2JZBB

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbB01
4DOBA 4F93B 5J2AA 5KG0A 4I27A 4J9NA 4GXKA 4O5CA 8ICLA 5C5JA 4RT3A 8ICPA 4ECWA 3PR5B 4NLNA 4F5PA 4EBCA 1N56A 4F5QA 4RNOA 4XA5A 4IR1A 4DO9A 4DL3A 3ZDAA 4TUPA 1MSWD 5IIMA 4YMOA 4MEYA 9ICEA 5KFRA 3H8WA 5KTQA 1KDHA 4M47A 1T4GA 3GIJA 9ICMA 1L3SA 2RDIA 1V9PA 3EWAA 2W8LA 4DFPA 4I2IA 5KFHA 1ZQNA 2HHVA 8ICOA 2BGWA 5D49A 5KFWA 2Q0ZX 4RT2A 4ED7A 5D4BA 2PI5A 4RQ4A 4F5RA 2HHSA 1UT5A 1UT8A 1U9LA 4IR9A 4F5OA 5DDMA 4J9SA 4DQIA 2BCSA 5HMLA 1CUKA 3JPTA 1JXEA 2KZ3A 5KFTA 4NLZA 3RAXA 9ICXA 2FPMA 3ZDEA 3HT3A 1Z00A 5J2DA 3JPSA 4JUZA 4MFFA 8ICNA 2W9MA 4KLEA 1BGXT 8ICHA 2ASDA 8ICIA 4DSKA 1U4BA 5DBAA 5KFEA 1XC9A 5BPCA 4ED8A 7ICEA 1S10A 1ZQIA 5KG3A 4RQ7A 3THVA 1ZQLA 5DB8A 3C5FA 2C22A 1KSPA 2ALZA 4MFAA 4DF4A 5IIIA 5KFJA 5IINA 4O3NA 3PVXA 3RB3A 1HUOA 3RBDA 3C21A 3RAQA 3UQ0A 3KHGA 4LZGA 5DLGA 7ICKA 4TQSA 1T8EA 5J2BA 3RJIA 2R8KA 1BPYA 5CA7A 5KFPA 3BQ0A 5L1LA 4B9SA 1JN3A 3V6JA 4BGDA 1NK5A 8ICAA 5IIOA 1XSPA 4JV2A 1SKSA 3T5LA 2Y1JA 2C2RA 2B21A 5KFIA 4XRHA 4KLGA 3HWTA 4Z6FA 3PX6A 2ZUDA 5BOMA 1SL0A 4KLFA 3QE9Y 8ICVA 5DB9A 4M9JA 4QWDA 1C7YA 4ECZA 2WTFA 3TARA 4ED6A 2ZTCA 1H38A 1LV5A 2VA2A 3ZD9A 4QZGA 5DG7A 2AGOA 3C23A 2BPCA 4Q43A 3HP6A 3PY8A 4FBUA 4PHDA 5KFVA 3T5JA 2KFNA 1A76A 4ED1A 3JPNA 4DFJA 1NK4A 1NK6A 9ICCA 4EYIB 7ICIA 2JEGA 1L3TA 3BDPA 3OHBA 3AU2A 4DLGA 8ICWA 5DGAA 2IHMA 4YR3A 1S0OA 4RQ2A 2R8GA 3N4MB 4IRDA 4R8UA 4RQ1A 3MBYA 3V7JA 1XU4A 2GWSA 8ICJA 1IM4A 1EXNA 4RU9A 4Z6EA 5L1KA 1TK0A 9ICQA 3LK9A 3HW8A 3V6HA 3TFRA 3C2LA 4ELUA 2BCQA 3GV8B 4E0DA 5J0XA 3FYHA 5KT4A 1U48A 1TK5A 5CJ7A 1ZQEA 1NJXA 3PNCA 4YN4A 3H4DA 3K4GA 2BCRA 1Y88A 4DL5A 3MABA 2ATLA 4G3IA 1XS9D 1IXRA 3T3FA 3G6VA 3BQTA 2XCPA 5IIKA 3PV8A 3V6KA 1D9FA 4IRKA 4YD2A 1B43A 3Q8LA 2BCVA 4NLKA 1NJYA 2VANA 7ICPA 1NK9A 1TVAA 3PMLA 3C2KA 4DOCA 2ZJ5A 1QTMA 2RDJA 5J0UA 4I2AA 2XY6A 3M9OB 4IRCA 4JWNA 4ECVA 4PGXA 4ED2A 1KLNA 1X2IA 4KTQA 4O3QA 4TQRA 3B0YA 4KLJA 3LDAA 2OWOA 5KFNA 3E2EA 1ZQPA 4DWIA 2A1JB 3UXPA 4F8RA 5KFBA 5DLFA 1D8LA 5J0OA 5J2IA 1ZQJA 4DSLA 3BQ1A 3PX0A 5JUMA 2VA8A 5DB7A 1WCLA 5DQHA 4UB1A 4FO6A 4IQWA 1HUZA 5HMMA 4J9RA 3H7IA 5J2GA 3SI8A 1LB2B 4QZCA 1NOMA 3GV5B 2IBKA 2UVRA 3ZDCA 2R8JA 3Q8RB 3EPGA 4BWJA 3GDXA 3GIIA 3BJYA 2R8HA 1S0VA 2XY5A 2ISOA 1BPDA 2KTQA 9ICSA 5DG8A 4DFMA 4BXOB 4QZAA 4O5KA 3T5KA 9ICUA 4ELTA 5IIJA 1Z3EB 4PHEA 2BDPA 4ECQA 1ZQVA 1ZQUA 4MF8A 5KFMA 2HHTA 7ICOA 3V7KA 3Q8MA 3C1YA 5KFGA 4BXOA 4UAZA 4P4OA 4IQVA 2H5XA 4RQ8A 2PFQA 2I1QA 3PO5A 4B9NA 4F4WA 5KT6A 1S0MA 3ORYA 7ICJA 2HHUA 3RRGA 4Q44A 4I2JA 3ISBA 3RH4A 4KLUA 2UVUA 2F1IA 3RR8A 4MEXA 4QWBA 5KT5A 5J2EA 5CHGA 5KG2A 2C28A 5J0PA 4YR0A 3PW4A 2KN7A 4ED3A 4I2FA 2HVIA 3LWMA 4XQ8A 2ZTEA 4GXIA 2NRWA 4DQSA 2P6RA 3OSNA 4ED0A 4BDPA 9ICOA 1D9DA 5J2CA 3OJUA 2W8KA 4LZDA 5CP2A 5KFZA 4KITB 4F4YA 4DS4A 9ICPA 9ICHA 1ZQYA 4K4IA 5KFDA 5KG7A 5HHHA 4O0IA 4QWEA 3ZDDA 2F1HA 5KG5A 1JMSA 3EPIA 8ICSA 4PGQA 4FS1A 1CEZA 1NK0A 4QZIA 1XSNA 4M2YA 3QEBZ 4ELVA 4YCXA 2FMPA 2C2EA 3RJGA 1TK8A 1T3NA 2PFNA 3KHHA 4F50A 4P2HA 4F4ZA 4HYKA 4I2EA 2HHXA 1XWLA 3B0XA 2BPGA 1TAUA 8ICRA 5CB1A 3JPOA 2XGPA 3MGIA 4J9OA 1S9FA 1BPXA 1KFDA 2BCUA 2PFPA 8ICZA 4BWMA 4QW8A 1UA0A 2JEIA 2XCAA 4PHAA 1TAQA 3H8SA 8ICBA 1MC8A 3HX0A 3SYZA 3MGHA 2V4QA 1NKBA 4EZ9A 2HVHA 2DFLA 3KHRA 4R8UB 5DB6A 2ASJA 4DS5A 8ICGA 3M9MB 1KTQA 2I9GA 3PR4A 2LYHA 4DL4A 4F91B 4F2RA 1ZQWA 1BVSA 2JZBB 7ICLA 4Q8EA 3RB4A 2Y1IA 2IHNA 7ICGA 1XO1A 2ZUBA 4RUCA 3ISDA 1ZQFA 4NXZA 3ETLA 5J2KA 2P6UA 5CR0A 2AGQA 3G6YA 4KLMA 4I2DA 5KFQA 4O9MA 4QZHA 4C8KA 3GIKA 3RJHA 2FPLA 1XSLA 3ISCA 1RYSA 9ICIA 4YG2A 5DQGA 3OSPA 4MF2A 4DF8A 4O3SA 4QZ9A 3JPQA 1S97A 4GC7A 4ECUA 1L3VA 5HP4A 1DOQA 2J6SA 2ISPA 1COOA 4YMNA 4M9HA 2HHWA 7ICQA 3Q8PB 3PX4A 3V72A 4JV1A 2XGQA 1KFSA 4DSIA 4M6WA 1ZQMA 1DGSA 5J0RA 5J0SA 3MR6A 1L3UA 5KFAA 4O3PA 4B9MA 3RH5A 4O3RA 2KFZA 7ICUA 4RQ0A 1ZQZA 1BPEA 4JWMA 3Q8QB 4Q8FA 5DG9A 4RQ3A 3RJKA 4EEYA 4YXJA 4J9MA 3RR7A 4ECYA 4QW9A 4F4KA 2F1JA 3IHQB 3AU6A 1ZJNA 1Z00B 1QLNA 5KG1A 5KFSA 5KT7A 1X9SA 5KFXA 3RB6A 5KT3A 4C8OA 5L9XA 4QWCA 9ICTA 3FDSA 3PMNA 4KLQA 2XY7A 3UXNA 4K4GA 4M0AA 5KT2A 4UB4A 3GIMA 1MQ2A 1NK8A 3RJJA 1TV9A 4F2SA 2AJQA 2BR0A 1HJPA 2PXIA 4F4XA 4RPZA 4F3OA 9ICLA 1NJWA 4I28A 2ZJ8A 4RUAA 8ICKA 3Q8SB 3TFSA 1S0NA 4P4PA 4DQQA 2AGPA 5KFYA 4M9NA 4QZDA 5J2FA 3SZ2A 5DGBA 4YFKA 3TAPA 3RB0A 3PW0A 4TUQA 1K1SA 3NGDA 2A1JA 2FPKA 4DSFA 5HNKA 4Z6DA 1ZQOA 3PO4A 4J9LA 4NY8A 5BOLA 1NJZA 4RZRA 4YP3A 1SL2A 5DBCA 3MR2A 5CWRA 4JV0A 3OHAA 3MFIA 1RXVA 1ZQGA 8ICMA 3SV4A 4DL7A 1TKDA 2ZTDA 4O3OA 2PI4A 5IILA 3IM1A 1SKWA 7ICRA 4YD1A 4MFCA 4B9VA 3C2MA 3PW7A 3RJEA 4GLXA 1L5UA 2BKEA 4UB2A 4YQWA 2NRTA 4DLEA 3C1ZA 9ICGA 3PW5A 4PGYA 4Z6CA 3JPRA 3GV7B 2W9CB 1X9WA 4KLLA 4I2GA 2J6UA 8ICQA 4YXMA 5F9LA 4EBDA 3G6XA 1ZQXA 1QSLA 2V9WA 2ASLA 4TUSA 1TFRA 4QZ8A 1BPZA 5J0TA 4RNNA 4I2BA 1PZNA 3M8RA 4EZ6A 5J0YA 2XO7A 4CCHA 2W9BB 2KZZA 2FLPA 2XC9A 4LVSA 4DL6A 4UQGA 4DQRA 2AQ4A 9ICVA 3EZ5A 4FBTA 3C5GA 4DL2A 3Q8KA 3HPOA 1K1QA 3GQCA 3M9NB 3QZ7A 4EBEA 2DPJA 4RPXA 9ICRA 8ICYA 4DFKA 5F9NA 1U49A 3MR3A 1ZQQA 8ICUA 8ICFA 4XUSA 2MUTB 3QEAZ 3UXOA 4KLTA 3MDCA 1JXLA 1B22A 2ZUCA 5KFUA 4KLHA 2M9NA 3H8JA 3QZ8A 2V4RA 3PW2A 1RPLA 2DPIA 3EYZA 4KLDA 4B9LA 9ICAA 5EOZA 5DDYA 3UQ2A 2BPFA 4B9TA 4DOAA 5EWFA 3ZDBA 1QSSA 3GILA 9ICJA 4KMUA 5EWEA 4GXJA 2P66A 4C8LA 4FS2A 2UVVA 4RNMA 2NRVA 3OJSA 5L1JA 5L1IA 1WCNA 1SKRA 3H4BA 4DSEA 3RTVA 4X5VA 5KG6A 4UB5A 5KG4A 5KFKA 5J0WA 3BQ2A 1ZETA 1KRPA 2IMWP 9ICKA 5KFFA 4J9KA 4I29A 4M04A 1A77A 3MR5A 1MQ3A 4KN4A 3SV3A 3RJFA 1AROP 4DQPA 4IQUA 3RH6A 4M9GA 1ZQKA 4PPXA 4RQ5A 3MDAA 2FLNA 3RBEA 2JEJA 4NM1A 1QSYA 4UAYA 4QZFA 3TI0A 4KLIA 2C2DA 1ZQTA 5KFLA 1NKCA 1ZQDA 4NLGA 1JIHA 4YMMA 3MFHA 4J9QA 7ICVA 3K75D 4PH5A 1JX4A 2FMSA 1X9MA 2KZMA 7ICFA 4C8NA 1SZPA 9ICFA 3AUOA 9ICWA 4QZBA 1ZQSA 5KFCA 1ZQCA 7ICSA 1ZJMA 1ZQHA 4DEZA 2UVWA 3EW9A 3TAQA 2AQ0A 4ECXA 1RYRA 7ICMA 1S77D 1S76D 4RQ6A 5J2HA 3GFKB 4J9PA 4C8MA 2JEFA 8ICTA 4RPYA 4PHPA 4R63A 1ZQBA 2BHNA 1KEJA 3LWLA 3TQ1A 4KLOA 4M6WB 8ICXA 2BQUA 3RRHA 2MAXA 4ECRA 1T7PA 5DBBA 4KN7A 3JPPA 2HW3A 4K4HA 1RXWA 7ICNA 3KTQA 4UAWA 4GC6A 2MUTA 2VA3A 4TURA 9ICNA 2NRXA 1N48A 2J6TA 7ICTA 5J29A 3V7LA 1BPBA 1D8YA 5DKWA 4YVZA 3T5HA 4F5NA 3TANA 2FMQA 4R66A 2NRZA 4F92B 3H40A 3UPQA 7ICHA 4YR2A 5EWGA 2R8IA 4R64A 5DQIA 4O5EA 4ECSA 4M9LA 5J2JA 2BQRA 4UB3A 5HHIA 2BQ3A 4DSJA 4Q45A 1U45A 4JK1A 8ICEA 2PFOA 5J0QA 2JZBA 4ZH4A 5KFOA 1RZTA 2IA6A 1NKEA 4IQTA 4I2HA 3M8SA 4I2CA 9ICBA 1ZQAA 2HHQA 5D46A 4R65A 2AU0A 3NTUA 4NM2A 3KHLA 2W9BA 4UBCA 1KFTA 1U47A 8ICCA 4QWAA 4EYHB 4ECTA 2FLLA 4B9UA 1SL1A 2W9CA 1NK7A 4UBBA 2W9AA 1ZYQA 3N97B 1ZQRA 4KLSA 2ZJAA 4P4MA 3OGUA 3ZD8A 4QZEA 5TZVA 1UA1A
chains in the Genus database with same CATH superfamily
