2JZBB

Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
b'GDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-directed RNA polymerase subunit alpha
publication title structural basis of transcription elongation control: the NusA-aCTD complex
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase/transcription
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2008-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2jzbB01
2ATLA 4KLDA 3JPOA 5EWFA 1WCNA 1RZTA 5KFAA 8ICTA 1MQ3A 4Q8EA 5J2BA 4F4YA 3BQ2A 4DS5A 4ECYA 2V9WA 4LZGA 3RJKA 4QW9A 2ASJA 2PFNA 3PR5B 4M2YA 1KSPA 3MGIA 1JXEA 2UVRA 4RQ5A 1V9PA 2M9NA 1QTMA 4DQPA 8ICZA 1ZJNA 4DL7A 2IHNA 5J0TA 4Z6EA 2BQUA 4J9QA 2XGQA 4DSFA 2R8KA 4NLKA 5HMMA 3EYZA 3TANA 1D9DA 4GLXA 3Q8LA 4B9LA 3PY8A 4J9PA 5L9XA 4QZAA 1Z00B 2AQ0A 4PH5A 3MR6A 3PW7A 1DOQA 2ZJ8A 3FYHA 4DQQA 2KFNA 5L1LA 5KFMA 4KLQA 1L3UA 4DSLA 4DEZA 4IQVA 5TZVA 2ASDA 4ZH4A 8ICOA 4F2SA 3GV7B 1L3VA 3RJIA 3MDAA 3T5KA 4M9JA 5DBBA 2Y1JA 5IINA 3JPSA 1SKRA 3RR7A 4IQWA 5J2FA 1ZQKA 4F91B 4R63A 4RQ2A 1U9LA 4GC7A 4RU9A 4RUCA 1KEJA 4PPXA 4F8RA 4FO6A 7ICNA 1ZQVA 2W9MA 2C2DA 5KG3A 4PHAA 5DQIA 2FPKA 5D46A 2XC9A 1ZJMA 3FDSA 2KZMA 8ICRA 4UAYA 3EW9A 3OHBA 4DFPA 1JX4A 5J0QA 1S97A 9ICXA 4LZDA 3V6JA 3Q8PB 4QZ9A 1SKSA 1ZQAA 4JV2A 4KLLA 3PR4A 5EWEA 3GIJA 2PXIA 1K1QA 4EYHB 2A1JA 1L3TA 1RPLA 2ZUDA 4QWCA 5J2GA 1D8LA 1UT8A 1NJYA 2W9CB 2R8GA 1C7YA 3HPOA 4DS4A 1MQ2A 4RQ7A 5KTQA 4UB1A 1SL1A 2V4RA 1X9MA 1NK0A 3MBYA 2XCPA 5KFVA 2PFOA 3SV4A 2JEFA 2B21A 2I9GA 5KG2A 4DL5A 3JPRA 4B9VA 5KFZA 2BCQA 7ICGA 9ICAA 2BR0A 4UAZA 2Y1IA 3AU6A 4RPXA 1MSWD 3PVXA 2RDIA 4QZDA 4B9SA 4K4GA 2RDJA 5KFNA 1ZQOA 3C2KA 4DL2A 1COOA 1S77D 2KFZA 5IIMA 2HW3A 8ICMA 5HHHA 1N48A 4MF2A 1TV9A 3ZDAA 7ICOA 9ICLA 5HP4A 3PW0A 4I2BA 3T5LA 5JUMA 5J2AA 4G3IA 2BCUA 2R8IA 3PO4A 5KG5A 4RQ1A 9ICUA 4ELUA 4YMNA 3HWTA 2AGQA 2ZTDA 2IHMA 3C23A 4KLFA 3RR8A 5KFRA 4MFFA 2HHUA 8ICSA 4RQ3A 4ED0A 1X2IA 3ETLA 4BGDA 4DL4A 4DF8A 4CCHA 9ICSA 9ICVA 2FPLA 5J0YA 4NLZA 2XY5A 4ECUA 2IMWP 7ICEA 4F4WA 5IIJA 1SKWA 2DFLA 4O3QA 4KLEA 5DBAA 2DPIA 1K1SA 4QZEA 1NJZA 2XCAA 1B22A 5L1IA 3QEAZ 5KG7A 1LV5A 1NK5A 4NLGA 5DLGA 3UXNA 4BXOB 5KFIA 3ZDEA 4UQGA 7ICUA 4QZGA 4ECVA 2WTFA 9ICRA 1UA0A 4J9KA 9ICCA 1ZQUA 4M6WB 5CWRA 3RB4A 4DSJA 4DSIA 1SZPA 1BGXT 4UAWA 8ICVA 2AU0A 3C2MA 2HHSA 4RQ6A 4RQ4A 4PHPA 5IILA 8ICXA 4RT3A 3H4BA 3RJJA 9ICKA 4YMOA 3Q8MA 3GV5B 1KTQA 1JN3A 5DB6A 1RYRA 5KFLA 3UPQA 3C2LA 1ZQFA 4RPYA 4RQ0A 1AROP 3PW2A 1TK8A 2FMPA 2IA6A 2JEGA 1TKDA 8ICEA 4IRCA 1D9FA 3RRGA 1HUOA 2BCSA 2AQ4A 5KG0A 4BWMA 3ZD8A 1XSLA 5KFGA 3RBEA 4I2FA 4I2DA 5CP2A 3G6XA 2NRZA 4IRDA 1CUKA 1SL2A 3V7KA 4KLHA 4J9NA 4NY8A 1TAUA 2ZTEA 4QZCA 2KN7A 1NK8A 4QZBA 4UB4A 3HX0A 1HUZA 2XGPA 4YR0A 3GIKA 3GV8B 4GXIA 3LK9A 4TQSA 4YP3A 1ZQHA 1T7PA 1QLNA 3GQCA 1NK4A 1DGSA 4MEYA 3TFRA 4O5EA 9ICWA 7ICPA 4ED1A 4M04A 3BQ0A 3Q8SB 7ICQA 2BPCA 2BDPA 1NK7A 4B9UA 3LDAA 4QZ8A 1U48A 2ZTCA 3C21A 3GDXA 1XWLA 3V7LA 5BOMA 4NM2A 3MR5A 2OWOA 1KRPA 4JK1A 1JXLA 3PW4A 9ICMA 4XUSA 3H4DA 8ICPA 4M47A 1IM4A 4B9TA 4KLSA 3N4MB 3PO5A 1ZETA 5DQGA 3G6YA 9ICFA 4KN4A 1JMSA 5J0OA 4RUAA 4Q44A 1B43A 2NRXA 4UBCA 4R65A 2BQ3A 3ZD9A 1UT5A 2C22A 1T8EA 1ZQQA 3LWMA 3K75D 4ECSA 3PNCA 9ICOA 3H7IA 3QE9Y 2W8KA 4XRHA 2AJQA 4TURA 5DDMA 4O3PA 5DG8A 7ICFA 4PGYA 4O0IA 4DFMA 5KFTA 4X5VA 4MF8A 3T5JA 3ZDBA 1KFTA 2JZBA 1Z3EB 3BJYA 5DB7A 1ZQPA 2JEIA 3N97B 4C8MA 1BPZA 7ICTA 1KFSA 3THVA 4KLMA 4ED7A 1ZQTA 2P6UA 4RNNA 3EPIA 1ZQXA 3RB3A 1KLNA 4FS2A 3G6VA 4RNMA 4I2AA 5KFYA 3RH6A 1ZQBA 5DBCA 4DLEA 3HW8A 4KLGA 4ED6A 2XY7A 2KZZA 1NK9A 2Q0ZX 2BKEA 4ECTA 4I27A 4HYKA 4I2CA 1X9SA 1H38A 4YN4A 5DLFA 1L5UA 4NXZA 3EWAA 5J0XA 1Y88A 4P4OA 3M8RA 4MFAA 4YXMA 1RYSA 1NJWA 8ICNA 1N56A 4Z6FA 4KMUA 2AGPA 3Q8KA 4F4KA 5J0RA 3M8SA 8ICLA 4YXJA 5KFPA 4UB3A 5KFFA 3V6HA 1QSLA 2FLLA 7ICHA 4DQSA 5DB9A 2BGWA 5KFUA 2IBKA 8ICWA 3RB0A 1T4GA 4F92B 4ECRA 3M9MB 4I28A 4EBDA 1S0OA 4UB5A 4IRKA 3C1ZA 4YD2A 2HHVA 2ALZA 4JV1A 1IXRA 3ISCA 5D49A 4TUSA 3MDCA 2PFQA 3BQ1A 4DOBA 5KFWA 5KFBA 3B0XA 2W9BA 1NOMA 3AU2A 4O3SA 5BOLA 2P6RA 1TK5A 1S0NA 4EZ6A 3K4GA 3T3FA 1U45A 8ICJA 4YR3A 1KDHA 3M9OB 7ICJA 4R64A 3OJSA 4I2EA 4M9LA 2MUTA 2NRWA 4YFKA 3RJEA 3JPQA 1XU4A 4J9LA 3H8SA 1ZQIA 4KLUA 4F5QA 3C5FA 4P4PA 3V6KA 4C8OA 5CA7A 3H8WA 4QZFA 7ICRA 1BPYA 4F50A 4J9OA 4O5KA 5IIIA 2ZUBA 4KLJA 2DPJA 5KT5A 4C8LA 4NLNA 1S0MA 3OSPA 5KT6A 4DL3A 3IM1A 3KHGA 4GXJA 4R8UA 3Q8RB 3TARA 4R66A 1ZQGA 4O3RA 5KT3A 3SI8A 4DLGA 4ELTA 3PV8A 5KT2A 3ZDDA 1ZQWA 5IIKA 3SV3A 3ZDCA 4FS1A 4JV0A 5KFCA 2F1IA 3C1YA 4F5NA 4O3NA 3PMNA 2FPMA 3Q8QB 5KT4A 3PX0A 1NKBA 5D4BA 2BPGA 2JEJA 1TFRA 4RT2A 3RTVA 5DG7A 4YQWA 2P66A 4B9NA 2PFPA 2BCRA 2UVWA 9ICTA 2HHXA 3HT3A 1MC8A 5KFDA 2H5XA 4DSEA 4PGQA 5HHIA 1S10A 5DQHA 1LB2B 4PGXA 4KLTA 4BDPA 4ELVA 1NKCA 4EBCA 5KFJA 2C2RA 1NKEA 4RNOA 4QZHA 4LVSA 4O5CA 3LWLA 3NGDA 1BPDA 4K4HA 3V72A 8ICBA 4YG2A 5F9NA 2R8JA 2XO7A 4J9RA 5KG6A 5KFEA 4UBBA 5F9LA 4MFCA 3RJFA 2BPFA 2HHWA 2NRVA 4I2IA 1JIHA 1SL0A 4PHEA 3OJUA 4RQ8A 4YCXA 2FLNA 5BPCA 3RH5A 2PI4A 3ORYA 5KFXA 5DGBA 1HJPA 3OGUA 3QEBZ 1BPXA 4KLIA 1S76D 4EYIB 3UQ0A 1S9FA 3GIIA 4DO9A 1X9WA 9ICEA 2J6UA 2HVHA 3BQTA 4ECWA 2FMQA 3C5GA 3TFSA 1WCLA 3RAXA 4BWJA 4JUZA 5HNKA 4ED8A 7ICLA 4EBEA 5CHGA 1XSPA 4DQIA 4F2RA 2W8LA 4F4ZA 2J6SA 1CEZA 1A76A 2XY6A 3E2EA 5DB8A 4C8KA 8ICUA 2VA3A 4GC6A 5DG9A 1S0VA 7ICIA 4ED3A 5J0UA 2ISPA 7ICVA 2NRTA 2JZBB 5J2KA 4KLOA 1NK6A 4M9GA 1Z00A 4M0AA 2ZJ5A 4KITB 4DL6A 8ICCA 3JPTA 4C8NA 5J0PA 4DSKA 4M9HA 4NM1A 4Q43A 4QZIA 4QWDA 4ED2A 1NJXA 3RH4A 4YD1A 2V4QA 2A1JB 5KT7A 3EZ5A 1U4BA 5J2DA 3BDPA 5J29A 5DDYA 3GIMA 1U47A 5DGAA 2UVUA 4J9SA 2MAXA 5L1KA 1ZYQA 1XSNA 3T5HA 3SZ2A 4QW8A 2VA8A 3ISBA 5DKWA 3UQ2A 5KFOA 4DQRA 5KG1A 5J2EA 4F5RA 4P2HA 7ICKA 3RRHA 8ICHA 3OSNA 2VA2A 3MR2A 4I2HA 3PW5A 3TQ1A 4EZ9A 4F4XA 5L1JA 4Q8FA 2I1QA 3JPNA 1XC9A 9ICGA 4Z6DA 3V7JA 3H40A 1PZNA 5KFKA 3AUOA 4DFKA 2FMSA 3RBDA 5C5JA 5KFHA 5IIOA 8ICKA 4XA5A 9ICNA 4DWIA 4JWMA 1ZQDA 4F5OA 5EOZA 3OHAA 8ICAA 5J2CA 7ICSA 9ICBA 2W9AA 8ICYA 2LYHA 1ZQCA 2ISOA 4F3OA 2W9CA 4GXKA 1RXVA 3GFKB 2W9BB 5HMLA 4IQTA 1ZQMA 1ZQRA 2F1HA 4UB2A 5CR0A 7ICMA 4F5PA 2J6TA 3QZ7A 5KFSA 3KHHA 9ICPA 4IR9A 1TVAA 5J2JA 1XO1A 1XS9D 5KG4A 1BVSA 1L3SA 8ICIA 4E0DA 3M9NB 1TK0A 1BPEA 2PI5A 2ZJAA 4QWBA 4F93B 3UXOA 2MUTB 4QWEA 2HVIA 4TUPA 4I29A 3H8JA 3NTUA 5EWGA 4XQ8A 1A77A 3KHLA 1ZQNA 2F1JA 1RXWA 3RJHA 2HHQA 4EEYA 3KHRA 2R8HA 4ECQA 1QSSA 9ICHA 3MGHA 1D8YA 4K4IA 3TI0A 4JWNA 3MABA 9ICJA 4R8UB 2BCVA 1QSYA 4YMMA 4KN7A 4ECZA 2HHTA 1TAQA 4O9MA 1ZQLA 4RZRA 3MFIA 3SYZA 4YR2A 4O3OA 3PX6A 2C28A 4DOCA 3HP6A 4DFJA 3PX4A 4B9MA 2GWSA 9ICQA 2VANA 1U49A 4IQUA 5J2HA 2ASLA 4I2JA 4TQRA 3MFHA 3UXPA 3RJGA 2ZUCA 4ECXA 3ISDA 4FBTA 1EXNA 1ZQEA 4TUQA 1UA1A 3TAQA 8ICFA 1BPBA 3TAPA 4BXOA 3IHQB 5J0WA 4QWAA 2AGOA 2BQRA 2C2EA 3EPGA 3B0YA 4J9MA 4RPZA 3QZ8A 3RB6A 2FLPA 2UVVA 2KTQA 4Q45A 4MEXA 1ZQJA 4YVZA 1ZQZA 4M6WA 4P4MA 1T3NA 4Z6CA 3JPPA 5CJ7A 3MR3A 4DF4A 4PHDA 8ICQA 5J0SA 4FBUA 1ZQYA 2KZ3A 3PMLA 9ICIA 4IR1A 3RAQA 5J2IA 5KFQA 4DOAA 8ICGA 2BHNA 4KTQA 3GILA 1KFDA 3KTQA 4M9NA 4I2GA 5CB1A 1ZQSA
chains in the Genus database with same CATH superfamily
