA A;  5D46 A;  5KL1 B;  2YQE A;  2NO5 A;  4AYB F;  3TAR A;  1PVQ A;  5J0X A;  3PX0 A;  4NLK A;  2HBK A;  3VC8 A;  5KFH A;  3H8M A;  5H2F U;  8ICH A;  1ZD5 A;  1UA0 A;  2JR5 A;  4ZH4 A;  4NLB A;  1COO A;  2E1F A;  3TAP A;  2DF4 B;  4MFC A;  4CGZ A;  4R65 A;  2W11 A;  3OPX A;  4FZN A;  8ICY A;  4Q43 A;  3RJJ A;  2W9A A;  3T5L A;  4Y2Q A;  4DFM A;  3M8R A;  5GTI U;  4RQ4 A;  2VKQ A;  2LYB A;  4RUA A;  3NS1 A;  3AN1 A;  5HR6 A;  4YCX A;  5DDM A;  2I6X A;  4QIW C;  4ECR A;  2LM4 A;  4EX6 A;  4NY8 A;  3RF9 A;  1UT5 A;  1B43 A;  4US8 A;  4TUP A;  4GC7 A;  3NUQ A;  3C2K A;  1JXE A;  4NLG A;  1QSY A;  3HJE A;  3ONN A;  4F50 A;  2VAN A;  2NRV A;  2ZJA A;  1T8E A;  1SL1 A;  3GIL A;  4CE6 A;  3EUB 2;  4O3S A;  4Z6F A;  1F44 A;  4F93 B;  1SKR A;  3FM9 A;  4RNO A;  4OJO A;  3H0M B;  5CHG A; 
#chains in the Genus database with same CATH homology
 5KG5 A;  2J6S A;  1KLN A;  3UQ2 A;  1XO1 A;  3ZDE A;  1NKE A;  1KFT A;  4PGQ A;  4F5R A;  1Z00 B;  2FMQ A;  4DL6 A;  8ICW A;  5KFK A;  4YVZ A;  2R8G A;  4KLD A;  3N4M B;  4LZG A;  4YMO A;  5KFA A;  5KFM A;  4UB5 A;  4J9R A;  4J9P A;  3MFI A;  3G6Y A;  1V9P A;  3E2E A;  2HHU A;  2ZUB A;  4RU9 A;  5F9N A;  2JZB A;  1N48 A;  8ICE A;  4RNN A;  1XWL A;  5IIM A;  3NTU A;  3MBY A;  1PZN A;  2ISO A;  4B9M A;  5J0W A;  2C22 A;  1U48 A;  1XS9 D;  1D8Y A;  4PHA A;  1B22 A;  4QWB A;  8ICU A;  5J0P A;  4ED3 A;  3RB6 A;  1D8L A;  3RH5 A;  2I9G A;  4UAW A;  2J6T A;  4NM1 A;  1DGS A;  5KT2 A;  5KFL A;  5J0R A;  3Q8Q B;  4BWJ A;  5KG7 A;  1RXV A;  1KFS A;  1KTQ A;  5J2A A;  4B9S A;  4M6W A;  3OSN A;  2LYH A;  4DL4 A;  5DLF A;  4B9V A;  9ICX A;  1ZJN A;  4IRK A;  2XCP A;  4ED6 A;  8ICF A;  2KTQ A;  4J9K A;  5CWR A;  1XSP A;  4RQ6 A;  1CEZ A;  4UB1 A;  2BKE A;  3N97 B;  3PR4 A;  2JEF A;  9ICP A;  3RJI A;  2NRW A;  5DQH A;  4FO6 A;  4DF8 A;  4M9H A;  4C8M A;  1D9F A;  2PI4 A;  4F4K A;  1K1Q A;  4RPX A;  1BPD A;  1XU4 A;  3NGD A;  5J2G A;  2ZUC A;  1BVS A;  1EXN A;  4QZB A;  5DBB A;  2C2E A;  1X9S A;  3GV5 B;  4YR2 A;  2RDJ A;  4DFJ A;  3SI8 A;  1S77 D;  4I2I A;  4M9J A;  4RQ5 A;  2ASL A;  4PHP A;  2ZTC A;  4IR1 