2JZPA

Nmr solution structure of kx5q protl mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
b'MEEVTIKANLIFANGSTQTAEFQGTFEQATSEAYAYADTLKQDNGEWTVDVADQGYTLNIQFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
molecule tags Immune system
source organism Peptostreptococcus magnus
publication title Protein stabilization and the hofmeister effect: the role of hydrophobic solvation
pubmed doi rcsb
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jzpA00
2LUMA 1K51A 1IBXA 2QMTA 1P7EA 3GB1A 1UWXA 2J52A 5HFYA 2JSVX 4KGRA 2PTLA 4OZCA 3UI3A 1XCQL 5HI1A 1XCTL 2LGIA 1D4BA 1K53A 3FILB 2ON8A 1MVKA 1PGAA 3MP9A 1F2RI 1YNTE 2RMMA 1MHXA 4KGSA 2LHDA 2N7JA 2OEDA 4KGTA 3FILA 2J53A 4HJGE 1EM7A 2IGGA 2IGHA 5HHDG 2KACA 1F2RC 2PLPA 4WH4A 5BMIA 2KWDA 3V3XA 1HZ6A 1K52A 4OZBA 1MI0A 1QKZA 1XF5L 2GI9A 2ONQA 4HKZE 1PGBA 2N9KA 2LHEA 2QSDA 5BMHA 2I2YA 5JXVA 5BMGA 1HEZE 2KDMA 4GLSC 2KQ4X 2RPVA 4IOIE 1IGCA 2ZW0A 1K50A 2I38A 1GB1A 2IGDA 2PW9A 2ZW1A 2JXTA 2GB1A 2JU6X 1HZ5A 2NMQA 2KN4A 4IKGA 1P7FA 1YMHE 5HG2A 1JMLA 2N9LA 1FD6A 1FCLA 1C9FA 2JWUA 2JZPA 1IGDA 1KH0A 4MACA 4OZAA 1MPEA 1MHHE 1PGXA 1GB4A 1FCCC 2EELA 1ZXHA 1Q10A 1IBXB 4D2KA 2K0PA
chains in the Genus database with same CATH superfamily
1KLUD 1WGKA 1PDXA 1Y56A 1FRDA 1FM0D 2KLCA 3T3OA 3DVNU 3ZTCA 2KMMA 1RWSA 3ZDMC 5FKAC 3ZXRA 4XYCA 2H88B 1PGAA 3ZRFA 2KX0A 2Z8LA 2QEJC 3NZSA 2A4ZA 2LHDA 1TKGA 3HUIA 3PLUA 4YTPB 1Z5SB 5HHDG 1SGHA 2WXNA 4HVBA 4GSWA 2KTRA 1YOVB 1QILA 2M56B 5HKHA 5J17A 1ET6A 3A33B 3OJ3A 1HTQA 3AH7A 4OZBA 2MRPA 3B9JA 1B1ZA 2IBIB 3L10B 2NBUA 2IO0B 4HKZE 3PHWB 2NCNA 4DHJB 1WXAA 4W9EA 1N62A 1RLFA 4WQMA 2IY1B 4PK1A 2KC1A 4ITKA 4W9DA 4TUUA 2OJWA 4N59A 2AX5A 4HROA 1BMLC 3TEXA 2MH7A 4BBNF 3VAWA 3ZKJC 2CHXA 4C4VB 3R8BA 1PQSA 2GMIC 2JXTA 1WWTA 5IOIA 3QIJA 1EF5A 3PZ8A 4YXDB 3W5UB 2JWUA 1CQVA 5AUKA 3VTWA 1YIWA 3BZDB 4ZRPA 3ETRA 2BQQA 1M4VA 3NS8A 1V5TA 4HPLB 4BZAA 1ZW7A 2BWES 2R2QA 4KV2A 1WJ4A 3BINA 1QOGA 3SEBA 2M19A 2M8SA 2QMTA 4TMAB 3C19A 4PS8A 1LFDA 2WXIA 4ZDVA 4AP4C 3J9CA 1V81A 3ML8A 2BW2A 2LD9A 1JROA 3SFDB 3PPAA 1EU3A 5BO4B 3V05A 2KWVB 2OEDA 4F1SA 3Q3MC 3ML9A 1T0SC 3W1SC 3PGEA 1TJEA 5H92C 1RFAA 2MJ3A 1SXTA 2AQ2B 4US8A 3MTNB 4XDCA 1TKEA 4C7YA 1VCBA 3BY4B 1X1MA 1YX5B 4NJ7A 5TSSA 2SEBD 4IM0A 1K52A 1QKZA 4PS3A 4AUQC 4RF0A 1H4RA 4KZCA 2KDEB 2G45B 1VRAB 1WI0A 5IKCM 2K8CA 1ZDXA 1GJZA 3AE2B 1V2YA 2BVCA 3JSVB 3OAWA 1AW7A 4IG7B 2SAKA 3UINB 1XLPA 2O2VB 2KQ4X 3AB5A 4PYZA 3A1QA 1PFDA 4RGOS 3IAS1 5D94A 5FR3A 2HDEA 3ECIA 3K9OB 3QA8A 3NZUA 2JU6X 1IUEA 5HG2A 1SJED 2Z0DB 4MSMB 1FCLA 2QDFA 4FHJA 3LB8C 2W54A 2KO3A 2OOBB 2RSUA 1HTOA 4M00A 2WU2B 4ARCA 2J0KA 5GMVA 4F7ZA 4IM3A 2D10A 2LGDA 4W9JA 1VZ6A 2EKIA 3X0WA 3B2GA 1SE3A 3IVFA 1VJKA 2RPQA 4LLGM 4JWUC 4B0EA 3ONSA 2KMAA 4RGTA 1V1PA 2AYOB 3DOWA 3LDZE 3W1YA 4K3CA 5DCNA 3FILB 3R66C 1KJTA 1FO4A 2C60A 1YN4A 4FN2A 2OJRA 2KXJA 4W9IA 4MGZE 5FR6A 1EM7A 2KVRA 1C77A 4MJSA 3RN9C 1UD7A 1QT9A 5FK9C 1UBQA 2LXCA 5DPWA 2QILA 3EGRA 4IM2A 2N9XA 3DPDA 1WYWB 1NI2A 2WXGA 1OGWA 3DVGX 3AU4A 3VFKA 2KQSA 3P4QB 4P16A 3DBHB 2LVOA 4ANUA 3BVGA 2WNMA 2ZVOA 3H8HA 2PKOA 3PRPB 1P98A 4GLSC 2JY6A 2DX5B 5I4DA 5G55A 2D5GA 5DPSA 1XT9B 1K50A 3L0WB 2BGFA 1HE8A 2K8BA 2L05A 3KW5B 2B3AA 4DHZB 4FLHA 2ZJDA 2LEKA 1YMHE 4DWFA 4ARIA 1FD6A 3N30A 2INNE 2MBQA 3EECA 3KVFB 2LRWA 1E0ZA 1PGXA 4GDLB 2C7HA 3ZDTA 3APDA 1TS4A 4IWOA 4AJYB 2KFKB 2NVUI 2NBWB 3H1UA 3DQVA 4GN1A 2WXJA 3HVDA 3GB1A 1EU4A 1PYWD 1MJDA 3IBEA 4XZ4A 3T3NA 2BPSA 1XCQL 2C7NB 2INPE 2UU7A 2ON8A 1NENB 2DZKA 1YNTE 3KUCB 1J7CA 3P2BA 3W2DA 2CS4A 3QJZA 4I6NB 2ZNVC 2FUG1 3V6CB 1JRUA 4XWWA 2XEWA 3L54A 4TQ1A 3MC9A 1AYFA 4LDTD 2GRIA 3Q3FA 2NS5A 2Y5BB 1KLGD 4AWJA 3TL5A 1YN3A 4K7UA 2JX5A 4CQNA 4PT5A 4JLCA 2MJDA 4DQOC 4M8MA 2NPTB 4L23A 4G50A 4M02A 4OHJA 4OVUA 3A9KA 1L4DB 4E71A 2HJ8A 4Q2JA 1I4PA 2IPKD 2JF5A 1V1PB 2RPVA 2KFKA 1OEYJ 4MSQB 5TR5A 2I38A 3UF8A 2LGXA 4A9AA 2O6VB 4DDGD 1HZ5A 3FAHA 1L6VA 