2JZMA

Chymotrypsin inhibitor c1 from nicotiana alata
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
53
structure length
53
Chain Sequence
DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase inhibitor
publication title Structural refinement of insecticidal plant proteinase inhibitors from Nicotiana alata.
pubmed rcsb
molecule tags Hydrolase inhibitor
total genus 11
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2008-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2jzmA00
1SGQI 1N13A 1SGDI 1IW4A 2GKRI 1CT4I 2NU0I 1HPTA 2NU3I 4GI3C 1PCEA 1TURA 1TBRR 2KMPA 1BUSA 1AN1I 2JYYA 2P6AC 2NU1I 3OVOA 1UUCA 3B4VC 1TUSA 1SGNI 2GKVA 1IY5A 1OMUA 1UVFA 1SGPI 2KMOA 3SGBI 2V53A 2QQDA 1HDLA 1UVGA 2LEOA 1LR8A 2NU4I 1OMTA 2NU2I 5JHWC 2KMRA 2N17A 2WCYA 1KMAA 2F3CI 1OYVI 2QQCA 2BUSA 2SGEI 5DAEA 1CT2I 1CGII 1CT0I 1YU6C 2M5XA 1MT1A 3SEKC 1TBQR 1Y1CA 1SGEI 1SGYI 2SGPI 1LR9A 1TGSI 2JZMA 1HJAI 4HGUA 1M8CA 1YTPA 1CE3A 1Y1BA 1CHOI 3TJQA 2ARPF 3SGQI 1H0ZA 4OVOA 1IY6A 3HH2C 4SGBI 1OVOA 2OVOA 3QTLD 2XRCA 1NUBA 1CSOI 2ERWA 2GKTI 1CGJI 1SGRI 2SGFI 2N52A 1DS3I 2SGDI 2KMQA 1DS2I 2KCXA 1R0RI 2JXDA 1FYBA 2SGQI 1Z7KB 2B0UC 1LR7A 1M8BA 1TIHA 2N71A 1PPFI 1BMOA 1PJUA
chains in the Genus database with same CATH superfamily
1K7VA 2OD1A 4E1PA 1SGQI 2OU2A 1N13A 1SGDI 2GIVA 1K7TA 3R5AA 2GKRI 2WVJA 2X3TA 1WGCA 2DIPA 1CT4I 1P9ZA 2JW6A 2NU0I 5HI7A 3KY9A 5FUWA 1Z2IA 3CXLA 1P9GA 4B6DA 1HPTA 2NU3I 4GI3C 1PCEA 1TURA 1HEVA 5FUYA 2L7XA 2RC4A 1TBRR 5FUXA 2KMPA 1BUSA 1AN1I 2JYYA 2P6AC 3TO7A 2NU1I 3OVOA 2QPOA 1UUCA 4JCVE 1MJAA 5E3QA 2ELIA 3B4VC 3TOBA 1W4RA 1ULKA 2RIJA 1W3SA 1K7UA 4UXHA 4WP4A 1TUSA 1SGNI 2GKVA 2ENNA 1PTRA 1IY5A 1PTQA 3GOXA 1OMUA 1UVFA 1SGPI 3BJIA 1FARA 3UEYA 3UEJA 2DKVA 7WGAA 1KBEA 2KMOA 2K9HA 3SGBI 3TO9A 2V53A 2ORWA 5EX0A 2QQDA 3E59A 1HDLA 2LUYA 1UVGA 3OL0A 1S20A 2LEOA 5CCMA 1LR8A 2X52A 2NU4I 1OMTA 1X74A 2NU2I 1KBFA 2CJSC 2QQ0A 3E2IA 5JHWC 2B8TA 3TOAA 3RU0A 2ROWA 3PDNA 2KMRA 2N17A 2V1CC 2WCYA 3QAHA 3R5DA 4UXIA 2JA1A 1KMAA 2UZ3A 3UGDA 1IW4A 2WGCA 2F3CI 2V1CA 1OYVI 