4DOBA 4F93B 2N1RA 5J2AA 4J9NA 4RT3A 8ICPA 4F5PA 4EBCA 1L7MA 2GLEA 3ZDAA 5GTIU 4US8A 1MSWD 4YMOA 5KFRA 3H8WA 1FFVA 1FO4A 9ICMA 1L3SA 2RDIA 2W8LA 4DFPA 5KFHA 1ZQNA 1X66A 2BGWA 5D49A 5KFWA 2Q4TA 4RQ4A 4OO1J 1PVQA 5DDMA 1AQ6A 1ZXIA 3JPTA 5KFTA 1HEKA 2O6KA 3F2BA 8ICNA 8ICHA 1YZ6A 1J2MA 1U4BA 1XC9A 1QCKA 7ICEA 2F76X 5KG3A 4RQ7A 5IIIA 3C28A 3RB3A 1D8BA 1HUOA 3RAQA 4Y2JA 1SXEA 2IOHA 4LZGA 3RJIA 4B9SA 4BGDA 8ICAA 3H0MB 2F3NA 2K8AA 4XRHA 4KLGA 5DB9A 5EE3A 4CGZA 1LV5A 3ZD9A 5DG7A 4FBUA 4UATA 1NK4A 2K4HA 1L3TA 3BDPA 3OHBA 3TKAA 4YR3A 1IV8A 2R8GA 2FI1A 1ZRMA 9ICQA 2BCQA 1LKYB 3PSPA 4FE3A 1Q3VA 5KT4A 1TK5A 3PNCA 1Y88A 3S6JA 4G3IA 5KL1B 3V6KA 3Q8LA 2CN1A 2ZJ5A 5J8YC 3SQIA 4IRCA 4PGXA 3LVWA 2NV3A 3B0YA 2OWOA 4F8RA 5B66U 2IOFK 3BQ1A 5AI8A 1YZ7A 1WCLA 1X6IA 4FO6A 3H7IA 4QZCA 1NOMA 2IBKA 2R8JA 4CRXA 3Q8RB 2KTQA 1QQ6A 3FC4A 4QZAA 2OCEA 5IIJA 1ZQVA 2ES6A 3C1YA 5KFGA 3HRDD 4IQVA 2PFQA 4B9NA 4F4WA 3RRGA 4CE6A 4I2JA 3RR8A 4MHVA 4ZOHC 4LJXA 2ZIWB 5ALEA 2C28A 4OJPA 2KN7A 5ALXA 2HVIA 2JRZA 3I1YA 5J2CA 4LZDA 5CP2A 2K4IA 5KFZA 4KITB 4F4YA 2D8CA 2JHDA 1ZQYA 3NRWA 5KG7A 2AH5A 3QUQA 3EPIA 1VLBA 4FS1A 2WHEA 1NK0A 4QZIA 2ESEA 3QEBZ 1XWLA 3JPOA 1S9FA 4J9OA 4BWMA 1UA0A 3H8SA 1MC8A 1BNPA 2V4QA 4EZ9A 2W3RA 4R8UB 4DS5A 2YMMA 3M9MB 2I9GA 1IG6A 4DL4A 2W3SA 4AYBC 2JZBB 2Y1IA 2YB1A 2EANA 3ETLA 2P6UA 5J2KA 4KX5A 4KLMA 4I2DA 3QUBA 4O9MA 4C8KA 2FPLA 1RYSA 2CRXA 4GC7A 3UMGA 5HP4A 2G5IB 2J6SA 5EE0A 3PX4A 1KFSA 2EAPA 1ZQMA 1DGSA 4B9MA 4O3RA 1L3UA 7ICUA 2KFZA 2ZIUA 1ZQZA 1BPEA 5DG9A 4RQ3A 2OYYA 4J9MA 3RR7A 4ECYA 4QW9A 2F1JA 3AU6A 1L7NA 3O0FA 2Y0SF 5KT7A 1X9SA 3TADC 5AKLA 4KLQA 4RQNA 3MGVA 4F2SA 2BR0A 4F3OA 8ICKA 2RP5A 4DQQA 2AGPA 3QNMA 2KV2A 4TUQA 3NGDA 4PL1A 2FPKA 1ZQOA 4NY8A 4J9LA 1NJZA 2G5HB 4JV0A 3MFIA 1ZQGA 3M6ZA 4DL7A 2PI4A 3IM1A 2W7OA 3PW7A 2WF5A 4GLXA 4U7CA 4YQWA 1ZD2P 5ALSA 1L6NA 3C1ZA 9ICGA 4Z6CA 2J6UA 1LKYA 8ICQA 3G6XA 1ZQXA 5L1MA 2HBLA 2V9WA 1BPZA 2KSOA 4I2BA 4CCHA 3BZKA 4C4TA 3C29A 2B6GA 4LVSA 1IIPA 5CRXA 3C5GA 3GQCA 3M9NB 8ICYA 2LKYA 4XUSA 4KLTA 3MDCA 1B22A 3PW2A 2YTUA 1RPLA 5EOZA 5DDYA 2I5HA 2PMZF 5AKZA 4B9TA 5EWFA 3F53A 2MRLA 2P66A 3WKAA 4FZNA 4C8LA 4FS2A 3D2NA 5HR6A 3OJSA 2NRVA 3MC1A 1SKRA 4X5VA 3H4BA 2KJ5A 1KRPA 4UB5A 9ICKA 5KFFA 4J9KA 2VJ5A 4I29A 1MQ3A 3WK4A 4DQPA 4M9GA 1UQVA 2KK0A 4UAYA 3TI0A 5KFLA 5ALNA 4NLGA 4YMMA 7ICVA 2FMSA 1X40A 3AUOA 5KFCA 4DEZA 2HBKA 1RYRA 1S77D 7ICMA 1S76D 8ICTA 4J9PA 2JEFA 4PHPA 2BHNA 2AHOB 4KLOA 2E8NA 4M6WB 4ECRA 1T7PA 3JPPA 4K4HA 2VA3A 5J29A 3V7LA 1URJA 3TANA 2FMQA 4O5EA 4R64A 5DQIA 5HHIA 2BQ3A 2YX8A 1U45A 8ICEA 3ED5A 2G0AA 3HKZC 1FIQA 3KD3A 1NKEA 9ICBA 2KSOB 2LMRA 3WK8A 1S5LU 4R65A 3SENA 3KZIU 1KFTA 3ICXA 4QWAA 1ZRNA 1WYGA 1ZQRA 2K60A 3OGUA 4QZEA 2QARA 3FAHA 1N63A 4I27A 4O5CA 1V38A 8ICLA 2DWQA 3PR5B 1N56A 3RF9A 5AM5A 4DL3A 4GFJA 4NWIA 4MEYA 2QB0B 3NVZA 2EAMA 2IOFA 5AM0A 8ICOA 1J2NA 4ED7A 2Q0ZX 5D4BA 4F5RA 2HHSA 1UT5A 4EX7A 1U9LA 1F5SA 3ALRA 5AK5A 2F2AB 5HMLA 1JXEA 2BZFA 3ZDEA 3BS7A 2EAOA 1DK2A 1T3QA 4MFFA 4KLEA 2ASDA 8ICIA 4ACOA 5KFEA 2ZIUB 3THVA 1ZQLA 3OTQA 2C22A 1KSPA 4MFAA 3PVXA 4O3NA 5ALWA 3RBDA 3KHGA 3QU2A 7ICKA 2HCFA 4TQSA 5J2BA 1BPYA 5L1LA 2YMQA 1JN3A 3V6JA 5JU5A 4C4RA 1KL9A 3T5LA 2Y1JA 1NI3A 5KFIA 3HWTA 4BX9C 3H8MA 1A0PA 3EUB2 5AM4A 4QZGA 5JRTA 3T5JA 2PKEA 3JPNA 1NK6A 9ICCA 8ICWA 4IRDA 3N4MB 2W7PA 2GWSA 3M7DA 1IM4A 4RU9A 3LK9A 3TFRA 3I28A 4ELUA 1SGGA 5EE1A 3FYHA 1U48A 2HDOA 1NJXA 4YN4A 3H4DA 2MU2A 4DL5A 2ATLA 1OW5A 1XS9D 1IXRA 1WUDA 2XCPA 4OJLA 2BCVA 1NJYA 2VANA 1NK9A 3QU9A 2K8CB 2RDJA 4I2AA 2XY6A 2DGZA 4ED2A 1KLNA 4KTQA 4O3QA 4TQRA 3LDAA 1F0MA 2A1JB 2ZIWA 2E1EA 2DKXA 1MN8A 5J2IA 3PX0A 4IS7A 3CYMA 4UB1A 4IQWA 5AKIA 2A3VA 3SI8A 3GV5B 4UASA 4BWJA 3GDXA 1S0VA 2HBMA 2ISOA 2XICA 4PL2A 1RG6A 2JGAA 2DF4B 1Z3EB 2BDPA 1ZQUA 2HHTA 7ICOA 4BXOA 2Y9TA 2H5XA 3PO5A 3QU4A 2I1QA 2VKQA 5KT6A 3ISBA 1RDFA 4MEXA 1KN5A 4RQMA 2KICA 2A19A 5J0PA 3SMVA 3KFUF 2ZTEA 3OSNA 4ED0A 4BDPA 3KKAC 9ICPA 9ICHA 4O0IA 1J97A 2F1HA 1CEZA 5KL8B 4M2YA 4ELVA 2KOBA 3RJGA 4CNQA 1L7PA 1TAUA 4DCCA 2YQEA 1BPXA 2XGPA 3F5EA 1KFDA 2JEIA 2XCAA 1QH9A 4PHAA 1TAQA 2JR5A 8ICBA 1RM6C 3SYZA 2DFLA 3KHRA 2ASJA 5AM1A 5DB6A 4C0ZA 2WAQC 1KTQA 2LYHA 3K1ZA 1BVSA 4Q8EA 2YMLA 2ZUBA 3F2DA 3BZCA 3G6YA 2YN4A 2A1AA 4QZHA 2GOLA 3ISCA 3ETRA 4MF2A 1VJ5A 1DOQA 2MA1A 1COOA 4M9HA 7ICQA 3Q8PB 4KMOB 3V72A 1ED1A 4JV1A 1QQ5A 1NZBA 4DSIA 1JALA 4C4SA 5J0SA 3MR6A 4O3PA 1N2XA 2K89A 3AQEA 4JWMA 3RJKA 4F4KA 5K4LA 4F71A 3R9KA 5KFXA 4C8OA 2E1FA 2F44A 3N7PD 3UXNA 5KT2A 2AJQA 1TV9A 3RFAA 4OJ5A 2PXIA 4RPZA 2ZJ8A 1BNOA 1Z19A 1TE2A 4M9NA 4QZDA 2EDUA 5AKGA 3PW0A 1K1SA 3UM9A 3PO4A 4Z6DA 5BOLA 4RZRA 4YP3A 3CW2C 3MR2A 5CWRA 8ICMA 1TKDA 1JROA 5ALHA 5IILA 3NUQA 2OXOA 2MSNA 4MFCA 3C2MA 5ALRA 4DLEA 4ICAA 3JPRA 4I2GA 4Y2QA 1V85A 2ZIXB 4EBDA 3DV9A 3LYSA 1TFRA 4RNNA 2HOIA 4US9A 5ALTA 4EZ6A 1F44A 2JH1A 3AQFA 4DL6A 2LPEA 3EZ5A 3IG8A 2F8LA 4PZOA 1ZD5A 3QZ7A 4EBEA 4P0QA 1X6JA 4RPXA 2RRDA 1U49A 5AHXA 1JXLA 1DK3A 2M9NA 3QZ8A 2CPRA 9ICAA 4B9LA 4EELA 3UQ2A 3SEIA 4Y2UA 4KMUA 1O08A 5ALYA 2UVVA 2G07A 5L1IA 4NLZA 5KG6A 2IMWP 5KFKA 4JMUA 3RJFA 4KN4A 3SV3A 4RQ5A 4NM1A 5AK3A 1QSYA 4KLIA 3WKCA 1DGJA 4J9QA 4NL9A 1T94A 7ICFA 3PSIA 9ICWA 2KJ9A 2AQ0A 1UHUA 5ALQA 1N62A 5ALDA 2Y9UA 4R63A 1V97A 1KEJA 2DUYA 5EE9A 2BQUA 5DBBA 4KN7A 7ICNA 3KTQA 4UAWA 4QNLA 9ICNA 2NRXA 3J81j 1PK1A 4YVZA 3T5HA 3BQ7A 5E79U 3H40A 3WKEA 4FZLA 4YR2A 2R8IA 1Z4OA 4ECSA 4DSJA 4JK1A 2PFOA 2DL0A 4ZH4A 1RZTA 1Q3UA 5ALFA 2WF9A 1ZQAA 4Y2VA 5D46A 5AM3A 4UB6U 4EYHB 2FLLA 4B9UA 1SL1A 2W9CA 4UBBA 2W9AA 1ZYQA 3VC8A 3N97B 4KLSA 2ZJAA 2ZIXA 3QU7A 1JI7A 5KG0A 1HIWA 1CRXA 1SV0A 5IIMA 1XNSA 9ICEA 1JRPA 3IDWA 5AKJA 4M47A 3WKBA 5ALUA 3EWAA 1V9PA 3VCBA 4I2IA 3H0RB 2HHVA 2PI5A 5KAIU 2JV3A 3AM9A 1UT8A 3SR6A 4IR9A 1L8OA 2CXYA 2KZ3A 3RAXA 2FPMA 2E3TA 3HT3A 1Z00A 3JPSA 3NASA 2YMPA 5AM2A 5AICA 3FM9A 2RQ5A 1ZQIA 5DB8A 2ALZA 3UQ0A 2R8KA 5T14A 5KFPA 3BQ0A 5IIOA 1XSPA 4JV2A 5G5GA 1SKSA 3H0LB 2B21A 1Z1VA 4CDGA 2ZXHA 4Z6FA 3PX6A 4AP9A 2ZUDA 5BOMA 3E0FA 4JB3A 8ICVA 4QWDA 2WTFA 1L7OA 4BJQA 3TARA 4ED6A 2ZTCA 1H38A 2AGOA 4G9BA 3C23A 2BPCA 4Q43A 3HP6A 5KFVA 4DFJA 4ED1A 4OJ6A 1N5WA 4EYIB 2ZIVB 3T79A 5DGAA 1S0OA 2IHMA 1RQNA 4RQ1A 3MBYA 3KKAA 3V7JA 5L1KA 4Z6EA 4BUGA 1TK0A 3HW8A 3V6HA 4B6JA 3CP8A 3GV8B 3D2SA 3LVVA 4HAIA 4E0DA 2ZIVA 3A0BU 3K4GA 3T3FA 1D9FA 3BQTA 2LBOA 5IIKA 4YD2A 1B43A 3WK5A 7ICPA 3NVYA 4DOCA 1YT3A 1S8OA 5J0UA 3M9OB 4JWNA 1RQLA 4ECVA 3I76A 1X2IA 5KFNA 1M6YA 3UXPA 5J0OA 3NS1A 5JUMA 2KHQA 1FFUA 1A6SA 5HMMA 1KW4A 1MA7A 5J2GA 3ZDCA 3WKDA 2W03A 3DEEA 2R8HA 3GIIA 1BPDA 2OH2A 4DFMA 4BXOB 4O5KA 2HI0A 3M6KA 2KJ8A 4ECQA 4MF8A 1SV4A 2KD1A 5ALIA 5KFMA 5AKHA 3V7KA 4Y2PA 4Y2TA 7ICJA 1Z4NA 2HHUA 5FP0A 3RH4A 3SD7A 2UVUA 2F1IA 5KT5A 5KAFU 5CHGA 4ED3A 2OM6A 4DQSA 2P6RA 2EZZA 3OJUA 4DS4A 2OEHA 4K4IA 2G09A 4F72A 3SAGA 5KG5A 3AN1A 2DBYA 5HR7A 2FMPA 2C2EA 2YB4A 1TK8A 5G5HA 1T3NA 2H3VA 2M0NA 3HKZF 4F50A 4P2HA 4F4ZA 3F2CA 2XVTA 4EENA 2HHXA 3KOOA 3B0XA 8ICRA 1UCVA 5ALPA 8ICZA 4QW8A 3PSTA 4C80A 3HX0A 3MGHA 1NKBA 2KVSA 3PR4A 1VDVA 1ZQWA 2LI6A 7ICLA 5C0YA 5ALMA 5CR0A 5KFQA 5F3XB 9ICIA 1SZHA 4YG2A 5DQGA 3OSPA 1N60A 1S97A 1ZOLA 4EEKA 2LYBA 2ISPA 5AI0A 5ALKA 4YMNA 2KVCA 2HMXA 5J0RA 5KFAA 2H3ZA 4RQ0A 1SWWA 4Q8FA 2XI9A 4YXJA 3HJEA 3IHQB 1ZJNA 5KFSA 3RB6A 5KT3A 2OHFA 2KIVA 9ICTA 3FDSA 3PMNA 2XY7A 4K4GA 4M0AA 4UB4A 3RJJA 2E8MA 1HJPA 9ICLA 1NJWA 4RUAA 3Q8SB 3TFSA 4P4PA 5J2FA 3SZ2A 5DGBA 3TAPA 5ALOA 2KP7A 4UAVA 3BS5A 5DBCA 5AI9A 3OHAA 1RXVA 3N28A 3DDHA 4UAUA 1SB3C 5AK6A 1SKWA 7ICRA 4YD1A 4B9VA 3RJEA 1L5UA 2BKEA 4UB2A 4KLLA 4NJ8A 4P0QB 4YXMA 5F9LA 1KBUA 4QZ8A 4Y2SA 5AI6A 5J0YA 1Q8KA 4CF3A 2KZZA 2AQ4A 4DL2A 1K1QA 2ZG6A 4EX6A 1OXJA 9ICRA 3U26A 3IV6A 3WK9A 2LM4A 3CNHA 4NLCA 3QEAZ 2MUTB 3SAHA 4PJ0U 2V4RA 1PUZA 3ZI4A 4KLDA 1DRGA 2W55A 1ECWA 3GILA 4P0PB 1ZQ1C 4Y2XA 4RNMA 5L1JA 4FBTA 4DSEA 1ZQCA 5KG4A 1DXSA 1ZETA 5ALVA 2GH1A 4UW9A 1A77A 3ONNA 2RLTA 1AROP 4IQUA 3RH6A 3MDAA 2KIWA 5GTHU 4QZFA 2C2DA 1WWVA 3D6JA 1C20A 2R18A 2Z7JA 1JIHA 3MFHA 4PH5A 1JX4A 1X9MA 2H3IA 2QLTA 1SZPA 9ICFA 3QX7A 1SWVA 7ICSA 2D3DA 1ZJMA 1ZQHA 4P0PA 4RQ6A 4C8MA 1O03A 2RHFA 3LWLA 8ICXA 1K5OA 2MAXA 2HW3A 2E8OA 4GC6A 2MUTA 1N48A 2J6TA 2D6FC 7ICTA 1BPBA 1D8YA 4WJ3B 2QKQA 4F5NA 2JXJA 4R66A 1P7DA 2NRZA 4F92B 3UPQA 7ICHA 3L5KA 3PZPA 4NLBA 5J2JA 2BQRA 4UB3A 4Q45A 2WF6A 5J0QA 4I2HA 3M8SA 3HILA 2WF7A 2HHQA 4NM2A 3KHLA 4UBCA 1U47A 5B5EU 4ECTA 2W43A 2WAQF 3CRXA 3K1RB 3ZD8A 5ALLA 1PK1B 2FJ6A 3A0HU 4GXKA 5C5JA 4ECWA 4NLNA 4F5QA 4RNOA 4XA5A 4IR1A 4DO9A 3BS5B 4TUPA 2PMZC 3TADA 5KTQA 1KDHA 1T4GA 3GIJA 2WB1F 4RT2A 2E8PA 5A0LA 4F5OA 5AIAA 1GO3F 4J9SA 4DQIA 2BCSA 1CUKA 3D2QA 9ICXA 5J2DA 2QB1A 4JUZA 2W9MA 1BGXT 4DSKA 5DBAA 5BPCA 4ED8A 2LM1A 2NYVA 1S10A 4QIWC 2NO4A 2Y0SC 3C5FA 