2W55A 2M0AA 5CTRC 3T8MA 4KDLB 1WZ3A 2QCZA 2XN9C 2N1VA 1C9FA 2DENB 1L2NA 2KDIA 3AXCA 3LXFA 2KC2A 1XLNA 4C7ZA 3HRDD 2WU5B 2WS3B 1C1YB 4XDDA 2K9XA 3OWEB 2K3UA 2PJHA 4OZCA 4YSXB 3VR8B 5JHAA 4W9FA 3SR6A 2PMVA 3MP9A 1UF0A 1KTKA 2KD0A 2L52A 2N7EA 3PSEB 5JZEB 1F77A 3FILA 2J53A 1JWMD 1XEEA 2XK5A 1WM2A 4I6PA 1FRRA 2C9WB 3U8ZA 4XWTA 4YSZB 3SDLC 4MJSB 3VQIA 1N63A 4ICVA 1P1AA 2IO3B 2L00B 2J4XA 3BK2A 1ESFA 4HXDA 3V6EB 2MHJA 1FNVA 1B9RA 4ZHPA 2ZNVB 2A5UA 3WIMA 3N1ZC 3RCZA 5AEKB 2MQJA 2WXOA 3Q2AC 4RMAA 3I57A 4TQ0A 1V8CA 3UIPB 1TKYA 3T9LA 4JWSC 1WF9A 3KWLA 1UZXB 2M0XA 4DXAB 3NZ3A 3AE4B 1DGJA 1FNWA 2BS4B 3QAQA 2BB6A 1GOZA 1C4AA 1JCKB 4HDOA 2M4NA 3AU5A 3TSSA 3IAM1 2NTTA 2JXXA 4E74A 1CMXB 1GB4A 4G0NB 3CF6E 2DYMA 1V86A 3WALA 3ZNZB 2YVCA 1JQ4A 2J42A 4ANVA 4CHKA 2Q5WD 4HRSA 3MFGA 4ZHOA 1F2RI 2LWPA 5DPTA 3RFZB 1G6JA 2PIAA 3DHHC 2GBRA 1ROEA 3HM6X 2K6DB 1V80A 3U4EG 3KH0A 1E10A 2LJ5A 4KGTA 1L7YA 3ZRCA 3DDCB 1D5MC 2GBMA 4JGHB 4TV3A 4WURA 2KWDA 4M8NA 5BMIA 3O65B 3TEYA 3N3KB 1NVID 2BKRB 1UH6A 3RUIB 2EKEC 1WZ0A 3KUDB 3HHMA 2HTHA 3RNEC 1YD8U 4ZRQA 1CK1A 3VTVA 3AE8B 1KF6B 3L4PA 4A55A 5IA7A 5IAAC 2LI5A 4FJVB 4N58A 3W1SA 1Q1OA 2N9EB 2MA9B 3Q69A 1IGCA 4II2B 4K3BA 3GZNI 3S2AA 1EWCA 3DWMA 1E9MA 1A70A 1RAXA 4EKUA 1BT0A 4IKGA 4W9LA 3N20C 1YX6B 1IGDA 3CIRB 2KT7A 2LGSA 2R2OA 3H7PA 2O6VA 4P6VF 1E8WA 1HXYD 5CHVC 4LNNA 4ANWA 2FCMA 3TCAA 4NY0A 1RFKA 4BVUC 3NVWA 4HKQA 2GLSA 3ZLZA 2LVPA 3E9SA 3I63C 4MGIE 1I7HA 1JW9D 4GU2A 3APCA 1WX8A 4M0WA 1MVKA 2CKHB 4IUMB 3P4PB 3DBHI 3B0AA 2LMCA 4NAMA 1Q5WB 3DWGC 1F9JA 2DNFA 3M63B 5G5HA 2IGGA 4HLEA 1KRHA 3I3TB 5AZFA 1SE9A 1SIJA 2PLPA 2JWZA 1FEHA 2CJOA 1OQQA 3PV1A 5E6NA 4MH0E 4WJPA 1HZ6A 1AARA 2KX3A 5CX3A 3V61A 3E56A 2KMCA 1PGBA 2XNAC 1C79A 1UGMA 2WXQA 2DYOA 4NNJB 2QSDA 1ZUD2 2KDBA 2PVOD 3NRZA 2Y5CA 3ZQ4A 3KUZA 2MP2A 3HVZA 1OQYA 3P1MA 4BKGA 2WXHA 3OJ4B 2W3RA 1MG4A 1WH3A 5LXHA 1WR6E 4UDUC 4YL8A 4NJCA 2BYEA 2Y3AA 1WMHA 3MHSD 2FBWB 2G4DB 2IO1B 2JQRB 4DXFA 3GP7A 3NY5A 4P7IA 3ENEA 2DZMA 4BOSC 1TBEA 2V3PA 4JX1C 3P42A 2L7RA 4KGRA 3V60A 4DHZE 1R7SA 1I4HA 2AEHA 4P1BC 3QHTA 2LGIA 3RNAC 3B1LX 2EMTA 4KSKC 4KVGB 3PRZA 4KX6B 1MHXA 2ZZPB 4KGSA 1EF1A 1E7PB 3L08A 3AE1B 1YJIA 2WXMA 2X8XX 1GAQB 3R7RA 4GDKB 2MSED 2FIFA 2QJLA 2KWCA 4WH4A 1C4CA 3C8YA 1XD3B 2KHWB 1UELA 1DOIA 2XK5B 4HCPB 1S3SG 2L76A 1WX9A 4GDLA 3TUOA 3RULA 2MCNB 2XBBC 1I4XA 4FADA 2Y5PA 1I42A 4GXBA 4JIOU 1AWDA 1RRBA 5D7GA 2I2YA 3H6NA 3ZW3A 3RD2A 4AS1A 2CHZA 2MEKA 2KJHB 2G4SA 1V49A 2M17A 3BYYB 4YTNB 4USAA 3X23A 3AEEB 5JHBA 3ZYYX 1SE4A 2GOWA 2IO2B 5G5GA 1WGGA 1QOFA 3TIXA 4ZOHC 4RM8A 2G1EA 3AEBB 3NVZA 2QC8A 1E90A 1WYGA 1A5RA 1IBXB 3OLMD 3PVLA 2JVCA 2K0PA 4NJ6A 1V97A 3R2TA 3ZJUA 1K51A 3A4RA 1J19A 4DBGA 1Z2MA 1TT5B 1P0RA 2YLMA 3ZVVA 1I35A 3Q8FA 4LDTB 3SFEB 2PTLA 3IT4B 3UI3A 1LXDA 1D4BA 4BKSA 3MC8A 2ZVNA 3A9JA 2N4FA 4BKSD 2KJ6A 2FUHB 2EMSA 1E8YA 1YQBA 4JPSA 3VUXA 5C1ZA 3MJWA 2MLBA 3AE3B 3BVZA 3JW0X 1XLQA 2LFIA 2BYVE 3R7QA 1NEKB 2AQ3B 2J0JA 4LNIA 4A8XC 2V4IB 1WIAA 1SE2A 5BYRA 3UIOB 2K8HA 2C5LC 3K9PB 5T8IA 4ZYNA 1J0GA 3WA0A 1ZOYB 4EZJA 4RH6A 1NBFC 4R3DA 3ZUNA 3EUB2 2KDMA 1WY8A 1L0XB 2IYDB 1TYGB 2WP9B 2ZEQA 2KTFA 4HEA1 3HM3A 3N1XC 3QC8B 4I6LB 2DBYA 1KM7A 4G11A 5J2RA 4NPNA 4NQKE 5CHFA 4YTMB 2WQYB 3BYTB 3W9CB 2WGSA 2BF8B 3TMPB 5GXGB 3PS6A 3AECB 4B0MA 3MC0B 2BB5A 3WAOA 3Q3NC 1ENFA 1FPYA 2CU1A 3N32A 1YJ1A 5C3JB 1JWUD 4RGMA 3Q3OC 2MW5A 2V0GA 3NG0A 4WAAA 4DXGA 2RDBC 3VDZA 4EFOA 2E6XA 1P3QU 3PRMB 3Q3JA 5HFYA 2PVGC 3VH4B 2V3SA 5HI1A 3AEFB 2MBHA 1NDDA 1JRPA 3BK1A 2WDRB 2YEPB 2VZKD 3VHTC 4HDQA 3KYCD 5MPOA 2AWTA 2N9PC 2LGYA 3AEAB 2JZZA 1WR1A 2DZIA 3A9KB 1FXTB 1FMAD 2BBCA 4GMVA 4BFRA 1LQBA 3H7SA 1I4GA 4CYEA 1EO6A 1WXQA 3EFCA 4GDKA 2KNBA 1CZPA 2FCQA 5AUIA 2LVQA 1ZE3D 2D3BA 5JXVA 1E6EB 1SJHD 5LNK1 4A3OA 2BYFA 4IWPA 1ZP0B 3NJTA 2D3AA 1BXTA 1TY2A 1ZPSA 1VZ8A 3QK0A 4ZRJA 3C0RB 2L0TA 2BS2B 1QQRA 1TZ1A 1N5WA 4TSSA 1STEA 2R61A 1BUIC 3HK0A 4EZLA 3M62B 