4KLDA 3QXGA 1WCNA 2EZZA 2I6XA 2V9WA 5AI5A 4M2YA 2WB1F 4RQ5A 3ETRA 4DQPA 8ICZA 2KNJA 2IHNA 5AK4A 2W3SA 1NNLA 3DEEA 4J9QA 4GLXA 4PH5A 1DOQA 2ZJ8A 5KFMA 5AKHA 4KLQA 2KJ5A 2ASDA 4Y2JA 3RJIA 1JI7A 3MDAA 1SKRA 4IQWA 3PZPA 4RQMA 4R63A 1F44A 1U9LA 4GC7A 4PPXA 4FO6A 2C2DA 5G5GA 2XC9A 1LVHA 3FDSA 1TE2A 4DFPA 9ICXA 4LZDA 4QZ9A 5KAFU 4F71A 4EYHB 1L3TA 1L7PA 1D8LA 2OHFA 3HKZC 1C7YA 1SL1A 4UB1A 4EX6A 1X9MA 1NK0A 3CRXA 2I9GA 5KG2A 2Y0SC 4B9VA 3SAGA 3M6KA 4P0PB 3QUCA 3AU6A 1MSWD 4K4GA 5KFNA 3NS1A 2KIWA 2XICA 2NO5A 2G0AA 2K4EA 4Y2RA 4MF2A 1TV9A 9ICLA 1COKA 3VCBA 4I2BA 3T5LA 2JR5A 5KG5A 4YMNA 2ZTDA 1X2IA 3PSPA 2ZIUB 9ICSA 2LYBA 5J0YA 4DFDA 4F4WA 5IIJA 2O6KA 1NJZA 1B22A 4UARA 5KG7A 5DLGA 4BXOB 3ZDEA 4UQGA 2VJ5A 1L8LA 4ECVA 9ICRA 9ICCA 4C4SA 5J8YA 1SZPA 4UAWA 4RQ4A 3RJJA 3H4BA 1KTQA 1JN3A 1X42A 5KFLA 1ZQFA 1TK8A 3QUBA 2GH1A 2JEGA 1TKDA 1D9FA 3RRGA 5AIBA 5CRXA 3ZD8A 5ALYA 2ZIXA 3RBEA 4I2DA 3G6XA 1SL2A 1TAUA 2JH7A 4QZCA 5ALJA 1NK8A 4QZBA 4UB4A 2YMLA 5AM1A 1HUZA 3RFAA 3GIKA 3LK9A 4TQSA 2YMPA 2CPRA 3GQCA 4MEYA 7ICPA 5ALVA 2FE9A 4ED1A 4M04A 2BPCA 1NK7A 4B9UA 2ZTCA 3C21A 2KVCA 3MR5A 4NM2A 4JK1A 3PW4A 3H4DA 4M47A 5JU5A 1ZETA 5DQGA 3G6YA 4NLCA 4Q44A 2L5YA 5ALEA 2NRXA 4R65A 2BQ3A 1ZQQA 3ZD9A 3K75D 4ECSA 3H7IA 2W8KA 2AJQA 3H0RB 1DXSA 2RLTA 5T14A 4MF8A 3ZDBA 2CRXA 1VJ5A 3EPIA 4C4RA 3RB3A 1ZQXA 1KLNA 4FS2A 5AKKA 4ED6A 2KZZA 2OEHA 1Z19A 4NXZA 1L5UA 4NLBA 4YXMA 1RYSA 8ICNA 1N56A 2WF7A 4Z6FA 2KMDA 2RRDA 4G9BA 1WG8A 5J0RA 2FLLA 7ICHA 5KFUA 4ACOA 8ICWA 4ECRA 5K4LA 4EBDA 3C1ZA 5D49A 4DCCA 3MDCA 2PFQA 1Z4OA 3BQ1A 4DOBA 2HI0A 2DGZA 5KFWA 1YZ7A 3AU2A 5BOLA 3UMBA 3KZXA 4EX7A 3QU7A 3OJSA 2NV3A 4I2EA 2MUTA 3RJEA 3JPQA 1RG6A 4F5QA 2HMXA 4QZFA 1BPYA 2JMGA 2LM4A 4ZOHC 5IIIA 4KLJA 3D2NA 3OSPA 3E0FA 3IM1A 3KHGA 3M6ZA 4R8UA 2ZIUA 3SI8A 3ZDDA 2KVSA 3ZDCA 2Z7JA 4FS1A 2ODGA 2F1IA 4O3NA 2FPMA 3PX0A 5KT4A 4A8EA 4RT2A 4YQWA 2PFPA 5AI4A 3WK9A 3OPXA 2ESEA 1Z1VA 1NKEA 3CNHA 4QZHA 1BPDA 2ZXIA 5AK3A 4YG2A 2R8JA 2HHWA 2NRVA 2B6GA 1K5OA 4RQ8A 1HJPA 3GIIA 2FMQA 1V85A 3RAXA 3GZFA 1ZD2P 4ED8A 5ALZA 4Y2TA 5CHGA 4F2RA 2EAPA 5JRTA 2KHQA 2J6SA 1CEZA 4C8KA 2HBLA 2VA3A 3NRWA 1S5LU 2KJ9A 5J2KA 4KLOA 1NK6A 4GIBA 3QU5A 4M9HA 4NM1A 4Q43A 1NJXA 4YD1A 2E5SA 3CW2C 5L1KA 2K8CB 4DQRA 3HJEA 5J2EA 4P2HA 3RRHA 3TQ1A 4F4XA 2I1QA 3JPNA 5AK6A 4OCZA 1ZQ1C 5ALTA 5KFKA 3AUOA 4DFKA 5C5JA 4EEKA 4XA5A 1ZQDA 7ICSA 8ICYA 2LYHA 1UHUA 2W43A 2E8OA 2W9CA 4GXKA 5AKIA 2QKQA 1XO1A 8ICIA 1TK0A 1BPEA 4KMOB 4QWBA 2YB1A 4TUPA 3K1RB 4JMUA 2DKZA 2A19A 1KL9A 1GO3F 3N28A 3KHRA 1QSSA 4PL2A 3TI0A 3U26A 1SV0C 5KL8B 2LPEA 2BCVA 2KK0A 5ALXA 2HBMA 3A0HU 4IQUA 4I2JA 3RJGA 1ED1A 3AQEA 3ISDA 4FBTA 3B9JA 2MRLA 4QJFB 5J0WA 3ZI4A 3NVYA 4RPZA 3QZ8A 4C7ZA 4M6WA 3JPPA 5ALGA 2KP7A 5J0SA 3IRUA 2W7OA 4IR1A 5KFQA 4DOAA 2BHNA 3KTQA 5CB1A 5ALFA 1RZTA 2QB0B 4Q8EA 3BQ2A 2A1AA 4LZGA 4QW9A 5ALWA 1KSPA 1JXEA 1J2MA 1QQ6A 1ZJNA 2EANA 2H3QA 4Z6EA 4NLKA 1XO0A 1D9DA 3TANA 3OTQA 3PY8A 2K4PA 2KFNA 3PW7A 1ZOLA 3FYHA 5L1LA 4DSLA 3CP8A 2W03A 4FE3A 3GV7B 3T5KA 4M9JA 5DBBA 5IINA 4C7YA 3RR7A 1VLBA 3KFUF 2LMRA 4RQ2A 1V97A 4PHAA 2KZMA 5AKYA 1ZJMA 2I5HA 1SXEA 5CEHA 4KLLA 3PR4A 3KBBA 2PXIA 5EE0A 1NJYA 2DWQA 2R8GA 3HPOA 1L7NA 3SV4A 2JEFA 2W11A 4DL5A 3JPRA 2BCQA 2K89A 2YB4A 2BR0A 2Y1IA 3H0MB 2RDJA 3C2KA 4DL2A 2WF5A 2KFZA 5IIMA 2HW3A 5HHHA 7ICOA 5ALUA 3ZDAA 5HP4A 4FZLA 5AI8A 2ZIWB 4G3IA 2R8IA 3D6JA 2RHFA 9ICUA 3HWTA 2AGQA 2Q4TA 3L3FX 3RR8A 5KFRA 8ICSA 4DL4A 3ETLA 3HILA 3HRDD 3SEIA 1N2XA 1FIQA 4NLZA 2IMWP 1SKWA 5B5EU 4KLEA 5ALSA 4O3QA 3HKZF 3SR6A 3SAFA 3UXNA 5KFIA 4QZGA 2WTFA 2G5IB 1NZBA 3AN1A 5CWRA 4DSJA 4DSIA 4LJXA 2HHSA 4Y2QA 4RT3A 4YMOA 3GV5B 3KOOA 3QU2A 1Q46A 5DB6A 1RYRA 3PSIA 3C2LA 4RPYA 2FMPA 3WKDA 8ICEA 3QUQA 3O0FA 4QIWC 2BCSA 2AQ4A 5KG0A 4I2FA 4IRDA 1CUKA 3V7KA 2IOFK 2JH1A 4NL9A 4GXIA 4YP3A 3SQIA 1NK4A 9ICWA 1DGJA 2BDPA 5TISU 3LDAA 1U48A 3V7LA 2OWOA 2E8NA 1JXLA 2GLEA 9ICMA 5AI9A 1FFVA 1X6JA 4B9TA 5C0YA 3N4MB 3I1YA 5J0OA 4CF5A 3LWMA 4CGZA 3AL0B 4X5VA 1KFTA 1XNSA 1ZQPA 3F2BA 4OO1J 5AM3A 7ICTA 1KFSA 4ED7A 1ZQTA 4RNNA 5JTIA 4C4TA 3BS5A 4RNMA 1PVQA 1ZQBA 4KLGA 5DBCA 4DLEA 3LYSA 5AKZA 3IN5A 3AEVA 4EELA 1NK9A 2Q0ZX 5KAIU 1H38A 4YN4A 1Y88A 2QARB 4MFAA 5H2FU 1WYGA 4EENA 3UMGA 2F76X 3M8SA 8ICLA 9ICIA 4NL9C 5KFPA 4UASA 4DQSA 1QCKA 2BGWA 3M1YA 2PMZC 3RB0A 1T4GA 3AMZA 5FP0A 4I28A 2EDUA 1KBUA 1B4FA 4JV1A 5AI0A 1LKYA 2HOIA 1IV8A 2JGAA 4CNQA 5KFBA 1NOMA 4KX5A 4AYBF 1TK5A 2P6RA 1UCVA 3K4GA 3NVZA 2A3VA 3M9OB 2H3IA 4R64A 4M9LA 2NRWA 5EE3A 4YFKA 1XU4A 3H8SA 4KLUA 3C5FA 3V6KA 5CA7A 3H8WA 4J9OA 2ZUBA 1DRGA 5KT5A 4NLNA 5KT6A 3TARA 2RP5A 4O3RA 2F3NA 1Q3VA 5KFCA 1SWWA 3PMNA 1V38A 5D4BA 1SV4A 2JEJA 1SZHA 2P66A 2ES6A 2ZXHA 3C28A 2YY6A 2E8PA 4ELVA 2LKYA 1JROA 2D3DA 4LVSA 3LWLA 3NGDA 3UM9A 2WAQF 3FC4A 5F9NA 2FDRA 2XO7A 2LBOA 4US9A 3RJFA 1SL0A 4IS7A 3OJUA 5BPCA 3RH5A 2PI4A 1S76D 1BPXA 1F0MA 2J6UA 3BQTA 1WCLA 4BWJA 4JUZA 4FFDA 2XY6A 5AK5A 5DG9A 4ED3A 5ALDA 7ICVA 2P35A 2JZBB 4P0QB 5J8YC 4M9GA 2EH9A 5E79U 2ZJ5A 8ICCA 1N63A 3JPTA 4C8NA 5J0PA 3WK5A 5ALPA 4QZIA 5KNIA 4BJQA 2V4QA 3EZ5A 3GIMA 1U47A 1PK3A 3T5HA 4QW8A 5DKWA 1CI4A 1RQNA 2VKQA 4ICAA 3NVVA 3OSNA 2HOFA 2F8KA 4EZ9A 5L1JA 1ZD3A 3V7JA 3H40A 1PZNA 2MSNA 5IIOA 5KFHA 9ICNA 4JWMA 3WK8A 4F5OA 3OHAA 5J2CA 2LHTA 3J81j 1IG6A 1RXVA 2W9BB 1ZQMA 1ZQRA 2F1HA 4UB2A 9ICPA 2J6TA 3KHHA 1PUZA 2HBKA 5KG4A 3TADA 4UB8U 2NYVA 2ZJAA 4P0PA 4F93B 2HVIA 2XI9A 1JUDA 2G09A 1A77A 3RJHA 9ICHA 1X9XA 4K4IA 3MABA 5L1MA 1QSYA 4KN7A 1TAQA 1ZQLA 4WJ3B 4RZRA 3SYZA 3PX6A 2YMMA 4B9MA 5AHXA 1U49A 5J2HA 5AIAA 4TQRA 1JRPA 4TUQA 3TAPA 4BXOA 3IHQB 2AGOA 4QWAA 2BQRA 4J9MA 3RB6A 2FLPA 2UVVA 4Q45A 1ZQZA 4P4MA 5ALNA 3ALRA 5CJ7A 4DF4A 4PHDA 1IIPA 8ICQA 1OXJA 1ZQYA 2KZ3A 5EE9A 4Y2PA 1F5SA 2H3ZA 3I28A 3IDWA 4KTQA 1QQ7A 2ATLA 3JPOA 5KFAA 1RDFA 5GTHU 8ICTA 3CYMA 4F4YA 2YN4A 4DS5A 4ECYA 2ASJA 3MGIA 2UVRA 1V9PA 2M9NA 2MU2A 5AKGA 4U7CA 5J0TA 2BQUA 4DSFA 3WKBA 3EYZA 2KJ8A 4J9PA 2QB1A 4QZAA 2AXTU 1Z00B 4DQQA 4BUGA 4ZH4A 8ICOA 4F2SA 2E8MA 2Y1JA 1KEJA 4F8RA 1ZQVA 5AKLA 1UPHA 2W9MA 2M0NA 2FPKA 4UAYA 3EW9A 3OHBA 1JX4A 3QYPA 1SKSA 3GIJA 1K1QA 2KSOB 4QWCA 3H0LB 1UT8A 3BS7A 5KTQA 2V4RA 1FO4A 4KX3A 2XCPA 4B6JA 2XVTA 5KFZA 4CDGA 9ICAA 4RPXA 3PVXA 5KL1B 1ZQOA 3WU2U 1COOA 1S77D 1A0PA 1N48A 3QU4A 3PW0A 1KQQA 5J2AA 2DQNB 2BCUA 1T94A 2IHMA 4KLFA 2HHUA 3VC8A 3C23A 3D2QA 4BGDA 4CCHA 9ICVA 2CN1A 4OJOA 2FPLA 1FFUA 2JRZA 2LM1A 4ECUA 7ICEA 2DFLA 5DBAA 4QZEA 3QEAZ 4NLGA 3RF9A 2JXJA 3QX7A 4J9KA 4OJ5A 1ZQUA 2DKXA 8ICVA 1SGGA 3C2MA 4Y2YA 4RQ6A 2KOBA 2AU0A 5IILA 8ICXA 2KE7A 2D8CA 1MN8A 2LI6A 2KG5A 1AROP 3IP4B 1L8OA 3F5AA 1HUOA 3KD3A 3H8MA 4BWMA 1XSLA 1KN5A 3L5KA 1RM6C 4NV0A 4NJ8A 2ZTEA 2KN7A 3HX0A 2XGPA 3S6JA 3IG8A 1ZQHA 3QUTA 1QLNA 1DGSA 3ONNA 2G06A 4FZNA 2HCFA 3Q8SB 7ICQA 5ALIA 4QZ8A 1XWLA 5AM2A 1IM4A 4UW9A 3BZCA 1PVRA 5ALRA 3TKAA 4QIWF 4KN4A 1JMSA 2F8LA 1B43A 4UBCA 2BDUA 1UT5A 2C22A 3PNCA 4XRHA 4TURA 5DG8A 7ICFA 4PGYA 4DFMA 5KFTA 3T5JA 3MC1A 1ZRNA 4CE6A 1O03A 1Z3EB 4RQNA 5DB7A 2KKPA 2JEIA 4C8MA 1BPZA 4KLMA 1J97A 3BZKA 3PSFA 9ICJA 2W04A 3QU9A 3G6VA 3RH6A 1OW5A 2W55A 4ECTA 4OJLA 5DLFA 2EQYA 1SXDA 3M8RA 3EWAA 5J0XA 3A0BU 1NJWA 4KMUA 3Q8KA 4CRXA 4YXJA 5KFFA 3V6HA 2IBKA 2KSOA 1S0OA 2D6FC 2KICA 1N5XA 2DBYA 3ISCA 4TUSA 2W54A 3WK4A 4O3SA 5ALMA 1S0NA 4EZ6A 2F77X 3T3FA 1U45A 4YR3A 3ICXA 1KDHA 1L7MA 7ICJA 1ZRMA 2Y0SF 3NRZA 1BNOA 4C8OA 7ICRA 3D2SA 5GTIU 4F50A 2HSZA 2DPJA 4C8LA 1S0MA 1ZQGA 5KT3A 4DLGA 1L7OA 2PMZF 2AH5A 4Y2UA 1URJA 3C1YA 4F5NA 2W3RA 5HR6A 3Q8QB 2ZIXB 1ZXIA 4B9NA 3RTVA 3UMCA 2BCRA 1X6IA 2OM6A 9ICTA 3HT3A 1MC8A 3DV9A 4PGQA 5HHIA 1S10A 5DQHA 4KLTA 5ALKA 2DL0A 2C2RA 1KKXA 4O5CA 3LVWA 3E58A 3I76A 3V72A 8ICBA 4J9RA 5KG6A 3C29A 4CF4A 4UBBA 1D8BA 4MFCA 4HAIA 1JIHA 4PHEA 2FLNA 4YCXA 4PZOA 3ORYA 5DGBA 1M6YA 4EYIB 2QB0A 3UQ0A 1S9FA 4DO9A 4ECWA 3C5GA 4EBEA 2H3FA 1A76A 5F3XB 8ICUA 4GC6A 1S0VA 5EE1A 2ISPA 4ED2A 1Q8KA 3RH4A 2A1JB 5KT7A 1MA7A 5J29A 5DDYA 2UVUA 1ZYQA 1NI3A 4MHVA 4Y2XA 2FI1A 5KG1A 7ICKA 8ICHA 3EUB2 4I2HA 1SB3C 1XC9A 9ICGA 1X66A 1SIJA 1N61A 4UATA 2FMSA 3RBDA 3F53A 9ICBA 2W9AA 3N7PD 4IQTA 5AKEA 7ICMA 4F5PA 3QZ7A 5KFSA 4IR9A 5J2JA 4US8A 4E0DA 3M9NB 2CXYA 4PJ0U 2VJ4A 3UXOA 2MUTB 4I29A 3H8JA 4XQ8A 3KHLA 1PK1B 1ZQNA 2XIDA 4EEYA 1CRXA 4ECQA 1D8YA 4Y2SA 2ZIWA 3F5EA 4CF3A 4R8UB 1TAMA 4YMMA 4IL6U 2E3TA 2HHTA 4O9MA 3L4PA 3MFIA 4YR2A 4O3OA 2C28A 2GWSA 2ASLA 3MFHA 3UXPA 3TACB 1EXNA 1ZQEA 2WB1C 3TAQA 8ICFA 3AM9A 2FJ6A 1ZQJA 4YVZA 1WUDA 2OYYA 1T3NA 