4GIBA 4DF4A 5KFJA 5IINA 2JMGA 3C21A 1CI4A 3WK7A 2KMDA 5DLGA 1T8EA 5CA7A 1NK5A 5ALZA 4IL6U 2C2RA 5KNIA 1SL0A 2DQNB 4KLFA 4KX3A 3QE9Y 4M9JA 1C7YA 2ZXIA 4ECZA 3IG5A 2VA2A 3NVWA 2P35A 2K8BB 3PY8A 2KFNA 4PHDA 1A76A 7ICIA 2JEGA 2I6XA 3AU2A 4DLGA 2F8KA 4RQ2A 4R8UA 1XU4A 2K4PA 8ICJA 1EXNA 2HSZA 3C2LA 2HBJA 5J0XA 5CJ7A 1ZQEA 2BCRA 1SXDA 3MABA 3G6VA 1PK3A 3QUTA 3PV8A 2E5SA 4IRKA 1PVPA 4NLKA 2F77X 1TVAA 1ZD4A 3PMLA 3C2KA 1QTMA 2KKPA 3WU2U 1LVHA 4KLJA 2G08A 4A8EA 3E2EA 1ZQPA 4DWIA 5KFBA 5DLFA 1D8LA 1ZQJA 4DSLA 5AKYA 2VA8A 5DB7A 5DQHA 1HUZA 4J9RA 2UVRA 1LB2B 2AXTU 2KEYA 3EPGA 3BJYA 3E58A 1ZD3A 2XY5A 9ICSA 5DG8A 1NNLA 5AK4A 2KKVA 2ODGA 3T5KA 3B9JA 3AEVA 9ICUA 4C7YA 4ELTA 4PHEA 2JH7A 3Q8MA 5J8YA 3QU5A 4UAZA 4P4OA 4RQ8A 1S0MA 3NRZA 3ORYA 3PSFA 4Q44A 2EQYA 4KLUA 2VIXA 4QWBA 5J2EA 3QYPA 5KG2A 2QB0A 3PW4A 3IP4B 4YR0A 4I2FA 3LWMA 4XQ8A 4GXIA 2NRWA 9ICOA 1D9DA 5AKXA 2W8KA 3IRUA 1QQ7A 4FZMA 5KFDA 4QWEA 4PZNA 5HHHA 3ZDDA 8ICSA 1JMSA 4PGQA 4IC9A 2VJ4A 1NZPA 1XSNA 3N7RC 4YCXA 1WWUA 3NVVA 2PFNA 3KHHA 4HYKA 4I2EA 2G06A 2BPGA 4U6PA 5CB1A 3MGIA 2BCUA 2PFPA 3F5AA 3OPXA 2HVHA 8ICGA 4F91B 4F2RA 4CF4A 3GZFA 3RB4A 2EZYA 2IHNA 1XO1A 4OJOA 4RUCA 3ISDA 1OUQA 4NXZA 3UMBA 1ZQFA 2AGQA 3M1YA 5TISU 3GIKA 3RJHA 1XSLA 2YY6A 3N7SC 4OD0A 4DF8A 4O3SA 4QZ9A 3JPQA 4ECUA 1L3VA 2HHWA 2LYAA 2XGQA 4M6WA 2FE9A 2HOQA 2WF8A 3RH5A 1UPHA 2BDUA 3Q8QB 4CF5A 2HOFA 2KE7A 4EEYA 2XIDA 4Y2RA 1Z00B 1QLNA 5KG1A 4DFDA 2W04A 5AI5A 5L9XA 4QWCA 2LHTA 1SV0C 1XO0A 5AI4A 3GIMA 1MQ2A 1NK8A 4F4XA 4I28A 1S0NA 4UARA 5KFYA 3TACB 4YFKA 3RB0A 2A1JA 4DSFA 5HNKA 1SL2A 2L5YA 3SV4A 2ZTDA 5JTIA 4O3OA 4QJFB 2NO5A 1X9XA 2EH9A 2NRTA 5ALJA 4PGYA 3PW5A 3GV7B 2W9CB 1X9WA 2KG5A 2KNJA 1QSLA 2ASLA 4TUSA 4QIWF 5J0TA 1PZNA 3M8RA 1B0XA 2XO7A 5AIBA 5AKKA 2W9BB 2FLPA 2XC9A 3UMCA 1Z1BA 4UQGA 4DQRA 9ICVA 3Q8KA 3GU3A 3L4PA 3HPOA 1SIJA 2DPJA 4DFKA 5F9NA 1N5XA 1Q46A 3MR3A 1ZQQA 8ICUA 8ICFA 1KQQA 3UXOA 1COKA 2WB1C 5ALGA 2ZUCA 4NL9C 5KFUA 4KLHA 3H8JA 2H3FA 2W54A 2DPIA 1WG8A 3EYZA 4O3MA 2BPFA 1FEZA 4DOAA 3ZDBA 1QSSA 9ICJA 1RYUA 5EWEA 4GXJA 5H2FU 3L3FX 1WCNA 3RTVA 5J0WA 3BQ2A 4M04A 3MR5A 4USAA 4OCZA 1ZQKA 2FLNA 4PPXA 3RBEA 2JEJA 4Y2YA 7ICGA 3AMZA 1ZQTA 3QXGA 1NKCA 5AKEA 1ZQDA 1X42A 3QUCA 3K75D 3AL0B 2KZMA 4C8NA 3KZXA 4QZBA 1ZQSA 2K4EA 2UVWA 2DKZA 3EW9A 3TAQA 4ECXA 2KHVA 5J2HA 3GFKB 1L8LA 4RPYA 4J03A 2EZXA 1ZQBA 2B0CA 3TQ1A 1JUDA 3RRHA 4AYBF 2GO7A 3KBBA 1RXWA 5CEHA 4TURA 4UB8U 5DKWA 2QARB 2H3QA 2FDRA 5EWGA 4M9LA 3IN5A 1N61A 2JZBA 4FFDA 5KFOA 1PVRA 2IA6A 4C7ZA 4IQTA 4I2CA 2AU0A 2W11A 3NTUA 2W9BA 8ICCA 3SAFA 1TAMA 1NK7A 1KKXA 4P4MA 4NV0A 5TZVA 3WK6A 1B4FA 1UA1A 2WFAA
chains in the Genus database with same CATH topology
4DOBA 4F93B 5J2AA 5KG0A 4I27A 4J9NA 4GXKA 4O5CA 8ICLA 5C5JA 4RT3A 8ICPA 4ECWA 3PR5B 4NLNA 4F5PA 4EBCA 1N56A 4F5QA 4RNOA 4XA5A 4IR1A 4DO9A 4DL3A 3ZDAA 4TUPA 1MSWD 5IIMA 4YMOA 4MEYA 9ICEA 5KFRA 3H8WA 5KTQA 1KDHA 4M47A 1T4GA 3GIJA 9ICMA 1L3SA 2RDIA 1V9PA 3EWAA 2W8LA 4DFPA 4I2IA 5KFHA 1ZQNA 2HHVA 8ICOA 2BGWA 5D49A 5KFWA 2Q0ZX 4RT2A 4ED7A 5D4BA 2PI5A 4RQ4A 4F5RA 2HHSA 1UT5A 1UT8A 1U9LA 4IR9A 4F5OA 5DDMA 4J9SA 4DQIA 2BCSA 5HMLA 1CUKA 3JPTA 1JXEA 2KZ3A 5KFTA 4NLZA 3RAXA 9ICXA 2FPMA 3ZDEA 3HT3A 1Z00A 5J2DA 3JPSA 4JUZA 4MFFA 8ICNA 2W9MA 4KLEA 1BGXT 8ICHA 2ASDA 8ICIA 4DSKA 1U4BA 5DBAA 5KFEA 1XC9A 5BPCA 4ED8A 7ICEA 1S10A 1ZQIA 5KG3A 4RQ7A 3THVA 1ZQLA 5DB8A 3C5FA 2C22A 1KSPA 2ALZA 4MFAA 4DF4A 5IIIA 5KFJA 5IINA 4O3NA 3PVXA 3RB3A 1HUOA 3RBDA 3C21A 3RAQA 3UQ0A 3KHGA 4LZGA 5DLGA 7ICKA 4TQSA 1T8EA 5J2BA 3RJIA 2R8KA 1BPYA 5CA7A 5KFPA 3BQ0A 5L1LA 4B9SA 1JN3A 3V6JA 4BGDA 1NK5A 8ICAA 5IIOA 1XSPA 4JV2A 1SKSA 3T5LA 2Y1JA 2C2RA 2B21A 5KFIA 4XRHA 4KLGA 3HWTA 4Z6FA 3PX6A 2ZUDA 5BOMA 1SL0A 4KLFA 3QE9Y 8ICVA 5DB9A 4M9JA 4QWDA 1C7YA 4ECZA 2WTFA 3TARA 4ED6A 2ZTCA 1H38A 1LV5A 2VA2A 3ZD9A 4QZGA 5DG7A 2AGOA 3C23A 2BPCA 4Q43A 3HP6A 3PY8A 4FBUA 4PHDA 5KFVA 3T5JA 2KFNA 1A76A 4ED1A 3JPNA 4DFJA 1NK4A 1NK6A 9ICCA 4EYIB 7ICIA 2JEGA 1L3TA 3BDPA 3OHBA 3AU2A 4DLGA 8ICWA 5DGAA 2IHMA 4YR3A 1S0OA 4RQ2A 2R8GA 3N4MB 4IRDA 4R8UA 4RQ1A 3MBYA 3V7JA 1XU4A 2GWSA 8ICJA 1IM4A 1EXNA 4RU9A 4Z6EA 5L1KA 1TK0A 9ICQA 3LK9A 3HW8A 3V6HA 3TFRA 3C2LA 4ELUA 2BCQA 3GV8B 4E0DA 5J0XA 3FYHA 5KT4A 1U48A 1TK5A 5CJ7A 1ZQEA 1NJXA 3PNCA 4YN4A 3H4DA 3K4GA 2BCRA 1Y88A 4DL5A 3MABA 2ATLA 4G3IA 1XS9D 1IXRA 3T3FA 3G6VA 3BQTA 2XCPA 5IIKA 3PV8A 3V6KA 1D9FA 4IRKA 4YD2A 1B43A 3Q8LA 2BCVA 4NLKA 1NJYA 2VANA 7ICPA 1NK9A 1TVAA 3PMLA 3C2KA 4DOCA 2ZJ5A 1QTMA 2RDJA 5J0UA 4I2AA 2XY6A 3M9OB 4IRCA 4JWNA 4ECVA 4PGXA 4ED2A 1KLNA 1X2IA 4KTQA 4O3QA 4TQRA 3B0YA 4KLJA 3LDAA 2OWOA 5KFNA 3E2EA 1ZQPA 4DWIA 2A1JB 3UXPA 4F8RA 5KFBA 5DLFA 1D8LA 5J0OA 5J2IA 1ZQJA 4DSLA 3BQ1A 3PX0A 5JUMA 2VA8A 5DB7A 1WCLA 5DQHA 4UB1A 4FO6A 4IQWA 1HUZA 5HMMA 4J9RA 3H7IA 5J2GA 3SI8A 1LB2B 4QZCA 1NOMA 3GV5B 2IBKA 2UVRA 3ZDCA 2R8JA 3Q8RB 3EPGA 4BWJA 3GDXA 3GIIA 3BJYA 2R8HA 1S0VA 2XY5A 2ISOA 1BPDA 2KTQA 9ICSA 5DG8A 4DFMA 4BXOB 4QZAA 4O5KA 3T5KA 9ICUA 4ELTA 5IIJA 1Z3EB 4PHEA 2BDPA 4ECQA 1ZQVA 1ZQUA 4MF8A 5KFMA 2HHTA 7ICOA 3V7KA 3Q8MA 3C1YA 5KFGA 4BXOA 4UAZA 4P4OA 4IQVA 2H5XA 4RQ8A 2PFQA 2I1QA 3PO5A 4B9NA 4F4WA 5KT6A 1S0MA 3ORYA 7ICJA 2HHUA 3RRGA 4Q44A 4I2JA 3ISBA 3RH4A 4KLUA 2UVUA 2F1IA 3RR8A 4MEXA 4QWBA 5KT5A 5J2EA 5CHGA 5KG2A 2C28A 5J0PA 4YR0A 3PW4A 2KN7A 4ED3A 4I2FA 2HVIA 3LWMA 4XQ8A 2ZTEA 4GXIA 2NRWA 4DQSA 2P6RA 3OSNA 4ED0A 4BDPA 9ICOA 1D9DA 5J2CA 3OJUA 2W8KA 4LZDA 5CP2A 5KFZA 4KITB 4F4YA 4DS4A 9ICPA 9ICHA 1ZQYA 4K4IA 5KFDA 5KG7A 5HHHA 4O0IA 4QWEA 3ZDDA 2F1HA 5KG5A 1JMSA 3EPIA 8ICSA 4PGQA 4FS1A 1CEZA 1NK0A 4QZIA 1XSNA 4M2YA 3QEBZ 4ELVA 4YCXA 2FMPA 2C2EA 3RJGA 1TK8A 1T3NA 2PFNA 3KHHA 4F50A 4P2HA 4F4ZA 4HYKA 4I2EA 2HHXA 1XWLA 3B0XA 2BPGA 1TAUA 8ICRA 5CB1A 3JPOA 2XGPA 3MGIA 4J9OA 1S9FA 1BPXA 1KFDA 2BCUA 2PFPA 8ICZA 4BWMA 4QW8A 1UA0A 2JEIA 2XCAA 4PHAA 1TAQA 3H8SA 8ICBA 1MC8A 3HX0A 3SYZA 3MGHA 2V4QA 1NKBA 4EZ9A 2HVHA 2DFLA 3KHRA 4R8UB 5DB6A 2ASJA 4DS5A 8ICGA 3M9MB 1KTQA 2I9GA 3PR4A 2LYHA 4DL4A 4F91B 4F2RA 1ZQWA 1BVSA 2JZBB 7ICLA 4Q8EA 3RB4A 2Y1IA 2IHNA 7ICGA 1XO1A 2ZUBA 4RUCA 3ISDA 1ZQFA 4NXZA 3ETLA 5J2KA 2P6UA 5CR0A 2AGQA 3G6YA 4KLMA 4I2DA 5KFQA 4O9MA 4QZHA 4C8KA 3GIKA 3RJHA 2FPLA 1XSLA 3ISCA 1RYSA 9ICIA 4YG2A 5DQGA 3OSPA 4MF2A 4DF8A 4O3SA 4QZ9A 3JPQA 1S97A 4GC7A 4ECUA 1L3VA 5HP4A 1DOQA 2J6SA 2ISPA 1COOA 4YMNA 4M9HA 2HHWA 7ICQA 3Q8PB 3PX4A 3V72A 4JV1A 2XGQA 1KFSA 4DSIA 4M6WA 1ZQMA 1DGSA 5J0RA 5J0SA 3MR6A 1L3UA 5KFAA 4O3PA 4B9MA 3RH5A 4O3RA 2KFZA 7ICUA 4RQ0A 1ZQZA 1BPEA 4JWMA 3Q8QB 4Q8FA 5DG9A 4RQ3A 3RJKA 4EEYA 4YXJA 4J9MA 3RR7A 4ECYA 4QW9A 4F4KA 2F1JA 3IHQB 3AU6A 1ZJNA 1Z00B 1QLNA 5KG1A 5KFSA 5KT7A 1X9SA 5KFXA 3RB6A 5KT3A 4C8OA 5L9XA 4QWCA 9ICTA 3FDSA 3PMNA 4KLQA 2XY7A 3UXNA 4K4GA 4M0AA 5KT2A 4UB4A 3GIMA 1MQ2A 1NK8A 3RJJA 1TV9A 4F2SA 2AJQA 2BR0A 1HJPA 2PXIA 4F4XA 4RPZA 4F3OA 9ICLA 1NJWA 4I28A 2ZJ8A 4RUAA 8ICKA 3Q8SB 3TFSA 1S0NA 4P4PA 4DQQA 2AGPA 5KFYA 4M9NA 4QZDA 5J2FA 3SZ2A 5DGBA 4YFKA 3TAPA 3RB0A 3PW0A 4TUQA 1K1SA 3NGDA 2A1JA 2FPKA 4DSFA 5HNKA 4Z6DA 1ZQOA 3PO4A 4J9LA 4NY8A 5BOLA 1NJZA 4RZRA 4YP3A 1SL2A 5DBCA 3MR2A 5CWRA 4JV0A 3OHAA 3MFIA 1RXVA 1ZQGA 8ICMA 3SV4A 4DL7A 1TKDA 2ZTDA 4O3OA 2PI4A 5IILA 3IM1A 1SKWA 7ICRA 4YD1A 4MFCA 4B9VA 3C2MA 3PW7A 3RJEA 4GLXA 1L5UA 2BKEA 4UB2A 4YQWA 2NRTA 4DLEA 3C1ZA 9ICGA 3PW5A 4PGYA 4Z6CA 3JPRA 3GV7B 2W9CB 1X9WA 4KLLA 4I2GA 2J6UA 8ICQA 4YXMA 5F9LA 4EBDA 3G6XA 1ZQXA 1QSLA 2V9WA 2ASLA 4TUSA 1TFRA 4QZ8A 1BPZA 5J0TA 4RNNA 4I2BA 1PZNA 3M8RA 4EZ6A 5J0YA 2XO7A 4CCHA 2W9BB 2KZZA 2FLPA 2XC9A 4LVSA 4DL6A 4UQGA 4DQRA 2AQ4A 9ICVA 3EZ5A 4FBTA 3C5GA 4DL2A 3Q8KA 3HPOA 1K1QA 3GQCA 3M9NB 3QZ7A 4EBEA 2DPJA 4RPXA 9ICRA 8ICYA 4DFKA 5F9NA 1U49A 3MR3A 1ZQQA 8ICUA 8ICFA 4XUSA 2MUTB 3QEAZ 3UXOA 