A;  3V6H A;  2HHQ A;  3MDC A;  4DWI A;  2BPG A;  2Q0Z X;  1KSP A;  4RQ7 A;  3H8W A;  3OJU A;  3M8S A;  3EPG A;  4R8U B;  2F1I A;  7ICQ A;  3JPQ A;  3Q8R B;  1Z00 A;  1ZQM A;  5J2H A;  2UVV A;  4YG2 A;  4QZD A;  3M9O B;  4ECS A;  2IMW P;  3ZD8 A;  2C2R A;  5KTQ A;  4QZ8 A;  5KT3 A;  3PO5 A;  3M9M B;  1T3N A;  5HMM A;  2W8L A;  8ICC A;  3MR6 A;  1XC9 A;  4JWM A;  9ICO A;  3BJY A;  3RJH A;  3THV A;  4KLO A;  4KLT A;  2I1Q A;  3JPR A;  9ICW A;  1RPL A;  5KG2 A;  7ICP A;  2F1J A;  5BPC A;  1ZQC A;  4IR9 A;  4FBU A;  4O3P A;  3PVX A;  5J2I A;  3KHR A;  1WCL A;  1XSL A;  1JXL A;  9ICL A;  4Q45 A;  3JPP A;  1CUK A;  4XQ8 A;  4R63 A;  4UQG A;  3V6J A;  4PHE A;  3EZ5 A;  4I2J A;  2ZTE A;  1X9M A;  1C7Y A;  5J2E A;  9ICB A;  3MR2 A;  3TAQ A;  1UT8 A;  8ICS A;  4F4X A;  2BGW A;  2IHN A;  1TAQ A;  3Q8K A;  1U45 A;  4IQT A;  4DSL A;  4QZF A;  5J0S A;  5DQI A;  1RYS A;  3ORY A;  3ZD9 A;  5DB6 A;  1BPY A;  2FMS A;  4M9L A;  4MFF A;  5III A;  1L5U A;  5KT7 A;  2ASJ A;  9ICH A;  4F5O A;  4C8O A;  3AUO A;  4QWD A;  2KN7 A;  5KFT A;  3Q8P B;  3H4D A;  3V7L A;  3RJG A;  3ZDD A;  4DL3 A;  2AGP A;  4QWE A;  4F92 B;  2KFN A;  5DB9 A;  2BHN A;  3UQ0 A;  4ECW A;  4XRH A;  5KG1 A;  2XY5 A;  8ICB A;  2JEG A;  5KFO A;  3PO4 A;  5J0U A;  1ZQF A;  4UB4 A;  4I28 A;  4P4P A;  8ICK A;  4C8K A;  1ZYQ A;  9ICT A;  1NKB A;  2BCR A;  4DSJ A;  3AU6 A;  1ZQY A;  1KRP A;  1TV9 A;  1S0O A;  4LZD A;  5L9X A;  4UB3 A;  4R8U A;  5KFX A;  1MQ2 A;  2H5X A;  3MR3 A;  4I27 A;  5KFG A;  1MQ3 A;  3FDS A;  2ZTD A;  4BDP A;  4M9G A;  5CB1 A;  3Q8M A;  3H8S A;  1ZET A;  5J0Y A;  1QSS A;  4QZA A;  1HJP A;  1Z3E B;  5F9L A;  9ICM A;  1U47 A;  9ICQ A;  4O3N A;  3SZ2 A;  4O3Q A;  7ICI A;  1TK5 A;  4Q8E A;  2HHX A;  4DEZ A;  5L1I A;  4GXJ A;  2DPI A;  4IRC A;  3PW4 A;  5IIK A;  3K75 D;  4J9O A;  4J9L A;  2XGQ A;  1L3T A;  1ZQL A;  4ED1 A;  2UVW A;  4M0A A;  4KLF A;  2HHS A;  1ZQX A;  2BPC A;  4EEY A;  1NK9 A;  2J6U A;  1X9W A;  5EWE A;  1JX4 A;  4ELT A;  4ED0 A;  4EZ6 A;  5D49 A;  5KFP A;  3EW9 A;  3OHA A;  2HVH A;  4MFA A;  3OSP A;  4DQP A;  3V6K A;  4DQI A;  3HW8 A;  1ZQD