4Z6CA 1T3QA 3LVVA 3RAQA 3NVWA 8ICGA 3GILA 4I2GA 1WWVA 5EWFA 3IV6A 1MQ3A 5J2BA 1OUQA 3RJKA 2WF6A 2PFNA 3PR5B 1RQLA 5ALQA 2JV3A 1QTMA 2KV2A 4DL7A 2K4HA 2K8BB 2R8KA 2XGQA 5HMMA 3Q8LA 4B9LA 1YZ6A 5L9XA 2AQ0A 3MR6A 3AQFA 3QNMA 1WWUA 1HIWA 1L3UA 4DEZA 4IQVA 5TZVA 1L3VA 3JPSA 5J2FA 1L6NA 1ZQKA 4F91B 4RU9A 4RUCA 5AICA 7ICNA 5KG3A 4O3MA 5DQIA 5D46A 8ICRA 3F2DA 2DF4B 5J0QA 1S97A 3V6JA 1Q3UA 3Q8PB 1ZQAA 4JV2A 5G5HA 5EWEA 3SAHA 2A1JA 1RPLA 2ZUDA 4AYBC 5J2GA 1ZD4A 1ZD5A 2N1RA 2W9CB 4DS4A 1MQ2A 4JB3A 4RQ7A 3MBYA 5KFVA 2PFOA 2B21A 7ICGA 2BZFA 4GFJA 4UAZA 5AM0A 3WKAA 2RDIA 4QZDA 4B9SA 2QARA 4OD0A 8ICMA 3ED5A 5JUMA 3PO4A 4RQ1A 4ELUA 4MFFA 4USAA 1Z4NA 4RQ3A 2WF8A 4ED0A 4DF8A 4OJ6A 2GO7A 3FM9A 2XY5A 2DPIA 1K1SA 2XCAA 5L1IA 2WF9A 1NK5A 1LV5A 2DUYA 2WHEA 7ICUA 2OH2A 3WKEA 1UA0A 1KW4A 1PK1A 1RYUA 4M6WB 3RB4A 2WAQC 4C0ZA 1BGXT 2H3VA 4QNLA 4Y2VA 4PHPA 3SMVA 9ICKA 3Q8MA 2LYAA 1ECWA 3UPQA 4RQ0A 3PW2A 2IA6A 4BX9C 1VDVA 2YX8A 4IRCA 1DK3A 3FAHA 3IG5A 5KFGA 2HBJA 2B0CA 5CP2A 2NRZA 3KKAA 2K60A 4KLHA 4J9NA 4NY8A 1J2NA 2F44A 4YR0A 3GV8B 3TADC 1T7PA 2K8AA 4O5EA 3TFRA 2OCEA 3BQ0A 2NO4A 3GDXA 5BOMA 2OXOA 1KRPA 4XUSA 2MA1A 8ICPA 2EAOA 2QLTA 3NASA 4KLSA 4OJPA 3PO5A 9ICFA 4RUAA 1T8EA 3MGVA 5B66U 4FZMA 9ICOA 3QE9Y 2KEYA 1SV0A 5DDMA 4O3PA 2IOFA 4O0IA 2E1EA 4IC9A 3F2CA 2JZBA 4P0QA 3PSTA 3DDHA 4UAUA 3BJYA 2G08A 3N97B 3THVA 2P6UA 4I2AA 5KFYA 3HW8A 2XY7A 1A6SA 2EAMA 2BKEA 4I27A 4HYKA 4I2CA 1X9SA 1P7DA 4UB6U 4P4OA 5A0LA 3KKAC 2AGPA 4F4KA 3R9KA 4UB3A 1QSLA 1S8OA 5DB9A 3N7SC 2ZIVB 2PKEA 4F92B 1SWVA 3M9MB 3N7RC 4UB5A 4IRKA 1DK2A 4YD2A 1FEZA 2HHVA 2ALZA 1IXRA 4PZNA 2K4IA 2W9BA 3B0XA 1O08A 4C80A 8ICJA 4J03A 2KIVA 4J9LA 1ZQIA 4P4PA 1AQ6A 2E1FA 4O5KA 5HR7A 5AM4A 4DL3A 4GXJA 3SENA 3Q8RB 4R66A 2ZG6A 5ALLA 3PV8A 4ELTA 5KT2A 1ZQWA 5IIKA 3SV3A 2IOHA 4JV0A 1NKBA 2BPGA 1TFRA 5DG7A 2UVWA 1X40A 2HHXA 5KFDA 2H5XA 4DSEA 1LB2B 2YQEA 4PGXA 4BDPA 5AKJA 3SD7A 1NKCA 4EBCA 2HOQA 2VIXA 5KFJA 2Y9TA 4F72A 4RNOA 2YMQA 2RQ5A 3K1ZA 4NWIA 2Y9UA 4K4HA 1PVPA 5KFEA 5F9LA 2BPFA 4I2IA 1N62A 4KLIA 5KFXA 3OGUA 3QEBZ 1X9WA 9ICEA 5AM5A 2HVHA 2F2AB 3TFSA 5HNKA 7ICLA 4DQIA 1XSPA 2W8LA 1HEKA 4F4ZA 3E2EA 5DB8A 7ICIA 5J0UA 2NRTA 1UQVA 1Z00A 4M0AA 4KITB 4DL6A 4DSKA 4QWDA 1U4BA 5J2DA 3BDPA 2AHOB 3BS5B 5DGAA 1QQ5A 3WKCA 2MAXA 4J9SA 1XSNA 3SZ2A 2VA8A 3ISBA 3UQ2A 5KFOA 1N60A 2YTUA 4F5RA 3WK7A 2W7PA 2VA2A 3MR2A 5AI6A 3PW5A 4Q8FA 4AP9A 4Z6DA 1C20A 2WFAA 8ICKA 4DWIA 5EOZA 8ICAA 1LKYB 1ZQCA 2ISOA 4F3OA 3GFKB 5HMLA 5CR0A 2R18A 1TVAA 1XS9D 1BVSA 1L3SA 1QH9A 2PI5A 4UAVA 4QWEA 3M7DA 1JALA 4PL1A 3NTUA 5ALHA 5EWGA 2KKVA 2F1JA 2EZXA 1RXWA 2HHQA 3T79A 2R8HA 3MGHA 1NZPA 2ZIVA 4JWNA 2KHVA 1B0XA 3WK6A 4ECZA 2HDOA 2EZYA 4DOCA 3HP6A 4DFJA 3PX4A 9ICQA 2VANA 2GOLA 2G5HB 3KZIU 3BQ7A 2ZUCA 3GU3A 4ECXA 5ALOA 4U6PA 1UA1A 1BPBA 1Z1BA 2C2EA 3EPGA 1N5WA 3B0YA 2JHDA 5AKXA 2KTQA 4MEXA 2G07A 3NUQA 3MR3A 4FBUA 3PMLA 1BNPA 5J2IA 2KD1A 1KFDA 1YT3A 4M9NA 1ZQSA
chains in the Genus database with same CATH topology
2ATLA 4KLDA 3JPOA 5EWFA 1WCNA 1RZTA 5KFAA 8ICTA 1MQ3A 4Q8EA 5J2BA 4F4YA 3BQ2A 4DS5A 4ECYA 2V9WA 4LZGA 3RJKA 4QW9A 2ASJA 2PFNA 3PR5B 4M2YA 1KSPA 3MGIA 1JXEA 2UVRA 4RQ5A 1V9PA 2M9NA 1QTMA 4DQPA 8ICZA 1ZJNA 4DL7A 2IHNA 5J0TA 4Z6EA 2BQUA 4J9QA 2XGQA 4DSFA 2R8KA 4NLKA 5HMMA 3EYZA 3TANA 1D9DA 4GLXA 3Q8LA 4B9LA 3PY8A 4J9PA 5L9XA 4QZAA 1Z00B 2AQ0A 4PH5A 3MR6A 3PW7A 1DOQA 2ZJ8A 3FYHA 4DQQA 2KFNA 5L1LA 5KFMA 4KLQA 1L3UA 4DSLA 4DEZA 4IQVA 5TZVA 2ASDA 4ZH4A 8ICOA 4F2SA 3GV7B 1L3VA 3RJIA 3MDAA 3T5KA 4M9JA 5DBBA 2Y1JA 5IINA 3JPSA 1SKRA 3RR7A 4IQWA 5J2FA 1ZQKA 4F91B 4R63A 4RQ2A 1U9LA 4GC7A 4RU9A 4RUCA 1KEJA 4PPXA 4F8RA 4FO6A 7ICNA 1ZQVA 2W9MA 2C2DA 5KG3A 4PHAA 5DQIA 2FPKA 5D46A 2XC9A 1ZJMA 3FDSA 2KZMA 8ICRA 4UAYA 3EW9A 3OHBA 4DFPA 1JX4A 5J0QA 1S97A 9ICXA 4LZDA 3V6JA 3Q8PB 4QZ9A 1SKSA 1ZQAA 4JV2A 4KLLA 3PR4A 5EWEA 3GIJA 2PXIA 1K1QA 4EYHB 2A1JA 1L3TA 1RPLA 2ZUDA 4QWCA 5J2GA 1D8LA 1UT8A 1NJYA 2W9CB 2R8GA 1C7YA 3HPOA 4DS4A 1MQ2A 4RQ7A 5KTQA 4UB1A 1SL1A 2V4RA 1X9MA 1NK0A 3MBYA 2XCPA 5KFVA 2PFOA 3SV4A 2JEFA 2B21A 2I9GA 5KG2A 4DL5A 3JPRA 4B9VA 5KFZA 2BCQA 7ICGA 9ICAA 2BR0A 4UAZA 2Y1IA 3AU6A 4RPXA 1MSWD 3PVXA 2RDIA 4QZDA 4B9SA 4K4GA 2RDJA 5KFNA 1ZQOA 3C2KA 4DL2A 1COOA 1S77D 2KFZA 5IIMA 2HW3A 8ICMA 5HHHA 1N48A 4MF2A 1TV9A 3ZDAA 7ICOA 9ICLA 5HP4A 3PW0A 4I2BA 3T5LA 5JUMA 5J2AA 4G3IA 2BCUA 2R8IA 3PO4A 5KG5A 4RQ1A 9ICUA 4ELUA 4YMNA 3HWTA 2AGQA 2ZTDA 2IHMA 3C23A 4KLFA 3RR8A 5KFRA 4MFFA 2HHUA 8ICSA 4RQ3A 4ED0A 1X2IA 3ETLA 4BGDA 4DL4A 4DF8A 4CCHA 9ICSA 9ICVA 2FPLA 5J0YA 4NLZA 2XY5A 4ECUA 2IMWP 7ICEA 4F4WA 5IIJA 1SKWA 2DFLA 4O3QA 4KLEA 5DBAA 2DPIA 1K1SA 4QZEA 1NJZA 2XCAA 1B22A 5L1IA 3QEAZ 5KG7A 1LV5A 1NK5A 4NLGA 5DLGA 3UXNA 4BXOB 5KFIA 3ZDEA 4UQGA 7ICUA 4QZGA 4ECVA 2WTFA 9ICRA 1UA0A 4J9KA 9ICCA 1ZQUA 4M6WB 5CWRA 3RB4A 4DSJA 4DSIA 1SZPA 1BGXT 4UAWA 8ICVA 2AU0A 3C2MA 2HHSA 4RQ6A 4RQ4A 4PHPA 5IILA 8ICXA 4RT3A 3H4BA 3RJJA 9ICKA 4YMOA 3Q8MA 3GV5B 1KTQA 1JN3A 5DB6A 1RYRA 5KFLA 3UPQA 3C2LA 1ZQFA 4RPYA 4RQ0A 1AROP 3PW2A 1TK8A 2FMPA 2IA6A 2JEGA 1TKDA 8ICEA 4IRCA 1D9FA 3RRGA 1HUOA 2BCSA 2AQ4A 5KG0A 4BWMA 3ZD8A 1XSLA 5KFGA 3RBEA 4I2FA 4I2DA 5CP2A 3G6XA 2NRZA 4IRDA 1CUKA 1SL2A 3V7KA 4KLHA 4J9NA 4NY8A 1TAUA 2ZTEA 4QZCA 2KN7A 1NK8A 4QZBA 4UB4A 3HX0A 1HUZA 2XGPA 4YR0A 3GIKA 3GV8B 4GXIA 3LK9A 4TQSA 4YP3A 1ZQHA 1T7PA 1QLNA 3GQCA 1NK4A 1DGSA 4MEYA 3TFRA 4O5EA 9ICWA 7ICPA 4ED1A 4M04A 3BQ0A 3Q8SB 7ICQA 2BPCA 2BDPA 1NK7A 4B9UA 3LDAA 4QZ8A 1U48A 2ZTCA 3C21A 3GDXA 1XWLA 3V7LA 5BOMA 4NM2A 3MR5A 2OWOA 1KRPA 4JK1A 1JXLA 3PW4A 9ICMA 4XUSA 3H4DA 8ICPA 4M47A 1IM4A 4B9TA 4KLSA 3N4MB 3PO5A 1ZETA 5DQGA 3G6YA 9ICFA 4KN4A 1JMSA 5J0OA 4RUAA 4Q44A 1B43A 2NRXA 4UBCA 4R65A 2BQ3A 3ZD9A 1UT5A 2C22A 1T8EA 1ZQQA 3LWMA 3K75D 4ECSA 3PNCA 9ICOA 3H7IA 3QE9Y 2W8KA 4XRHA 2AJQA 4TURA 5DDMA 4O3PA 5DG8A 7ICFA 4PGYA 4O0IA 4DFMA 5KFTA 4X5VA 4MF8A 3T5JA 3ZDBA 1KFTA 2JZBA 1Z3EB 3BJYA 5DB7A 1ZQPA 2JEIA 3N97B 4C8MA 1BPZA 7ICTA 1KFSA 3THVA 4KLMA 4ED7A 1ZQTA 2P6UA 4RNNA 3EPIA 1ZQXA 3RB3A 1KLNA 4FS2A 3G6VA 4RNMA 4I2AA 5KFYA 3RH6A 1ZQBA 5DBCA 4DLEA 3HW8A 4KLGA 4ED6A 2XY7A 2KZZA 1NK9A 2Q0ZX 2BKEA 4ECTA 4I27A 4HYKA 4I2CA 1X9SA 1H38A 4YN4A 5DLFA 1L5UA 4NXZA 3EWAA 5J0XA 1Y88A 4P4OA 3M8RA 4MFAA 4YXMA 1RYSA 1NJWA 8ICNA 1N56A 4Z6FA 4KMUA 2AGPA 3Q8KA 4F4KA 5J0RA 3M8SA 8ICLA 4YXJA 5KFPA 4UB3A 5KFFA 3V6HA 1QSLA 2FLLA 7ICHA 4DQSA 5DB9A 2BGWA 5KFUA 2IBKA 8ICWA 3RB0A 1T4GA 4F92B 4ECRA 3M9MB 4I28A 4EBDA 1S0OA 4UB5A 4IRKA 3C1ZA 4YD2A 2HHVA 2ALZA 4JV1A 1IXRA 3ISCA 5D49A 4TUSA 3MDCA 2PFQA 3BQ1A 4DOBA 5KFWA 5KFBA 3B0XA 2W9BA 1NOMA 3AU2A 4O3SA 5BOLA 2P6RA 1TK5A 1S0NA 4EZ6A 3K4GA 3T3FA 1U45A 8ICJA 4YR3A 1KDHA 3M9OB 7ICJA 4R64A 3OJSA 4I2EA 4M9LA 2MUTA 2NRWA 4YFKA 3RJEA 3JPQA 1XU4A 4J9LA 3H8SA 1ZQIA 4KLUA 4F5QA 3C5FA 4P4PA 3V6KA 4C8OA 5CA7A 3H8WA 4QZFA 7ICRA 1BPYA 4F50A 4J9OA 4O5KA 5IIIA 2ZUBA 4KLJA 2DPJA 5KT5A 4C8LA 4NLNA 1S0MA 3OSPA 5KT6A 4DL3A 3IM1A 3KHGA 4GXJA 4R8UA 3Q8RB 3TARA 4R66A 1ZQGA 4O3RA 5KT3A 3SI8A 4DLGA 4ELTA 3PV8A 5KT2A 3ZDDA 1ZQWA 5IIKA 3SV3A 3ZDCA 4FS1A 4JV0A 5KFCA 2F1IA 3C1YA 4F5NA 4O3NA 3PMNA 2FPMA 3Q8QB 5KT4A 3PX0A 1NKBA 5D4BA 2BPGA 2JEJA 1TFRA 4RT2A 3RTVA 5DG7A 4YQWA 2P66A 4B9NA 2PFPA 2BCRA 2UVWA 9ICTA 2HHXA 3HT3A 1MC8A 5KFDA 2H5XA 4DSEA 4PGQA 5HHIA 1S10A 5DQHA 1LB2B 4PGXA 4KLTA 4BDPA 4ELVA 1NKCA 4EBCA 5KFJA 2C2RA 1NKEA 4RNOA 4QZHA 4LVSA 4O5CA 3LWLA 3NGDA 1BPDA 4K4HA 3V72A 8ICBA 4YG2A 5F9NA 2R8JA 2XO7A 4J9RA 5KG6A 5KFEA 4UBBA 5F9LA 4MFCA 3RJFA 2BPFA 2HHWA 2NRVA 4I2IA 1JIHA 1SL0A 4PHEA 3OJUA 4RQ8A 4YCXA 2FLNA 5BPCA 3RH5A 2PI4A 3ORYA 5KFXA 5DGBA 1HJPA 3OGUA 3QEBZ 1BPXA 4KLIA 1S76D 4EYIB 3UQ0A 1S9FA 3GIIA 4DO9A 1X9WA 9ICEA 2J6UA 2HVHA 3BQTA 4ECWA 2FMQA 3C5GA 3TFSA 1WCLA 3RAXA 4BWJA 4JUZA 5HNKA 4ED8A 7ICLA 4EBEA 5CHGA 1XSPA 4DQIA 4F2RA 