2JZMA

Chymotrypsin inhibitor c1 from nicotiana alata
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
53
structure length
53
Chain Sequence
DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACTLNCDPRIAYGVCPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase inhibitor
publication title Structural refinement of insecticidal plant proteinase inhibitors from Nicotiana alata.
pubmed rcsb
molecule tags Hydrolase inhibitor
total genus 11
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2008-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2jzmA00
2V53A 1TURA 1N13A 1HJAI 3QTLD 1OMTA 1CE3A 1Y1CA 2B0UC 1CT4I 4GI3C 2NU0I 2JZMA 1SGYI 3SGQI 2QQCA 1NUBA 2QQDA 2KCXA 1Y1BA 1UVFA 1LR7A 1SGPI 2XRCA 2GKTI 1BMOA 1CGII 2GKRI 1OMUA 2SGFI 2GKVA 1CGJI 2N52A 2ARPF 1AN1I 1SGRI 2SGEI 1TBRR 1CT2I 1DS2I 1SGQI 1PCEA 3B4VC 2SGPI 2KMQA 1TGSI 1LR8A 3HH2C 2BUSA 2P6AC 3OVOA 1YTPA 1IY5A 2F3CI 4OVOA 1OYVI 1TBQR 1YU6C 2NU3I 3TJQA 5JHWC 2M5XA 2NU4I 1TIHA 2JXDA 2LEOA 2NU2I 5DAEA 1FYBA 1UVGA 1LR9A 1SGEI 2OVOA 1HDLA 1IY6A 1H0ZA 4SGBI 1PPFI 2KMPA 1SGNI 1IW4A 1CHOI 1Z7KB 2N71A 2NU1I 1M8BA 1UUCA 1SGDI 2SGDI 1OVOA 3SGBI 1MT1A 2SGQI 1PJUA 1CSOI 2KMOA 1CT0I 2KMRA 1DS3I 1M8CA 2JYYA 1HPTA 1BUSA 2ERWA 2WCYA 1TUSA 2N17A 1R0RI 3SEKC 4HGUA 1KMAA
chains in the Genus database with same CATH superfamily
2ROWA 1K7UA 1RFHA 3VE5A 2DB6A 2V53A 4DNCA 1TURA 1N13A 1HJAI 1WKXA 3KY9A 5J8FA 3QTLD 1OMTA 2LB7A 3TO7A 3UEYA 1CE3A 9WGAA 3PDNA 3UOEA 1Y1CA 2B0UC 3R5BA 1CT4I 4GI3C 1NXUA 2NU0I 1Z2IA 1MJAA 2JZMA 2QPOA 2X52A 1SGYI 5FUVA 3SGQI 2OD1A 1VDDA 2QQCA 4B6DA 1W4RA 3UEJA 1NUBA 2QQDA 4UXJA 1R79A 2KCXA 1Y1BA 2E5RA 1UVFA 3E2IA 7WGAA 2DKVA 3VDPA 1LR7A 2CWHA 3OXGA 1SGPI 2XRCA 1FAQA 2V1CA 2LUYA 2WGCA 1WTJA 2CWGA 3TOAA 2GKTI 1BMOA 3E59A 1ULKA 1CGII 2DIPA 4AMLA 2GKRI 2L8EA 1OMUA 2ORWA 1HEVA 1MJBA 1WGCA 2CWFA 2GKVA 2SGFI 1CGJI 2N52A 2ARPF 1AN1I 1SGRI 1W3SA 3OXFA 3FC3A 1ULMA 2SGEI 1TBRR 3QWPA 1CT2I 1DS2I 1FY7A 1K7VA 1X74A 4MPIA 1SGQI 5J8CA 1PCEA 2CJSC 4E1RA 2UZ3A 3B4VC 2SGPI 4UXHA 2KMQA 3UGDA 3UGLA 3CXLA 3UFFA 1TGSI 