2J87A 1TBNA 2BUSA 2QQCA 2Y0MA 3UFFA 1WTJA 2YQPA 2SGEI 5DAEA 2CWGA 1ULNA 1CT2I 1CGII 2E73A 1CT0I 4A24A 1XA6A 1YU6C 1WGTA 1MT1A 2M5XA 4MPIA 3SEKC 2UVOA 1TBQR 1XBTA 1Y1CA 2CWFA 2E5RA 2YUUA 2FNFX 4UXJA 1MJBA 1SGEI 2PQ8A 1SGYI 2SGPI 5FUVA 5EX3A 1LR9A 1TGSI 2ODDA 2JZMA 1R79A 1HJAI 5E3PA 2A20A 4HGUA 3VE5A 1Q9BA 3FSYA 1M8CA 1XX6A 1YTPA 3R5CA 3FSXA 1CE3A 5J8CA 1V1IA 3FC3A 1Y1BA 5J8FA 1CHOI 3TJQA 2ARPF 3OXFA 3SGQI 2ORVA 1H0ZA 2J9RA 4OVOA 1IY6A 2DB6A 3HH2C 3VDPA 4SGBI 1OVOA 3UOEA 4AMLA 2OVOA 4DNCA 1FY7A 1FAQA 2ENZA 3OXLA 2L8EA 3QTLD 1VDDA 2LB7A 2VRWB 2XRCA 1NUBA 1CSOI 1NXUA 2ERWA 3UGLA 1WKXA 2GKTI 4L9MA 4E1RA 3D00A 1TBOA 1CGJI 1SGRI 2SGFI 5E3RA 2OZUA 2N52A 1DS3I 2SGDI 3TO6A 3VDUA 1ULMA 5CCLA 2KMQA 1DS2I 2KCXA 3OXGA 5HQ8A 1Y8FA 1R0RI 2JXDA 2N1AB 1FYBA 1V1HA 2SGQI 1Z7KB 2B0UC 1LR7A 1UHAA 1TOTA 3UGIA 1X4SA 1M8BA 2QQEA 2GVIA 1U5KA 1TIHA 1MJ9A 3QWPA 4FKDA 2N71A 9WGAA 1RFHA 2W0TA 3MEKA 3R5BA 1PPFI 2CWHA 1BMOA 1PJUA
chains in the Genus database with same CATH topology
2OD1A 4E1PA 1SGQI 1N13A 1SGDI 1IW4A 2GKRI 2WVJA 5HI7A 2DIPA 1CT4I 2JW6A 2NU0I 3KY9A 5FUWA 3CXLA 4B6DA 1HPTA 2NU3I 4GI3C 1PCEA 1TURA 5FUYA 2L7XA 1TBRR 5FUXA 2KMPA 1BUSA 1AN1I 2JYYA 2P6AC 2NU1I 3OVOA 2QPOA 1UUCA 4JCVE 2ELIA 3B4VC 1W4RA 1W3SA 4UXHA 1TUSA 1SGNI 2GKVA 2ENNA 1PTRA 1IY5A 1PTQA 3GOXA 1OMUA 1UVFA 1SGPI 3BJIA 1FARA 3UEYA 3UEJA 1KBEA 2KMOA 2K9HA 3SGBI 2V53A 2ORWA 5EX0A 2QQDA 3E59A 1HDLA 2LUYA 1UVGA 3OL0A 5CCMA 2LEOA 1LR8A 2NU4I 1OMTA 1X74A 2NU2I 1KBFA 2CJSC 2QQ0A 3E2IA 5JHWC 2B8TA 3RU0A 2ROWA 3PDNA 2KMRA 2N17A 2V1CC 2WCYA 4UXIA 2JA1A 1KMAA 2UZ3A 3UGDA 2F3CI 2V1CA 1OYVI 2J87A 1TBNA 2BUSA 2QQCA 3UFFA 2YQPA 2SGEI 5DAEA 1CT2I 1CGII 2E73A 1CT0I 4A24A 1XA6A 1YU6C 2M5XA 1MT1A 3SEKC 1TBQR 1XBTA 1Y1CA 2E5RA 2YUUA 2FNFX 4UXJA 1SGEI 1SGYI 2SGPI 5FUVA 5EX3A 1LR9A 1TGSI 2ODDA 2JZMA 1R79A 1HJAI 2A20A 4HGUA 3VE5A 1M8CA 1XX6A 1YTPA 1CE3A 1V1IA 3FC3A 1Y1BA 1CHOI 3TJQA 2ARPF 3OXFA 3SGQI 2ORVA 1H0ZA 2J9RA 4OVOA 1IY6A 2DB6A 3HH2C 3VDPA 4SGBI 1OVOA 2OVOA 1FAQA 2ENZA 3OXLA 2L8EA 3QTLD 1VDDA 2VRWB 2XRCA 1NUBA 1CSOI 