4KSLC 1WFYA 1WGDA 1KH0A 2RDHA 3Q8BA 3DVNV 3ALBA 2WXLA 3TJPA 1L0VB 5E6PA 2D2QA 3RYTA 4O1NA 3DCGA 3Q14C 3DHIC 1EUVB 3Q8EA 3PZDA 4EE2A 2D11A 2DWQA 1HA5A 1GC7A 1IBXA 3QARA 1OTRB 4DK5A 1LO5D 3AEGB 4KKJA 3NS1A 5D3DA 3U30A 2TSSA 4GGQA 1FNUA 4K7WA 3UQAA 3ZNGC 1QLBB 4EEWA 3DHGC 5J18A 4WWPA 2HTME 3IHPC 4JL9A 4II3B 3TEWA 3A9JB 1V1OA 5D3IB 4FXCA 1WX7A 1DOYA 2JRHA 1XO3A 1RM6C 2REXA 3WANA 4RFBA 1SF0A 4L2YA 1D6EC 1JALA 1KOTA 4JQWC 4E3CA 3AE7B 1NI3A 4WJOA 4C56C 1E7VA 4M0WB 2O6VD 3AMZA 1MI0A 1ZDVA 3URYA 1AN8A 2N9KA 2INDC 4LNOA 2WDTB 4A3PA 4AOFA 3L17A 4WAFA 2MWSB 2HJ1A 3LJ3A 2W82A 2OHFA 2WHIA 4MGKE 3B08A 2WXPA 4NQLB 2FNJB 2IJ0A 4IOIE 2ZCCA 2Z0EB 3JVZX 1TZOA 3RI7C 2IGDA 5EE3A 2E3TA 2ACZB 2W9NA 3AE9B 2GB1A 3CSFA 2N1WA 2KN4A 3GS2A 2KZRA 1J8CA 3VRAB 2JZPA 2NR2A 4MACA 1QOAA 5LXIB 4EOYA 1MHHE 4B9KA 1LM8B 1T3QA 3DBRB 4LCDE 1FCCC 5CHWA 1WE7A 1J7AA 4D2KA 3IT6B 2LUMA 1GG3A 3BWUD 1TS3A 3ZNHB 3KWVA 3SU8X 1XLOA 1Y8RC 4DDID 2JSVX 3PHXB 1XCTL 4WWNA 1WRIA 4WJQA 5EDSA 4FHKA 1KFYB 3L13A 2VZKB 2RMMA 2LUEA 2FE8A 1JWSD 3H9DA 3NHEB 3R3MA 4W9GA 1WRDB 3APFA 3I5JC 4NAWA 2FIDA 5D6JB 2KFJA 4KDIC 3V62A 2PE9A 4M01A 2K39A 2ASQA 3ZJVA 1FFUA 1NYRA 5DPRA 4JE3B 1TS5A 2UYZB 1V9JA 1GNUA 1WMHB 2KLGA 2RR9A 3PTFC 3U52E 3VR9B 3AE5B 2M1MA 4EZKA 4XGAB 1WJUA 1D3ZA 3RNBC 3CSTA 1VLBA 3QX1A 4BKTA 3ZIMA 2RGFA 2JRIB 2G9HD 4FBJB 3CWIA 1HEZE 3H7PB 2CJNA 1FFVA 4MT5A 1T0YA 3KYDD 2L83A 3VXWA 4NAWB 3ZGZA 1T5XD 1WXVA 3QCAA 1T0QC 1CJEA 3BVMA 1KLVA 4KZ0A 3GZNB 3ZXVA 5BYSA 2WDVB 3P63A 1DYQA 2DYBA 4WQOB 2BTEA 5BYQA 3VUWA 5AZGA 2NBVB 4G3XB 3RZFA 3IXSA 4OZAA 3O13A 4LNKA 3OG5A 1E5WA 1C78A 1GUAB 4FULA 2C7MB 4HWIB 3DBSA 3VTUA 1Q10A 1D5XC 2GBKA 2V3NA 1D5ZC 1TGZB 4ZRKA 4FJZA 2Z59B 1XQQA 3PLVA 1UWXA 1SBBB 2J52A 2WXRA 1I4QA 4YSYB 4XC2A 3A4SC 1I4RA 2LASA 4N6EB 5EE0A 1QF6A 4KIKA 3BIID 1K53A 2I1KA 4BAXA 4LNFA 4RM9A 1UBIA 2KN5A 3P4RB 4URKA 3EFUA 2CU3A 3RT3B 1YJJA 2IGHA 2J0MA 1C4PA 1PUTA 2KACA 2KKCA 2MX2A 4RF1A 2JT4B 2MP2B 3NOBA 2JYTA 3V3XA 3RPFC 2LRUA 1OEYA 4J6IA 4WIPA 3RNFC 1XF5L 2GI9A 2ONQA 4LJOB 1OQRA 1FXIA 1R4NI 1WM3A 2LJIA 4IDIA 4RNAA 4FJYA 2BS3B 2JYEA 1R4NB 5EE9A 1P9DU 5E6OA 1E8XA 1WE6A 4J3OD 1C3TA 2ZW0A 5KHOA 4H2AA 5D2MB 4C80A 3EHVA 2PW9A 2NTSA 2NPTA 1YQ4B 3AN1A 2MBEA 2NMQA 1VD2A 1P7FA 2WXFA 1VR9A 2ICIA 4MM3A 2L32A 3WAPA 2DHZA 3AV8A 2KWUB 1N60A 3SD5A 1MPEA 4MH8A 4W9CA 2PEAA 2X38A 2EELA 4A6QA 3EC8A 3PREA 1EWYC 4IWQA 4BOZB 4ANXA 2KVZA 2GBJA 2MJEA 5KHQA 3RNGC 3L16A 5L83A 4US9A 3JYUA 4LTUA 3IFWB 2V1YA 1F52A 3MJ5A 2WWZA 3HIZA 1Q0WB 2PE6B 2WYQA 2N7DA 4W9HA 1SIFA 4L1BA 1QZEA 1N6ZA 3VVWB 2V4LA 2IY0B 4HJGE 2BKFA 3I9V1 2WX0A 4HK2A 1R4MI 4K1RB 3ZJTA 1T0RC 4LK0M 1FXAA 3AEDB 4CO7A 3D32A 4REZA 2FCNA 3ZTDA 4HPPA 2VH2A 3ZO5B 1YN5A 3UGBB 2FAZA 1ACCA 2WX1A 3KLSX 1ISNA 2VRRB 1E8ZA 3EA6A 2ZPNA 3ABVB 1SSNA 3LYYA 1HQRD 4C4VA 3RNCC 2MBBB 4OW0A 2K22A 4S0RA 2WLBA 3A1QB 2DLBA 3VRBB 1WGYA 5H8YE 3M3JA 2KOXA 3U2SC 3DBLI 5AZHA 1MFWA 3GE8C 1JWAD 1VDVA 2G3QB 3CMMB 4ICUA 5EE1A 1J7BA 2JUOA 4WJNA 3NVYA 4AQ7A 4OVZA 4F8CB 5LLIA 4DHJD 4PS7A 5IO9A 5IN7A 2LZ6A 4K81A 2FCSA 2JZ3B 3KQ4A 3VUYA 2I1JA 3MHZA 1P7EA 2WDQB 4EUTA 2DAJA 2BYTA 1F1HA 2B76B 3R2IA 4C00A 2V9HA 1OFFA 1C76A 2L3ZA 3RZWC 3U7DA 1WJNA 2KJRA 4IW0A 4KIKB 2AL3A 3AULA 3IG3A 4A90A 1LGRA 2CR5A 2K1FA 2KANA 3PT2B 4X57B 3PZ7A 1TTNA 1WGHA 1UGJA 2HE7A 2KTRB 1F2RC 3JSVA 1V5OA 2IDYA 1ZKHA 2JPHA 1L0YB 2QIEB 2QHOA 4P1CC 1ZXIA 1JWBD 3P4SB 4W9KA 1FIQA 3ZNID 2UWQA 1TS2A 4GOCA 4HJKA 4OVVA 1GC6A 2O2VA 4IC7B 1H8CA 1WGRA 3AI5A 1R4MB 1SB3C 3DBRI 3Q8CA 4YWGG 1WXSA 5BMGA 4WWMA 1U4AA 2H89B 3M95A 4GIVA 2INCC 4MELA 2KAJA 2ZCBA 2D3CA 4NZLB 3QWZB 2DAFA 2W3SA 1N61A 3DBLB 4XX5A 3N9YC 4K7SA 1N5XA 2CHWA 3SHQA 2RD0A 2AQ1B 2BWFA 1L5PA 3B2FA 3TBLD 1S1QB 2K25A 4MM3B 1IPGA 4S17A 1L6UA 5L95C 1ET9A 2D07B 2MBOA 3QQ8B 1V6EA 3VH3B 4ZRIA 1UNSA 1QOBA 1TY0A 4MGYE 4PYUA 4KKIA 3GOEA 2KQ7A 2LXAA 4ASWC 2K6QA 4TKNA 4A20A 2L1AA 2DZJA 1UWMA 3AM9A 4MEMA 1RYJA 5G2NA 3N1YC 1TIFA 3DVGY 4YT0B 4HCNB 3PO0A 2N7JA 1ZGUB 1WSPA 5JH5C 3AE6B 5C2TB 4N9F4 4WWOA 4MDKE 2BT6A 1L4ZB 3WCQA 1WXMA 5IP4D 1IP9A 2KYWA 3W5VB 2YEPF 3RMKC 4BBNC 3GE3C 2KDFB 2LHEA 1M94A 3FKYA 1YQ3B 2PPHA 2WXKA 5BMHA 4RGNA 4ACFA 3Q6BA 2N0SB 1GPXA 1NYQA 2GBNA 2KK8A 4QAYA 4RCOA 2D3GA 4HPMB 3TEZA 2ZPYA 2AL6A 3NUHB 1IYFA 2IZVB 1SEBD 1T6BX 1E7UA 4AJWA 3NVVA 1VZ7A 1GB1A 1K8RB 4B6WA 5C23A 4B95A 2RDGA 3WAMA 2ZW1A 3FC4A 2HD5B 3UQBA 1DOXA 1JMLA 2N9LA 3U7ZA 2J7QB 2VH1A 5E6JA 1WJ6A 4FA6A 3Q8AA 2K5PA 1XXGA 4LJPB 4ZYSA 2L8JA 4GB9A 1UUPA 2L0FA 4XE0A 1ZXHA 1F0ZA 1MG8A