4KLTA 3MDCA 1JXLA 1B22A 2ZUCA 5KFUA 4KLHA 2M9NA 3H8JA 3QZ8A 2V4RA 3PW2A 1RPLA 2DPIA 3EYZA 4KLDA 4B9LA 9ICAA 5EOZA 5DDYA 3UQ2A 2BPFA 4B9TA 4DOAA 5EWFA 3ZDBA 1QSSA 3GILA 9ICJA 4KMUA 5EWEA 4GXJA 2P66A 4C8LA 4FS2A 2UVVA 4RNMA 2NRVA 3OJSA 5L1JA 5L1IA 1WCNA 1SKRA 3H4BA 4DSEA 3RTVA 4X5VA 5KG6A 4UB5A 5KG4A 5KFKA 5J0WA 3BQ2A 1ZETA 1KRPA 2IMWP 9ICKA 5KFFA 4J9KA 4I29A 4M04A 1A77A 3MR5A 1MQ3A 4KN4A 3SV3A 3RJFA 1AROP 4DQPA 4IQUA 3RH6A 4M9GA 1ZQKA 4PPXA 4RQ5A 3MDAA 2FLNA 3RBEA 2JEJA 4NM1A 1QSYA 4UAYA 4QZFA 3TI0A 4KLIA 2C2DA 1ZQTA 5KFLA 1NKCA 1ZQDA 4NLGA 1JIHA 4YMMA 3MFHA 4J9QA 7ICVA 3K75D 4PH5A 1JX4A 2FMSA 1X9MA 2KZMA 7ICFA 4C8NA 1SZPA 9ICFA 3AUOA 9ICWA 4QZBA 1ZQSA 5KFCA 1ZQCA 7ICSA 1ZJMA 1ZQHA 4DEZA 2UVWA 3EW9A 3TAQA 2AQ0A 4ECXA 1RYRA 7ICMA 1S77D 1S76D 4RQ6A 5J2HA 3GFKB 4J9PA 4C8MA 2JEFA 8ICTA 4RPYA 4PHPA 4R63A 1ZQBA 2BHNA 1KEJA 3LWLA 3TQ1A 4KLOA 4M6WB 8ICXA 2BQUA 3RRHA 2MAXA 4ECRA 1T7PA 5DBBA 4KN7A 3JPPA 2HW3A 4K4HA 1RXWA 7ICNA 3KTQA 4UAWA 4GC6A 2MUTA 2VA3A 4TURA 9ICNA 2NRXA 1N48A 2J6TA 7ICTA 5J29A 3V7LA 1BPBA 1D8YA 5DKWA 4YVZA 3T5HA 4F5NA 3TANA 2FMQA 4R66A 2NRZA 4F92B 3H40A 3UPQA 7ICHA 4YR2A 5EWGA 2R8IA 4R64A 5DQIA 4O5EA 4ECSA 4M9LA 5J2JA 2BQRA 4UB3A 5HHIA 2BQ3A 4DSJA 4Q45A 1U45A 4JK1A 8ICEA 2PFOA 5J0QA 2JZBA 4ZH4A 5KFOA 1RZTA 2IA6A 1NKEA 4IQTA 4I2HA 3M8SA 4I2CA 9ICBA 1ZQAA 2HHQA 5D46A 4R65A 2AU0A 3NTUA 4NM2A 3KHLA 2W9BA 4UBCA 1KFTA 1U47A 8ICCA 4QWAA 4EYHB 4ECTA 2FLLA 4B9UA 1SL1A 2W9CA 1NK7A 4UBBA 2W9AA 1ZYQA 3N97B 1ZQRA 4KLSA 2ZJAA 4P4MA 3OGUA 3ZD8A 4QZEA 5TZVA 1UA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOB A;  4F93 B;  5J2A A;  5KG0 A;  4I27 A;  4J9N A;  4GXK A;  4O5C A;  8ICL A;  5C5J A;  4RT3 A;  8ICP A;  4ECW A;  3PR5 B;  4NLN A;  4F5P A;  4EBC A;  1N56 A;  4F5Q A;  4RNO A;  4XA5 A;  4IR1 A;  4DO9 A;  4DL3 A;  3ZDA A;  4TUP A;  1MSW D;  5IIM A;  4YMO A;  4MEY A;  9ICE A;  5KFR A;  3H8W A;  5KTQ A;  1KDH A;  4M47 A;  1T4G A;  3GIJ A;  9ICM A;  1L3S A;  2RDI A;  1V9P A;  3EWA A;  2W8L A;  4DFP A;  4I2I A;  5KFH A;  1ZQN A;  2HHV A;  8ICO A;  2BGW A;  5D49 A;  5KFW A;  2Q0Z X;  4RT2 A;  4ED7 A;  5D4B A;  2PI5 A;  4RQ4 A;  4F5R A;  2HHS A;  1UT5 A;  1UT8 A;  1U9L A;  4IR9 A;  4F5O A;  5DDM A;  4J9S A;  4DQI A;  2BCS A;  5HML A;  1CUK A;  3JPT A;  1JXE A;  2KZ3 A;  5KFT A;  4NLZ A;  3RAX A;  9ICX A;  2FPM A;  3ZDE A;  3HT3 A;  1Z00 A;  5J2D A;  3JPS A;  4JUZ A;  4MFF A;  8ICN A;  2W9M A;  4KLE A;  1BGX T;  8ICH A;  2ASD A;  8ICI A;  4DSK A;  1U4B A;  5DBA A;  5KFE A;  1XC9 A;  5BPC A;  4ED8 A;  7ICE A;  1S10 A;  1ZQI A;  5KG3 A;  4RQ7 A;  3THV A;  1ZQL A;  5DB8 A;  3C5F A;  2C22 A;  1KSP A;  2ALZ A;  4MFA A;  4DF4 A;  5III A;  5KFJ A;  5IIN A;  4O3N A;  3PVX A;  3RB3 A;  1HUO A;  3RBD A;  3C21 A;  3RAQ A;  3UQ0 A;  3KHG A;  4LZG A;  5DLG A;  7ICK A;  4TQS A;  1T8E A;  5J2B A;  3RJI A;  2R8K A;  1BPY A;  5CA7 A;  5KFP A;  3BQ0 A;  5L1L A;  4B9S A;  1JN3 A;  3V6J A;  4BGD A;  1NK5 A;  8ICA A;  5IIO A;  1XSP A;  4JV2 A;  1SKS A;  3T5L A;  2Y1J A;  2C2R A;  2B21 A;  5KFI A;  4XRH A;  4KLG A;  3HWT A;  4Z6F A;  3PX6 A;  2ZUD A;  5BOM A;  1SL0 A;  4KLF A;  3QE9 Y;  8ICV A;  5DB9 A;  4M9J A;  4QWD A;  1C7Y A;  4ECZ A;  2WTF A;  3TAR A;  4ED6 A;  2ZTC A;  1H38 A;  1LV5 A;  2VA2 A;  3ZD9 A;  4QZG A;  5DG7 A;  2AGO A;  3C23 A;  2BPC A;  4Q43 A;  3HP6 A;  3PY8 A;  4FBU A;  4PHD A;  5KFV A;  3T5J A;  2KFN A;  1A76 A;  4ED1 A;  3JPN A;  4DFJ A;  1NK4 A;  1NK6 A;  9ICC A;  4EYI B;  7ICI A;  2JEG A;  1L3T A;  3BDP A;  3OHB A;  3AU2 A;  4DLG A;  8ICW A;  5DGA A;  2IHM A;  4YR3 A;  1S0O A;  4RQ2 A;  2R8G A;  3N4M B;  4IRD A;  4R8U A;  4RQ1 A;  3MBY A;  3V7J A;  1XU4 A;  2GWS A;  8ICJ A;  1IM4 A;  1EXN A;  4RU9 A;  4Z6E A;  5L1K A;  1TK0 A;  9ICQ A;  3LK9 A;  3HW8 A;  3V6H A;  3TFR A;  3C2L A;  4ELU A;  2BCQ A;  3GV8 B;  4E0D A;  5J0X A;  3FYH A;  5KT4 A;  1U48 A;  1TK5 A;  5CJ7 A;  1ZQE A;  1NJX A;  3PNC A;  4YN4 A;  3H4D A;  3K4G A;  2BCR A;  1Y88 A;  4DL5 A;  3MAB A;  2ATL A;  4G3I A;  1XS9 D;  1IXR A;  3T3F A;  3G6V A;  3BQT A;  2XCP A;  5IIK A;  3PV8 A;  3V6K A;  1D9F A;  4IRK A;  4YD2 A;  1B43 A;  3Q8L A;  2BCV A;  4NLK A;  1NJY A;  2VAN A;  7ICP A;  1NK9 A;  1TVA A;  3PML A;  3C2K A;  4DOC A;  2ZJ5 A;  1QTM A;  2RDJ A;  5J0U A;  4I2A A;  2XY6 A;  3M9O B;  4IRC A;  4JWN A;  4ECV A;  4PGX A;  4ED2 A;  1KLN A;  1X2I A;  4KTQ A;  4O3Q A;  4TQR A;  3B0Y A;  4KLJ A;  3LDA A;  2OWO A;  5KFN A;  3E2E A;  1ZQP A;  4DWI A;  2A1J B;  3UXP A;  4F8R A;  5KFB A;  5DLF A;  1D8L A;  5J0O A;  5J2I A;  1ZQJ A;  4DSL A;  3BQ1 A;  3PX0 A;  5JUM A;  2VA8 A;  5DB7 A;  1WCL A;  5DQH A;  4UB1 A;  4FO6 A;  4IQW A;  1HUZ A;  5HMM A;  4J9R A;  3H7I A;  5J2G A;  3SI8 A;  1LB2 B;  4QZC A;  1NOM A;  3GV5 B;  2IBK A;  2UVR A;  3ZDC A;  2R8J A;  3Q8R B;  3EPG A;  4BWJ A;  3GDX A;  3GII A;  3BJY A;  2R8H A;  1S0V A;  2XY5 A;  2ISO A;  1BPD A;  2KTQ A;  9ICS A;  5DG8 A;  4DFM A;  4BXO B;  4QZA A;  4O5K A;  3T5K A;  9ICU A;  4ELT A;  5IIJ A;  1Z3E B;  4PHE A;  2BDP A;  4ECQ A;  1ZQV A;  1ZQU A;  4MF8 A;  5KFM A;  2HHT A;  7ICO A;  3V7K A;  3Q8M A;  3C1Y A;  5KFG A;  4BXO A;  4UAZ A;  4P4O A;  4IQV A;  2H5X A;  4RQ8 A;  2PFQ A;  2I1Q A;  3PO5 A;  4B9N A;  4F4W A;  5KT6 A;  1S0M A;  3ORY A;  7ICJ A;  2HHU A;  3RRG A;  4Q44 A;  4I2J A;  3ISB A;  3RH4 A;  4KLU A;  2UVU A;  2F1I A;  3RR8 A;  4MEX A;  4QWB A;  5KT5 A;  5J2E A;  5CHG A;  5KG2 A;  2C28 A;  5J0P A;  4YR0 A;  3PW4 A;  2KN7 A;  4ED3 A;  4I2F A;  2HVI A;  3LWM A;  4XQ8 A;  2ZTE A;  4GXI A;  2NRW A;  4DQS A;  2P6R A;  3OSN A;  4ED0 A;  4BDP A;  9ICO A;  1D9D A;  5J2C A;  3OJU A;  2W8K A;  4LZD A;  5CP2 A;  5KFZ A;  4KIT B;  4F4Y A;  4DS4 A;  9ICP A;  9ICH A;  1ZQY A;  4K4I A;  5KFD A;  5KG7 A;  5HHH A;  4O0I A;  4QWE A;  3ZDD A;  2F1H A;  5KG5 A;  1JMS A;  3EPI A;  8ICS A;  4PGQ A;  4FS1 A;  1CEZ A;  1NK0 A;  4QZI A;  1XSN A;  4M2Y A;  3QEB Z;  4ELV A;  4YCX A;  2FMP A;  2C2E A;  3RJG A;  1TK8 A;  1T3N A;  2PFN A;  3KHH A;  4F50 A;  4P2H A;  4F4Z A;  4HYK A;  4I2E A;  2HHX A;  1XWL A;  3B0X A;  2BPG A;  1TAU A;  8ICR A;  5CB1 A;  3JPO A;  2XGP A;  3MGI A;  4J9O A;  1S9F A;  1BPX A;  1KFD A;  2BCU A;  2PFP A;  8ICZ A;  4BWM A;  4QW8 A;  1UA0 A;  2JEI A;  2XCA A;  4PHA A;  1TAQ A;  3H8S A;  8ICB A;  1MC8 A;  3HX0 A;  3SYZ A;  3MGH A;  2V4Q A;  1NKB A;  4EZ9 A;  2HVH A;  2DFL A;  3KHR A;  4R8U B;  5DB6 A;  2ASJ A;  4DS5 A;  8ICG A;  3M9M B;  1KTQ A;  2I9G A;  3PR4 A;  2LYH A;  4DL4 A;  4F91 B;  4F2R A;  1ZQW A;  1BVS A;  2JZB B;  7ICL A;  4Q8E A;  3RB4 A;  2Y1I A;  2IHN A;  7ICG A;  1XO1 A;  2ZUB A;  4RUC A;  3ISD A;  1ZQF A;  4NXZ A;  3ETL A;  5J2K A;  2P6U A;  5CR0 A;  2AGQ A;  3G6Y A;  4KLM A;  4I2D A;  5KFQ A;  4O9M A;  4QZH A;  4C8K A;  3GIK A;  3RJH A;  2FPL A;  1XSL A;  3ISC A;  1RYS A;  9ICI A;  4YG2 A;  5DQG A;  3OSP A;  4MF2 A;  4DF8 A;  4O3S A;  4QZ9 A;  3JPQ A;  1S97 A;  4GC7 A;  4ECU A;  1L3V A;  5HP4 A;  1DOQ A;  2J6S A;  2ISP A;  1COO A;  4YMN A;  4M9H A;  2HHW A;  7ICQ A;  3Q8P B;  3PX4 A;  3V72 A;  4JV1 A;  2XGQ A;  1KFS A;  4DSI A;  4M6W A;  1ZQM A;  1DGS A;  5J0R A;  5J0S A;  3MR6 A;  1L3U A;  5KFA A;  4O3P A;  4B9M A;  3RH5 A;  4O3R A;  2KFZ A;  7ICU A;  4RQ0 A;  1ZQZ A;  1BPE A;  4JWM A;  3Q8Q B;  4Q8F A;  5DG9 A;  4RQ3 A;  3RJK A;  4EEY A;  4YXJ A;  4J9M A;  3RR7 A;  4ECY A;  4QW9 A;  4F4K A;  2F1J A;  3IHQ B;  3AU6 A;  1ZJN A;  1Z00 B;  1QLN A;  5KG1 A;  5KFS A;  5KT7 A;  1X9S A;  5KFX A;  3RB6 A;  5KT3 A;  4C8O A;  5L9X A;  4QWC A;  9ICT A;  3FDS A;  3PMN A;  4KLQ A;  2XY7 A;  3UXN A;  4K4G A;  4M0A A;  5KT2 A;  4UB4 A;  3GIM A;  1MQ2 A;  1NK8 