A;  3TFS A;  7ICE A;  4RPZ A;  2ALZ A;  3RB0 A;  1HUZ A;  3GFK B;  4JWN A;  4F5Q A;  3PX6 A;  1S9F A;  3RJF A;  1L3S A;  3BDP A;  1A77 A;  4ECU A;  1NK7 A;  4KLS A;  3JPO A;  2C2D A;  4B9T A;  3TQ1 A;  1SKS A;  1BGX T;  5KFF A;  4M2Y A;  3MR5 A;  5L1K A;  4J9M A;  2AGO A;  1QTM A;  5DGA A;  3IHQ B;  2W8K A;  1K1S A;  1NJX A;  2AJQ A;  2P6R A;  8ICL A;  4GC6 A;  1S76 D;  4O5C A;  3K4G A;  2XCA A;  3HWT A;  4ED2 A;  2BQ3 A;  1ZQJ A;  5CJ7 A;  3OGU A;  5DDY A;  5DQG A;  3BQ0 A;  3V72 A;  2BR0 A;  5KFJ A;  9ICS A;  3C1Y A;  4RNM A;  1QSL A;  7ICV A;  5CA7 A;  1NKC A;  4F3O A;  7ICU A;  3T5H A;  3GIK A;  3C5G A;  1IM4 A;  3HP6 A;  4JV1 A;  4ELV A;  1IXR A;  4RPY A;  2NRT A;  4PGX A;  5L1J A;  3RB3 A;  1MSW D;  3GV7 B;  3C23 A;  5KT5 A;  4YFK A;  4DQQ A;  4I2D A;  4K4G A;  1S0N A;  1ZQA A;  4QZH A;  5J2K A;  4DOB A;  4KTQ A;  4KLL A;  1L3V A;  4KIT B;  4NLN A;  3SYZ A;  1SZP A;  3UPQ A;  8ICA A;  4YD2 A;  4ECT A;  1RXW A;  5IIO A;  3RAX A;  4DSE A;  3LDA A;  4Z6E A;  5D4B A;  1ZJM A;  4PGY A;  4I2B A;  4YR3 A;  4IQU A;  5KFR A;  5EOZ A;  3H4B A;  8ICZ A;  3GQC A;  1ZQK A;  4QZC A;  7ICG A;  3QZ8 A;  4DS4 A;  3KHH A;  4DLE A;  4YQW A;  4I2A A;  5HHI A;  3RBE A;  4TUS A;  3TFR A;  5KFS A;  4QZG A;  3PML A;  3GIM A;  3HT3 A;  2OWO A;  3KHG A;  3T3F A;  4I29 A;  3ISD A;  4YXJ A;  5KT6 A;  9ICR A;  3UXP A;  5J2D A;  4M04 A;  4RUC A;  4F5P A;  4DL7 A;  7ICH A;  3LWM A;  4G3I A;  9ICJ A;  3QEB Z;  4R66 A;  3PR5 B;  5HML A;  3C2M A;  2MUT B;  3C21 A;  9ICA A;  3SV3 A;  4YR0 A;  3ETL A;  7ICJ A;  2AGQ A;  5DBC A;  4DL2 A;  2XY7 A;  4KLH A;  4C8N A;  2W9B B;  4TQR A;  7ICT A;  1SKW A;  2DPJ A;  4MEX A;  1ARO P;  2B21 A;  2PFN A;  4QW8 A;  2HHW A;  9ICC A;  7ICK A;  5L1L A;  2R8K A;  3RR7 A;  2HW3 A;  5KFC A;  3ZDC A;  3RBD A;  4I2G A;  4FS2 A;  4ECV A;  5KFV A;  1WCN A;  4JUZ A;  4QW9 A;  4UAZ A;  4DFP A;  1H38 A;  9ICV A;  4KLJ A;  1X2I A;  4EYH B;  1NK8 A;  4J9Q A;  2GWS A;  2KZ3 A;  2V4Q A;  4UAY A;  4UBB A;  5BOL A;  4DO9 A;  1NK6 A;  8ICN A;  2RDI A;  4F2S A;  2PFO A;  3V7J A;  4CCH A;  2R8J A;  2NRX A;  3C5F A;  4KLU A;  3RJK