2W8LA 4F4ZA 2J6SA 1CEZA 1A76A 2XY6A 3E2EA 5DB8A 4C8KA 8ICUA 2VA3A 4GC6A 5DG9A 1S0VA 7ICIA 4ED3A 5J0UA 2ISPA 7ICVA 2NRTA 2JZBB 5J2KA 4KLOA 1NK6A 4M9GA 1Z00A 4M0AA 2ZJ5A 4KITB 4DL6A 8ICCA 3JPTA 4C8NA 5J0PA 4DSKA 4M9HA 4NM1A 4Q43A 4QZIA 4QWDA 4ED2A 1NJXA 3RH4A 4YD1A 2V4QA 2A1JB 5KT7A 3EZ5A 1U4BA 5J2DA 3BDPA 5J29A 5DDYA 3GIMA 1U47A 5DGAA 2UVUA 4J9SA 2MAXA 5L1KA 1ZYQA 1XSNA 3T5HA 3SZ2A 4QW8A 2VA8A 3ISBA 5DKWA 3UQ2A 5KFOA 4DQRA 5KG1A 5J2EA 4F5RA 4P2HA 7ICKA 3RRHA 8ICHA 3OSNA 2VA2A 3MR2A 4I2HA 3PW5A 3TQ1A 4EZ9A 4F4XA 5L1JA 4Q8FA 2I1QA 3JPNA 1XC9A 9ICGA 4Z6DA 3V7JA 3H40A 1PZNA 5KFKA 3AUOA 4DFKA 2FMSA 3RBDA 5C5JA 5KFHA 5IIOA 8ICKA 4XA5A 9ICNA 4DWIA 4JWMA 1ZQDA 4F5OA 5EOZA 3OHAA 8ICAA 5J2CA 7ICSA 9ICBA 2W9AA 8ICYA 2LYHA 1ZQCA 2ISOA 4F3OA 2W9CA 4GXKA 1RXVA 3GFKB 2W9BB 5HMLA 4IQTA 1ZQMA 1ZQRA 2F1HA 4UB2A 5CR0A 7ICMA 4F5PA 2J6TA 3QZ7A 5KFSA 3KHHA 9ICPA 4IR9A 1TVAA 5J2JA 1XO1A 1XS9D 5KG4A 1BVSA 1L3SA 8ICIA 4E0DA 3M9NB 1TK0A 1BPEA 2PI5A 2ZJAA 4QWBA 4F93B 3UXOA 2MUTB 4QWEA 2HVIA 4TUPA 4I29A 3H8JA 3NTUA 5EWGA 4XQ8A 1A77A 3KHLA 1ZQNA 2F1JA 1RXWA 3RJHA 2HHQA 4EEYA 3KHRA 2R8HA 4ECQA 1QSSA 9ICHA 3MGHA 1D8YA 4K4IA 3TI0A 4JWNA 3MABA 9ICJA 4R8UB 2BCVA 1QSYA 4YMMA 4KN7A 4ECZA 2HHTA 1TAQA 4O9MA 1ZQLA 4RZRA 3MFIA 3SYZA 4YR2A 4O3OA 3PX6A 2C28A 4DOCA 3HP6A 4DFJA 3PX4A 4B9MA 2GWSA 9ICQA 2VANA 1U49A 4IQUA 5J2HA 2ASLA 4I2JA 4TQRA 3MFHA 3UXPA 3RJGA 2ZUCA 4ECXA 3ISDA 4FBTA 1EXNA 1ZQEA 4TUQA 1UA1A 3TAQA 8ICFA 1BPBA 3TAPA 4BXOA 3IHQB 5J0WA 4QWAA 2AGOA 2BQRA 2C2EA 3EPGA 3B0YA 4J9MA 4RPZA 3QZ8A 3RB6A 2FLPA 2UVVA 2KTQA 4Q45A 4MEXA 1ZQJA 4YVZA 1ZQZA 4M6WA 4P4MA 1T3NA 4Z6CA 3JPPA 5CJ7A 3MR3A 4DF4A 4PHDA 8ICQA 5J0SA 4FBUA 1ZQYA 2KZ3A 3PMLA 9ICIA 4IR1A 3RAQA 5J2IA 5KFQA 4DOAA 8ICGA 2BHNA 4KTQA 3GILA 1KFDA 3KTQA 4M9NA 4I2GA 5CB1A 1ZQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATL A;  4KLD A;  3JPO A;  5EWF A;  1WCN A;  1RZT A;  5KFA A;  8ICT A;  1MQ3 A;  4Q8E A;  5J2B A;  4F4Y A;  3BQ2 A;  4DS5 A;  4ECY A;  2V9W A;  4LZG A;  3RJK A;  4QW9 A;  2ASJ A;  2PFN A;  3PR5 B;  4M2Y A;  1KSP A;  3MGI A;  1JXE A;  2UVR A;  4RQ5 A;  1V9P A;  2M9N A;  1QTM A;  4DQP A;  8ICZ A;  1ZJN A;  4DL7 A;  2IHN A;  5J0T A;  4Z6E A;  2BQU A;  4J9Q A;  2XGQ A;  4DSF A;  2R8K A;  4NLK A;  5HMM A;  3EYZ A;  3TAN A;  1D9D A;  4GLX A;  3Q8L A;  4B9L A;  3PY8 A;  4J9P A;  5L9X A;  4QZA A;  1Z00 B;  2AQ0 A;  4PH5 A;  3MR6 A;  3PW7 A;  1DOQ A;  2ZJ8 A;  3FYH A;  4DQQ A;  2KFN A;  5L1L A;  5KFM A;  4KLQ A;  1L3U A;  4DSL A;  4DEZ A;  4IQV A;  5TZV A;  2ASD A;  4ZH4 A;  8ICO A;  4F2S A;  3GV7 B;  1L3V A;  3RJI A;  3MDA A;  3T5K A;  4M9J A;  5DBB A;  2Y1J A;  5IIN A;  3JPS A;  1SKR A;  3RR7 A;  4IQW A;  5J2F A;  1ZQK A;  4F91 B;  4R63 A;  4RQ2 A;  1U9L A;  4GC7 A;  4RU9 A;  4RUC A;  1KEJ A;  4PPX A;  4F8R A;  4FO6 A;  7ICN A;  1ZQV A;  2W9M A;  2C2D A;  5KG3 A;  4PHA A;  5DQI A;  2FPK A;  5D46 A;  2XC9 A;  1ZJM A;  3FDS A;  2KZM A;  8ICR A;  4UAY A;  3EW9 A;  3OHB A;  4DFP A;  1JX4 A;  5J0Q A;  1S97 A;  9ICX A;  4LZD A;  3V6J A;  3Q8P B;  4QZ9 A;  1SKS A;  1ZQA A;  4JV2 A;  4KLL A;  3PR4 A;  5EWE A;  3GIJ A;  2PXI A;  1K1Q A;  4EYH B;  2A1J A;  1L3T A;  1RPL A;  2ZUD A;  4QWC A;  5J2G A;  1D8L A;  1UT8 A;  1NJY A;  2W9C B;  2R8G A;  1C7Y A;  3HPO A;  4DS4 A;  1MQ2 A;  4RQ7 A;  5KTQ A;  4UB1 A;  1SL1 A;  2V4R A;  1X9M A;  1NK0 A;  3MBY A;  2XCP A;  5KFV A;  2PFO A;  3SV4 A;  2JEF A;  2B21 A;  2I9G A;  5KG2 A;  4DL5 A;  3JPR A;  4B9V A;  5KFZ A;  2BCQ A;  7ICG A;  9ICA A;  2BR0 A;  4UAZ A;  2Y1I A;  3AU6 A;  4RPX A;  1MSW D;  3PVX A;  2RDI A;  4QZD A;  4B9S A;  4K4G A;  2RDJ A;  5KFN A;  1ZQO A;  3C2K A;  4DL2 A;  1COO A;  1S77 D;  2KFZ A;  5IIM A;  2HW3 A;  8ICM A;  5HHH A;  1N48 A;  4MF2 A;  1TV9 A;  3ZDA A;  7ICO A;  9ICL A;  5HP4 A;  3PW0 A;  4I2B A;  3T5L A;  5JUM A;  5J2A A;  4G3I A;  2BCU A;  2R8I A;  3PO4 A;  5KG5 A;  4RQ1 A;  9ICU A;  4ELU A;  4YMN A;  3HWT A;  2AGQ A;  2ZTD A;  2IHM A;  3C23 A;  4KLF A;  3RR8 A;  5KFR A;  4MFF A;  2HHU A;  8ICS A;  4RQ3 A;  4ED0 A;  1X2I A;  3ETL A;  4BGD A;  4DL4 A;  4DF8 A;  4CCH A;  9ICS A;  9ICV A;  2FPL A;  5J0Y A;  4NLZ A;  2XY5 A;  4ECU A;  2IMW P;  7ICE A;  4F4W A;  5IIJ A;  1SKW A;  2DFL A;  4O3Q A;  4KLE A;  5DBA A;  2DPI A;  1K1S A;  4QZE A;  1NJZ A;  2XCA A;  1B22 A;  5L1I A;  3QEA Z;  5KG7 A;  1LV5 A;  1NK5 A;  4NLG A;  5DLG A;  3UXN A;  4BXO B;  5KFI A;  3ZDE A;  4UQG A;  7ICU A;  4QZG A;  4ECV A;  2WTF A;  9ICR A;  1UA0 A;  4J9K A;  9ICC A;  1ZQU A;  4M6W B;  5CWR A;  3RB4 A;  4DSJ A;  4DSI A;  1SZP A;  1BGX T;  4UAW A;  8ICV A;  2AU0 A;  3C2M A;  2HHS A;  4RQ6 A;  4RQ4 A;  4PHP A;  5IIL A;  8ICX A;  4RT3 A;  3H4B A;  3RJJ A;  9ICK A;  4YMO A;  3Q8M A;  3GV5 B;  1KTQ A;  1JN3 A;  5DB6 A;  1RYR A;  5KFL A;  3UPQ A;  3C2L A;  1ZQF A;  4RPY A;  4RQ0 A;  1ARO P;  3PW2 A;  1TK8 A;  2FMP A;  2IA6 A;  2JEG A;  1TKD A;  8ICE A;  4IRC A;  1D9F A;  3RRG A;  1HUO A;  2BCS A;  2AQ4 A;  5KG0 A;  4BWM A;  3ZD8 A;  1XSL A;  5KFG A;  3RBE A;  4I2F A;  4I2D A;  5CP2 A;  3G6X A;  2NRZ A;  4IRD A;  1CUK A;  1SL2 A;  3V7K A;  4KLH A;  4J9N A;  4NY8 A;  1TAU A;  2ZTE A;  4QZC A;  2KN7 A;  1NK8 A;  4QZB A;  4UB4 A;  3HX0 A;  1HUZ A;  2XGP A;  4YR0 A;  3GIK A;  3GV8 B;  4GXI A;  3LK9 A;  4TQS A;  4YP3 A;  1ZQH A;  1T7P A;  1QLN A;  3GQC A;  1NK4 A;  1DGS A;  4MEY A;  3TFR A;  4O5E A;  9ICW A;  7ICP A;  4ED1 A;  4M04 A;  3BQ0 A;  3Q8S B;  7ICQ A;  2BPC A;  2BDP A;  1NK7 A;  4B9U A;  3LDA A;  4QZ8 A;  1U48 A;  2ZTC A;  3C21 A;  3GDX A;  1XWL A;  3V7L A;  5BOM A;  4NM2 A;  3MR5 A;  2OWO A;  1KRP A;  4JK1 A;  1JXL A;  3PW4 A;  9ICM A;  4XUS A;  3H4D A;  8ICP A;  4M47 A;  1IM4 A;  4B9T A;  4KLS A;  3N4M B;  3PO5 A;  1ZET A;  5DQG A;  3G6Y A;  9ICF A;  4KN4 A;  1JMS A;  5J0O A;  4RUA A;  4Q44 A;  1B43 A;  2NRX A;  4UBC A;  4R65 A;  2BQ3 A;  3ZD9 A;  1UT5 A;  2C22 A;  1T8E A;  1ZQQ A;  3LWM A;  3K75 D;  4ECS A;  3PNC A;  9ICO A;  3H7I A;  3QE9 Y;  2W8K A;  4XRH A;  2AJQ A;  4TUR A;  5DDM A;  4O3P A;  5DG8 A;  7ICF A;  4PGY A;  4O0I A;  4DFM A;  5KFT A;  4X5V A;  4MF8 A;  3T5J A;  3ZDB A;  1KFT A;  2JZB A;  1Z3E B;  3BJY A;  5DB7 A;  1ZQP A;  2JEI A;  3N97 B;  4C8M A;  1BPZ A;  7ICT A;  1KFS A;  3THV A;  4KLM A;  4ED7 A;  1ZQT A;  2P6U A;  4RNN A;  3EPI A;  1ZQX A;  3RB3 A;  1KLN A;  4FS2 A;  3G6V A;  4RNM A;  4I2A A;  5KFY A;  3RH6 A;  1ZQB A;  5DBC A;  4DLE A;  3HW8 A;  4KLG A;  4ED6 A;  2XY7 A;  2KZZ A;  1NK9 A;  2Q0Z X;  2BKE A;  4ECT A;  4I27 A;  4HYK A;  4I2C A;  1X9S A;  1H38 A;  4YN4 A;  5DLF A;  1L5U A;  4NXZ A;  3EWA A;  5J0X A;  1Y88 A;  4P4O A;  3M8R A;  4MFA A;  4YXM A;  1RYS A;  1NJW A;  8ICN A;  1N56 A;  4Z6F A;  4KMU A;  2AGP A;  3Q8K A;  4F4K A;  5J0R A;  3M8S A;  8ICL A;  4YXJ A;  5KFP A;  4UB3 A;  5KFF A;  3V6H A;  1QSL A;  2FLL A;  7ICH A;  4DQS A;  5DB9 A;  2BGW A;  5KFU A;  2IBK A;  8ICW A;  3RB0 A;  1T4G A;  4F92 B;  4ECR A;  3M9M B;  4I28 A;  4EBD A;  1S0O A;  4UB5 A;  4IRK A;  3C1Z A;  4YD2 A;  2HHV A;  2ALZ A;  4JV1 A;  1IXR A;  3ISC A;  5D49 A;  4TUS A;  3MDC A;  2PFQ A;  3BQ1 A;  4DOB A;  5KFW A;  5KFB A;  3B0X A;  2W9B A;  1NOM A;  3AU2 A;  4O3S A;  5BOL A;  2P6R A;  1TK5 A;  1S0N A;  4EZ6 A;  3K4G A;  3T3F A;  1U45 A;  8ICJ A;  4YR3 A;  1KDH A;  3M9O B;  7ICJ A;  4R64 A;  3OJS A;  4I2E A;  4M9L A;  2MUT A;  2NRW A;  4YFK A;  3RJE A;  3JPQ A;  1XU4 A;  4J9L A;  3H8S A;  1ZQI A;  4KLU A;  4F5Q A;  3C5F A;  4P4P A;  3V6K A;  4C8O A;  5CA7 A;  3H8W A;  4QZF A;  7ICR A;  1BPY A;  4F50 A;  4J9O A;  4O5K A;  5III A;  2ZUB A;  4KLJ A;  2DPJ A;  5KT5 A;  4C8L A;  4NLN A;  1S0M A;  3OSP A;  5KT6 A;  4DL3 A;  3IM1 A;  3KHG A;  4GXJ A;  4R8U A;  3Q8R