1TBOA 2OZUA 1LR8A 2ENZA 3HH2C 5EX3A 3D00A 3TOBA 2BUSA 2P6AC 3OVOA 1TOTA 1FYBA 1K7TA 3FSYA 2V1CC 1YTPA 5HQ8A 3GOXA 1IY5A 2F3CI 2JW6A 4OVOA 1OYVI 1TBQR 2A20A 2PQ8A 1YU6C 1WGTA 2NU3I 2UVOA 3TJQA 2FNFX 2M5XA 5JHWC 1UHAA 1Y8FA 2NU4I 2N1AB 2Y0MA 2ENNA 5E3PA 4WP4A 1PTQA 1U5KA 2YUUA 3UGIA 2GVIA 1XBTA 2X3TA 2ELIA 1TIHA 2JXDA 2LEOA 2NU2I 5DAEA 1FARA 1ULNA 1P9ZA 1UVGA 1LR9A 1SGEI 1XX6A 2RIJA 2YQPA 3BJIA 5E3RA 5EX0A 1X4SA 2QQEA 3R5CA 2OVOA 1HDLA 4UXIA 1IY6A 1KBEA 1TBNA 1Q9BA 2QQ0A 2J87A 1H0ZA 3TO6A 1PTRA 2RC4A 4SGBI 3OL0A 2GIVA 1PPFI 1V1HA 2WVJA 5FUWA 2KMPA 1MJ9A 3FSXA 1SGNI 1IW4A 4JCVE 3OXLA 1CHOI 1Z7KB 2N71A 2NU1I 2J9RA 4FKDA 2B8TA 1M8BA 5E3QA 3RU0A 2K9HA 1P9GA 2ORVA 5FUYA 1UUCA 1SGDI 2SGDI 1OVOA 1V1IA 3SGBI 3MEKA 4A24A 1MT1A 3TO9A 2VRWB 5CCMA 1XA6A 5FUXA 2ODDA 2SGQI 2W0TA 4L9MA 1PJUA 1CSOI 2KMOA 4E1PA 5HI7A 1CT0I 2KMRA 3R5AA 3R5DA 1DS3I 1M8CA 2JYYA 1HPTA 2OU2A 2JA1A 2L7XA 3QAHA 1KBFA 1BUSA 2ERWA 2WCYA 1TUSA 5CCLA 1S20A 2N17A 3VDUA 1R0RI 3SEKC 4HGUA 1KMAA 2E73A
chains in the Genus database with same CATH topology
2ROWA 1RFHA 3VE5A 2DB6A 2V53A 1TURA 1N13A 1HJAI 3KY9A 3QTLD 1OMTA 3UEYA 1CE3A 3PDNA 1Y1CA 2B0UC 1CT4I 4GI3C 2NU0I 2JZMA 2QPOA 1SGYI 3SGQI 2OD1A 1VDDA 2QQCA 4B6DA 1W4RA 3UEJA 1NUBA 2QQDA 4UXJA 1R79A 2KCXA 1Y1BA 2E5RA 1UVFA 3E2IA 3VDPA 1LR7A 3OXGA 1SGPI 2XRCA 1FAQA 2V1CA 2LUYA 2GKTI 1BMOA 3E59A 1CGII 2DIPA 2GKRI 2L8EA 1OMUA 2ORWA 2SGFI 2GKVA 5FUVA 1CGJI 2N52A 2ARPF 1AN1I 1SGRI 1W3SA 3OXFA 3FC3A 2SGEI 1TBRR 3QWPA 1CT2I 1DS2I 1X74A 1SGQI 1PCEA 2CJSC 4E1RA 2UZ3A 3B4VC 2SGPI 4UXHA 2KMQA 3UGDA 3UGLA 3CXLA 3UFFA 1TGSI 1TBOA 1LR8A 2ENZA 3HH2C 5EX3A 3D00A 2BUSA 2P6AC 3OVOA 1TOTA 2V1CC 1YTPA 5HQ8A 3GOXA 1IY5A 2F3CI 2JW6A 4OVOA 1OYVI 1TBQR 2A20A 1YU6C 2NU3I 3TJQA 2FNFX 2M5XA 5JHWC 1Y8FA 2NU4I 2N1AB 2ENNA 1PTQA 1U5KA 2YUUA 3UGIA 2GVIA 1XBTA 2ELIA 1TIHA 2JXDA 2LEOA 2NU2I 5DAEA 1FARA 1FYBA 1UVGA 2YQPA 1LR9A 1SGEI 1XX6A 3BJIA 5EX0A 1X4SA 2QQEA 2OVOA 1HDLA 4UXIA 1IY6A 1KBEA 1TBNA 2QQ0A 1H0ZA 2J87A 1PTRA 4SGBI 3OL0A 1PPFI 1V1HA 2WVJA 5FUWA 2KMPA 1SGNI 1IW4A 4JCVE 3OXLA 1CHOI 