2ERWA 3UGLA 2GKTI 4L9MA 4E1RA 3D00A 1TBOA 1CGJI 1SGRI 2SGFI 2N52A 1DS3I 2SGDI 3VDUA 5CCLA 2KMQA 1DS2I 2KCXA 3OXGA 5HQ8A 1Y8FA 1R0RI 2JXDA 2N1AB 1FYBA 1V1HA 2SGQI 1Z7KB 2B0UC 1LR7A 3UGIA 1TOTA 1X4SA 1M8BA 2QQEA 2GVIA 1U5KA 1TIHA 3QWPA 4FKDA 2N71A 1RFHA 2W0TA 3MEKA 1PPFI 1BMOA 1PJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGQ I;  1N13 A;  1SGD I;  1IW4 A;  2GKR I;  1CT4 I;  2NU0 I;  1HPT A;  2NU3 I;  4GI3 C;  1PCE A;  1TUR A;  1TBR R;  2KMP A;  1BUS A;  1AN1 I;  2JYY A;  2P6A C;  2NU1 I;  3OVO A;  1UUC A;  3B4V C;  1TUS A;  1SGN I;  2GKV A;  1IY5 A;  1OMU A;  1UVF A;  1SGP I;  2KMO A;  3SGB I;  2V53 A;  2QQD A;  1HDL A;  1UVG A;  2LEO A;  1LR8 A;  2NU4 I;  1OMT A;  2NU2 I;  5JHW C;  2KMR A;  2N17 A;  2WCY A;  1KMA A;  2F3C I;  1OYV I;  2QQC A;  2BUS A;  2SGE I;  5DAE A;  1CT2 I;  1CGI I;  1CT0 I;  1YU6 C;  2M5X A;  1MT1 A;  3SEK C;  1TBQ R;  1Y1C A;  1SGE I;  1SGY I;  2SGP I;  1LR9 A;  1TGS I;  2JZM A;  1HJA I;  4HGU A;  1M8C A;  1YTP A;  1CE3 A;  1Y1B A;  1CHO I;  3TJQ A;  2ARP F;  3SGQ I;  1H0Z A;  4OVO A;  1IY6 A;  3HH2 C;  4SGB I;  1OVO A;  2OVO A;  3QTL D;  2XRC A;  1NUB A;  1CSO I;  2ERW A;  2GKT I;  1CGJ I;  1SGR I;  2SGF I;  2N52 A;  1DS3 I;  2SGD I;  2KMQ A;  1DS2 I;  2KCX A;  1R0R I;  2JXD A;  1FYB A;  2SGQ I;  1Z7K B;  2B0U C;  1LR7 A;  1M8B A;  1TIH A;  2N71 A;  1PPF I;  1BMO A;  1PJU A; 
#chains in the Genus database with same CATH topology
 1K7V A;  2OD1 A;  4E1P A;  1SGQ I;  2OU2 A;  1N13 A;  1SGD I;  2GIV A;  1K7T A;  3R5A A;  2GKR I;  2WVJ A;  2X3T A;  1WGC A;  2DIP A;  1CT4 I;  1P9Z A;  2JW6 A;  2NU0 I;  5HI7 A;  3KY9 A;  5FUW A;  1Z2I A;  3CXL A;  1P9G A;  4B6D A;  1HPT A;  2NU3 I;  4GI3 C;  1PCE A;  1TUR A;  1HEV A;  5FUY A;  2L7X A;  2RC4 A;  1TBR R;  5FUX A;  2KMP A;  1BUS A;  1AN1 I;  2JYY A;  2P6A C;  3TO7 A;  2NU1 I;  3OVO A;  2QPO A;  1UUC A;  4JCV E;  1MJA A;  5E3Q A;  2ELI A;  3B4V C;  3TOB A;  1W4R A;  1ULK A;  2RIJ A;  1W3S A;  1K7U A;  4UXH A;  4WP4 A;  1TUS A;  1SGN I;  2GKV A;  2ENN A;  1PTR A;  1IY5 A;  