chains in the Genus database with same CATH topology
3R2TA 1KLUD 1WGKA 1K51A 1PDXA 4XDDA 3ZJUA 2V3NA 1D5ZC 1Y56A 2K9XA 1FRDA 1FM0D 3OWEB 2K3UA 3T3OA 1UWXA 1SBBB 3Q8FA 2J52A 2WXRA 1I4QA 4YSYB 3SFEB 2PTLA 3IT4B 2KMMA 1RWSA 4OZCA 3UI3A 1I4RA 5EE0A 4N6EB 4YSXB 1QF6A 3VR8B 1D4BA 3BIID 5FKAC 1K53A 3SR6A 2PMVA 2H88B 1PGAA 3MP9A 1KTKA 2Z8LA 3P4RB 2QEJC 2L52A 2LHDA 1TKGA 4JPSA 2CU3A 1F77A 1YJJA 3AE3B 2J53A 3BVZA 3FILA 3HUIA 1XLQA 1JWMD 2LFIA 2IGHA 1NEKB 4YTPB 1XEEA 5HHDG 1C4PA 1PUTA 2KACA 2WXNA 2AQ3B 1FRRA 4RF1A 1QILA 2M56B 2V4IB 2JYTA 4XWTA 4A8XC 5BYRA 1SE2A 4YSZB 3V3XA 1ET6A 3RPFC 1N63A 3VQIA 5T8IA 3AH7A 4OZBA 1ZOYB 3B9JA 1B1ZA 4WIPA 1XF5L 2J4XA 2GI9A 3BK2A 2ONQA 1ESFA 4HKZE 1OQRA 1FNVA 1FXIA 1N62A 1B9RA 4RH6A 4ZHPA 4R3DA 4WQMA 2LJIA 4IDIA 4RNAA 2BS3B 2JYEA 4ITKA 2WXOA 3EUB2 5EE9A 3I57A 4TQ0A 2KDMA 1L0XB 4N59A 1TYGB 1V8CA 2WP9B 2AX5A 4HROA 4HEA1 1BMLC 1TKYA 3TEXA 2MH7A 2DBYA 4JWSC 4J3OD 2ZW0A 3KWLA 4H2AA 4YTMB 2WQYB 3R8BA 3NZ3A 4C80A 3AE4B 2PW9A 3BYTB 1DGJA 1FNWA 2NTSA 2BS4B 3W9CB 2JXTA 1YQ4B 3AN1A 1WWTA 2BB6A 2NMQA 5GXGB 1P7FA 2WXFA 1VR9A 2ICIA 3AECB 3PZ8A 4B0MA 2L32A 1GOZA 4YXDB 3W5UB 1C4AA 3MC0B 2BB5A 1JCKB 2JWUA 1CQVA 5AUKA 3AV8A 1ENFA 1N60A 3TSSA 3BZDB 4ZRPA 3IAM1 2NTTA 1MPEA 3ETRA 4MH8A 1M4VA 5C3JB 1JWUD 4RGMA 1GB4A 2V0GA 2X38A 2EELA 4A6QA 4DXGA 2DYMA 1EWYC 1QOGA 3SEBA 2M19A 2QMTA 2E6XA 4TMAB 1JQ4A 2J42A 2MJEA 2WXIA 5HFYA 2PVGC 4US9A 3J9CA 4LTUA 5HI1A 3AEFB 2Q5WD 3MJ5A 4HRSA 2BW2A 1JRPA 3BK1A 1JROA 3MFGA 3SFDB 4ZHOA 1F2RI 4L1BA 3RFZB 2PIAA 1EU3A 2WDRB 2YEPB 2VZKD 1ROEA 5MPOA 3V05A 3U4EG 2OEDA 1E10A 4KGTA 3AEAB 4HJGE 3I9V1 1TJEA 5H92C 2MJ3A 1D5MC 3ZJTA 1SXTA 2AQ2B 1FMAD 4US8A 4XDCA 1TKEA 4WURA 2KWDA 4C7YA 2BBCA 5BMIA 4LK0M 3TEYA 1FXAA 1NVID 3AEDB 5TSSA 2SEBD 1I4GA 4REZA 1K52A 1WXQA 1QKZA 1CZPA 1YN5A 1ACCA 4RF0A 5AUIA 3KLSX 4ZRQA 1ZE3D 1VRAB 1CK1A 3AE8B 1KF6B 1E6EB 5JXVA 1ZDXA 3AE2B 3EA6A 1SJHD 3L4PA 4A55A 3ABVB 1SSNA 5LNK1 1AW7A 3LYYA 1HQRD 2SAKA 1XLPA 4N58A 3W1SA 2KQ4X 1ZP0B 3AB5A 4OW0A 2K22A 1BXTA 1PFDA 3Q69A 2WLBA 1TY2A 1IGCA 4RGOS 3VRBB 1ZPSA 2DLBA 5H8YE 3IAS1 1VZ8A 1EWCA 3U2SC 3DWMA 5FR3A 2HDEA 1E9MA 1A70A 2BS2B 1QQRA 2JU6X 1JWAD 1IUEA 1N5WA 4TSSA 4IKGA 1VDVA 1STEA 2R61A 5HG2A 1SJED 5EE1A 1BUIC 1FCLA 3LB8C 1IGDA 2W54A 3CIRB 1KH0A 2RDHA 1J7BA 3NVYA 3Q8BA 4P6VF 4AQ7A 4OVZA 2WXLA 1L0VB 1HXYD 2WU2B 4ARCA 4O1NA 3Q8EA 1VZ6A 4EE2A 2DWQA 1HA5A 2EKIA 1IBXA 3KQ4A 3B2GA 1RFKA 1SE3A 1VJKA 3MHZA 1LO5D 3NVWA 4LLGM 1P7EA 2WDQB 4JWUC 3AEGB 4KKJA 4B0EA 4HKQA 2BYTA 3NS1A 5D3DA 2B76B 3E9SA 3R2IA 2TSSA 4RGTA 1FNUA 1V1PA 1OFFA 1C76A 1I7HA 1JW9D 3FILB 1QLBB 4M0WA 1MVKA 1FO4A 3P4PB 1YN4A 2LMCA 2HTME 4NAMA 3DWGC 4A90A 1EM7A 3TEWA 5G5HA 2IGGA 1C77A 1V1OA 5D3IB 4FXCA 1DOYA 3PZ7A 1XO3A 1RM6C 1KRHA 4RFBA 1UGJA 1F2RC 1SIJA 2PLPA 1SF0A 4L2YA 2IDYA 1QT9A 1D6EC 1FEHA 1JALA 1L0YB 5FK9C 2CJOA 2QIEB 1OQQA 1NI3A 3AE7B 1ZXIA 4C56C 1HZ6A 2QILA 1JWBD 3EGRA 3P4SB 1FIQA 3AMZA 1MI0A 1TS2A 1ZDVA 3E56A 3URYA 1PGBA 2WXGA 2XNAC 1AN8A 2N9KA 1C79A 2WXQA 2DYOA 4WAFA 2QSDA 1ZUD2 3P4QB 4P16A 1SB3C 2PVOD 3BVGA 2WNMA 3Q8CA 2W82A 3NRZA 3H8HA 4YWGG 5BMGA 2PKOA 4WWMA 2OHFA 2Y5CA 2H89B 3ZQ4A 4GLSC 2WXPA 3HVZA 5I4DA 2IJ0A 4IOIE 2KAJA 4NZLB 2W3SA 2D5GA 1K50A 1N61A 1TZOA 2IGDA 5EE3A 3N9YC 2E3TA 3P1MA 2WXHA 2W3RA 2ACZB 3AE9B 1N5XA 2GB1A 2KN4A 2AQ1B 3GS2A 2LEKA 