1Z7KB 2N71A 2NU1I 2J9RA 4FKDA 2B8TA 1M8BA 3RU0A 2K9HA 2ORVA 5FUYA 1UUCA 1SGDI 2SGDI 1OVOA 1V1IA 3SGBI 3MEKA 4A24A 1MT1A 5CCMA 2VRWB 1XA6A 5FUXA 2ODDA 2SGQI 2W0TA 4L9MA 1PJUA 1CSOI 2KMOA 4E1PA 5HI7A 1CT0I 2KMRA 1DS3I 1M8CA 2JYYA 1HPTA 2JA1A 2L7XA 1KBFA 1BUSA 2ERWA 2WCYA 1TUSA 5CCLA 3VDUA 2N17A 1R0RI 3SEKC 4HGUA 1KMAA 2E73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V53 A;  1TUR A;  1N13 A;  1HJA I;  3QTL D;  1OMT A;  1CE3 A;  1Y1C A;  2B0U C;  1CT4 I;  4GI3 C;  2NU0 I;  2JZM A;  1SGY I;  3SGQ I;  2QQC A;  1NUB A;  2QQD A;  2KCX A;  1Y1B A;  1UVF A;  1LR7 A;  1SGP I;  2XRC A;  2GKT I;  1BMO A;  1CGI I;  2GKR I;  1OMU A;  2SGF I;  2GKV A;  1CGJ I;  2N52 A;  2ARP F;  1AN1 I;  1SGR I;  2SGE I;  1TBR R;  1CT2 I;  1DS2 I;  1SGQ I;  1PCE A;  3B4V C;  2SGP I;  2KMQ A;  1TGS I;  1LR8 A;  3HH2 C;  2BUS A;  2P6A C;  3OVO A;  1YTP A;  1IY5 A;  2F3C I;  4OVO A;  1OYV I;  1TBQ R;  1YU6 C;  2NU3 I;  3TJQ A;  5JHW C;  2M5X A;  2NU4 I;  1TIH A;  2JXD A;  2LEO A;  2NU2 I;  5DAE A;  1FYB A;  1UVG A;  1LR9 A;  1SGE I;  2OVO A;  1HDL A;  1IY6 A;  1H0Z A;  4SGB I;  1PPF I;  2KMP A;  1SGN I;  1IW4 A;  1CHO I;  1Z7K B;  2N71 A;  2NU1 I;  1M8B A;  1UUC A;  1SGD I;  2SGD I;  1OVO A;  3SGB I;  1MT1 A;  2SGQ I;  1PJU A;  1CSO I;  2KMO A;  1CT0 I;  2KMR A;  1DS3 I;  1M8C A;  2JYY A;  1HPT A;  1BUS A;  2ERW A;  2WCY A;  1TUS A;  2N17 A;  1R0R I;  3SEK C;  4HGU A;  1KMA A; 
#chains in the Genus database with same CATH topology
 2ROW A;  1K7U A;  1RFH A;  3VE5 A;  2DB6 A;  2V53 A;  4DNC A;  1TUR A;  1N13 A;  1HJA I;  1WKX A;  3KY9 A;  5J8F A;  3QTL D;  1OMT A;  2LB7 A;  3TO7 A;  3UEY A;  1CE3 A;  9WGA A;  3PDN A;  3UOE A;  1Y1C A;  2B0U C;  3R5B A;  1CT4 I;  4GI3 C;  1NXU A;  2NU0 I;  1Z2I A;  1MJA A;  2JZM A;  2QPO A;  2X52 A;  1SGY I;  5FUV A;  3SGQ I;  2OD1 A;  1VDD A;  2QQC A;  4B6D A;  1W4R A;  3UEJ A;  1NUB A;  2QQD A;  4UXJ A;  1R79 A;  2KCX A;  1Y1B A;  2E5R A;  1UVF A;  3E2I A;  7WGA A;  2DKV A;  3VDP A;  1LR7 A;  2CWH A;  3OXG A;  1SGP I;  2XRC A;  1FAQ A;  2V1C A;  2LUY A;  