A;  3RJJ A;  1TV9 A;  4F2S A;  2AJQ A;  2BR0 A;  1HJP A;  2PXI A;  4F4X A;  4RPZ A;  4F3O A;  9ICL A;  1NJW A;  4I28 A;  2ZJ8 A;  4RUA A;  8ICK A;  3Q8S B;  3TFS A;  1S0N A;  4P4P A;  4DQQ A;  2AGP A;  5KFY A;  4M9N A;  4QZD A;  5J2F A;  3SZ2 A;  5DGB A;  4YFK A;  3TAP A;  3RB0 A;  3PW0 A;  4TUQ A;  1K1S A;  3NGD A;  2A1J A;  2FPK A;  4DSF A;  5HNK A;  4Z6D A;  1ZQO A;  3PO4 A;  4J9L A;  4NY8 A;  5BOL A;  1NJZ A;  4RZR A;  4YP3 A;  1SL2 A;  5DBC A;  3MR2 A;  5CWR A;  4JV0 A;  3OHA A;  3MFI A;  1RXV A;  1ZQG A;  8ICM A;  3SV4 A;  4DL7 A;  1TKD A;  2ZTD A;  4O3O A;  2PI4 A;  5IIL A;  3IM1 A;  1SKW A;  7ICR A;  4YD1 A;  4MFC A;  4B9V A;  3C2M A;  3PW7 A;  3RJE A;  4GLX A;  1L5U A;  2BKE A;  4UB2 A;  4YQW A;  2NRT A;  4DLE A;  3C1Z A;  9ICG A;  3PW5 A;  4PGY A;  4Z6C A;  3JPR A;  3GV7 B;  2W9C B;  1X9W A;  4KLL A;  4I2G A;  2J6U A;  8ICQ A;  4YXM A;  5F9L A;  4EBD A;  3G6X A;  1ZQX A;  1QSL A;  2V9W A;  2ASL A;  4TUS A;  1TFR A;  4QZ8 A;  1BPZ A;  5J0T A;  4RNN A;  4I2B A;  1PZN A;  3M8R A;  4EZ6 A;  5J0Y A;  2XO7 A;  4CCH A;  2W9B B;  2KZZ A;  2FLP A;  2XC9 A;  4LVS A;  4DL6 A;  4UQG A;  4DQR A;  2AQ4 A;  9ICV A;  3EZ5 A;  4FBT A;  3C5G A;  4DL2 A;  3Q8K A;  3HPO A;  1K1Q A;  3GQC A;  3M9N B;  3QZ7 A;  4EBE A;  2DPJ A;  4RPX A;  9ICR A;  8ICY A;  4DFK A;  5F9N A;  1U49 A;  3MR3 A;  1ZQQ A;  8ICU A;  8ICF A;  4XUS A;  2MUT B;  3QEA Z;  3UXO A;  4KLT A;  3MDC A;  1JXL A;  1B22 A;  2ZUC A;  5KFU A;  4KLH A;  2M9N A;  3H8J A;  3QZ8 A;  2V4R A;  3PW2 A;  1RPL A;  2DPI A;  3EYZ A;  4KLD A;  4B9L A;  9ICA A;  5EOZ A;  5DDY A;  3UQ2 A;  2BPF A;  4B9T A;  4DOA A;  5EWF A;  3ZDB A;  1QSS A;  3GIL A;  9ICJ A;  4KMU A;  5EWE A;  4GXJ A;  2P66 A;  4C8L A;  4FS2 A;  2UVV A;  4RNM A;  2NRV A;  3OJS A;  5L1J A;  5L1I A;  1WCN A;  1SKR A;  3H4B A;  4DSE A;  3RTV A;  4X5V A;  5KG6 A;  4UB5 A;  5KG4 A;  5KFK A;  5J0W A;  3BQ2 A;  1ZET A;  1KRP A;  2IMW P;  9ICK A;  5KFF A;  4J9K A;  4I29 A;  4M04 A;  1A77 A;  3MR5 A;  1MQ3 A;  4KN4 A;  3SV3 A;  3RJF A;  1ARO P;  4DQP A;  4IQU A;  3RH6 A;  4M9G A;  1ZQK A;  4PPX A;  4RQ5 A;  3MDA A;  2FLN A;  3RBE A;  2JEJ A;  4NM1 A;  1QSY A;  4UAY A;  4QZF A;  3TI0 A;  4KLI A;  2C2D A;  1ZQT A;  5KFL A;  1NKC A;  1ZQD A;  4NLG A;  1JIH A;  4YMM A;  3MFH A;  4J9Q A;  7ICV A;  3K75 D;  4PH5 A;  1JX4 A;  2FMS A;  1X9M A;  2KZM A;  7ICF A;  4C8N A;  1SZP A;  9ICF A;  3AUO A;  9ICW A;  4QZB A;  1ZQS A;  5KFC A;  1ZQC A;  7ICS A;  1ZJM A;  1ZQH A;  4DEZ A;  2UVW A;  3EW9 A;  3TAQ A;  2AQ0 A;  4ECX A;  1RYR A;  7ICM A;  1S77 D;  1S76 D;  4RQ6 A;  5J2H A;  3GFK B;  4J9P A;  4C8M A;  2JEF A;  8ICT A;  4RPY A;  4PHP A;  4R63 A;  1ZQB A;  2BHN A;  1KEJ A;  3LWL A;  3TQ1 A;  4KLO A;  4M6W B;  8ICX A;  2BQU A;  3RRH A;  2MAX A;  4ECR A;  1T7P A;  5DBB A;  4KN7 A;  3JPP A;  2HW3 A;  4K4H A;  1RXW A;  7ICN A;  3KTQ A;  4UAW A;  4GC6 A;  2MUT A;  2VA3 A;  4TUR A;  9ICN A;  2NRX A;  1N48 A;  2J6T A;  7ICT A;  5J29 A;  3V7L A;  1BPB A;  1D8Y A;  5DKW A;  4YVZ A;  3T5H A;  4F5N A;  3TAN A;  2FMQ A;  4R66 A;  2NRZ A;  4F92 B;  3H40 A;  3UPQ A;  7ICH A;  4YR2 A;  5EWG A;  2R8I A;  4R64 A;  5DQI A;  4O5E A;  4ECS A;  4M9L A;  5J2J A;  2BQR A;  4UB3 A;  5HHI A;  2BQ3 A;  4DSJ A;  4Q45 A;  1U45 A;  4JK1 A;  8ICE A;  2PFO A;  5J0Q A;  2JZB A;  4ZH4 A;  5KFO A;  1RZT A;  2IA6 A;  1NKE A;  4IQT A;  4I2H A;  3M8S A;  4I2C A;  9ICB A;  1ZQA A;  2HHQ A;  5D46 A;  4R65 A;  2AU0 A;  3NTU A;  4NM2 A;  3KHL A;  2W9B A;  4UBC A;  1KFT A;  1U47 A;  8ICC A;  4QWA A;  4EYH B;  4ECT A;  2FLL A;  4B9U A;  1SL1 A;  2W9C A;  1NK7 A;  4UBB A;  2W9A A;  1ZYQ A;  3N97 B;  1ZQR A;  4KLS A;  2ZJA A;  4P4M A;  3OGU A;  3ZD8 A;  4QZE A;  5TZV A;  1UA1 A; 
#chains in the Genus database with same CATH topology
 4DOB A;  4F93 B;  2N1R A;  5J2A A;  4J9N A;  4RT3 A;  8ICP A;  4F5P A;  4EBC A;  1L7M A;  2GLE A;  3ZDA A;  5GTI U;  4US8 A;  1MSW D;  4YMO A;  5KFR A;  3H8W A;  1FFV A;  1FO4 A;  9ICM A;  1L3S A;  2RDI A;  2W8L A;  4DFP A;  5KFH A;  1ZQN A;  1X66 A;  2BGW A;  5D49 A;  5KFW A;  2Q4T A;  4RQ4 A;  4OO1 J;  1PVQ A;  5DDM A;  1AQ6 A;  1ZXI A;  3JPT A;  5KFT A;  1HEK A;  2O6K A;  3F2B A;  8ICN A;  8ICH A;  1YZ6 A;  1J2M A;  1U4B A;  1XC9 A;  1QCK A;  7ICE A;  2F76 X;  5KG3 A;  4RQ7 A;  5III A;  3C28 A;  3RB3 A;  1D8B A;  1HUO A;  3RAQ A;  4Y2J A;  1SXE A;  2IOH A;  4LZG A;  3RJI A;  4B9S A;  4BGD A;  8ICA A;  3H0M B;  2F3N A;  2K8A A;  4XRH A;  4KLG A;  5DB9 A;  5EE3 A;  4CGZ A;  1LV5 A;  3ZD9 A;  5DG7 A;  4FBU A;  4UAT A;  1NK4 A;  2K4H A;  1L3T A;  3BDP A;  3OHB A;  3TKA A;  4YR3 A;  1IV8 A;  2R8G A;  2FI1 A;  1ZRM A;  9ICQ A;  2BCQ A;  1LKY B;  3PSP A;  4FE3 A;  1Q3V A;  5KT4 A;  1TK5 A;  3PNC A;  1Y88 A;  3S6J A;  4G3I A;  5KL1 B;  3V6K A;  3Q8L A;  2CN1 A;  2ZJ5 A;  5J8Y C;  3SQI A;  4IRC A;  4PGX A;  3LVW A;  2NV3 A;  3B0Y A;  2OWO A;  4F8R A;  5B66 U;  2IOF K;  3BQ1 A;  5AI8 A;  1YZ7 A;  1WCL A;  1X6I A;  4FO6 A;  3H7I A;  4QZC A;  1NOM A;  2IBK A;  2R8J A;  4CRX A;  3Q8R B;  2KTQ A;  1QQ6 A;  3FC4 A;  4QZA A;  2OCE A;  5IIJ A;  1ZQV A;  2ES6 A;  3C1Y A;  5KFG A;  3HRD D;  4IQV A;  2PFQ A;  4B9N A;  4F4W A;  3RRG A;  4CE6 A;  4I2J A;  3RR8 A;  4MHV A;  4ZOH C;  4LJX A;  2ZIW B;  5ALE A;  2C28 A;  4OJP A;  2KN7 A;  5ALX A;  2HVI A;  2JRZ A;  3I1Y A;  5J2C A;  4LZD A;  5CP2 A;  2K4I A;  5KFZ A;  4KIT B;  4F4Y A;  2D8C A;  2JHD A;  1ZQY A;  3NRW A;  5KG7 A;  2AH5 A;  3QUQ A;  3EPI A;  1VLB A;  4FS1 A;  2WHE A;  1NK0 A;  4QZI A;  2ESE A;  3QEB Z;  1XWL A;  3JPO A;  1S9F A;  4J9O A;  4BWM A;  1UA0 A;  3H8S A;  1MC8 A;  1BNP A;  2V4Q A;  4EZ9 A;  2W3R A;  4R8U B;  4DS5 A;  2YMM A;  3M9M B;  2I9G A;  1IG6 A;  4DL4 A;  2W3S A;  4AYB C;  2JZB B;  2Y1I A;  2YB1 A;  2EAN A;  3ETL A;  2P6U A;  5J2K A;  4KX5 A;  4KLM A;  4I2D A;  3QUB A;  4O9M A;  4C8K A;  2FPL A;  1RYS A;  2CRX A;  4GC7 A;  3UMG A;  5HP4 A;  2G5I B;  2J6S A;  5EE0 A;  3PX4 A;  1KFS A;  2EAP A;  1ZQM A;  1DGS A;  4B9M A;  4O3R A;  1L3U A;  7ICU A;  2KFZ A;  2ZIU A;  1ZQZ A;  1BPE A;  5DG9 A;  4RQ3 A;  2OYY A;  4J9M A;  3RR7 A;  4ECY A;  4QW9 A;  2F1J A;  3AU6 A;  1L7N A;  3O0F A;  2Y0S F;  5KT7 A;  1X9S A;  3TAD C;  5AKL A;  4KLQ A;  4RQN A;  3MGV A;  4F2S A;  2BR0 A;  4F3O A;  8ICK A;  2RP5 A;  4DQQ A;  2AGP A;  3QNM A;  2KV2 A;  4TUQ A;  3NGD A;  4PL1 A;  2FPK A;  1ZQO A;  4NY8 A;  4J9L A;  1NJZ A;  2G5H B;  4JV0 A;  3MFI A;  1ZQG A;  3M6Z A;  4DL7 A;  2PI4 A;  3IM1 A;  2W7O A;  3PW7 A;  2WF5 A;  4GLX A;  4U7C A;  4YQW A;  1ZD2 P;  5ALS A;  1L6N A;  3C1Z A;  9ICG A;  4Z6C A;  2J6U A;  1LKY A;  8ICQ A;  3G6X A;  1ZQX A;  5L1M A;  2HBL A;  2V9W A;  1BPZ A;  2KSO A;  4I2B A;  4CCH A;  3BZK A;  4C4T A;  3C29 A;  2B6G A;  4LVS A;  1IIP A;  5CRX A;  3C5G A;  3GQC A;  3M9N B;  8ICY A;  2LKY A;  4XUS A;  4KLT A;  3MDC A;  1B22 A;  3PW2 A;  2YTU A;  1RPL A;  5EOZ A;  5DDY A;  2I5H A;  2PMZ F;  5AKZ A;  4B9T A;  5EWF A;  3F53 A;  2MRL A;  2P66 A;  3WKA A;  4FZN A;  4C8L A;  4FS2 A;  3D2N A;  5HR6 A;  3OJS A;  2NRV A;  3MC1 A;  1SKR A;  4X5V A;  3H4B A;  2KJ5 A;  1KRP A;  4UB5 A;  9ICK A;  5KFF A;  4J9K A;  2VJ5 A;  4I29 A;  1MQ3 A;  3WK4 A;  4DQP A;  4M9G A;  1UQV A;  2KK0 A;  4UAY A;  3TI0 A;  5KFL A;  5ALN A;  4NLG A;  4YMM A;  7ICV A;  2FMS A;  1X40 A;  3AUO A;  5KFC A;  4DEZ A;  2HBK A;  1RYR A;  1S77 D;  7ICM A;  1S76 D;  8ICT A;  4J9P A;  2JEF A;  4PHP A;  2BHN A;  2AHO B;  4KLO A;  2E8N A;  4M6W B;  4ECR A;  1T7P A;  3JPP A;  4K4H A;  2VA3 A;  5J29 A;  3V7L A;  1URJ A;  3TAN A;  2FMQ A;  4O5E A;  4R64 A;  5DQI A;  5HHI A;  2BQ3 A;  2YX8 A;  1U45 A;  8ICE