B;  3TAR A;  4R66 A;  1ZQG A;  4O3R A;  5KT3 A;  3SI8 A;  4DLG A;  4ELT A;  3PV8 A;  5KT2 A;  3ZDD A;  1ZQW A;  5IIK A;  3SV3 A;  3ZDC A;  4FS1 A;  4JV0 A;  5KFC A;  2F1I A;  3C1Y A;  4F5N A;  4O3N A;  3PMN A;  2FPM A;  3Q8Q B;  5KT4 A;  3PX0 A;  1NKB A;  5D4B A;  2BPG A;  2JEJ A;  1TFR A;  4RT2 A;  3RTV A;  5DG7 A;  4YQW A;  2P66 A;  4B9N A;  2PFP A;  2BCR A;  2UVW A;  9ICT A;  2HHX A;  3HT3 A;  1MC8 A;  5KFD A;  2H5X A;  4DSE A;  4PGQ A;  5HHI A;  1S10 A;  5DQH A;  1LB2 B;  4PGX A;  4KLT A;  4BDP A;  4ELV A;  1NKC A;  4EBC A;  5KFJ A;  2C2R A;  1NKE A;  4RNO A;  4QZH A;  4LVS A;  4O5C A;  3LWL A;  3NGD A;  1BPD A;  4K4H A;  3V72 A;  8ICB A;  4YG2 A;  5F9N A;  2R8J A;  2XO7 A;  4J9R A;  5KG6 A;  5KFE A;  4UBB A;  5F9L A;  4MFC A;  3RJF A;  2BPF A;  2HHW A;  2NRV A;  4I2I A;  1JIH A;  1SL0 A;  4PHE A;  3OJU A;  4RQ8 A;  4YCX A;  2FLN A;  5BPC A;  3RH5 A;  2PI4 A;  3ORY A;  5KFX A;  5DGB A;  1HJP A;  3OGU A;  3QEB Z;  1BPX A;  4KLI A;  1S76 D;  4EYI B;  3UQ0 A;  1S9F A;  3GII A;  4DO9 A;  1X9W A;  9ICE A;  2J6U A;  2HVH A;  3BQT A;  4ECW A;  2FMQ A;  3C5G A;  3TFS A;  1WCL A;  3RAX A;  4BWJ A;  4JUZ A;  5HNK A;  4ED8 A;  7ICL A;  4EBE A;  5CHG A;  1XSP A;  4DQI A;  4F2R A;  2W8L A;  4F4Z A;  2J6S A;  1CEZ A;  1A76 A;  2XY6 A;  3E2E A;  5DB8 A;  4C8K A;  8ICU A;  2VA3 A;  4GC6 A;  5DG9 A;  1S0V A;  7ICI A;  4ED3 A;  5J0U A;  2ISP A;  7ICV A;  2NRT A;  2JZB B;  5J2K A;  4KLO A;  1NK6 A;  4M9G A;  1Z00 A;  4M0A A;  2ZJ5 A;  4KIT B;  4DL6 A;  8ICC A;  3JPT A;  4C8N A;  5J0P A;  4DSK A;  4M9H A;  4NM1 A;  4Q43 A;  4QZI A;  4QWD A;  4ED2 A;  1NJX A;  3RH4 A;  4YD1 A;  2V4Q A;  2A1J B;  5KT7 A;  3EZ5 A;  1U4B A;  5J2D A;  3BDP A;  5J29 A;  5DDY A;  3GIM A;  1U47 A;  5DGA A;  2UVU A;  4J9S A;  2MAX A;  5L1K A;  1ZYQ A;  1XSN A;  3T5H A;  3SZ2 A;  4QW8 A;  2VA8 A;  3ISB A;  5DKW A;  3UQ2 A;  5KFO A;  4DQR A;  5KG1 A;  5J2E A;  4F5R A;  4P2H A;  7ICK A;  3RRH A;  8ICH A;  3OSN A;  2VA2 A;  3MR2 A;  4I2H A;  3PW5 A;  3TQ1 A;  4EZ9 A;  4F4X A;  5L1J A;  4Q8F A;  2I1Q A;  3JPN A;  1XC9 A;  9ICG A;  4Z6D A;  3V7J A;  3H40 A;  1PZN A;  5KFK A;  3AUO A;  4DFK A;  2FMS A;  3RBD A;  5C5J A;  5KFH A;  5IIO A;  8ICK A;  4XA5 A;  9ICN A;  4DWI A;  4JWM A;  1ZQD A;  4F5O A;  5EOZ A;  3OHA A;  8ICA A;  5J2C A;  7ICS A;  9ICB A;  2W9A A;  8ICY A;  2LYH A;  1ZQC A;  2ISO A;  4F3O A;  2W9C A;  4GXK A;  1RXV A;  3GFK B;  2W9B B;  5HML A;  4IQT A;  1ZQM A;  1ZQR A;  2F1H A;  4UB2 A;  5CR0 A;  7ICM A;  4F5P A;  2J6T A;  3QZ7 A;  5KFS A;  3KHH A;  9ICP A;  4IR9 A;  1TVA A;  5J2J A;  1XO1 A;  1XS9 D;  5KG4 A;  1BVS A;  1L3S A;  8ICI A;  4E0D A;  3M9N B;  1TK0 A;  1BPE A;  2PI5 A;  2ZJA A;  4QWB A;  4F93 B;  3UXO A;  2MUT B;  4QWE A;  2HVI A;  4TUP A;  4I29 A;  3H8J A;  3NTU A;  5EWG A;  4XQ8 A;  1A77 A;  3KHL A;  1ZQN A;  2F1J A;  1RXW A;  3RJH A;  2HHQ A;  4EEY A;  3KHR A;  2R8H A;  4ECQ A;  1QSS A;  9ICH A;  3MGH A;  1D8Y A;  4K4I A;  3TI0 A;  4JWN A;  3MAB A;  9ICJ A;  4R8U B;  2BCV A;  1QSY A;  4YMM A;  4KN7 A;  4ECZ A;  2HHT A;  1TAQ A;  4O9M A;  1ZQL A;  4RZR A;  3MFI A;  3SYZ A;  4YR2 A;  4O3O A;  3PX6 A;  2C28 A;  4DOC A;  3HP6 A;  4DFJ A;  3PX4 A;  4B9M A;  2GWS A;  9ICQ A;  2VAN A;  1U49 A;  4IQU A;  5J2H A;  2ASL A;  4I2J A;  4TQR A;  3MFH A;  3UXP A;  3RJG A;  2ZUC A;  4ECX A;  3ISD A;  4FBT A;  1EXN A;  1ZQE A;  4TUQ A;  1UA1 A;  3TAQ A;  8ICF A;  1BPB A;  3TAP A;  4BXO A;  3IHQ B;  5J0W A;  4QWA A;  2AGO A;  2BQR A;  2C2E A;  3EPG A;  3B0Y A;  4J9M A;  4RPZ A;  3QZ8 A;  3RB6 A;  2FLP A;  2UVV A;  2KTQ A;  4Q45 A;  4MEX A;  1ZQJ A;  4YVZ A;  1ZQZ A;  4M6W A;  4P4M A;  1T3N A;  4Z6C A;  3JPP A;  5CJ7 A;  3MR3 A;  4DF4 A;  4PHD A;  8ICQ A;  5J0S A;  4FBU A;  1ZQY A;  2KZ3 A;  3PML A;  9ICI A;  4IR1 A;  3RAQ A;  5J2I A;  5KFQ A;  4DOA A;  8ICG A;  2BHN A;  4KTQ A;  3GIL A;  1KFD A;  3KTQ A;  4M9N A;  4I2G A;  5CB1 A;  1ZQS A; 
#chains in the Genus database with same CATH topology
 4KLD A;  3QXG A;  1WCN A;  2EZZ A;  2I6X A;  2V9W A;  5AI5 A;  4M2Y A;  2WB1 F;  4RQ5 A;  3ETR A;  4DQP A;  8ICZ A;  2KNJ A;  2IHN A;  5AK4 A;  2W3S A;  1NNL A;  3DEE A;  4J9Q A;  4GLX A;  4PH5 A;  1DOQ A;  2ZJ8 A;  5KFM A;  5AKH A;  4KLQ A;  2KJ5 A;  2ASD A;  4Y2J A;  3RJI A;  1JI7 A;  3MDA A;  1SKR A;  4IQW A;  3PZP A;  4RQM A;  4R63 A;  1F44 A;  1U9L A;  4GC7 A;  4PPX A;  4FO6 A;  2C2D A;  5G5G A;  2XC9 A;  1LVH A;  3FDS A;  1TE2 A;  4DFP A;  9ICX A;  4LZD A;  4QZ9 A;  5KAF U;  4F71 A;  4EYH B;  1L3T A;  1L7P A;  1D8L A;  2OHF A;  3HKZ C;  1C7Y A;  1SL1 A;  4UB1 A;  4EX6 A;  1X9M A;  1NK0 A;  3CRX A;  2I9G A;  5KG2 A;  2Y0S C;  4B9V A;  3SAG A;  3M6K A;  4P0P B;  3QUC A;  3AU6 A;  1MSW D;  4K4G A;  5KFN A;  3NS1 A;  2KIW A;  2XIC A;  2NO5 A;  2G0A A;  2K4E A;  4Y2R A;  4MF2 A;  1TV9 A;  9ICL A;  1COK A;  3VCB A;  4I2B A;  3T5L A;  2JR5 A;  5KG5 A;  4YMN A;  2ZTD A;  1X2I A;  3PSP A;  2ZIU B;  9ICS A;  2LYB A;  5J0Y A;  4DFD A;  4F4W A;  5IIJ A;  2O6K A;  1NJZ A;  1B22 A;  4UAR A;  5KG7 A;  5DLG A;  4BXO B;  3ZDE A;  4UQG A;  2VJ5 A;  1L8L A;  4ECV A;  9ICR A;  9ICC A;  4C4S A;  5J8Y A;  1SZP A;  4UAW A;  4RQ4 A;  3RJJ A;  3H4B A;  1KTQ A;  1JN3 A;  1X42 A;  5KFL A;  1ZQF A;  1TK8 A;  3QUB A;  2GH1 A;  2JEG A;  1TKD A;  1D9F A;  3RRG A;  5AIB A;  5CRX A;  3ZD8 A;  5ALY A;  2ZIX A;  3RBE A;  4I2D A;  3G6X A;  1SL2 A;  1TAU A;  2JH7 A;  4QZC A;  5ALJ A;  1NK8 A;  4QZB A;  4UB4 A;  2YML A;  5AM1 A;  1HUZ A;  3RFA A;  3GIK A;  3LK9 A;  4TQS A;  2YMP A;  2CPR A;  3GQC A;  4MEY A;  7ICP A;  5ALV A;  2FE9 A;  4ED1 A;  4M04 A;  2BPC A;  1NK7 A;  4B9U A;  2ZTC A;  3C21 A;  2KVC A;  3MR5 A;  4NM2 A;  4JK1 A;  3PW4 A;  3H4D A;  4M47 A;  5JU5 A;  1ZET A;  5DQG A;  3G6Y A;  4NLC A;  4Q44 A;  2L5Y A;  5ALE A;  2NRX A;  4R65 A;  2BQ3 A;  1ZQQ A;  3ZD9 A;  3K75 D;  4ECS A;  3H7I A;  2W8K A;  2AJQ A;  3H0R B;  1DXS A;  2RLT A;  5T14 A;  4MF8 A;  3ZDB A;  2CRX A;  1VJ5 A;  3EPI A;  4C4R A;  3RB3 A;  1ZQX A;  1KLN A;  4FS2 A;  5AKK A;  4ED6 A;  2KZZ A;  2OEH A;  1Z19 A;  4NXZ A;  1L5U A;  4NLB A;  4YXM A;  1RYS A;  8ICN A;  1N56 A;  2WF7 A;  4Z6F A;  2KMD A;  2RRD A;  4G9B A;  1WG8 A;  5J0R A;  2FLL A;  7ICH A;  5KFU A;  4ACO A;  8ICW A;  4ECR A;  5K4L A;  4EBD A;  3C1Z A;  5D49 A;  4DCC A;  3MDC A;  2PFQ A;  1Z4O A;  3BQ1 A;  4DOB A;  2HI0 A;  2DGZ A;  5KFW A;  1YZ7 A;  3AU2 A;  5BOL A;  3UMB A;  3KZX A;  4EX7 A;  3QU7 A;  3OJS A;  2NV3 A;  4I2E A;  2MUT A;  3RJE A;  3JPQ A;  1RG6 A;  4F5Q A;  2HMX A;  4QZF A;  1BPY A;  2JMG A;  2LM4 A;  4ZOH C;  5III A;  4KLJ A;  3D2N A;  3OSP A;  3E0F A;  3IM1 A;  3KHG A;  3M6Z A;  4R8U A;  2ZIU A;  3SI8 A;  3ZDD A;  2KVS A;  3ZDC A;  2Z7J A;  4FS1 A;  2ODG A;  2F1I A;  4O3N A;  2FPM A;  3PX0 A;  5KT4 A;  4A8E A;  4RT2 A;  4YQW A;  2PFP A;  5AI4 A;  3WK9 A;  3OPX A;  2ESE A;  1Z1V A;  1NKE A;  3CNH A;  4QZH A;  1BPD A;  2ZXI A;  5AK3 A;  4YG2 A;  2R8J A;  2HHW A;  2NRV A;  2B6G A;  1K5O A;  4RQ8 A;  1HJP A;  3GII A;  2FMQ A;  1V85 A;  3RAX A;  3GZF A;  1ZD2 P;  4ED8 A;  5ALZ A;  4Y2T A;  5CHG A;  4F2R A;  2EAP A;  5JRT A;  2KHQ A;  2J6S A;  1CEZ A;  4C8K A;  2HBL A;  2VA3 A;  3NRW A;  1S5L U;  2KJ9 A;  5J2K A;  4KLO A;  1NK6 A;  4GIB A;  3QU5 A;  4M9H A;  4NM1 A;  4Q43 A;  1NJX A;  4YD1 A;  2E5S A;  3CW2 C;  5L1K A;  2K8C B;  4DQR A;  3HJE A;  5J2E A;  4P2H A;  3RRH A;  3TQ1 A;  4F4X A;  2I1Q A;  3JPN A;  5AK6 A;  4OCZ A;  1ZQ1 C;  5ALT A;  5KFK A;  3AUO A;  4DFK A;  5C5J A;  4EEK A;  4XA5 A;  1ZQD A;  7ICS A;  8ICY A;  2LYH A;  1UHU A;  2W43 A;  2E8O A;  2W9C A;  4GXK A;  5AKI A;  2QKQ A;  1XO1 A;  8ICI A;  1TK0 A;  1BPE A;  4KMO B;  4QWB A;  2YB1 A;  