1YMHE 4ARIA 1FD6A 1L5PA 3B2FA 3VRAB 2JZPA 4MM3B 2INNE 4UDUC 1L6UA 1ET9A 4MACA 1QOAA 4NJCA 1MHHE 1E0ZA 2Y3AA 1PGXA 1T3QA 4GDLB 2FBWB 1FCCC 2JQRB 4DXFA 3GP7A 1UNSA 1TS4A 1J7AA 1QOBA 1TY0A 4D2KA 3IT6B 2LUMA 3BWUD 1TS3A 3KWVA 4KKIA 2WXJA 1XLOA 3HVDA 3GB1A 2V3PA 4JX1C 1EU4A 1PYWD 3P42A 2JSVX 4KGRA 3T3NA 1XCQL 1R7SA 1I4HA 2L1AA 2INPE 1XCTL 2LGIA 1UWMA 3AM9A 1WRIA 2ON8A 1NENB 1KFYB 1RYJA 2VZKB 1YNTE 2RMMA 1J7CA 4YT0B 4KX6B 2FE8A 1MHXA 1JWSD 4KGSA 3W2DA 3PO0A 2N7JA 1E7PB 1WSPA 2FUG1 3AE6B 3AE1B 1YJIA 2WXMA 5C2TB 4XWWA 1GAQB 4GDKB 4TQ1A 2QJLA 1AYFA 3C8YA 1C4CA 2BT6A 4WH4A 1L4ZB 3WCQA 2GRIA 3ZJVA 1FFUA 1NYRA 1DOIA 4JE3B 1TS5A 3W5VB 1KLGD 2YEPF 3U52E 3TUOA 1YN3A 2JX5A 4CQNA 3VR9B 4PT5A 3AE5B 2MJDA 4DQOC 1I4XA 4L23A 2Y5PA 4OHJA 2LHEA 1YQ3B 2WXKA 5BMHA 1AWDA 1VLBA 4RGNA 5D7GA 2I2YA 2N0SB 1GPXA 1NYQA 4AS1A 1L4DB 2MEKA 2G9HD 4Q2JA 1I4PA 4RCOA 3CWIA 1HEZE 2IPKD 2CJNA 3TEZA 1FFVA 4MT5A 1V1PB 3NUHB 2L83A 2RPVA 4NAWB 3BYYB 3ZGZA 1SEBD 1T6BX 1T5XD 3NVVA 4USAA 1VZ7A 3AEEB 2I38A 4YTNB 1GB1A 3ZYYX 1SE4A 2RDGA 1CJEA 2ZW1A 3BVMA 4A9AA 3FC4A 1HZ5A 3FAHA 5BYSA 1DOXA 1L6VA 2WDVB 1JMLA 2M0AA 2N9LA 2W55A 3P63A 5G5GA 3U7ZA 1DYQA 2XN9C 1C9FA 5E6JA 1QOFA 5BYQA 3Q8AA 2BTEA 2K5PA 2G1EA 1XXGA 4ZOHC 3AEBB 3NVZA 3IXSA 4OZAA 4ZYSA 3O13A 3LXFA 1UUPA 1XLNA 4C7ZA 4XE0A 1C78A 1ZXHA 1WYGA 3HRDD 1F0ZA 1Q10A 2WU5B 1D5XC 2WS3B 1IBXB 1V97A 2K0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUM A;  1K51 A;  1IBX A;  2QMT A;  1P7E A;  3GB1 A;  1UWX A;  2J52 A;  5HFY A;  2JSV X;  4KGR A;  2PTL A;  4OZC A;  3UI3 A;  1XCQ L;  5HI1 A;  1XCT L;  2LGI A;  1D4B A;  1K53 A;  3FIL B;  2ON8 A;  1MVK A;  1PGA A;  3MP9 A;  1F2R I;  1YNT E;  2RMM A;  1MHX A;  4KGS A;  2LHD A;  2N7J A;  2OED A;  4KGT A;  3FIL A;  2J53 A;  4HJG E;  1EM7 A;  2IGG A;  2IGH A;  5HHD G;  2KAC A;  1F2R C;  2PLP A;  4WH4 A;  5BMI A;  2KWD A;  3V3X A;  1HZ6 A;  1K52 A;  4OZB A;  1MI0 A;  1QKZ A;  1XF5 L;  2GI9 A;  2ONQ A;  4HKZ E;  1PGB A;  2N9K A;  2LHE A;  2QSD A;  5BMH A;  2I2Y A;  5JXV A;  5BMG A;  1HEZ E;  2KDM A;  4GLS C;  2KQ4 X;  2RPV A;  4IOI E;  1IGC A;  2ZW0 A;  1K50 A;  2I38 A;  1GB1 A;  2IGD A;  2PW9 A;  2ZW1 A;  2JXT A;  2GB1 A;  2JU6 X;  1HZ5 A;  2NMQ A;  2KN4 A;  4IKG A;  1P7F A;  1YMH E;  5HG2 A;  1JML A;  2N9L A;  1FD6 A;  1FCL A;  1C9F A;  2JWU A;  2JZP A;  1IGD A;  1KH0 A;  4MAC A;  4OZA A;  1MPE A;  1MHH E;  1PGX A;  1GB4 A;  1FCC C;  2EEL A;  1ZXH A;  1Q10 A;  1IBX B;  4D2K A;  2K0P A; 
#chains in the Genus database with same CATH topology
 1KLU D;  1WGK A;  1PDX A;  1Y56 A;  1FRD A;  1FM0 D;  2KLC A;  3T3O A;  3DVN U;  3ZTC A;  2KMM A;  1RWS A;  3ZDM C;  5FKA C;  3ZXR A;  4XYC A;  2H88 B;  1PGA A;  3ZRF A;  2KX0 A;  2Z8L A;  2QEJ C;  3NZS A;  2A4Z A;  2LHD A;  1TKG A;  3HUI A;  3PLU A;  4YTP B;  1Z5S B;  5HHD G;  1SGH A;  2WXN A;  4HVB A;  4GSW A;  2KTR A;  1YOV B;  1QIL A;  2M56 B;  5HKH A;  5J17 A;  1ET6 A;  3A33 B;  3OJ3 A;  1HTQ A;  3AH7 A;  4OZB A;  2MRP A;  3B9J A;  1B1Z A;  2IBI B;  3L10 B;  2NBU A;  2IO0 B;  4HKZ E;  3PHW B;  2NCN A;  4DHJ B;  1WXA A;  4W9E A;  1N62 A;  1RLF A;  4WQM A;  2IY1 B;  4PK1 A;  2KC1 A;  4ITK A;  4W9D A;  4TUU A;  2OJW A;  4N59 A;  2AX5 A;  4HRO A;  1BML C;  3TEX A;  2MH7 A;  4BBN F;  3VAW A;  3ZKJ C;  2CHX A;  4C4V B;  3R8B A;  1PQS A;  2GMI C;  2JXT A;  1WWT A;  5IOI A;  3QIJ A;  1EF5 A;  3PZ8 A;  4YXD B;  3W5U B;  2JWU A;  1CQV A;  5AUK A;  3VTW A;  1YIW A;  3BZD B;  4ZRP A;  3ETR A;  2BQQ A;  1M4V A;  3NS8 A;  1V5T A;  4HPL B;  4BZA A;  1ZW7 A;  2BWE S;  2R2Q A;  4KV2 A;  1WJ4 A;  3BIN A;  1QOG A;  3SEB A;  2M19 A;  2M8S A;  2QMT A;  4TMA B;  3C19 A;  4PS8 A;  1LFD A;  2WXI A;  4ZDV A;  4AP4 C;  3J9C A;  1V81 A;  3ML8 A;  2BW2 A;  2LD9 A;  1JRO A;  3SFD B;  3PPA A;  1EU3 A;  5BO4 B;  3V05 A;  2KWV B;  2OED A;  4F1S A;  3Q3M C;  3ML9 A;  1T0S C;  3W1S C;  3PGE A;  1TJE A;  