A;  3ED5 A;  2G0A A;  3HKZ C;  1FIQ A;  3KD3 A;  1NKE A;  9ICB A;  2KSO B;  2LMR A;  3WK8 A;  1S5L U;  4R65 A;  3SEN A;  3KZI U;  1KFT A;  3ICX A;  4QWA A;  1ZRN A;  1WYG A;  1ZQR A;  2K60 A;  3OGU A;  4QZE A;  2QAR A;  3FAH A;  1N63 A;  4I27 A;  4O5C A;  1V38 A;  8ICL A;  2DWQ A;  3PR5 B;  1N56 A;  3RF9 A;  5AM5 A;  4DL3 A;  4GFJ A;  4NWI A;  4MEY A;  2QB0 B;  3NVZ A;  2EAM A;  2IOF A;  5AM0 A;  8ICO A;  1J2N A;  4ED7 A;  2Q0Z X;  5D4B A;  4F5R A;  2HHS A;  1UT5 A;  4EX7 A;  1U9L A;  1F5S A;  3ALR A;  5AK5 A;  2F2A B;  5HML A;  1JXE A;  2BZF A;  3ZDE A;  3BS7 A;  2EAO A;  1DK2 A;  1T3Q A;  4MFF A;  4KLE A;  2ASD A;  8ICI A;  4ACO A;  5KFE A;  2ZIU B;  3THV A;  1ZQL A;  3OTQ A;  2C22 A;  1KSP A;  4MFA A;  3PVX A;  4O3N A;  5ALW A;  3RBD A;  3KHG A;  3QU2 A;  7ICK A;  2HCF A;  4TQS A;  5J2B A;  1BPY A;  5L1L A;  2YMQ A;  1JN3 A;  3V6J A;  5JU5 A;  4C4R A;  1KL9 A;  3T5L A;  2Y1J A;  1NI3 A;  5KFI A;  3HWT A;  4BX9 C;  3H8M A;  1A0P A;  3EUB 2;  5AM4 A;  4QZG A;  5JRT A;  3T5J A;  2PKE A;  3JPN A;  1NK6 A;  9ICC A;  8ICW A;  4IRD A;  3N4M B;  2W7P A;  2GWS A;  3M7D A;  1IM4 A;  4RU9 A;  3LK9 A;  3TFR A;  3I28 A;  4ELU A;  1SGG A;  5EE1 A;  3FYH A;  1U48 A;  2HDO A;  1NJX A;  4YN4 A;  3H4D A;  2MU2 A;  4DL5 A;  2ATL A;  1OW5 A;  1XS9 D;  1IXR A;  1WUD A;  2XCP A;  4OJL A;  2BCV A;  1NJY A;  2VAN A;  1NK9 A;  3QU9 A;  2K8C B;  2RDJ A;  4I2A A;  2XY6 A;  2DGZ A;  4ED2 A;  1KLN A;  4KTQ A;  4O3Q A;  4TQR A;  3LDA A;  1F0M A;  2A1J B;  2ZIW A;  2E1E A;  2DKX A;  1MN8 A;  5J2I A;  3PX0 A;  4IS7 A;  3CYM A;  4UB1 A;  4IQW A;  5AKI A;  2A3V A;  3SI8 A;  3GV5 B;  4UAS A;  4BWJ A;  3GDX A;  1S0V A;  2HBM A;  2ISO A;  2XIC A;  4PL2 A;  1RG6 A;  2JGA A;  2DF4 B;  1Z3E B;  2BDP A;  1ZQU A;  2HHT A;  7ICO A;  4BXO A;  2Y9T A;  2H5X A;  3PO5 A;  3QU4 A;  2I1Q A;  2VKQ A;  5KT6 A;  3ISB A;  1RDF A;  4MEX A;  1KN5 A;  4RQM A;  2KIC A;  2A19 A;  5J0P A;  3SMV A;  3KFU F;  2ZTE A;  3OSN A;  4ED0 A;  4BDP A;  3KKA C;  9ICP A;  9ICH A;  4O0I A;  1J97 A;  2F1H A;  1CEZ A;  5KL8 B;  4M2Y A;  4ELV A;  2KOB A;  3RJG A;  4CNQ A;  1L7P A;  1TAU A;  4DCC A;  2YQE A;  1BPX A;  2XGP A;  3F5E A;  1KFD A;  2JEI A;  2XCA A;  1QH9 A;  4PHA A;  1TAQ A;  2JR5 A;  8ICB A;  1RM6 C;  3SYZ A;  2DFL A;  3KHR A;  2ASJ A;  5AM1 A;  5DB6 A;  4C0Z A;  2WAQ C;  1KTQ A;  2LYH A;  3K1Z A;  1BVS A;  4Q8E A;  2YML A;  2ZUB A;  3F2D A;  3BZC A;  3G6Y A;  2YN4 A;  2A1A A;  4QZH A;  2GOL A;  3ISC A;  3ETR A;  4MF2 A;  1VJ5 A;  1DOQ A;  2MA1 A;  1COO A;  4M9H A;  7ICQ A;  3Q8P B;  4KMO B;  3V72 A;  1ED1 A;  4JV1 A;  1QQ5 A;  1NZB A;  4DSI A;  1JAL A;  4C4S A;  5J0S A;  3MR6 A;  4O3P A;  1N2X A;  2K89 A;  3AQE A;  4JWM A;  3RJK A;  4F4K A;  5K4L A;  4F71 A;  3R9K A;  5KFX A;  4C8O A;  2E1F A;  2F44 A;  3N7P D;  3UXN A;  5KT2 A;  2AJQ A;  1TV9 A;  3RFA A;  4OJ5 A;  2PXI A;  4RPZ A;  2ZJ8 A;  1BNO A;  1Z19 A;  1TE2 A;  4M9N A;  4QZD A;  2EDU A;  5AKG A;  3PW0 A;  1K1S A;  3UM9 A;  3PO4 A;  4Z6D A;  5BOL A;  4RZR A;  4YP3 A;  3CW2 C;  3MR2 A;  5CWR A;  8ICM A;  1TKD A;  1JRO A;  5ALH A;  5IIL A;  3NUQ A;  2OXO A;  2MSN A;  4MFC A;  3C2M A;  5ALR A;  4DLE A;  4ICA A;  3JPR A;  4I2G A;  4Y2Q A;  1V85 A;  2ZIX B;  4EBD A;  3DV9 A;  3LYS A;  1TFR A;  4RNN A;  2HOI A;  4US9 A;  5ALT A;  4EZ6 A;  1F44 A;  2JH1 A;  3AQF A;  4DL6 A;  2LPE A;  3EZ5 A;  3IG8 A;  2F8L A;  4PZO A;  1ZD5 A;  3QZ7 A;  4EBE A;  4P0Q A;  1X6J A;  4RPX A;  2RRD A;  1U49 A;  5AHX A;  1JXL A;  1DK3 A;  2M9N A;  3QZ8 A;  2CPR A;  9ICA A;  4B9L A;  4EEL A;  3UQ2 A;  3SEI A;  4Y2U A;  4KMU A;  1O08 A;  5ALY A;  2UVV A;  2G07 A;  5L1I A;  4NLZ A;  5KG6 A;  2IMW P;  5KFK A;  4JMU A;  3RJF A;  4KN4 A;  3SV3 A;  4RQ5 A;  4NM1 A;  5AK3 A;  1QSY A;  4KLI A;  3WKC A;  1DGJ A;  4J9Q A;  4NL9 A;  1T94 A;  7ICF A;  3PSI A;  9ICW A;  2KJ9 A;  2AQ0 A;  1UHU A;  5ALQ A;  1N62 A;  5ALD A;  2Y9U A;  4R63 A;  1V97 A;  1KEJ A;  2DUY A;  5EE9 A;  2BQU A;  5DBB A;  4KN7 A;  7ICN A;  3KTQ A;  4UAW A;  4QNL A;  9ICN A;  2NRX A;  3J81 j;  1PK1 A;  4YVZ A;  3T5H A;  3BQ7 A;  5E79 U;  3H40 A;  3WKE A;  4FZL A;  4YR2 A;  2R8I A;  1Z4O A;  4ECS A;  4DSJ A;  4JK1 A;  2PFO A;  2DL0 A;  4ZH4 A;  1RZT A;  1Q3U A;  5ALF A;  2WF9 A;  1ZQA A;  4Y2V A;  5D46 A;  5AM3 A;  4UB6 U;  4EYH B;  2FLL A;  4B9U A;  1SL1 A;  2W9C A;  4UBB A;  2W9A A;  1ZYQ A;  3VC8 A;  3N97 B;  4KLS A;  2ZJA A;  2ZIX A;  3QU7 A;  1JI7 A;  5KG0 A;  1HIW A;  1CRX A;  1SV0 A;  5IIM A;  1XNS A;  9ICE A;  1JRP A;  3IDW A;  5AKJ A;  4M47 A;  3WKB A;  5ALU A;  3EWA A;  1V9P A;  3VCB A;  4I2I A;  3H0R B;  2HHV A;  2PI5 A;  5KAI U;  2JV3 A;  3AM9 A;  1UT8 A;  3SR6 A;  4IR9 A;  1L8O A;  2CXY A;  2KZ3 A;  3RAX A;  2FPM A;  2E3T A;  3HT3 A;  1Z00 A;  3JPS A;  3NAS A;  2YMP A;  5AM2 A;  5AIC A;  3FM9 A;  2RQ5 A;  1ZQI A;  5DB8 A;  2ALZ A;  3UQ0 A;  2R8K A;  5T14 A;  5KFP A;  3BQ0 A;  5IIO A;  1XSP A;  4JV2 A;  5G5G A;  1SKS A;  3H0L B;  2B21 A;  1Z1V A;  4CDG A;  2ZXH A;  4Z6F A;  3PX6 A;  4AP9 A;  2ZUD A;  5BOM A;  3E0F A;  4JB3 A;  8ICV A;  4QWD A;  2WTF A;  1L7O A;  4BJQ A;  3TAR A;  4ED6 A;  2ZTC A;  1H38 A;  2AGO A;  4G9B A;  3C23 A;  2BPC A;  4Q43 A;  3HP6 A;  5KFV A;  4DFJ A;  4ED1 A;  4OJ6 A;  1N5W A;  4EYI B;  2ZIV B;  3T79 A;  5DGA A;  1S0O A;  2IHM A;  1RQN A;  4RQ1 A;  3MBY A;  3KKA A;  3V7J A;  5L1K A;  4Z6E A;  4BUG A;  1TK0 A;  3HW8 A;  3V6H A;  4B6J A;  3CP8 A;  3GV8 B;  3D2S A;  3LVV A;  4HAI A;  4E0D A;  2ZIV A;  3A0B U;  3K4G A;  3T3F A;  1D9F A;  3BQT A;  2LBO A;  5IIK A;  4YD2 A;  1B43 A;  3WK5 A;  7ICP A;  3NVY A;  4DOC A;  1YT3 A;  1S8O A;  5J0U A;  3M9O B;  4JWN A;  1RQL A;  4ECV A;  3I76 A;  1X2I A;  5KFN A;  1M6Y A;  3UXP A;  5J0O A;  3NS1 A;  5JUM A;  2KHQ A;  1FFU A;  1A6S A;  5HMM A;  1KW4 A;  1MA7 A;  5J2G A;  3ZDC A;  3WKD A;  2W03 A;  3DEE A;  2R8H A;  3GII A;  1BPD A;  2OH2 A;  4DFM A;  4BXO B;  4O5K A;  2HI0 A;  3M6K A;  2KJ8 A;  4ECQ A;  4MF8 A;  1SV4 A;  2KD1 A;  5ALI A;  5KFM A;  5AKH A;  3V7K A;  4Y2P A;  4Y2T A;  7ICJ A;  1Z4N A;  2HHU A;  5FP0 A;  3RH4 A;  3SD7 A;  2UVU A;  2F1I A;  5KT5 A;  5KAF U;  5CHG A;  4ED3 A;  2OM6 A;  4DQS A;  2P6R A;  2EZZ A;  3OJU A;  4DS4 A;  2OEH A;  4K4I A;  2G09 A;  4F72 A;  3SAG A;  5KG5 A;  3AN1 A;  2DBY A;  5HR7 A;  2FMP A;  2C2E A;  2YB4 A;  1TK8 A;  5G5H A;  1T3N A;  2H3V A;  2M0N A;  3HKZ F;  4F50 A;  4P2H A;  4F4Z A;  3F2C A;  2XVT A;  4EEN A;  2HHX A;  3KOO A;  3B0X A;  8ICR A;  1UCV A;  5ALP A;  8ICZ A;  4QW8 A;  3PST A;  4C80 A;  3HX0 A;  3MGH A;  1NKB A;  2KVS A;  3PR4 A;  1VDV A;  1ZQW A;  2LI6 A;  7ICL A;  5C0Y A;  5ALM A;  5CR0 A;  5KFQ A;  5F3X B;  9ICI A;  1SZH A;  4YG2 A;  5DQG A;  3OSP A;  1N60 A;  1S97 A;  1ZOL A;  4EEK A;  2LYB A;  2ISP A;  5AI0 A;  5ALK A;  4YMN A;  2KVC A;  2HMX A;  5J0R A;  5KFA A;  2H3Z A;  4RQ0 A;  1SWW A;  4Q8F A;  2XI9 A;  4YXJ A;  3HJE A;  3IHQ B;  1ZJN A;  5KFS A;  3RB6 A;  5KT3 A;  2OHF A;  2KIV A;  9ICT A;  3FDS A;  3PMN A;  2XY7 A;  4K4G A;  4M0A A;  4UB4 A;  3RJJ A;  2E8M A;  1HJP A;  9ICL A;  1NJW A;  4RUA A;  3Q8S B;  3TFS A;  4P4P A;  5J2F A;  3SZ2 A;  5DGB A;  3TAP A;  5ALO A;  2KP7 A;  4UAV A;  3BS5 A;  5DBC A;  5AI9 A;  3OHA A;  1RXV A;  3N28 A;  3DDH A;  4UAU A;  1SB3 C;  5AK6 A;  1SKW A;  7ICR A;  4YD1 A;  4B9V A;  3RJE A;  1L5U A;  2BKE A;  4UB2 A;  4KLL A;  4NJ8 A;  4P0Q B;  4YXM A;  5F9L A;  1KBU A;  4QZ8 A;  4Y2S A;  5AI6 A;  5J0Y A;  1Q8K A;  4CF3 A;  2KZZ A;  2AQ4 A;  4DL2 A;  1K1Q A;  2ZG6 A;  4EX6 A;  1OXJ A;  9ICR A;  3U26 A;  3IV6 A;  3WK9 A;  2LM4 A;  3CNH A;  4NLC A;  3QEA Z;  2MUT B;  3SAH A;  4PJ0 U;  2V4R