4TUP A;  3K1R B;  4JMU A;  2DKZ A;  2A19 A;  1KL9 A;  1GO3 F;  3N28 A;  3KHR A;  1QSS A;  4PL2 A;  3TI0 A;  3U26 A;  1SV0 C;  5KL8 B;  2LPE A;  2BCV A;  2KK0 A;  5ALX A;  2HBM A;  3A0H U;  4IQU A;  4I2J A;  3RJG A;  1ED1 A;  3AQE A;  3ISD A;  4FBT A;  3B9J A;  2MRL A;  4QJF B;  5J0W A;  3ZI4 A;  3NVY A;  4RPZ A;  3QZ8 A;  4C7Z A;  4M6W A;  3JPP A;  5ALG A;  2KP7 A;  5J0S A;  3IRU A;  2W7O A;  4IR1 A;  5KFQ A;  4DOA A;  2BHN A;  3KTQ A;  5CB1 A;  5ALF A;  1RZT A;  2QB0 B;  4Q8E A;  3BQ2 A;  2A1A A;  4LZG A;  4QW9 A;  5ALW A;  1KSP A;  1JXE A;  1J2M A;  1QQ6 A;  1ZJN A;  2EAN A;  2H3Q A;  4Z6E A;  4NLK A;  1XO0 A;  1D9D A;  3TAN A;  3OTQ A;  3PY8 A;  2K4P A;  2KFN A;  3PW7 A;  1ZOL A;  3FYH A;  5L1L A;  4DSL A;  3CP8 A;  2W03 A;  4FE3 A;  3GV7 B;  3T5K A;  4M9J A;  5DBB A;  5IIN A;  4C7Y A;  3RR7 A;  1VLB A;  3KFU F;  2LMR A;  4RQ2 A;  1V97 A;  4PHA A;  2KZM A;  5AKY A;  1ZJM A;  2I5H A;  1SXE A;  5CEH A;  4KLL A;  3PR4 A;  3KBB A;  2PXI A;  5EE0 A;  1NJY A;  2DWQ A;  2R8G A;  3HPO A;  1L7N A;  3SV4 A;  2JEF A;  2W11 A;  4DL5 A;  3JPR A;  2BCQ A;  2K89 A;  2YB4 A;  2BR0 A;  2Y1I A;  3H0M B;  2RDJ A;  3C2K A;  4DL2 A;  2WF5 A;  2KFZ A;  5IIM A;  2HW3 A;  5HHH A;  7ICO A;  5ALU A;  3ZDA A;  5HP4 A;  4FZL A;  5AI8 A;  2ZIW B;  4G3I A;  2R8I A;  3D6J A;  2RHF A;  9ICU A;  3HWT A;  2AGQ A;  2Q4T A;  3L3F X;  3RR8 A;  5KFR A;  8ICS A;  4DL4 A;  3ETL A;  3HIL A;  3HRD D;  3SEI A;  1N2X A;  1FIQ A;  4NLZ A;  2IMW P;  1SKW A;  5B5E U;  4KLE A;  5ALS A;  4O3Q A;  3HKZ F;  3SR6 A;  3SAF A;  3UXN A;  5KFI A;  4QZG A;  2WTF A;  2G5I B;  1NZB A;  3AN1 A;  5CWR A;  4DSJ A;  4DSI A;  4LJX A;  2HHS A;  4Y2Q A;  4RT3 A;  4YMO A;  3GV5 B;  3KOO A;  3QU2 A;  1Q46 A;  5DB6 A;  1RYR A;  3PSI A;  3C2L A;  4RPY A;  2FMP A;  3WKD A;  8ICE A;  3QUQ A;  3O0F A;  4QIW C;  2BCS A;  2AQ4 A;  5KG0 A;  4I2F A;  4IRD A;  1CUK A;  3V7K A;  2IOF K;  2JH1 A;  4NL9 A;  4GXI A;  4YP3 A;  3SQI A;  1NK4 A;  9ICW A;  1DGJ A;  2BDP A;  5TIS U;  3LDA A;  1U48 A;  3V7L A;  2OWO A;  2E8N A;  1JXL A;  2GLE A;  9ICM A;  5AI9 A;  1FFV A;  1X6J A;  4B9T A;  5C0Y A;  3N4M B;  3I1Y A;  5J0O A;  4CF5 A;  3LWM A;  4CGZ A;  3AL0 B;  4X5V A;  1KFT A;  1XNS A;  1ZQP A;  3F2B A;  4OO1 J;  5AM3 A;  7ICT A;  1KFS A;  4ED7 A;  1ZQT A;  4RNN A;  5JTI A;  4C4T A;  3BS5 A;  4RNM A;  1PVQ A;  1ZQB A;  4KLG A;  5DBC A;  4DLE A;  3LYS A;  5AKZ A;  3IN5 A;  3AEV A;  4EEL A;  1NK9 A;  2Q0Z X;  5KAI U;  1H38 A;  4YN4 A;  1Y88 A;  2QAR B;  4MFA A;  5H2F U;  1WYG A;  4EEN A;  3UMG A;  2F76 X;  3M8S A;  8ICL A;  9ICI A;  4NL9 C;  5KFP A;  4UAS A;  4DQS A;  1QCK A;  2BGW A;  3M1Y A;  2PMZ C;  3RB0 A;  1T4G A;  3AMZ A;  5FP0 A;  4I28 A;  2EDU A;  1KBU A;  1B4F A;  4JV1 A;  5AI0 A;  1LKY A;  2HOI A;  1IV8 A;  2JGA A;  4CNQ A;  5KFB A;  1NOM A;  4KX5 A;  4AYB F;  1TK5 A;  2P6R A;  1UCV A;  3K4G A;  3NVZ A;  2A3V A;  3M9O B;  2H3I A;  4R64 A;  4M9L A;  2NRW A;  5EE3 A;  4YFK A;  1XU4 A;  3H8S A;  4KLU A;  3C5F A;  3V6K A;  5CA7 A;  3H8W A;  4J9O A;  2ZUB A;  1DRG A;  5KT5 A;  4NLN A;  5KT6 A;  3TAR A;  2RP5 A;  4O3R A;  2F3N A;  1Q3V A;  5KFC A;  1SWW A;  3PMN A;  1V38 A;  5D4B A;  1SV4 A;  2JEJ A;  1SZH A;  2P66 A;  2ES6 A;  2ZXH A;  3C28 A;  2YY6 A;  2E8P A;  4ELV A;  2LKY A;  1JRO A;  2D3D A;  4LVS A;  3LWL A;  3NGD A;  3UM9 A;  2WAQ F;  3FC4 A;  5F9N A;  2FDR A;  2XO7 A;  2LBO A;  4US9 A;  3RJF A;  1SL0 A;  4IS7 A;  3OJU A;  5BPC A;  3RH5 A;  2PI4 A;  1S76 D;  1BPX A;  1F0M A;  2J6U A;  3BQT A;  1WCL A;  4BWJ A;  4JUZ A;  4FFD A;  2XY6 A;  5AK5 A;  5DG9 A;  4ED3 A;  5ALD A;  7ICV A;  2P35 A;  2JZB B;  4P0Q B;  5J8Y C;  4M9G A;  2EH9 A;  5E79 U;  2ZJ5 A;  8ICC A;  1N63 A;  3JPT A;  4C8N A;  5J0P A;  3WK5 A;  5ALP A;  4QZI A;  5KNI A;  4BJQ A;  2V4Q A;  3EZ5 A;  3GIM A;  1U47 A;  1PK3 A;  3T5H A;  4QW8 A;  5DKW A;  1CI4 A;  1RQN A;  2VKQ A;  4ICA A;  3NVV A;  3OSN A;  2HOF A;  2F8K A;  4EZ9 A;  5L1J A;  1ZD3 A;  3V7J A;  3H40 A;  1PZN A;  2MSN A;  5IIO A;  5KFH A;  9ICN A;  4JWM A;  3WK8 A;  4F5O A;  3OHA A;  5J2C A;  2LHT A;  3J81 j;  1IG6 A;  1RXV A;  2W9B B;  1ZQM A;  1ZQR A;  2F1H A;  4UB2 A;  9ICP A;  2J6T A;  3KHH A;  1PUZ A;  2HBK A;  5KG4 A;  3TAD A;  4UB8 U;  2NYV A;  2ZJA A;  4P0P A;  4F93 B;  2HVI A;  2XI9 A;  1JUD A;  2G09 A;  1A77 A;  3RJH A;  9ICH A;  1X9X A;  4K4I A;  3MAB A;  5L1M A;  1QSY A;  4KN7 A;  1TAQ A;  1ZQL A;  4WJ3 B;  4RZR A;  3SYZ A;  3PX6 A;  2YMM A;  4B9M A;  5AHX A;  1U49 A;  5J2H A;  5AIA A;  4TQR A;  1JRP A;  4TUQ A;  3TAP A;  4BXO A;  3IHQ B;  2AGO A;  4QWA A;  2BQR A;  4J9M A;  3RB6 A;  2FLP A;  2UVV A;  4Q45 A;  1ZQZ A;  4P4M A;  5ALN A;  3ALR A;  5CJ7 A;  4DF4 A;  4PHD A;  1IIP A;  8ICQ A;  1OXJ A;  1ZQY A;  2KZ3 A;  5EE9 A;  4Y2P A;  1F5S A;  2H3Z A;  3I28 A;  3IDW A;  4KTQ A;  1QQ7 A;  2ATL A;  3JPO A;  5KFA A;  1RDF A;  5GTH U;  8ICT A;  3CYM A;  4F4Y A;  2YN4 A;  4DS5 A;  4ECY A;  2ASJ A;  3MGI A;  2UVR A;  1V9P A;  2M9N A;  2MU2 A;  5AKG A;  4U7C A;  5J0T A;  2BQU A;  4DSF A;  3WKB A;  3EYZ A;  2KJ8 A;  4J9P A;  2QB1 A;  4QZA A;  2AXT U;  1Z00 B;  4DQQ A;  4BUG A;  4ZH4 A;  8ICO A;  4F2S A;  2E8M A;  2Y1J A;  1KEJ A;  4F8R A;  1ZQV A;  5AKL A;  1UPH A;  2W9M A;  2M0N A;  2FPK A;  4UAY A;  3EW9 A;  3OHB A;  1JX4 A;  3QYP A;  1SKS A;  3GIJ A;  1K1Q A;  2KSO B;  4QWC A;  3H0L B;  1UT8 A;  3BS7 A;  5KTQ A;  2V4R A;  1FO4 A;  4KX3 A;  2XCP A;  4B6J A;  2XVT A;  5KFZ A;  4CDG A;  9ICA A;  4RPX A;  3PVX A;  5KL1 B;  1ZQO A;  3WU2 U;  1COO A;  1S77 D;  1A0P A;  1N48 A;  3QU4 A;  3PW0 A;  1KQQ A;  5J2A A;  2DQN B;  2BCU A;  1T94 A;  2IHM A;  4KLF A;  2HHU A;  3VC8 A;  3C23 A;  3D2Q A;  4BGD A;  4CCH A;  9ICV A;  2CN1 A;  4OJO A;  2FPL A;  1FFU A;  2JRZ A;  2LM1 A;  4ECU A;  7ICE A;  2DFL A;  5DBA A;  4QZE A;  3QEA Z;  4NLG A;  3RF9 A;  2JXJ A;  3QX7 A;  4J9K A;  4OJ5 A;  1ZQU A;  2DKX A;  8ICV A;  1SGG A;  3C2M A;  4Y2Y A;  4RQ6 A;  2KOB A;  2AU0 A;  5IIL A;  8ICX A;  2KE7 A;  2D8C A;  1MN8 A;  2LI6 A;  2KG5 A;  1ARO P;  3IP4 B;  1L8O A;  3F5A A;  1HUO A;  3KD3 A;  3H8M A;  4BWM A;  1XSL A;  1KN5 A;  3L5K A;  1RM6 C;  4NV0 A;  4NJ8 A;  2ZTE A;  2KN7 A;  3HX0 A;  2XGP A;  3S6J A;  3IG8 A;  1ZQH A;  3QUT A;  1QLN A;  1DGS A;  3ONN A;  2G06 A;  4FZN A;  2HCF A;  3Q8S B;  7ICQ A;  5ALI A;  4QZ8 A;  1XWL A;  5AM2 A;  1IM4 A;  4UW9 A;  3BZC A;  1PVR A;  5ALR A;  3TKA A;  4QIW F;  4KN4 A;  1JMS A;  2F8L A;  1B43 A;  4UBC A;  2BDU A;  1UT5 A;  2C22 A;  3PNC A;  4XRH A;  4TUR A;  5DG8 A;  7ICF A;  4PGY A;  4DFM A;  5KFT A;  3T5J A;  3MC1 A;  1ZRN A;  4CE6 A;  1O03 A;  1Z3E B;  4RQN A;  5DB7 A;  2KKP A;  2JEI A;  4C8M A;  1BPZ A;  4KLM A;  1J97 A;  3BZK A;  3PSF A;  9ICJ A;  2W04 A;  3QU9 A;  3G6V A;  3RH6 A;  1OW5 A;  2W55 A;  4ECT A;  4OJL A;  5DLF A;  2EQY A;  1SXD A;  3M8R A;  3EWA A;  5J0X A;  3A0B U;  1NJW A;  4KMU A;  3Q8K A;  4CRX A;  4YXJ A;  5KFF A;  3V6H A;  2IBK A;  2KSO A;  1S0O A;  2D6F C;  2KIC A;  1N5X A;  2DBY A;  3ISC A;  4TUS A;  2W54 A;  3WK4 A;  4O3S A;  5ALM A;  1S0N A;  4EZ6 A;  2F77 X;  3T3F A;  1U45 A;  4YR3 A;  3ICX A;  1KDH A;  1L7M A;  7ICJ A;  1ZRM A;  2Y0S F;  3NRZ A;  1BNO A;  4C8O A;  7ICR A;  3D2S A;  5GTI U;  4F50 A;  2HSZ A;  2DPJ A;  4C8L A;  1S0M A;  1ZQG A;  5KT3 A;  4DLG A;  1L7O A;  2PMZ F;  2AH5 A;  4Y2U A;  1URJ A;  3C1Y A;  4F5N A;  2W3R A;  5HR6 A;  3Q8Q B;  2ZIX B;  1ZXI A;  4B9N A;  3RTV A;  3UMC A;  2BCR A;  1X6I A;  2OM6 A;  9ICT A;  3HT3 A;  1MC8 A;  3DV9 A;  4PGQ A;  5HHI A;  1S10 A;  5DQH A;  4KLT A;  5ALK A;  2DL0 A;  2C2R A;  1KKX A;  4O5C A;  3LVW A;  3E58 A;  3I76 A;  3V72 A;  8ICB A;  4J9R A;  5KG6 A;  3C29 A;  4CF4 A;  