5H92 C;  1RFA A;  2MJ3 A;  1SXT A;  2AQ2 B;  4US8 A;  3MTN B;  4XDC A;  1TKE A;  4C7Y A;  1VCB A;  3BY4 B;  1X1M A;  1YX5 B;  4NJ7 A;  5TSS A;  2SEB D;  4IM0 A;  1K52 A;  1QKZ A;  4PS3 A;  4AUQ C;  4RF0 A;  1H4R A;  4KZC A;  2KDE B;  2G45 B;  1VRA B;  1WI0 A;  5IKC M;  2K8C A;  1ZDX A;  1GJZ A;  3AE2 B;  1V2Y A;  2BVC A;  3JSV B;  3OAW A;  1AW7 A;  4IG7 B;  2SAK A;  3UIN B;  1XLP A;  2O2V B;  2KQ4 X;  3AB5 A;  4PYZ A;  3A1Q A;  1PFD A;  4RGO S;  3IAS 1;  5D94 A;  5FR3 A;  2HDE A;  3ECI A;  3K9O B;  3QA8 A;  3NZU A;  2JU6 X;  1IUE A;  5HG2 A;  1SJE D;  2Z0D B;  4MSM B;  1FCL A;  2QDF A;  4FHJ A;  3LB8 C;  2W54 A;  2KO3 A;  2OOB B;  2RSU A;  1HTO A;  4M00 A;  2WU2 B;  4ARC A;  2J0K A;  5GMV A;  4F7Z A;  4IM3 A;  2D10 A;  2LGD A;  4W9J A;  1VZ6 A;  2EKI A;  3X0W A;  3B2G A;  1SE3 A;  3IVF A;  1VJK A;  2RPQ A;  4LLG M;  4JWU C;  4B0E A;  3ONS A;  2KMA A;  4RGT A;  1V1P A;  2AYO B;  3DOW A;  3LDZ E;  3W1Y A;  4K3C A;  5DCN A;  3FIL B;  3R66 C;  1KJT A;  1FO4 A;  2C60 A;  1YN4 A;  4FN2 A;  2OJR A;  2KXJ A;  4W9I A;  4MGZ E;  5FR6 A;  1EM7 A;  2KVR A;  1C77 A;  4MJS A;  3RN9 C;  1UD7 A;  1QT9 A;  5FK9 C;  1UBQ A;  2LXC A;  5DPW A;  2QIL A;  3EGR A;  4IM2 A;  2N9X A;  3DPD A;  1WYW B;  1NI2 A;  2WXG A;  1OGW A;  3DVG X;  3AU4 A;  3VFK A;  2KQS A;  3P4Q B;  4P16 A;  3DBH B;  2LVO A;  4ANU A;  3BVG A;  2WNM A;  2ZVO A;  3H8H A;  2PKO A;  3PRP B;  1P98 A;  4GLS C;  2JY6 A;  2DX5 B;  5I4D A;  5G55 A;  2D5G A;  5DPS A;  1XT9 B;  1K50 A;  3L0W B;  2BGF A;  1HE8 A;  2K8B A;  2L05 A;  3KW5 B;  2B3A A;  4DHZ B;  4FLH A;  2ZJD A;  2LEK A;  1YMH E;  4DWF A;  4ARI A;  1FD6 A;  3N30 A;  2INN E;  2MBQ A;  3EEC A;  3KVF B;  2LRW A;  1E0Z A;  1PGX A;  4GDL B;  2C7H A;  3ZDT A;  3APD A;  1TS4 A;  4IWO A;  4AJY B;  2KFK B;  2NVU I;  2NBW B;  3H1U A;  3DQV A;  4GN1 A;  2WXJ A;  3HVD A;  3GB1 A;  1EU4 A;  1PYW D;  1MJD A;  3IBE A;  4XZ4 A;  3T3N A;  2BPS A;  1XCQ L;  2C7N B;  2INP E;  2UU7 A;  2ON8 A;  1NEN B;  2DZK A;  1YNT E;  3KUC B;  1J7C A;  3P2B A;  3W2D A;  2CS4 A;  3QJZ A;  4I6N B;  2ZNV C;  2FUG 1;  3V6C B;  1JRU A;  4XWW A;  2XEW A;  3L54 A;  4TQ1 A;  3MC9 A;  1AYF A;  4LDT D;  2GRI A;  3Q3F A;  2NS5 A;  2Y5B B;  1KLG D;  4AWJ A;  3TL5 A;  1YN3 A;  4K7U A;  2JX5 A;  4CQN A;  4PT5 A;  4JLC A;  2MJD A;  4DQO C;  4M8M A;  2NPT B;  4L23 A;  4G50 A;  4M02 A;  4OHJ A;  4OVU A;  3A9K A;  1L4D B;  4E71 A;  2HJ8 A;  4Q2J A;  1I4P A;  2IPK D;  2JF5 A;  1V1P B;  2RPV A;  2KFK A;  1OEY J;  4MSQ B;  5TR5 A;  2I38 A;  3UF8 A;  2LGX A;  4A9A A;  2O6V B;  4DDG D;  1HZ5 A;  3FAH A;  1L6V A;  2W55 A;  2M0A A;  5CTR C;  3T8M A;  4KDL B;  1WZ3 A;  2QCZ A;  2XN9 C;  2N1V A;  1C9F A;  2DEN B;  1L2N A;  2KDI A;  3AXC A;  3LXF A;  2KC2 A;  1XLN A;  4C7Z A;  3HRD D;  2WU5 B;  2WS3 B;  1C1Y B;  4XDD A;  2K9X A;  3OWE B;  2K3U A;  2PJH A;  4OZC A;  4YSX B;  3VR8 B;  5JHA A;  4W9F A;  3SR6 A;  2PMV A;  3MP9 A;  1UF0 A;  1KTK A;  2KD0 A;  2L52 A;  2N7E A;  3PSE B;  5JZE B;  1F77 A;  3FIL A;  2J53 A;  1JWM D;  1XEE A;  2XK5 A;  1WM2 A;  4I6P A;  1FRR A;  2C9W B;  3U8Z A;  4XWT A;  4YSZ B;  3SDL C;  4MJS B;  3VQI A;  1N63 A;  4ICV A;  1P1A A;  2IO3 B;  2L00 B;  2J4X A;  3BK2 A;  1ESF A;  4HXD A;  3V6E B;  2MHJ A;  1FNV A;  1B9R A;  4ZHP A;  2ZNV B;  2A5U A;  3WIM A;  3N1Z C;  3RCZ A;  5AEK B;  2MQJ A;  2WXO A;  3Q2A C;  4RMA A;  3I57 A;  4TQ0 A;  1V8C A;  3UIP B;  1TKY A;  3T9L A;  4JWS C;  1WF9 A;  3KWL A;  1UZX B;  2M0X A;  4DXA B;  3NZ3 A;  3AE4 B;  1DGJ A;  1FNW A;  2BS4 B;  3QAQ A;  2BB6 A;  1GOZ A;  1C4A A;  1JCK B;  4HDO A;  2M4N A;  3AU5 A;  3TSS A;  3IAM 1;  2NTT A;  2JXX A;  4E74 A;  1CMX B;  1GB4 A;  4G0N B;  3CF6 E;  2DYM A;  1V86 A;  3WAL A;  3ZNZ B;  2YVC A;  1JQ4 A;  2J42 A;  4ANV A;  4CHK A;  2Q5W D;  4HRS A;  3MFG A;  4ZHO A;  1F2R I;  2LWP A;  5DPT A;  3RFZ B;  1G6J A;  2PIA A;  