2WGC A;  1WTJ A;  2CWG A;  3TOA A;  2GKT I;  1BMO A;  3E59 A;  1ULK A;  1CGI I;  2DIP A;  4AML A;  2GKR I;  2L8E A;  1OMU A;  2ORW A;  1HEV A;  1MJB A;  1WGC A;  2CWF A;  2GKV A;  2SGF I;  1CGJ I;  2N52 A;  2ARP F;  1AN1 I;  1SGR I;  1W3S A;  3OXF A;  3FC3 A;  1ULM A;  2SGE I;  1TBR R;  3QWP A;  1CT2 I;  1DS2 I;  1FY7 A;  1K7V A;  1X74 A;  4MPI A;  1SGQ I;  5J8C A;  1PCE A;  2CJS C;  4E1R A;  2UZ3 A;  3B4V C;  2SGP I;  4UXH A;  2KMQ A;  3UGD A;  3UGL A;  3CXL A;  3UFF A;  1TGS I;  1TBO A;  2OZU A;  1LR8 A;  2ENZ A;  3HH2 C;  5EX3 A;  3D00 A;  3TOB A;  2BUS A;  2P6A C;  3OVO A;  1TOT A;  1FYB A;  1K7T A;  3FSY A;  2V1C C;  1YTP A;  5HQ8 A;  3GOX A;  1IY5 A;  2F3C I;  2JW6 A;  4OVO A;  1OYV I;  1TBQ R;  2A20 A;  2PQ8 A;  1YU6 C;  1WGT A;  2NU3 I;  2UVO A;  3TJQ A;  2FNF X;  2M5X A;  5JHW C;  1UHA A;  1Y8F A;  2NU4 I;  2N1A B;  2Y0M A;  2ENN A;  5E3P A;  4WP4 A;  1PTQ A;  1U5K A;  2YUU A;  3UGI A;  2GVI A;  1XBT A;  2X3T A;  2ELI A;  1TIH A;  2JXD A;  2LEO A;  2NU2 I;  5DAE A;  1FAR A;  1ULN A;  1P9Z A;  1UVG A;  1LR9 A;  1SGE I;  1XX6 A;  2RIJ A;  2YQP A;  3BJI A;  5E3R A;  5EX0 A;  1X4S A;  2QQE A;  3R5C A;  2OVO A;  1HDL A;  4UXI A;  1IY6 A;  1KBE A;  1TBN A;  1Q9B A;  2QQ0 A;  2J87 A;  1H0Z A;  3TO6 A;  1PTR A;  2RC4 A;  4SGB I;  3OL0 A;  2GIV A;  1PPF I;  1V1H A;  2WVJ A;  5FUW A;  2KMP A;  1MJ9 A;  3FSX A;  1SGN I;  1IW4 A;  4JCV E;  3OXL A;  1CHO I;  1Z7K B;  2N71 A;  2NU1 I;  2J9R A;  4FKD A;  2B8T A;  1M8B A;  5E3Q A;  3RU0 A;  2K9H A;  1P9G A;  2ORV A;  5FUY A;  1UUC A;  1SGD I;  2SGD I;  1OVO A;  1V1I A;  3SGB I;  3MEK A;  4A24 A;  1MT1 A;  3TO9 A;  2VRW B;  5CCM A;  1XA6 A;  5FUX A;  2ODD A;  2SGQ I;  2W0T A;  4L9M A;  1PJU A;  1CSO I;  2KMO A;  4E1P A;  5HI7 A;  1CT0 I;  2KMR A;  3R5A A;  3R5D A;  1DS3 I;  1M8C A;  2JYY A;  1HPT A;  2OU2 A;  2JA1 A;  2L7X A;  3QAH A;  1KBF A;  1BUS A;  2ERW A;  2WCY A;  1TUS A;  5CCL A;  1S20 A;  2N17 A;  3VDU A;  1R0R I;  3SEK C;  4HGU A;  1KMA A;  2E73 A; 
#chains in the Genus database with same CATH homology