4UBB A;  1D8B A;  4MFC A;  4HAI A;  1JIH A;  4PHE A;  2FLN A;  4YCX A;  4PZO A;  3ORY A;  5DGB A;  1M6Y A;  4EYI B;  2QB0 A;  3UQ0 A;  1S9F A;  4DO9 A;  4ECW A;  3C5G A;  4EBE A;  2H3F A;  1A76 A;  5F3X B;  8ICU A;  4GC6 A;  1S0V A;  5EE1 A;  2ISP A;  4ED2 A;  1Q8K A;  3RH4 A;  2A1J B;  5KT7 A;  1MA7 A;  5J29 A;  5DDY A;  2UVU A;  1ZYQ A;  1NI3 A;  4MHV A;  4Y2X A;  2FI1 A;  5KG1 A;  7ICK A;  8ICH A;  3EUB 2;  4I2H A;  1SB3 C;  1XC9 A;  9ICG A;  1X66 A;  1SIJ A;  1N61 A;  4UAT A;  2FMS A;  3RBD A;  3F53 A;  9ICB A;  2W9A A;  3N7P D;  4IQT A;  5AKE A;  7ICM A;  4F5P A;  3QZ7 A;  5KFS A;  4IR9 A;  5J2J A;  4US8 A;  4E0D A;  3M9N B;  2CXY A;  4PJ0 U;  2VJ4 A;  3UXO A;  2MUT B;  4I29 A;  3H8J A;  4XQ8 A;  3KHL A;  1PK1 B;  1ZQN A;  2XID A;  4EEY A;  1CRX A;  4ECQ A;  1D8Y A;  4Y2S A;  2ZIW A;  3F5E A;  4CF3 A;  4R8U B;  1TAM A;  4YMM A;  4IL6 U;  2E3T A;  2HHT A;  4O9M A;  3L4P A;  3MFI A;  4YR2 A;  4O3O A;  2C28 A;  2GWS A;  2ASL A;  3MFH A;  3UXP A;  3TAC B;  1EXN A;  1ZQE A;  2WB1 C;  3TAQ A;  8ICF A;  3AM9 A;  2FJ6 A;  1ZQJ A;  4YVZ A;  1WUD A;  2OYY A;  1T3N A;  4Z6C A;  1T3Q A;  3LVV A;  3RAQ A;  3NVW A;  8ICG A;  3GIL A;  4I2G A;  1WWV A;  5EWF A;  3IV6 A;  1MQ3 A;  5J2B A;  1OUQ A;  3RJK A;  2WF6 A;  2PFN A;  3PR5 B;  1RQL A;  5ALQ A;  2JV3 A;  1QTM A;  2KV2 A;  4DL7 A;  2K4H A;  2K8B B;  2R8K A;  2XGQ A;  5HMM A;  3Q8L A;  4B9L A;  1YZ6 A;  5L9X A;  2AQ0 A;  3MR6 A;  3AQF A;  3QNM A;  1WWU A;  1HIW A;  1L3U A;  4DEZ A;  4IQV A;  5TZV A;  1L3V A;  3JPS A;  5J2F A;  1L6N A;  1ZQK A;  4F91 B;  4RU9 A;  4RUC A;  5AIC A;  7ICN A;  5KG3 A;  4O3M A;  5DQI A;  5D46 A;  8ICR A;  3F2D A;  2DF4 B;  5J0Q A;  1S97 A;  3V6J A;  1Q3U A;  3Q8P B;  1ZQA A;  4JV2 A;  5G5H A;  5EWE A;  3SAH A;  2A1J A;  1RPL A;  2ZUD A;  4AYB C;  5J2G A;  1ZD4 A;  1ZD5 A;  2N1R A;  2W9C B;  4DS4 A;  1MQ2 A;  4JB3 A;  4RQ7 A;  3MBY A;  5KFV A;  2PFO A;  2B21 A;  7ICG A;  2BZF A;  4GFJ A;  4UAZ A;  5AM0 A;  3WKA A;  2RDI A;  4QZD A;  4B9S A;  2QAR A;  4OD0 A;  8ICM A;  3ED5 A;  5JUM A;  3PO4 A;  4RQ1 A;  4ELU A;  4MFF A;  4USA A;  1Z4N A;  4RQ3 A;  2WF8 A;  4ED0 A;  4DF8 A;  4OJ6 A;  2GO7 A;  3FM9 A;  2XY5 A;  2DPI A;  1K1S A;  2XCA A;  5L1I A;  2WF9 A;  1NK5 A;  1LV5 A;  2DUY A;  2WHE A;  7ICU A;  2OH2 A;  3WKE A;  1UA0 A;  1KW4 A;  1PK1 A;  1RYU A;  4M6W B;  3RB4 A;  2WAQ C;  4C0Z A;  1BGX T;  2H3V A;  4QNL A;  4Y2V A;  4PHP A;  3SMV A;  9ICK A;  3Q8M A;  2LYA A;  1ECW A;  3UPQ A;  4RQ0 A;  3PW2 A;  2IA6 A;  4BX9 C;  1VDV A;  2YX8 A;  4IRC A;  1DK3 A;  3FAH A;  3IG5 A;  5KFG A;  2HBJ A;  2B0C A;  5CP2 A;  2NRZ A;  3KKA A;  2K60 A;  4KLH A;  4J9N A;  4NY8 A;  1J2N A;  2F44 A;  4YR0 A;  3GV8 B;  3TAD C;  1T7P A;  2K8A A;  4O5E A;  3TFR A;  2OCE A;  3BQ0 A;  2NO4 A;  3GDX A;  5BOM A;  2OXO A;  1KRP A;  4XUS A;  2MA1 A;  8ICP A;  2EAO A;  2QLT A;  3NAS A;  4KLS A;  4OJP A;  3PO5 A;  9ICF A;  4RUA A;  1T8E A;  3MGV A;  5B66 U;  4FZM A;  9ICO A;  3QE9 Y;  2KEY A;  1SV0 A;  5DDM A;  4O3P A;  2IOF A;  4O0I A;  2E1E A;  4IC9 A;  3F2C A;  2JZB A;  4P0Q A;  3PST A;  3DDH A;  4UAU A;  3BJY A;  2G08 A;  3N97 B;  3THV A;  2P6U A;  4I2A A;  5KFY A;  3HW8 A;  2XY7 A;  1A6S A;  2EAM A;  2BKE A;  4I27 A;  4HYK A;  4I2C A;  1X9S A;  1P7D A;  4UB6 U;  4P4O A;  5A0L A;  3KKA C;  2AGP A;  4F4K A;  3R9K A;  4UB3 A;  1QSL A;  1S8O A;  5DB9 A;  3N7S C;  2ZIV B;  2PKE A;  4F92 B;  1SWV A;  3M9M B;  3N7R C;  4UB5 A;  4IRK A;  1DK2 A;  4YD2 A;  1FEZ A;  2HHV A;  2ALZ A;  1IXR A;  4PZN A;  2K4I A;  2W9B A;  3B0X A;  1O08 A;  4C80 A;  8ICJ A;  4J03 A;  2KIV A;  4J9L A;  1ZQI A;  4P4P A;  1AQ6 A;  2E1F A;  4O5K A;  5HR7 A;  5AM4 A;  4DL3 A;  4GXJ A;  3SEN A;  3Q8R B;  4R66 A;  2ZG6 A;  5ALL A;  3PV8 A;  4ELT A;  5KT2 A;  1ZQW A;  5IIK A;  3SV3 A;  2IOH A;  4JV0 A;  1NKB A;  2BPG A;  1TFR A;  5DG7 A;  2UVW A;  1X40 A;  2HHX A;  5KFD A;  2H5X A;  4DSE A;  1LB2 B;  2YQE A;  4PGX A;  4BDP A;  5AKJ A;  3SD7 A;  1NKC A;  4EBC A;  2HOQ A;  2VIX A;  5KFJ A;  2Y9T A;  4F72 A;  4RNO A;  2YMQ A;  2RQ5 A;  3K1Z A;  4NWI A;  2Y9U A;  4K4H A;  1PVP A;  5KFE A;  5F9L A;  2BPF A;  4I2I A;  1N62 A;  4KLI A;  5KFX A;  3OGU A;  3QEB Z;  1X9W A;  9ICE A;  5AM5 A;  2HVH A;  2F2A B;  3TFS A;  5HNK A;  7ICL A;  4DQI A;  1XSP A;  2W8L A;  1HEK A;  4F4Z A;  3E2E A;  5DB8 A;  7ICI A;  5J0U A;  2NRT A;  1UQV A;  1Z00 A;  4M0A A;  4KIT B;  4DL6 A;  4DSK A;  4QWD A;  1U4B A;  5J2D A;  3BDP A;  2AHO B;  3BS5 B;  5DGA A;  1QQ5 A;  3WKC A;  2MAX A;  4J9S A;  1XSN A;  3SZ2 A;  2VA8 A;  3ISB A;  3UQ2 A;  5KFO A;  1N60 A;  2YTU A;  4F5R A;  3WK7 A;  2W7P A;  2VA2 A;  3MR2 A;  5AI6 A;  3PW5 A;  4Q8F A;  4AP9 A;  4Z6D A;  1C20 A;  2WFA A;  8ICK A;  4DWI A;  5EOZ A;  8ICA A;  1LKY B;  1ZQC A;  2ISO A;  4F3O A;  3GFK B;  5HML A;  5CR0 A;  2R18 A;  1TVA A;  1XS9 D;  1BVS A;  1L3S A;  1QH9 A;  2PI5 A;  4UAV A;  4QWE A;  3M7D A;  1JAL A;  4PL1 A;  3NTU A;  5ALH A;  5EWG A;  2KKV A;  2F1J A;  2EZX A;  1RXW A;  2HHQ A;  3T79 A;  2R8H A;  3MGH A;  1NZP A;  2ZIV A;  4JWN A;  2KHV A;  1B0X A;  3WK6 A;  4ECZ A;  2HDO A;  2EZY A;  4DOC A;  3HP6 A;  4DFJ A;  3PX4 A;  9ICQ A;  2VAN A;  2GOL A;  2G5H B;  3KZI U;  3BQ7 A;  2ZUC A;  3GU3 A;  4ECX A;  5ALO A;  4U6P A;  1UA1 A;  1BPB A;  1Z1B A;  2C2E A;  3EPG A;  1N5W A;  3B0Y A;  2JHD A;  5AKX A;  2KTQ A;  4MEX A;  2G07 A;  3NUQ A;  3MR3 A;  4FBU A;  3PML A;  1BNP A;  5J2I A;  2KD1 A;  1KFD A;  1YT3 A;  4M9N A;  1ZQS A; 
#chains in the Genus database with same CATH homology
 2ATL A;  4KLD A;  3JPO A;  5EWF A;  1WCN A;  1RZT A;  5KFA A;  8ICT A;  1MQ3 A;  4Q8E A;  5J2B A;  4F4Y A;  3BQ2 A;  4DS5 A;  4ECY A;  2V9W A;  4LZG A;  3RJK A;  4QW9 A;  2ASJ A;  2PFN A;  3PR5 B;  4M2Y A;  1KSP A;  3MGI A;  1JXE A;  2UVR A;  4RQ5 A;  1V9P A;  2M9N A;  1QTM A;  4DQP A;  8ICZ A;  1ZJN A;  4DL7 A;  2IHN A;  5J0T A;  4Z6E A;  2BQU A;  4J9Q A;  2XGQ A;  4DSF A;  2R8K A;  4NLK A;  5HMM A;  3EYZ A;  3TAN A;  1D9D A;  4GLX A;  3Q8L A;  4B9L A;  3PY8 A;  4J9P A;  5L9X A;  4QZA A;  1Z00 B;  2AQ0 A;  4PH5 A;  3MR6 A;  3PW7 A;  1DOQ A;  2ZJ8 A;  3FYH A;  4DQQ A;  2KFN A;  5L1L A;  5KFM A;  4KLQ A;  1L3U A;  4DSL A;  4DEZ A;  4IQV A;  5TZV A;  2ASD A;  4ZH4 A;  8ICO A;  4F2S A;  3GV7 B;  1L3V A;  3RJI A;  3MDA A;  3T5K A;  4M9J A;  5DBB A;  2Y1J A;  5IIN A;  3JPS A;  1SKR A;  3RR7 A;  4IQW A;  5J2F A;  1ZQK A;  4F91 B;  4R63 A;  4RQ2 A;  1U9L A;  4GC7 A;  4RU9 A;  4RUC A;  1KEJ A;  4PPX A;  4F8R A;  4FO6 A;  7ICN A;  1ZQV A;  2W9M A;  2C2D A;  5KG3 A;  4PHA A;  5DQI A;  2FPK A;  5D46 A;  2XC9 A;  1ZJM A;  3FDS A;  2KZM A;  8ICR A;  4UAY A;  3EW9 A;  3OHB A;  4DFP A;  1JX4 A;  5J0Q A;  1S97 A;  9ICX A;  4LZD A;  3V6J A;  3Q8P B;  4QZ9 A;  1SKS A;  1ZQA A;  4JV2 A;  4KLL A;  3PR4 A;  5EWE A;  3GIJ A;  2PXI A;  1K1Q A;  4EYH B;  2A1J A;  1L3T A;  1RPL A;  2ZUD A;  4QWC A;  5J2G A;  1D8L A;  1UT8 A;  1NJY A;  2W9C B;  2R8G A;  1C7Y A;  3HPO A;  4DS4 A;  1MQ2 A;  4RQ7 A;  5KTQ A;  4UB1 A;  1SL1 A;  2V4R A;  1X9M A;  1NK0 A;  3MBY A;  2XCP A;  5KFV A;  2PFO A;  3SV4 A;  2JEF A;  2B21 A;  2I9G A;  5KG2 A;  4DL5 A;  3JPR A;  4B9V A;  5KFZ A;  2BCQ A;  7ICG A;  9ICA A;  2BR0 A;  4UAZ A;  2Y1I A;  3AU6 A;  4RPX A;  1MSW D;  3PVX A;  2RDI A;  4QZD A;  4B9S A;  4K4G A;  2RDJ A;  5KFN A;  1ZQO A;  3C2K A;  4DL2 A;  1COO A;  1S77 D;  2KFZ A;  5IIM A;  2HW3 A;  8ICM A;  5HHH A;  1N48 A;  4MF2 A;  1TV9 A;  3ZDA A;  7ICO A;  9ICL A;  5HP4 A;  3PW0 A;  4I2B A;  3T5L A;  5JUM A;  5J2A A;  4G3I A;  2BCU A;  2R8I A;  3PO4 A;  5KG5 A;  4RQ1 A;  9ICU A;  4ELU A;  4YMN A;  3HWT A;  2AGQ A;  2ZTD A;  2IHM A;  3C23 A;  4KLF A;  3RR8 A;  5KFR