1PTQ A;  3GOX A;  1OMU A;  1UVF A;  1SGP I;  3BJI A;  1FAR A;  3UEY A;  3UEJ A;  2DKV A;  7WGA A;  1KBE A;  2KMO A;  2K9H A;  3SGB I;  3TO9 A;  2V53 A;  2ORW A;  5EX0 A;  2QQD A;  3E59 A;  1HDL A;  2LUY A;  1UVG A;  3OL0 A;  1S20 A;  2LEO A;  5CCM A;  1LR8 A;  2X52 A;  2NU4 I;  1OMT A;  1X74 A;  2NU2 I;  1KBF A;  2CJS C;  2QQ0 A;  3E2I A;  5JHW C;  2B8T A;  3TOA A;  3RU0 A;  2ROW A;  3PDN A;  2KMR A;  2N17 A;  2V1C C;  2WCY A;  3QAH A;  3R5D A;  4UXI A;  2JA1 A;  1KMA A;  2UZ3 A;  3UGD A;  1IW4 A;  2WGC A;  2F3C I;  2V1C A;  1OYV I;  2J87 A;  1TBN A;  2BUS A;  2QQC A;  2Y0M A;  3UFF A;  1WTJ A;  2YQP A;  2SGE I;  5DAE A;  2CWG A;  1ULN A;  1CT2 I;  1CGI I;  2E73 A;  1CT0 I;  4A24 A;  1XA6 A;  1YU6 C;  1WGT A;  1MT1 A;  2M5X A;  4MPI A;  3SEK C;  2UVO A;  1TBQ R;  1XBT A;  1Y1C A;  2CWF A;  2E5R A;  2YUU A;  2FNF X;  4UXJ A;  1MJB A;  1SGE I;  2PQ8 A;  1SGY I;  2SGP I;  5FUV A;  5EX3 A;  1LR9 A;  1TGS I;  2ODD A;  2JZM A;  1R79 A;  1HJA I;  5E3P A;  2A20 A;  4HGU A;  3VE5 A;  1Q9B A;  3FSY A;  1M8C A;  1XX6 A;  1YTP A;  3R5C A;  3FSX A;  1CE3 A;  5J8C A;  1V1I A;  3FC3 A;  1Y1B A;  5J8F A;  1CHO I;  3TJQ A;  2ARP F;  3OXF A;  3SGQ I;  2ORV A;  1H0Z A;  2J9R A;  4OVO A;  1IY6 A;  2DB6 A;  3HH2 C;  3VDP A;  4SGB I;  1OVO A;  3UOE A;  4AML A;  2OVO A;  4DNC A;  1FY7 A;  1FAQ A;  2ENZ A;  3OXL A;  2L8E A;  3QTL D;  1VDD A;  2LB7 A;  2VRW B;  2XRC A;  1NUB A;  1CSO I;  1NXU A;  2ERW A;  3UGL A;  1WKX A;  2GKT I;  4L9M A;  4E1R A;  3D00 A;  1TBO A;  1CGJ I;  1SGR I;  2SGF I;  5E3R A;  2OZU A;  2N52 A;  1DS3 I;  2SGD I;  3TO6 A;  3VDU A;  1ULM A;  5CCL A;  2KMQ A;  1DS2 I;  2KCX A;  3OXG A;  5HQ8 A;  1Y8F A;  1R0R I;  2JXD A;  2N1A B;  1FYB A;  1V1H A;  2SGQ I;  1Z7K B;  2B0U C;  1LR7 A;  1UHA A;  1TOT A;  3UGI A;  1X4S A;  1M8B A;  2QQE A;  2GVI A;  1U5K A;  1TIH A;  1MJ9 A;  3QWP A;  4FKD A;  2N71 A;  9WGA A;  1RFH A;  2W0T A;  3MEK A;  3R5B A;  1PPF I;  2CWH A;  1BMO A;  1PJU A; 
#chains in the Genus database with same CATH homology
