2JZFA

Nmr conformer closest to the mean coordinates of the domain 513-651 of the sars-cov nonstructural protein nsp3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
143
structure length
143
Chain Sequence
GSHMVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 35
structure length 143
sequence length 143
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11633 SUD-M Single-stranded poly(A) binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2jzfA01
2KQVA 2WCTA 2JZEA 2RNKA 2JZFA 2JZDA 2W2GA
chains in the Genus database with same CATH superfamily
4R6TA 2RNKA 3JRUA 3GPQA 1YD9A 4ABKA 3SIJA 3IIFA 4D86A 3ETIA 3GQEA 5HOLA 5AILA 2XD7A 4J5QA 2EEEA 3KQZA 4KYBA 2L8RA 5CMSA 3EJGA 1BPNA 4JLLA 4K3NA 5CB5A 3H8GA 5DUSA 5CBMA 2VRIA 4ZI6A 5FSYA 3SIIA 4JCAA 1LANA 3SIGA 3Q6ZA 2AFCA 2JZFA 4R76A 3EWRA 5CB3A 1VHUA 4ZY0A 3GPGA 3PEIA 4GUAA 1BLLE 5E3BA 4ZX9A 3SIHA 4J5RA 4JGKA 1GYTA 4ZYQA 1BPMA 3EWPA 2KQVA 4ZY1A 3V2BA 2FG1A 5D8NA 3EJFA 3KR4A 4J4ZA 5FSZA 4UMLA 3EKEA 4ETJA 3GQOA 1SPVA 4ZX8A 2LGRA 3EWOA 3T8WA 4ESSA 2JZDA 3GPOA 4ZY2A 3KQXA 4KSIA 5FSXA 2ACFA 2JZEA 3VFQA 2BFQA 2FXKA 4GVVA 3V45A 4TU0A 3IJ3A 5HIHA 4GVWA 3KZWA 2X47A 1HJZA 4IQYA 3EWQA 4J5SA 4JVVA 2DX6A 3H8FA 4ABLA 4ETKA 4K0CA 2FAVA 2BFRA 4R7MA 3JZTA 5FSVA 1TY8A 2EWBA 1LCPA 3KR5A 1TXZA 1ZR5A 5FSUA 3H8EA 1LAMA 1ZR3A 3EW5A 4X2TA 2WCTA 3Q71A 1NJRA 2J9AA 1LAPA 3IIDA 2W2GA
chains in the Genus database with same CATH topology
2KQVA 2WCTA 2JZEA 2RNKA 2JZFA 2JZDA 2W2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQV A;  2WCT A;  2JZE A;  2RNK A;  2JZF A;  2JZD A;  2W2G A; 
#chains in the Genus database with same CATH topology
 4R6T A;  2RNK A;  3JRU A;  3GPQ A;  1YD9 A;  4ABK A;  3SIJ A;  3IIF A;  4D86 A;  3ETI A;  3GQE A;  5HOL A;  5AIL A;  2XD7 A;  4J5Q A;  2EEE A;  3KQZ A;  4KYB A;  2L8R A;  5CMS A;  3EJG A;  1BPN A;  4JLL A;  4K3N A;  5CB5 A;  3H8G A;  5DUS A;  5CBM A;  2VRI A;  4ZI6 A;  5FSY A;  3SII A;  4JCA A;  1LAN A;  3SIG A;  3Q6Z A;  2AFC A;  2JZF A;  4R76 A;  3EWR A;  5CB3 A;  1VHU A;  4ZY0 A;  3GPG A;  3PEI A;  4GUA A;  1BLL E;  5E3B A;  4ZX9 A;  3SIH A;  4J5R A;  4JGK A;  1GYT A;  4ZYQ A;  1BPM A;  3EWP A;  2KQV A;  4ZY1 A;  3V2B A;  2FG1 A;  5D8N A;  3EJF A;  3KR4 A;  4J4Z A;  5FSZ A;  4UML A;  3EKE A;  4ETJ A;  3GQO A;  1SPV A;  4ZX8 A;  2LGR A;  3EWO A;  3T8W A;  4ESS A;  2JZD A;  3GPO A;  4ZY2 A;  3KQX A;  4KSI A;  5FSX A;  2ACF A;  2JZE A;  3VFQ A;  2BFQ A;  2FXK A;  4GVV A;  3V45 A;  4TU0 A;  3IJ3 A;  5HIH A;  4GVW A;  3KZW A;  2X47 A;  1HJZ A;  4IQY A;  3EWQ A;  4J5S A;  4JVV A;  2DX6 A;  3H8F A;  4ABL A;  4ETK A;  4K0C A;  2FAV A;  2BFR A;  4R7M A;  3JZT A;  5FSV A;  1TY8 A;  2EWB A;  1LCP A;  3KR5 A;  1TXZ A;  1ZR5 A;  5FSU A;  3H8E A;  1LAM A;  1ZR3 A;  3EW5 A;  4X2T A;  2WCT A;  3Q71 A;  1NJR A;  2J9A A;  1LAP A;  3IID A;  2W2G A; 
#chains in the Genus database with same CATH homology
 2KQV A;  2WCT A;  2JZE A;  2RNK A;  2JZF A;  2JZD A;  2W2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...