A;  1PUZ A;  3ZI4 A;  4KLD A;  1DRG A;  2W55 A;  1ECW A;  3GIL A;  4P0P B;  1ZQ1 C;  4Y2X A;  4RNM A;  5L1J A;  4FBT A;  4DSE A;  1ZQC A;  5KG4 A;  1DXS A;  1ZET A;  5ALV A;  2GH1 A;  4UW9 A;  1A77 A;  3ONN A;  2RLT A;  1ARO P;  4IQU A;  3RH6 A;  3MDA A;  2KIW A;  5GTH U;  4QZF A;  2C2D A;  1WWV A;  3D6J A;  1C20 A;  2R18 A;  2Z7J A;  1JIH A;  3MFH A;  4PH5 A;  1JX4 A;  1X9M A;  2H3I A;  2QLT A;  1SZP A;  9ICF A;  3QX7 A;  1SWV A;  7ICS A;  2D3D A;  1ZJM A;  1ZQH A;  4P0P A;  4RQ6 A;  4C8M A;  1O03 A;  2RHF A;  3LWL A;  8ICX A;  1K5O A;  2MAX A;  2HW3 A;  2E8O A;  4GC6 A;  2MUT A;  1N48 A;  2J6T A;  2D6F C;  7ICT A;  1BPB A;  1D8Y A;  4WJ3 B;  2QKQ A;  4F5N A;  2JXJ A;  4R66 A;  1P7D A;  2NRZ A;  4F92 B;  3UPQ A;  7ICH A;  3L5K A;  3PZP A;  4NLB A;  5J2J A;  2BQR A;  4UB3 A;  4Q45 A;  2WF6 A;  5J0Q A;  4I2H A;  3M8S A;  3HIL A;  2WF7 A;  2HHQ A;  4NM2 A;  3KHL A;  4UBC A;  1U47 A;  5B5E U;  4ECT A;  2W43 A;  2WAQ F;  3CRX A;  3K1R B;  3ZD8 A;  5ALL A;  1PK1 B;  2FJ6 A;  3A0H U;  4GXK A;  5C5J A;  4ECW A;  4NLN A;  4F5Q A;  4RNO A;  4XA5 A;  4IR1 A;  4DO9 A;  3BS5 B;  4TUP A;  2PMZ C;  3TAD A;  5KTQ A;  1KDH A;  1T4G A;  3GIJ A;  2WB1 F;  4RT2 A;  2E8P A;  5A0L A;  4F5O A;  5AIA A;  1GO3 F;  4J9S A;  4DQI A;  2BCS A;  1CUK A;  3D2Q A;  9ICX A;  5J2D A;  2QB1 A;  4JUZ A;  2W9M A;  1BGX T;  4DSK A;  5DBA A;  5BPC A;  4ED8 A;  2LM1 A;  2NYV A;  1S10 A;  4QIW C;  2NO4 A;  2Y0S C;  3C5F A;  4GIB A;  4DF4 A;  5KFJ A;  5IIN A;  2JMG A;  3C21 A;  1CI4 A;  3WK7 A;  2KMD A;  5DLG A;  1T8E A;  5CA7 A;  1NK5 A;  5ALZ A;  4IL6 U;  2C2R A;  5KNI A;  1SL0 A;  2DQN B;  4KLF A;  4KX3 A;  3QE9 Y;  4M9J A;  1C7Y A;  2ZXI A;  4ECZ A;  3IG5 A;  2VA2 A;  3NVW A;  2P35 A;  2K8B B;  3PY8 A;  2KFN A;  4PHD A;  1A76 A;  7ICI A;  2JEG A;  2I6X A;  3AU2 A;  4DLG A;  2F8K A;  4RQ2 A;  4R8U A;  1XU4 A;  2K4P A;  8ICJ A;  1EXN A;  2HSZ A;  3C2L A;  2HBJ A;  5J0X A;  5CJ7 A;  1ZQE A;  2BCR A;  1SXD A;  3MAB A;  3G6V A;  1PK3 A;  3QUT A;  3PV8 A;  2E5S A;  4IRK A;  1PVP A;  4NLK A;  2F77 X;  1TVA A;  1ZD4 A;  3PML A;  3C2K A;  1QTM A;  2KKP A;  3WU2 U;  1LVH A;  4KLJ A;  2G08 A;  4A8E A;  3E2E A;  1ZQP A;  4DWI A;  5KFB A;  5DLF A;  1D8L A;  1ZQJ A;  4DSL A;  5AKY A;  2VA8 A;  5DB7 A;  5DQH A;  1HUZ A;  4J9R A;  2UVR A;  1LB2 B;  2AXT U;  2KEY A;  3EPG A;  3BJY A;  3E58 A;  1ZD3 A;  2XY5 A;  9ICS A;  5DG8 A;  1NNL A;  5AK4 A;  2KKV A;  2ODG A;  3T5K A;  3B9J A;  3AEV A;  9ICU A;  4C7Y A;  4ELT A;  4PHE A;  2JH7 A;  3Q8M A;  5J8Y A;  3QU5 A;  4UAZ A;  4P4O A;  4RQ8 A;  1S0M A;  3NRZ A;  3ORY A;  3PSF A;  4Q44 A;  2EQY A;  4KLU A;  2VIX A;  4QWB A;  5J2E A;  3QYP A;  5KG2 A;  2QB0 A;  3PW4 A;  3IP4 B;  4YR0 A;  4I2F A;  3LWM A;  4XQ8 A;  4GXI A;  2NRW A;  9ICO A;  1D9D A;  5AKX A;  2W8K A;  3IRU A;  1QQ7 A;  4FZM A;  5KFD A;  4QWE A;  4PZN A;  5HHH A;  3ZDD A;  8ICS A;  1JMS A;  4PGQ A;  4IC9 A;  2VJ4 A;  1NZP A;  1XSN A;  3N7R C;  4YCX A;  1WWU A;  3NVV A;  2PFN A;  3KHH A;  4HYK A;  4I2E A;  2G06 A;  2BPG A;  4U6P A;  5CB1 A;  3MGI A;  2BCU A;  2PFP A;  3F5A A;  3OPX A;  2HVH A;  8ICG A;  4F91 B;  4F2R A;  4CF4 A;  3GZF A;  3RB4 A;  2EZY A;  2IHN A;  1XO1 A;  4OJO A;  4RUC A;  3ISD A;  1OUQ A;  4NXZ A;  3UMB A;  1ZQF A;  2AGQ A;  3M1Y A;  5TIS U;  3GIK A;  3RJH A;  1XSL A;  2YY6 A;  3N7S C;  4OD0 A;  4DF8 A;  4O3S A;  4QZ9 A;  3JPQ A;  4ECU A;  1L3V A;  2HHW A;  2LYA A;  2XGQ A;  4M6W A;  2FE9 A;  2HOQ A;  2WF8 A;  3RH5 A;  1UPH A;  2BDU A;  3Q8Q B;  4CF5 A;  2HOF A;  2KE7 A;  4EEY A;  2XID A;  4Y2R A;  1Z00 B;  1QLN A;  5KG1 A;  4DFD A;  2W04 A;  5AI5 A;  5L9X A;  4QWC A;  2LHT A;  1SV0 C;  1XO0 A;  5AI4 A;  3GIM A;  1MQ2 A;  1NK8 A;  4F4X A;  4I28 A;  1S0N A;  4UAR A;  5KFY A;  3TAC B;  4YFK A;  3RB0 A;  2A1J A;  4DSF A;  5HNK A;  1SL2 A;  2L5Y A;  3SV4 A;  2ZTD A;  5JTI A;  4O3O A;  4QJF B;  2NO5 A;  1X9X A;  2EH9 A;  2NRT A;  5ALJ A;  4PGY A;  3PW5 A;  3GV7 B;  2W9C B;  1X9W A;  2KG5 A;  2KNJ A;  1QSL A;  2ASL A;  4TUS A;  4QIW F;  5J0T A;  1PZN A;  3M8R A;  1B0X A;  2XO7 A;  5AIB A;  5AKK A;  2W9B B;  2FLP A;  2XC9 A;  3UMC A;  1Z1B A;  4UQG A;  4DQR A;  9ICV A;  3Q8K A;  3GU3 A;  3L4P A;  3HPO A;  1SIJ A;  2DPJ A;  4DFK A;  5F9N A;  1N5X A;  1Q46 A;  3MR3 A;  1ZQQ A;  8ICU A;  8ICF A;  1KQQ A;  3UXO A;  1COK A;  2WB1 C;  5ALG A;  2ZUC A;  4NL9 C;  5KFU A;  4KLH A;  3H8J A;  2H3F A;  2W54 A;  2DPI A;  1WG8 A;  3EYZ A;  4O3M A;  2BPF A;  1FEZ A;  4DOA A;  3ZDB A;  1QSS A;  9ICJ A;  1RYU A;  5EWE A;  4GXJ A;  5H2F U;  3L3F X;  1WCN A;  3RTV A;  5J0W A;  3BQ2 A;  4M04 A;  3MR5 A;  4USA A;  4OCZ A;  1ZQK A;  2FLN A;  4PPX A;  3RBE A;  2JEJ A;  4Y2Y A;  7ICG A;  3AMZ A;  1ZQT A;  3QXG A;  1NKC A;  5AKE A;  1ZQD A;  1X42 A;  3QUC A;  3K75 D;  3AL0 B;  2KZM A;  4C8N A;  3KZX A;  4QZB A;  1ZQS A;  2K4E A;  2UVW A;  2DKZ A;  3EW9 A;  3TAQ A;  4ECX A;  2KHV A;  5J2H A;  3GFK B;  1L8L A;  4RPY A;  4J03 A;  2EZX A;  1ZQB A;  2B0C A;  3TQ1 A;  1JUD A;  3RRH A;  4AYB F;  2GO7 A;  3KBB A;  1RXW A;  5CEH A;  4TUR A;  4UB8 U;  5DKW A;  2QAR B;  2H3Q A;  2FDR A;  5EWG A;  4M9L A;  3IN5 A;  1N61 A;  2JZB A;  4FFD A;  5KFO A;  1PVR A;  2IA6 A;  4C7Z A;  4IQT A;  4I2C A;  2AU0 A;  2W11 A;  3NTU A;  2W9B A;  8ICC A;  3SAF A;  1TAM A;  1NK7 A;  1KKX A;  4P4M A;  4NV0 A;  5TZV A;  3WK6 A;  1B4F A;  1UA1 A;  2WFA A; 
#chains in the Genus database with same CATH homology
 4DOB A;  4F93 B;  5J2A A;  5KG0 A;  4I27 A;  4J9N A;  4GXK A;  4O5C A;  8ICL A;  5C5J A;  4RT3 A;  8ICP A;  4ECW A;  3PR5 B;  4NLN A;  4F5P A;  4EBC A;  1N56 A;  4F5Q A;  4RNO A;  4XA5 A;  4IR1 A;  4DO9 A;  4DL3 A;  3ZDA A;  4TUP A;  1MSW D;  5IIM A;  4YMO A;  4MEY A;  9ICE A;  5KFR A;  3H8W A;  5KTQ A;  1KDH A;  4M47 A;  1T4G A;  3GIJ A;  9ICM A;  1L3S A;  2RDI A;  1V9P A;  3EWA A;  2W8L A;  4DFP A;  4I2I A;  5KFH A;  1ZQN A;  2HHV A;  8ICO A;  2BGW A;  5D49 A;  5KFW A;  2Q0Z X;  4RT2 A;  4ED7 A;  5D4B A;  2PI5 A;  4RQ4 A;  4F5R A;  2HHS A;  1UT5 A;  1UT8 A;  1U9L A;  4IR9 A;  4F5O A;  5DDM A;  4J9S A;  4DQI A;  2BCS A;  5HML A;  1CUK A;  3JPT A;  1JXE A;  2KZ3 A;  5KFT A;  4NLZ A;  3RAX A;  9ICX A;  2FPM A;  3ZDE A;  3HT3 A;  1Z00 A;  5J2D A;  3JPS A;  4JUZ A;  4MFF A;  8ICN A;  2W9M A;  4KLE A;  1BGX T;  8ICH A;  2ASD A;  8ICI A;  4DSK A;  1U4B A;  5DBA A;  5KFE A;  1XC9 A;  5BPC A;  4ED8 A;  7ICE A;  1S10 A;  1ZQI A;  5KG3 A;  4RQ7 A;  3THV A;  1ZQL A;  5DB8 A;  3C5F A;  2C22 A;  1KSP A;  2ALZ A;  4MFA A;  4DF4 A;  5III A;  5KFJ A;  5IIN A;  4O3N A;  3PVX A;  3RB3 A;  1HUO A;  3RBD A;  3C21 A;  3RAQ A;  3UQ0 A;  3KHG A;  4LZG A;  5DLG A;  7ICK A;  4TQS A;  1T8E A;  5J2B A;  3RJI A;  2R8K A;  1BPY A;  5CA7 A;  5KFP A;  3BQ0 A;  5L1L A;  4B9S A;  1JN3 A;  3V6J A;  4BGD A;  1NK5 A;  8ICA A;  5IIO A;  1XSP A;  4JV2 A;  1SKS A;  3T5L A;  2Y1J A;  2C2R A;  2B21 A;  5KFI A;  4XRH A;  4KLG A;  3HWT A;  4Z6F A;  3PX6 A;  2ZUD A;  5BOM A;  1SL0 A;  4KLF A;  3QE9 Y;  8ICV A;  5DB9 A;  4M9J A;  4QWD A;  1C7Y A;  4ECZ A;  2WTF A;  3TAR A;  4ED6 A;  2ZTC A;  1H38 A;  1LV5 A;  2VA2 A;  3ZD9 A;  4QZG A;  5DG7 A;  2AGO A;  3C23 A;  2BPC A;  4Q43 A;  3HP6 A;  3PY8 A;  4FBU A;  4PHD A;  5KFV A;  3T5J A;  2KFN A;  1A76 A;  4ED1 A;  3JPN A;  4DFJ A;  1NK4 A;  1NK6 A;  9ICC A;  4EYI B;  7ICI A;  2JEG A;  1L3T A;  3BDP A;  3OHB A;  3AU2 A;  4DLG A;  8ICW A;  5DGA A;  2IHM A;  4YR3 A;  1S0O A;  4RQ2 A;  2R8G A;  3N4M B;  4IRD A;  4R8U A;  4RQ1 A;  3MBY A;  3V7J A;  1XU4 A;  2GWS A;  8ICJ A;  1IM4 A;  1EXN A;  4RU9 A;  4Z6E A;  5L1K A;  1TK0 A;  9ICQ A;  3LK9 A;  3HW8 A;  3V6H A;  3TFR