A;  4MEY A;  2ISP A;  5C5J A;  1ZQP A;  4DSF A;  1KEJ A;  5HP4 A;  4BXO B;  3RAQ A;  4K4I A;  3ZDA A;  4RQ1 A;  8ICG A;  4QWA A;  3T5K A;  2JEI A;  3RTV A;  3RH4 A;  2XC9 A;  1LV5 A;  4ED7 A;  1U4B A;  1SL2 A;  1L3U A;  2W9C B;  1TVA A;  3IM1 A;  4F8R A;  4P4M A;  5J2F A;  1TK8 A;  1ZQB A;  4MF2 A;  4TQS A;  2C28 A;  3RJE A;  3RH6 A;  4DSK A;  5HHH A;  4O3R A;  4J9N A;  3BQ2 A;  4C8L A;  5J2C A;  4GLX A;  4RT2 A;  1KFD A;  4X5V A;  4O3O A;  4ELU A;  3PMN A;  1NJW A;  4YN4 A;  1NK0 A;  4JV2 A;  7ICM A;  2WTF A;  4PPX A;  4DF4 A;  3GIJ A;  9ICF A;  4Z6D A;  3H7I A;  5J2J A;  4DFK A;  4Q44 A;  4ECQ A;  2MUT A;  4ECX A;  2VA2 A;  4JV0 A;  4ED8 A;  4YD1 A;  5DB7 A;  3BQ1 A;  1NJZ A;  2JEJ A;  3ISC A;  4KLM A;  7ICR A;  2W9B A;  1ZQH A;  5KG6 A;  2FLP A;  4BGD A;  5J29 A;  2BQU A;  3TI0 A;  7ICF A;  1DOQ A;  4RQ0 A;  1TFR A;  3MFH A;  9ICE A;  1MC8 A;  1RZT A;  5DG9 A;  1S0M A;  1JMS A;  4UB2 A;  4I2F A;  1HUO A;  3OHB A;  4FS1 A;  2AQ4 A;  1TK0 A;  1TKD A;  4O5K A;  2AQ0 A;  2KFZ A;  2BCV A;  5IIN A;  2Y1I A;  1SL0 A;  4EBD A;  2PFQ A;  1N56 A;  3RRG A;  4DS5 A;  4DQR A;  4Z6C A;  3BQT A;  5KFB A;  5DGB A;  1KDH A;  2IA6 A;  3PW2 A;  2HHV A;  4KN4 A;  2BCU A;  4DLG A;  7ICL A;  5CP2 A;  1A76 A;  2P6U A;  3LWL A;  2Y1J A;  5TZV A;  4EYI B;  4BXO A;  3M9N B;  4NM2 A;  2P66 A;  5DB8 A;  4O5E A;  4F2R A;  3PW5 A;  4HYK A;  5J0Q A;  5BOM A;  8ICI A;  5JUM A;  3H8J A;  9ICK A;  4KMU A;  5J0O A;  4MF8 A;  2W9C A;  5KFZ A;  3QEA Z;  3T5J A;  4DSI A;  3PNC A;  2R8I A;  5KFE A;  3Q8S B;  2HHT A;  1ZQU A;  2ZUD A;  4F4Z A;  4IQV A;  2KZM A;  3GII A;  2R8H A;  3TAN A;  1NK4 A;  7ICO A;  3C2L A;  3UXN A;  4IQW A;  3GDX A;  4R64 A;  8ICP A;  5J2B A;  2A1J B;  1BPB A;  3KHL A;  2BPF A;  8ICT A;  3MGI A;  4KLG A;  4F91 B;  8ICM A;  1ZQV A;  2BCS A;  5IIJ A;  1ZQE A;  9ICI A;  4KLI A;  3GV8 B;  4YMN A;  2HVI A;  4P2H A;  2FPM A;  3QZ7 A;  4KLQ A;  1U49 A;  7ICS A;  3HX0 A;  1ZQG A;  3RB4 A;  3PV8 A;  3RR8 A;  3LK9 A;  1NK5 A;  8ICR A;  5EWG A;  1ZQI A;  5KFU A;  1UA1 A;  2VA8 A;  2FLL A;  8ICJ A;  4RQ2 A;  3JPN A;  5KFQ A;  3OJS A;  5KG4 