 2OD1 A;  4E1P A;  1SGQ I;  1N13 A;  1SGD I;  1IW4 A;  2GKR I;  2WVJ A;  5HI7 A;  2DIP A;  1CT4 I;  2JW6 A;  2NU0 I;  3KY9 A;  5FUW A;  3CXL A;  4B6D A;  1HPT A;  2NU3 I;  4GI3 C;  1PCE A;  1TUR A;  5FUY A;  2L7X A;  1TBR R;  5FUX A;  2KMP A;  1BUS A;  1AN1 I;  2JYY A;  2P6A C;  2NU1 I;  3OVO A;  2QPO A;  1UUC A;  4JCV E;  2ELI A;  3B4V C;  1W4R A;  1W3S A;  4UXH A;  1TUS A;  1SGN I;  2GKV A;  2ENN A;  1PTR A;  1IY5 A;  1PTQ A;  3GOX A;  1OMU A;  1UVF A;  1SGP I;  3BJI A;  1FAR A;  3UEY A;  3UEJ A;  1KBE A;  2KMO A;  2K9H A;  3SGB I;  2V53 A;  2ORW A;  5EX0 A;  2QQD A;  3E59 A;  1HDL A;  2LUY A;  1UVG A;  3OL0 A;  5CCM A;  2LEO A;  1LR8 A;  2NU4 I;  1OMT A;  1X74 A;  2NU2 I;  1KBF A;  2CJS C;  2QQ0 A;  3E2I A;  5JHW C;  2B8T A;  3RU0 A;  2ROW A;  3PDN A;  2KMR A;  2N17 A;  2V1C C;  2WCY A;  4UXI A;  2JA1 A;  1KMA A;  2UZ3 A;  3UGD A;  2F3C I;  2V1C A;  1OYV I;  2J87 A;  1TBN A;  2BUS A;  2QQC A;  3UFF A;  2YQP A;  2SGE I;  5DAE A;  1CT2 I;  1CGI I;  2E73 A;  1CT0 I;  4A24 A;  1XA6 A;  1YU6 C;  2M5X A;  1MT1 A;  3SEK C;  1TBQ R;  1XBT A;  1Y1C A;  2E5R A;  2YUU A;  2FNF X;  4UXJ A;  1SGE I;  1SGY I;  2SGP I;  5FUV A;  5EX3 A;  1LR9 A;  1TGS I;  2ODD A;  2JZM A;  1R79 A;  1HJA I;  2A20 A;  4HGU A;  3VE5 A;  1M8C A;  1XX6 A;  1YTP A;  1CE3 A;  1V1I A;  3FC3 A;  1Y1B A;  1CHO I;  3TJQ A;  2ARP F;  3OXF A;  3SGQ I;  2ORV A;  1H0Z A;  2J9R A;  4OVO A;  1IY6 A;  2DB6 A;  3HH2 C;  3VDP A;  4SGB I;  1OVO A;  2OVO A;  1FAQ A;  2ENZ A;  3OXL A;  2L8E A;  3QTL D;  1VDD A;  2VRW B;  2XRC A;  1NUB A;  1CSO I;  2ERW A;  3UGL A;  2GKT I;  4L9M A;  4E1R A;  3D00 A;  1TBO A;  1CGJ I;  1SGR I;  2SGF I;  2N52 A;  1DS3 I;  2SGD I;  3VDU A;  5CCL A;  2KMQ A;  1DS2 I;  2KCX A;  3OXG A;  5HQ8 A;  1Y8F A;  1R0R I;  2JXD A;  2N1A B;  1FYB A;  1V1H A;  2SGQ I;  1Z7K B;  2B0U C;  1LR7 A;  3UGI A;  1TOT A;  1X4S A;  1M8B A;  2QQE A;  2GVI A;  1U5K A;  1TIH A;  3QWP A;  4FKD A;  2N71 A;  1RFH A;  2W0T A;  3MEK A;  1PPF I;  1BMO A;  1PJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...