3DHH C;  2GBR A;  1ROE A;  3HM6 X;  2K6D B;  1V80 A;  3U4E G;  3KH0 A;  1E10 A;  2LJ5 A;  4KGT A;  1L7Y A;  3ZRC A;  3DDC B;  1D5M C;  2GBM A;  4JGH B;  4TV3 A;  4WUR A;  2KWD A;  4M8N A;  5BMI A;  3O65 B;  3TEY A;  3N3K B;  1NVI D;  2BKR B;  1UH6 A;  3RUI B;  2EKE C;  1WZ0 A;  3KUD B;  3HHM A;  2HTH A;  3RNE C;  1YD8 U;  4ZRQ A;  1CK1 A;  3VTV A;  3AE8 B;  1KF6 B;  3L4P A;  4A55 A;  5IA7 A;  5IAA C;  2LI5 A;  4FJV B;  4N58 A;  3W1S A;  1Q1O A;  2N9E B;  2MA9 B;  3Q69 A;  1IGC A;  4II2 B;  4K3B A;  3GZN I;  3S2A A;  1EWC A;  3DWM A;  1E9M A;  1A70 A;  1RAX A;  4EKU A;  1BT0 A;  4IKG A;  4W9L A;  3N20 C;  1YX6 B;  1IGD A;  3CIR B;  2KT7 A;  2LGS A;  2R2O A;  3H7P A;  2O6V A;  4P6V F;  1E8W A;  1HXY D;  5CHV C;  4LNN A;  4ANW A;  2FCM A;  3TCA A;  4NY0 A;  1RFK A;  4BVU C;  3NVW A;  4HKQ A;  2GLS A;  3ZLZ A;  2LVP A;  3E9S A;  3I63 C;  4MGI E;  1I7H A;  1JW9 D;  4GU2 A;  3APC A;  1WX8 A;  4M0W A;  1MVK A;  2CKH B;  4IUM B;  3P4P B;  3DBH I;  3B0A A;  2LMC A;  4NAM A;  1Q5W B;  3DWG C;  1F9J A;  2DNF A;  3M63 B;  5G5H A;  2IGG A;  4HLE A;  1KRH A;  3I3T B;  5AZF A;  1SE9 A;  1SIJ A;  2PLP A;  2JWZ A;  1FEH A;  2CJO A;  1OQQ A;  3PV1 A;  5E6N A;  4MH0 E;  4WJP A;  1HZ6 A;  1AAR A;  2KX3 A;  5CX3 A;  3V61 A;  3E56 A;  2KMC A;  1PGB A;  2XNA C;  1C79 A;  1UGM A;  2WXQ A;  2DYO A;  4NNJ B;  2QSD A;  1ZUD 2;  2KDB A;  2PVO D;  3NRZ A;  2Y5C A;  3ZQ4 A;  3KUZ A;  2MP2 A;  3HVZ A;  1OQY A;  3P1M A;  4BKG A;  2WXH A;  3OJ4 B;  2W3R A;  1MG4 A;  1WH3 A;  5LXH A;  1WR6 E;  4UDU C;  4YL8 A;  4NJC A;  2BYE A;  2Y3A A;  1WMH A;  3MHS D;  2FBW B;  2G4D B;  2IO1 B;  2JQR B;  4DXF A;  3GP7 A;  3NY5 A;  4P7I A;  3ENE A;  2DZM A;  4BOS C;  1TBE A;  2V3P A;  4JX1 C;  3P42 A;  2L7R A;  4KGR A;  3V60 A;  4DHZ E;  1R7S A;  1I4H A;  2AEH A;  4P1B C;  3QHT A;  2LGI A;  3RNA C;  3B1L X;  2EMT A;  4KSK C;  4KVG B;  3PRZ A;  4KX6 B;  1MHX A;  2ZZP B;  4KGS A;  1EF1 A;  1E7P B;  3L08 A;  3AE1 B;  1YJI A;  2WXM A;  2X8X X;  1GAQ B;  3R7R A;  4GDK B;  2MSE D;  2FIF A;  2QJL A;  2KWC A;  4WH4 A;  1C4C A;  3C8Y A;  1XD3 B;  2KHW B;  1UEL A;  1DOI A;  2XK5 B;  4HCP B;  1S3S G;  2L76 A;  1WX9 A;  4GDL A;  3TUO A;  3RUL A;  2MCN B;  2XBB C;  1I4X A;  4FAD A;  2Y5P A;  1I42 A;  4GXB A;  4JIO U;  1AWD A;  1RRB A;  5D7G A;  2I2Y A;  3H6N A;  3ZW3 A;  3RD2 A;  4AS1 A;  2CHZ A;  2MEK A;  2KJH B;  2G4S A;  1V49 A;  2M17 A;  3BYY B;  4YTN B;  4USA A;  3X23 A;  3AEE B;  5JHB A;  3ZYY X;  1SE4 A;  2GOW A;  2IO2 B;  5G5G A;  1WGG A;  1QOF A;  3TIX A;  4ZOH C;  4RM8 A;  2G1E A;  3AEB B;  3NVZ A;  2QC8 A;  1E90 A;  1WYG A;  1A5R A;  1IBX B;  3OLM D;  3PVL A;  2JVC A;  2K0P A;  4NJ6 A;  1V97 A;  3R2T A;  3ZJU A;  1K51 A;  3A4R A;  1J19 A;  4DBG A;  1Z2M A;  1TT5 B;  1P0R A;  2YLM A;  3ZVV A;  1I35 A;  3Q8F A;  4LDT B;  3SFE B;  2PTL A;  3IT4 B;  3UI3 A;  1LXD A;  1D4B A;  4BKS A;  3MC8 A;  2ZVN A;  3A9J A;  2N4F A;  4BKS D;  2KJ6 A;  2FUH B;  2EMS A;  1E8Y A;  1YQB A;  4JPS A;  3VUX A;  5C1Z A;  3MJW A;  2MLB A;  3AE3 B;  3BVZ A;  3JW0 X;  1XLQ A;  2LFI A;  2BYV E;  3R7Q A;  1NEK B;  2AQ3 B;  2J0J A;  4LNI A;  4A8X C;  2V4I B;  1WIA A;  1SE2 A;  5BYR A;  3UIO B;  2K8H A;  2C5L C;  3K9P B;  5T8I A;  4ZYN A;  1J0G A;  3WA0 A;  1ZOY B;  4EZJ A;  4RH6 A;  1NBF C;  4R3D A;  3ZUN A;  3EUB 2;  2KDM A;  1WY8 A;  1L0X B;  2IYD B;  1TYG B;  2WP9 B;  2ZEQ A;  2KTF A;  4HEA 1;  3HM3 A;  3N1X C;  3QC8 B;  4I6L B;  2DBY A;  1KM7 A;  4G11 A;  5J2R A;  4NPN A;  4NQK E;  5CHF A;  4YTM B;  2WQY B;  3BYT B;  3W9C B;  2WGS A;  2BF8 B;  3TMP B;  5GXG B;  3PS6 A;  3AEC B;  4B0M A;  3MC0 B;  2BB5 A;  3WAO A;  3Q3N C;  1ENF A;  1FPY A;  2CU1 A;  3N32 A;  1YJ1 A;  5C3J B;  1JWU D;  4RGM A;  3Q3O C;  2MW5 A;  2V0G A;  3NG0 A;  4WAA A;  4DXG A;  2RDB C;  3VDZ A;  4EFO A;  2E6X A;  1P3Q U;  3PRM B;  3Q3J A;  5HFY A;  2PVG C;  