A;  1ZQW A;  5IIL A;  2F1H A;  4NXZ A;  3EPI A;  4B9L A;  5CR0 A;  3MAB A;  7ICN A;  2MAX A;  3JPS A;  4M47 A;  2ZJ5 A;  2V9W A;  3FYH A;  2XY6 A;  8ICX A;  4PHD A;  4E0D A;  3EYZ A;  1TAU A;  5DG8 A;  5J0T A;  3PY8 A;  3QE9 Y;  3B0Y A;  1BPX A;  4O9M A;  1RYR A;  4M9N A;  2VA3 A;  4F4Y A;  1NOM A;  1ZQT A;  4RQ3 A;  3G6V A;  5DBA A;  5D46 A;  8ICQ A;  4J9S A;  2BDP A;  4RQ8 A;  4LVS A;  4F4W A;  3TAR A;  2PI5 A;  5J0X A;  3EWA A;  3PX0 A;  4NLK A;  2W9M A;  5DKW A;  4KLE A;  4I2E A;  8ICO A;  4XA5 A;  2AU0 A;  4F5N A;  5KFH A;  8ICV A;  3MDA A;  3ISB A;  3PW7 A;  5KG0 A;  4IRD A;  1ZQQ A;  3C1Z A;  8ICH A;  5KFY A;  1ZQO A;  1NJY A;  4EZ9 A;  1UA0 A;  4I2H A;  2XGP A;  1T7P A;  2A1J A;  3AU2 A;  4I2C A;  4RZR A;  9ICG A;  4K4H A;  4ZH4 A;  3SV4 A;  2FLN A;  2FMP A;  1COO A;  3TAP A;  5KFN A;  2PXI A;  4MFC A;  4TUR A;  1D9D A;  4R65 A;  1T4G A;  8ICY A;  3RRH A;  3V7K A;  4PH5 A;  4Q43 A;  1S97 A;  4Q8F A;  3H40 A;  5DLG A;  2W9A A;  5DG7 A;  3HPO A;  3T5L A;  5KFI A;  1JN3 A;  3RJJ A;  4JK1 A;  4BWM A;  2V4R A;  3JPT A;  3M8R A;  4DFM A;  1S10 A;  1S0V A;  4RQ4 A;  2JZB B;  5KG3 A;  1BPE A;  4DL5 A;  4RUA A;  3UXO A;  4DOC A;  4YMM A;  5EWF A;  4YCX A;  2NRZ A;  4FBT A;  5DDM A;  4ECR A;  4QWC A;  1ZQZ A;  4EBC A;  2UVR A;  2XO7 A;  2ASD A;  4UBC A;  4B9U A;  4EBE A;  4NY8 A;  4NLZ A;  4YXM A;  1QLN A;  5KFD A;  1UT5 A;  5KT4 A;  1U9L A;  9ICU A;  5KFW A;  1B43 A;  2ZJ8 A;  4QZI A;  1BPZ A;  4KN7 A;  1LB2 B;  2FPK A;  4M6W B;  4P4O A;  4TUP A;  2DFL A;  4GC7 A;  3KTQ A;  2FPL A;  3C2K A;  4ECZ A;  1JXE A;  4NLG A;  1QSY A;  4O0I A;  3G6X A;  4GXI A;  4F50 A;  2VAN A;  4XUS A;  2NRV A;  2ZJA A;  3PX4 A;  4QZE A;  1T8E A;  2BQR A;  3B0X A;  1Y88 A;  2M9N A;  3GIL A;  1XSN A;  3Q8L A;  1SL1 A;  1ZQR A;  4QZ9 A;  2UVU A;  4DQS A;  4Z6F A;  4B9N A;  4O3S A;  4GXK A;  2PFP A;  1JIH A;  4YP3 A;  4ECY A;  1ZQS A;  4F93 B;  1SKR A;  2IHM A;  4DOA A;  2ATL A;  2IBK A;  4RNO A;  9ICN A;  2BCQ A;  3MGH A;  4TUQ A;  1ZQN A;  2KZZ A;  3PW0 A;  3ZDB A;  5HNK A;  4RT3 A;  5CHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...