A;  4MFF A;  2HHU A;  8ICS A;  4RQ3 A;  4ED0 A;  1X2I A;  3ETL A;  4BGD A;  4DL4 A;  4DF8 A;  4CCH A;  9ICS A;  9ICV A;  2FPL A;  5J0Y A;  4NLZ A;  2XY5 A;  4ECU A;  2IMW P;  7ICE A;  4F4W A;  5IIJ A;  1SKW A;  2DFL A;  4O3Q A;  4KLE A;  5DBA A;  2DPI A;  1K1S A;  4QZE A;  1NJZ A;  2XCA A;  1B22 A;  5L1I A;  3QEA Z;  5KG7 A;  1LV5 A;  1NK5 A;  4NLG A;  5DLG A;  3UXN A;  4BXO B;  5KFI A;  3ZDE A;  4UQG A;  7ICU A;  4QZG A;  4ECV A;  2WTF A;  9ICR A;  1UA0 A;  4J9K A;  9ICC A;  1ZQU A;  4M6W B;  5CWR A;  3RB4 A;  4DSJ A;  4DSI A;  1SZP A;  1BGX T;  4UAW A;  8ICV A;  2AU0 A;  3C2M A;  2HHS A;  4RQ6 A;  4RQ4 A;  4PHP A;  5IIL A;  8ICX A;  4RT3 A;  3H4B A;  3RJJ A;  9ICK A;  4YMO A;  3Q8M A;  3GV5 B;  1KTQ A;  1JN3 A;  5DB6 A;  1RYR A;  5KFL A;  3UPQ A;  3C2L A;  1ZQF A;  4RPY A;  4RQ0 A;  1ARO P;  3PW2 A;  1TK8 A;  2FMP A;  2IA6 A;  2JEG A;  1TKD A;  8ICE A;  4IRC A;  1D9F A;  3RRG A;  1HUO A;  2BCS A;  2AQ4 A;  5KG0 A;  4BWM A;  3ZD8 A;  1XSL A;  5KFG A;  3RBE A;  4I2F A;  4I2D A;  5CP2 A;  3G6X A;  2NRZ A;  4IRD A;  1CUK A;  1SL2 A;  3V7K A;  4KLH A;  4J9N A;  4NY8 A;  1TAU A;  2ZTE A;  4QZC A;  2KN7 A;  1NK8 A;  4QZB A;  4UB4 A;  3HX0 A;  1HUZ A;  2XGP A;  4YR0 A;  3GIK A;  3GV8 B;  4GXI A;  3LK9 A;  4TQS A;  4YP3 A;  1ZQH A;  1T7P A;  1QLN A;  3GQC A;  1NK4 A;  1DGS A;  4MEY A;  3TFR A;  4O5E A;  9ICW A;  7ICP A;  4ED1 A;  4M04 A;  3BQ0 A;  3Q8S B;  7ICQ A;  2BPC A;  2BDP A;  1NK7 A;  4B9U A;  3LDA A;  4QZ8 A;  1U48 A;  2ZTC A;  3C21 A;  3GDX A;  1XWL A;  3V7L A;  5BOM A;  4NM2 A;  3MR5 A;  2OWO A;  1KRP A;  4JK1 A;  1JXL A;  3PW4 A;  9ICM A;  4XUS A;  3H4D A;  8ICP A;  4M47 A;  1IM4 A;  4B9T A;  4KLS A;  3N4M B;  3PO5 A;  1ZET A;  5DQG A;  3G6Y A;  9ICF A;  4KN4 A;  1JMS A;  5J0O A;  4RUA A;  4Q44 A;  1B43 A;  2NRX A;  4UBC A;  4R65 A;  2BQ3 A;  3ZD9 A;  1UT5 A;  2C22 A;  1T8E A;  1ZQQ A;  3LWM A;  3K75 D;  4ECS A;  3PNC A;  9ICO A;  3H7I A;  3QE9 Y;  2W8K A;  4XRH A;  2AJQ A;  4TUR A;  5DDM A;  4O3P A;  5DG8 A;  7ICF A;  4PGY A;  4O0I A;  4DFM A;  5KFT A;  4X5V A;  4MF8 A;  3T5J A;  3ZDB A;  1KFT A;  2JZB A;  1Z3E B;  3BJY A;  5DB7 A;  1ZQP A;  2JEI A;  3N97 B;  4C8M A;  1BPZ A;  7ICT A;  1KFS A;  3THV A;  4KLM A;  4ED7 A;  1ZQT A;  2P6U A;  4RNN A;  3EPI A;  1ZQX A;  3RB3 A;  1KLN A;  4FS2 A;  3G6V A;  4RNM A;  4I2A A;  5KFY A;  3RH6 A;  1ZQB A;  5DBC A;  4DLE A;  3HW8 A;  4KLG A;  4ED6 A;  2XY7 A;  2KZZ A;  1NK9 A;  2Q0Z X;  2BKE A;  4ECT A;  4I27 A;  4HYK A;  4I2C A;  1X9S A;  1H38 A;  4YN4 A;  5DLF A;  1L5U A;  4NXZ A;  3EWA A;  5J0X A;  1Y88 A;  4P4O A;  3M8R A;  4MFA A;  4YXM A;  1RYS A;  1NJW A;  8ICN A;  1N56 A;  4Z6F A;  4KMU A;  2AGP A;  3Q8K A;  4F4K A;  5J0R A;  3M8S A;  8ICL A;  4YXJ A;  5KFP A;  4UB3 A;  5KFF A;  3V6H A;  1QSL A;  2FLL A;  7ICH A;  4DQS A;  5DB9 A;  2BGW A;  5KFU A;  2IBK A;  8ICW A;  3RB0 A;  1T4G A;  4F92 B;  4ECR A;  3M9M B;  4I28 A;  4EBD A;  1S0O A;  4UB5 A;  4IRK A;  3C1Z A;  4YD2 A;  2HHV A;  2ALZ A;  4JV1 A;  1IXR A;  3ISC A;  5D49 A;  4TUS A;  3MDC A;  2PFQ A;  3BQ1 A;  4DOB A;  5KFW A;  5KFB A;  3B0X A;  2W9B A;  1NOM A;  3AU2 A;  4O3S A;  5BOL A;  2P6R A;  1TK5 A;  1S0N A;  4EZ6 A;  3K4G A;  3T3F A;  1U45 A;  8ICJ A;  4YR3 A;  1KDH A;  3M9O B;  7ICJ A;  4R64 A;  3OJS A;  4I2E A;  4M9L A;  2MUT A;  2NRW A;  4YFK A;  3RJE A;  3JPQ A;  1XU4 A;  4J9L A;  3H8S A;  1ZQI A;  4KLU A;  4F5Q A;  3C5F A;  4P4P A;  3V6K A;  4C8O A;  5CA7 A;  3H8W A;  4QZF A;  7ICR A;  1BPY A;  4F50 A;  4J9O A;  4O5K A;  5III A;  2ZUB A;  4KLJ A;  2DPJ A;  5KT5 A;  4C8L A;  4NLN A;  1S0M A;  3OSP A;  5KT6 A;  4DL3 A;  3IM1 A;  3KHG A;  4GXJ A;  4R8U A;  3Q8R B;  3TAR A;  4R66 A;  1ZQG A;  4O3R A;  5KT3 A;  3SI8 A;  4DLG A;  4ELT A;  3PV8 A;  5KT2 A;  3ZDD A;  1ZQW A;  5IIK A;  3SV3 A;  3ZDC A;  4FS1 A;  4JV0 A;  5KFC A;  2F1I A;  3C1Y A;  4F5N A;  4O3N A;  3PMN A;  2FPM A;  3Q8Q B;  5KT4 A;  3PX0 A;  1NKB A;  5D4B A;  2BPG A;  2JEJ A;  1TFR A;  4RT2 A;  3RTV A;  5DG7 A;  4YQW A;  2P66 A;  4B9N A;  2PFP A;  2BCR A;  2UVW A;  9ICT A;  2HHX A;  3HT3 A;  1MC8 A;  5KFD A;  2H5X A;  4DSE A;  4PGQ A;  5HHI A;  1S10 A;  5DQH A;  1LB2 B;  4PGX A;  4KLT A;  4BDP A;  4ELV A;  1NKC A;  4EBC A;  5KFJ A;  2C2R A;  1NKE A;  4RNO A;  4QZH A;  4LVS A;  4O5C A;  3LWL A;  3NGD A;  1BPD A;  4K4H A;  3V72 A;  8ICB A;  4YG2 A;  5F9N A;  2R8J A;  2XO7 A;  4J9R A;  5KG6 A;  5KFE A;  4UBB A;  5F9L A;  4MFC A;  3RJF A;  2BPF A;  2HHW A;  2NRV A;  4I2I A;  1JIH A;  1SL0 A;  4PHE A;  3OJU A;  4RQ8 A;  4YCX A;  2FLN A;  5BPC A;  3RH5 A;  2PI4 A;  3ORY A;  5KFX A;  5DGB A;  1HJP A;  3OGU A;  3QEB Z;  1BPX A;  4KLI A;  1S76 D;  4EYI B;  3UQ0 A;  1S9F A;  3GII A;  4DO9 A;  1X9W A;  9ICE A;  2J6U A;  2HVH A;  3BQT A;  4ECW A;  2FMQ A;  3C5G A;  3TFS A;  1WCL A;  3RAX A;  4BWJ A;  4JUZ A;  5HNK A;  4ED8 A;  7ICL A;  4EBE A;  5CHG A;  1XSP A;  4DQI A;  4F2R A;  2W8L A;  4F4Z A;  2J6S A;  1CEZ A;  1A76 A;  2XY6 A;  3E2E A;  5DB8 A;  4C8K A;  8ICU A;  2VA3 A;  4GC6 A;  5DG9 A;  1S0V A;  7ICI A;  4ED3 A;  5J0U A;  2ISP A;  7ICV A;  2NRT A;  2JZB B;  5J2K A;  4KLO A;  1NK6 A;  4M9G A;  1Z00 A;  4M0A A;  2ZJ5 A;  4KIT B;  4DL6 A;  8ICC A;  3JPT A;  4C8N A;  5J0P A;  4DSK A;  4M9H A;  4NM1 A;  4Q43 A;  4QZI A;  4QWD A;  4ED2 A;  1NJX A;  3RH4 A;  4YD1 A;  2V4Q A;  2A1J B;  5KT7 A;  3EZ5 A;  1U4B A;  5J2D A;  3BDP A;  5J29 A;  5DDY A;  3GIM A;  1U47 A;  5DGA A;  2UVU A;  4J9S A;  2MAX A;  5L1K A;  1ZYQ A;  1XSN A;  3T5H A;  3SZ2 A;  4QW8 A;  2VA8 A;  3ISB A;  5DKW A;  3UQ2 A;  5KFO A;  4DQR A;  5KG1 A;  5J2E A;  4F5R A;  4P2H A;  7ICK A;  3RRH A;  8ICH A;  3OSN A;  2VA2 A;  3MR2 A;  4I2H A;  3PW5 A;  3TQ1 A;  4EZ9 A;  4F4X A;  5L1J A;  4Q8F A;  2I1Q A;  3JPN A;  1XC9 A;  9ICG A;  4Z6D A;  3V7J A;  3H40 A;  1PZN A;  5KFK A;  3AUO A;  4DFK A;  2FMS A;  3RBD A;  5C5J A;  5KFH A;  5IIO A;  8ICK A;  4XA5 A;  9ICN A;  4DWI A;  4JWM A;  1ZQD A;  4F5O A;  5EOZ A;  3OHA A;  8ICA A;  5J2C A;  7ICS A;  9ICB A;  2W9A A;  8ICY A;  2LYH A;  1ZQC A;  2ISO A;  4F3O A;  2W9C A;  4GXK A;  1RXV A;  3GFK B;  2W9B B;  5HML A;  4IQT A;  1ZQM A;  1ZQR A;  2F1H A;  4UB2 A;  5CR0 A;  7ICM A;  4F5P A;  2J6T A;  3QZ7 A;  5KFS A;  3KHH A;  9ICP A;  4IR9 A;  1TVA A;  5J2J A;  1XO1 A;  1XS9 D;  5KG4 A;  1BVS A;  1L3S A;  8ICI A;  4E0D A;  3M9N B;  1TK0 A;  1BPE A;  2PI5 A;  2ZJA A;  4QWB A;  4F93 B;  3UXO A;  2MUT B;  4QWE A;  2HVI A;  4TUP A;  4I29 A;  3H8J A;  3NTU A;  5EWG A;  4XQ8 A;  1A77 A;  3KHL A;  1ZQN A;  2F1J A;  1RXW A;  3RJH A;  2HHQ A;  4EEY A;  3KHR A;  2R8H A;  4ECQ A;  1QSS A;  9ICH A;  3MGH A;  1D8Y A;  4K4I A;  3TI0 A;  4JWN A;  3MAB A;  9ICJ A;  4R8U B;  2BCV A;  1QSY A;  4YMM A;  4KN7 A;  4ECZ A;  2HHT A;  1TAQ A;  4O9M A;  1ZQL A;  4RZR A;  3MFI A;  3SYZ A;  4YR2 A;  4O3O A;  3PX6 A;  2C28 A;  4DOC A;  3HP6 A;  4DFJ A;  3PX4 A;  4B9M A;  2GWS A;  9ICQ A;  2VAN A;  1U49 A;  4IQU A;  5J2H A;  2ASL A;  4I2J A;  4TQR A;  3MFH A;  3UXP A;  3RJG A;  2ZUC A;  4ECX A;  3ISD A;  4FBT A;  1EXN A;  1ZQE A;  4TUQ A;  1UA1 A;  3TAQ A;  8ICF A;  1BPB A;  3TAP A;  4BXO A;  3IHQ B;  5J0W A;  4QWA A;  2AGO A;  2BQR A;  2C2E A;  3EPG A;  3B0Y A;  4J9M A;  4RPZ A;  3QZ8 A;  3RB6 A;  2FLP A;  2UVV A;  2KTQ A;  4Q45 A;  4MEX A;  1ZQJ A;  4YVZ A;  1ZQZ A;  4M6W A;  4P4M A;  1T3N A;  4Z6C A;  3JPP A;  5CJ7 A;  3MR3 A;  4DF4 A;  4PHD A;  8ICQ A;  5J0S A;  4FBU A;  1ZQY A;  2KZ3 A;  3PML A;  9ICI A;  4IR1 A;  3RAQ A;  5J2I A;  5KFQ A;  4DOA A;  8ICG A;  2BHN A;  4KTQ A;  3GIL A;  1KFD A;  3KTQ A;  4M9N A;  4I2G A;  5CB1 A;  1ZQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...