A;  3C2L A;  4ELU A;  2BCQ A;  3GV8 B;  4E0D A;  5J0X A;  3FYH A;  5KT4 A;  1U48 A;  1TK5 A;  5CJ7 A;  1ZQE A;  1NJX A;  3PNC A;  4YN4 A;  3H4D A;  3K4G A;  2BCR A;  1Y88 A;  4DL5 A;  3MAB A;  2ATL A;  4G3I A;  1XS9 D;  1IXR A;  3T3F A;  3G6V A;  3BQT A;  2XCP A;  5IIK A;  3PV8 A;  3V6K A;  1D9F A;  4IRK A;  4YD2 A;  1B43 A;  3Q8L A;  2BCV A;  4NLK A;  1NJY A;  2VAN A;  7ICP A;  1NK9 A;  1TVA A;  3PML A;  3C2K A;  4DOC A;  2ZJ5 A;  1QTM A;  2RDJ A;  5J0U A;  4I2A A;  2XY6 A;  3M9O B;  4IRC A;  4JWN A;  4ECV A;  4PGX A;  4ED2 A;  1KLN A;  1X2I A;  4KTQ A;  4O3Q A;  4TQR A;  3B0Y A;  4KLJ A;  3LDA A;  2OWO A;  5KFN A;  3E2E A;  1ZQP A;  4DWI A;  2A1J B;  3UXP A;  4F8R A;  5KFB A;  5DLF A;  1D8L A;  5J0O A;  5J2I A;  1ZQJ A;  4DSL A;  3BQ1 A;  3PX0 A;  5JUM A;  2VA8 A;  5DB7 A;  1WCL A;  5DQH A;  4UB1 A;  4FO6 A;  4IQW A;  1HUZ A;  5HMM A;  4J9R A;  3H7I A;  5J2G A;  3SI8 A;  1LB2 B;  4QZC A;  1NOM A;  3GV5 B;  2IBK A;  2UVR A;  3ZDC A;  2R8J A;  3Q8R B;  3EPG A;  4BWJ A;  3GDX A;  3GII A;  3BJY A;  2R8H A;  1S0V A;  2XY5 A;  2ISO A;  1BPD A;  2KTQ A;  9ICS A;  5DG8 A;  4DFM A;  4BXO B;  4QZA A;  4O5K A;  3T5K A;  9ICU A;  4ELT A;  5IIJ A;  1Z3E B;  4PHE A;  2BDP A;  4ECQ A;  1ZQV A;  1ZQU A;  4MF8 A;  5KFM A;  2HHT A;  7ICO A;  3V7K A;  3Q8M A;  3C1Y A;  5KFG A;  4BXO A;  4UAZ A;  4P4O A;  4IQV A;  2H5X A;  4RQ8 A;  2PFQ A;  2I1Q A;  3PO5 A;  4B9N A;  4F4W A;  5KT6 A;  1S0M A;  3ORY A;  7ICJ A;  2HHU A;  3RRG A;  4Q44 A;  4I2J A;  3ISB A;  3RH4 A;  4KLU A;  2UVU A;  2F1I A;  3RR8 A;  4MEX A;  4QWB A;  5KT5 A;  5J2E A;  5CHG A;  5KG2 A;  2C28 A;  5J0P A;  4YR0 A;  3PW4 A;  2KN7 A;  4ED3 A;  4I2F A;  2HVI A;  3LWM A;  4XQ8 A;  2ZTE A;  4GXI A;  2NRW A;  4DQS A;  2P6R A;  3OSN A;  4ED0 A;  4BDP A;  9ICO A;  1D9D A;  5J2C A;  3OJU A;  2W8K A;  4LZD A;  5CP2 A;  5KFZ A;  4KIT B;  4F4Y A;  4DS4 A;  9ICP A;  9ICH A;  1ZQY A;  4K4I A;  5KFD A;  5KG7 A;  5HHH A;  4O0I A;  4QWE A;  3ZDD A;  2F1H A;  5KG5 A;  1JMS A;  3EPI A;  8ICS A;  4PGQ A;  4FS1 A;  1CEZ A;  1NK0 A;  4QZI A;  1XSN A;  4M2Y A;  3QEB Z;  4ELV A;  4YCX A;  2FMP A;  2C2E A;  3RJG A;  1TK8 A;  1T3N A;  2PFN A;  3KHH A;  4F50 A;  4P2H A;  4F4Z A;  4HYK A;  4I2E A;  2HHX A;  1XWL A;  3B0X A;  2BPG A;  1TAU A;  8ICR A;  5CB1 A;  3JPO A;  2XGP A;  3MGI A;  4J9O A;  1S9F A;  1BPX A;  1KFD A;  2BCU A;  2PFP A;  8ICZ A;  4BWM A;  4QW8 A;  1UA0 A;  2JEI A;  2XCA A;  4PHA A;  1TAQ A;  3H8S A;  8ICB A;  1MC8 A;  3HX0 A;  3SYZ A;  3MGH A;  2V4Q A;  1NKB A;  4EZ9 A;  2HVH A;  2DFL A;  3KHR A;  4R8U B;  5DB6 A;  2ASJ A;  4DS5 A;  8ICG A;  3M9M B;  1KTQ A;  2I9G A;  3PR4 A;  2LYH A;  4DL4 A;  4F91 B;  4F2R A;  1ZQW A;  1BVS A;  2JZB B;  7ICL A;  4Q8E A;  3RB4 A;  2Y1I A;  2IHN A;  7ICG A;  1XO1 A;  2ZUB A;  4RUC A;  3ISD A;  1ZQF A;  4NXZ A;  3ETL A;  5J2K A;  2P6U A;  5CR0 A;  2AGQ A;  3G6Y A;  4KLM A;  4I2D A;  5KFQ A;  4O9M A;  4QZH A;  4C8K A;  3GIK A;  3RJH A;  2FPL A;  1XSL A;  3ISC A;  1RYS A;  9ICI A;  4YG2 A;  5DQG A;  3OSP A;  4MF2 A;  4DF8 A;  4O3S A;  4QZ9 A;  3JPQ A;  1S97 A;  4GC7 A;  4ECU A;  1L3V A;  5HP4 A;  1DOQ A;  2J6S A;  2ISP A;  1COO A;  4YMN A;  4M9H A;  2HHW A;  7ICQ A;  3Q8P B;  3PX4 A;  3V72 A;  4JV1 A;  2XGQ A;  1KFS A;  4DSI A;  4M6W A;  1ZQM A;  1DGS A;  5J0R A;  5J0S A;  3MR6 A;  1L3U A;  5KFA A;  4O3P A;  4B9M A;  3RH5 A;  4O3R A;  2KFZ A;  7ICU A;  4RQ0 A;  1ZQZ A;  1BPE A;  4JWM A;  3Q8Q B;  4Q8F A;  5DG9 A;  4RQ3 A;  3RJK A;  4EEY A;  4YXJ A;  4J9M A;  3RR7 A;  4ECY A;  4QW9 A;  4F4K A;  2F1J A;  3IHQ B;  3AU6 A;  1ZJN A;  1Z00 B;  1QLN A;  5KG1 A;  5KFS A;  5KT7 A;  1X9S A;  5KFX A;  3RB6 A;  5KT3 A;  4C8O A;  5L9X A;  4QWC A;  9ICT A;  3FDS A;  3PMN A;  4KLQ A;  2XY7 A;  3UXN A;  4K4G A;  4M0A A;  5KT2 A;  4UB4 A;  3GIM A;  1MQ2 A;  1NK8 A;  3RJJ A;  1TV9 A;  4F2S A;  2AJQ A;  2BR0 A;  1HJP A;  2PXI A;  4F4X A;  4RPZ A;  4F3O A;  9ICL A;  1NJW A;  4I28 A;  2ZJ8 A;  4RUA A;  8ICK A;  3Q8S B;  3TFS A;  1S0N A;  4P4P A;  4DQQ A;  2AGP A;  5KFY A;  4M9N A;  4QZD A;  5J2F A;  3SZ2 A;  5DGB A;  4YFK A;  3TAP A;  3RB0 A;  3PW0 A;  4TUQ A;  1K1S A;  3NGD A;  2A1J A;  2FPK A;  4DSF A;  5HNK A;  4Z6D A;  1ZQO A;  3PO4 A;  4J9L A;  4NY8 A;  5BOL A;  1NJZ A;  4RZR A;  4YP3 A;  1SL2 A;  5DBC A;  3MR2 A;  5CWR A;  4JV0 A;  3OHA A;  3MFI A;  1RXV A;  1ZQG A;  8ICM A;  3SV4 A;  4DL7 A;  1TKD A;  2ZTD A;  4O3O A;  2PI4 A;  5IIL A;  3IM1 A;  1SKW A;  7ICR A;  4YD1 A;  4MFC A;  4B9V A;  3C2M A;  3PW7 A;  3RJE A;  4GLX A;  1L5U A;  2BKE A;  4UB2 A;  4YQW A;  2NRT A;  4DLE A;  3C1Z A;  9ICG A;  3PW5 A;  4PGY A;  4Z6C A;  3JPR A;  3GV7 B;  2W9C B;  1X9W A;  4KLL A;  4I2G A;  2J6U A;  8ICQ A;  4YXM A;  5F9L A;  4EBD A;  3G6X A;  1ZQX A;  1QSL A;  2V9W A;  2ASL A;  4TUS A;  1TFR A;  4QZ8 A;  1BPZ A;  5J0T A;  4RNN A;  4I2B A;  1PZN A;  3M8R A;  4EZ6 A;  5J0Y A;  2XO7 A;  4CCH A;  2W9B B;  2KZZ A;  2FLP A;  2XC9 A;  4LVS A;  4DL6 A;  4UQG A;  4DQR A;  2AQ4 A;  9ICV A;  3EZ5 A;  4FBT A;  3C5G A;  4DL2 A;  3Q8K A;  3HPO A;  1K1Q A;  3GQC A;  3M9N B;  3QZ7 A;  4EBE A;  2DPJ A;  4RPX A;  9ICR A;  8ICY A;  4DFK A;  5F9N A;  1U49 A;  3MR3 A;  1ZQQ A;  8ICU A;  8ICF A;  4XUS A;  2MUT B;  3QEA Z;  3UXO A;  4KLT A;  3MDC A;  1JXL A;  1B22 A;  2ZUC A;  5KFU A;  4KLH A;  2M9N A;  3H8J A;  3QZ8 A;  2V4R A;  3PW2 A;  1RPL A;  2DPI A;  3EYZ A;  4KLD A;  4B9L A;  9ICA A;  5EOZ A;  5DDY A;  3UQ2 A;  2BPF A;  4B9T A;  4DOA A;  5EWF A;  3ZDB A;  1QSS A;  3GIL A;  9ICJ A;  4KMU A;  5EWE A;  4GXJ A;  2P66 A;  4C8L A;  4FS2 A;  2UVV A;  4RNM A;  2NRV A;  3OJS A;  5L1J A;  5L1I A;  1WCN A;  1SKR A;  3H4B A;  4DSE A;  3RTV A;  4X5V A;  5KG6 A;  4UB5 A;  5KG4 A;  5KFK A;  5J0W A;  3BQ2 A;  1ZET A;  1KRP A;  2IMW P;  9ICK A;  5KFF A;  4J9K A;  4I29 A;  4M04 A;  1A77 A;  3MR5 A;  1MQ3 A;  4KN4 A;  3SV3 A;  3RJF A;  1ARO P;  4DQP A;  4IQU A;  3RH6 A;  4M9G A;  1ZQK A;  4PPX A;  4RQ5 A;  3MDA A;  2FLN A;  3RBE A;  2JEJ A;  4NM1 A;  1QSY A;  4UAY A;  4QZF A;  3TI0 A;  4KLI A;  2C2D A;  1ZQT A;  5KFL A;  1NKC A;  1ZQD A;  4NLG A;  1JIH A;  4YMM A;  3MFH A;  4J9Q A;  7ICV A;  3K75 D;  4PH5 A;  1JX4 A;  2FMS A;  1X9M A;  2KZM A;  7ICF A;  4C8N A;  1SZP A;  9ICF A;  3AUO A;  9ICW A;  4QZB A;  1ZQS A;  5KFC A;  1ZQC A;  7ICS A;  1ZJM A;  1ZQH A;  4DEZ A;  2UVW A;  3EW9 A;  3TAQ A;  2AQ0 A;  4ECX A;  1RYR A;  7ICM A;  1S77 D;  1S76 D;  4RQ6 A;  5J2H A;  3GFK B;  4J9P A;  4C8M A;  2JEF A;  8ICT A;  4RPY A;  4PHP A;  4R63 A;  1ZQB A;  2BHN A;  1KEJ A;  3LWL A;  3TQ1 A;  4KLO A;  4M6W B;  8ICX A;  2BQU A;  3RRH A;  2MAX A;  4ECR A;  1T7P A;  5DBB A;  4KN7 A;  3JPP A;  2HW3 A;  4K4H A;  1RXW A;  7ICN A;  3KTQ A;  4UAW A;  4GC6 A;  2MUT A;  2VA3 A;  4TUR A;  9ICN A;  2NRX A;  1N48 A;  2J6T A;  7ICT A;  5J29 A;  3V7L A;  1BPB A;  1D8Y A;  5DKW A;  4YVZ A;  3T5H A;  4F5N A;  3TAN A;  2FMQ A;  4R66 A;  2NRZ A;  4F92 B;  3H40 A;  3UPQ A;  7ICH A;  4YR2 A;  5EWG A;  2R8I A;  4R64 A;  5DQI A;  4O5E A;  4ECS A;  4M9L A;  5J2J A;  2BQR A;  4UB3 A;  5HHI A;  2BQ3 A;  4DSJ A;  4Q45 A;  1U45 A;  4JK1 A;  8ICE A;  2PFO A;  5J0Q A;  2JZB A;  4ZH4 A;  5KFO A;  1RZT A;  2IA6 A;  1NKE A;  4IQT A;  4I2H A;  3M8S A;  4I2C A;  9ICB A;  1ZQA A;  2HHQ A;  5D46 A;  4R65 A;  2AU0 A;  3NTU A;  4NM2 A;  3KHL A;  2W9B A;  4UBC A;  1KFT A;  1U47 A;  8ICC A;  4QWA A;  4EYH B;  4ECT A;  2FLL A;  4B9U A;  1SL1 A;  2W9C A;  1NK7 A;  4UBB A;  2W9A A;  1ZYQ A;  3N97 B;  1ZQR A;  4KLS A;  2ZJA A;  4P4M A;  3OGU A;  3ZD8 A;  4QZE A;  5TZV A;  1UA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...