 2ROW A;  1RFH A;  3VE5 A;  2DB6 A;  2V53 A;  1TUR A;  1N13 A;  1HJA I;  3KY9 A;  3QTL D;  1OMT A;  3UEY A;  1CE3 A;  3PDN A;  1Y1C A;  2B0U C;  1CT4 I;  4GI3 C;  2NU0 I;  2JZM A;  2QPO A;  1SGY I;  3SGQ I;  2OD1 A;  1VDD A;  2QQC A;  4B6D A;  1W4R A;  3UEJ A;  1NUB A;  2QQD A;  4UXJ A;  1R79 A;  2KCX A;  1Y1B A;  2E5R A;  1UVF A;  3E2I A;  3VDP A;  1LR7 A;  3OXG A;  1SGP I;  2XRC A;  1FAQ A;  2V1C A;  2LUY A;  2GKT I;  1BMO A;  3E59 A;  1CGI I;  2DIP A;  2GKR I;  2L8E A;  1OMU A;  2ORW A;  2SGF I;  2GKV A;  5FUV A;  1CGJ I;  2N52 A;  2ARP F;  1AN1 I;  1SGR I;  1W3S A;  3OXF A;  3FC3 A;  2SGE I;  1TBR R;  3QWP A;  1CT2 I;  1DS2 I;  1X74 A;  1SGQ I;  1PCE A;  2CJS C;  4E1R A;  2UZ3 A;  3B4V C;  2SGP I;  4UXH A;  2KMQ A;  3UGD A;  3UGL A;  3CXL A;  3UFF A;  1TGS I;  1TBO A;  1LR8 A;  2ENZ A;  3HH2 C;  5EX3 A;  3D00 A;  2BUS A;  2P6A C;  3OVO A;  1TOT A;  2V1C C;  1YTP A;  5HQ8 A;  3GOX A;  1IY5 A;  2F3C I;  2JW6 A;  4OVO A;  1OYV I;  1TBQ R;  2A20 A;  1YU6 C;  2NU3 I;  3TJQ A;  2FNF X;  2M5X A;  5JHW C;  1Y8F A;  2NU4 I;  2N1A B;  2ENN A;  1PTQ A;  1U5K A;  2YUU A;  3UGI A;  2GVI A;  1XBT A;  2ELI A;  1TIH A;  2JXD A;  2LEO A;  2NU2 I;  5DAE A;  1FAR A;  1FYB A;  1UVG A;  2YQP A;  1LR9 A;  1SGE I;  1XX6 A;  3BJI A;  5EX0 A;  1X4S A;  2QQE A;  2OVO A;  1HDL A;  4UXI A;  1IY6 A;  1KBE A;  1TBN A;  2QQ0 A;  1H0Z A;  2J87 A;  1PTR A;  4SGB I;  3OL0 A;  1PPF I;  1V1H A;  2WVJ A;  5FUW A;  2KMP A;  1SGN I;  1IW4 A;  4JCV E;  3OXL A;  1CHO I;  1Z7K B;  2N71 A;  2NU1 I;  2J9R A;  4FKD A;  2B8T A;  1M8B A;  3RU0 A;  2K9H A;  2ORV A;  5FUY A;  1UUC A;  1SGD I;  2SGD I;  1OVO A;  1V1I A;  3SGB I;  3MEK A;  4A24 A;  1MT1 A;  5CCM A;  2VRW B;  1XA6 A;  5FUX A;  2ODD A;  2SGQ I;  2W0T A;  4L9M A;  1PJU A;  1CSO I;  2KMO A;  4E1P A;  5HI7 A;  1CT0 I;  2KMR A;  1DS3 I;  1M8C A;  2JYY A;  1HPT A;  2JA1 A;  2L7X A;  1KBF A;  1BUS A;  2ERW A;  2WCY A;  1TUS A;  5CCL A;  3VDU A;  2N17 A;  1R0R I;  3SEK C;  4HGU A;  1KMA A;  2E73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...