3VH4 B;  2V3S A;  5HI1 A;  3AEF B;  2MBH A;  1NDD A;  1JRP A;  3BK1 A;  2WDR B;  2YEP B;  2VZK D;  3VHT C;  4HDQ A;  3KYC D;  5MPO A;  2AWT A;  2N9P C;  2LGY A;  3AEA B;  2JZZ A;  1WR1 A;  2DZI A;  3A9K B;  1FXT B;  1FMA D;  2BBC A;  4GMV A;  4BFR A;  1LQB A;  3H7S A;  1I4G A;  4CYE A;  1EO6 A;  1WXQ A;  3EFC A;  4GDK A;  2KNB A;  1CZP A;  2FCQ A;  5AUI A;  2LVQ A;  1ZE3 D;  2D3B A;  5JXV A;  1E6E B;  1SJH D;  5LNK 1;  4A3O A;  2BYF A;  4IWP A;  1ZP0 B;  3NJT A;  2D3A A;  1BXT A;  1TY2 A;  1ZPS A;  1VZ8 A;  3QK0 A;  4ZRJ A;  3C0R B;  2L0T A;  2BS2 B;  1QQR A;  1TZ1 A;  1N5W A;  4TSS A;  1STE A;  2R61 A;  1BUI C;  3HK0 A;  4EZL A;  3M62 B;  4KSL C;  1WFY A;  1WGD A;  1KH0 A;  2RDH A;  3Q8B A;  3DVN V;  3ALB A;  2WXL A;  3TJP A;  1L0V B;  5E6P A;  2D2Q A;  3RYT A;  4O1N A;  3DCG A;  3Q14 C;  3DHI C;  1EUV B;  3Q8E A;  3PZD A;  4EE2 A;  2D11 A;  2DWQ A;  1HA5 A;  1GC7 A;  1IBX A;  3QAR A;  1OTR B;  4DK5 A;  1LO5 D;  3AEG B;  4KKJ A;  3NS1 A;  5D3D A;  3U30 A;  2TSS A;  4GGQ A;  1FNU A;  4K7W A;  3UQA A;  3ZNG C;  1QLB B;  4EEW A;  3DHG C;  5J18 A;  4WWP A;  2HTM E;  3IHP C;  4JL9 A;  4II3 B;  3TEW A;  3A9J B;  1V1O A;  5D3I B;  4FXC A;  1WX7 A;  1DOY A;  2JRH A;  1XO3 A;  1RM6 C;  2REX A;  3WAN A;  4RFB A;  1SF0 A;  4L2Y A;  1D6E C;  1JAL A;  1KOT A;  4JQW C;  4E3C A;  3AE7 B;  1NI3 A;  4WJO A;  4C56 C;  1E7V A;  4M0W B;  2O6V D;  3AMZ A;  1MI0 A;  1ZDV A;  3URY A;  1AN8 A;  2N9K A;  2IND C;  4LNO A;  2WDT B;  4A3P A;  4AOF A;  3L17 A;  4WAF A;  2MWS B;  2HJ1 A;  3LJ3 A;  2W82 A;  2OHF A;  2WHI A;  4MGK E;  3B08 A;  2WXP A;  4NQL B;  2FNJ B;  2IJ0 A;  4IOI E;  2ZCC A;  2Z0E B;  3JVZ X;  1TZO A;  3RI7 C;  2IGD A;  5EE3 A;  2E3T A;  2ACZ B;  2W9N A;  3AE9 B;  2GB1 A;  3CSF A;  2N1W A;  2KN4 A;  3GS2 A;  2KZR A;  1J8C A;  3VRA B;  2JZP A;  2NR2 A;  4MAC A;  1QOA A;  5LXI B;  4EOY A;  1MHH E;  4B9K A;  1LM8 B;  1T3Q A;  3DBR B;  4LCD E;  1FCC C;  5CHW A;  1WE7 A;  1J7A A;  4D2K A;  3IT6 B;  2LUM A;  1GG3 A;  3BWU D;  1TS3 A;  3ZNH B;  3KWV A;  3SU8 X;  1XLO A;  1Y8R C;  4DDI D;  2JSV X;  3PHX B;  1XCT L;  4WWN A;  1WRI A;  4WJQ A;  5EDS A;  4FHK A;  1KFY B;  3L13 A;  2VZK B;  2RMM A;  2LUE A;  2FE8 A;  1JWS D;  3H9D A;  3NHE B;  3R3M A;  4W9G A;  1WRD B;  3APF A;  3I5J C;  4NAW A;  2FID A;  5D6J B;  2KFJ A;  4KDI C;  3V62 A;  2PE9 A;  4M01 A;  2K39 A;  2ASQ A;  3ZJV A;  1FFU A;  1NYR A;  5DPR A;  4JE3 B;  1TS5 A;  2UYZ B;  1V9J A;  1GNU A;  1WMH B;  2KLG A;  2RR9 A;  3PTF C;  3U52 E;  3VR9 B;  3AE5 B;  2M1M A;  4EZK A;  4XGA B;  1WJU A;  1D3Z A;  3RNB C;  3CST A;  1VLB A;  3QX1 A;  4BKT A;  3ZIM A;  2RGF A;  2JRI B;  2G9H D;  4FBJ B;  3CWI A;  1HEZ E;  3H7P B;  2CJN A;  1FFV A;  4MT5 A;  1T0Y A;  3KYD D;  2L83 A;  3VXW A;  4NAW B;  3ZGZ A;  1T5X D;  1WXV A;  3QCA A;  1T0Q C;  1CJE A;  3BVM A;  1KLV A;  4KZ0 A;  3GZN B;  3ZXV A;  5BYS A;  2WDV B;  3P63 A;  1DYQ A;  2DYB A;  4WQO B;  2BTE A;  5BYQ A;  3VUW A;  5AZG A;  2NBV B;  4G3X B;  3RZF A;  3IXS A;  4OZA A;  3O13 A;  4LNK A;  3OG5 A;  1E5W A;  1C78 A;  1GUA B;  4FUL A;  2C7M B;  4HWI B;  3DBS A;  3VTU A;  1Q10 A;  1D5X C;  2GBK A;  2V3N A;  1D5Z C;  1TGZ B;  4ZRK A;  4FJZ A;  2Z59 B;  1XQQ A;  3PLV A;  1UWX A;  1SBB B;  2J52 A;  2WXR A;  1I4Q A;  4YSY B;  4XC2 A;  3A4S C;  1I4R A;  2LAS A;  4N6E B;  5EE0 A;  1QF6 A;  4KIK A;  3BII D;  1K53 A;  2I1K A;  4BAX A;  4LNF A;  4RM9 A;  1UBI A;  2KN5 A;  3P4R B;  4URK A;  3EFU A;  2CU3 A;  3RT3 B;  1YJJ A;  2IGH A;  2J0M A;  1C4P A;  1PUT A;  2KAC A;  2KKC A;  2MX2 A;  4RF1 A;  2JT4 B;  2MP2 B;  3NOB A;  2JYT A;  3V3X A;  3RPF C;  2LRU A;  1OEY A;  4J6I A;  4WIP A;  3RNF C;  1XF5 L;  2GI9 A;  2ONQ A;  4LJO B;  1OQR A;  1FXI A;  1R4N I;  1WM3 A;  2LJI A;  4IDI A;  4RNA A;  4FJY A;  2BS3 B;  2JYE A;  1R4N B;  5EE9 A;  1P9D U;  5E6O A;  1E8X A;  1WE6 A;  4J3O D;  1C3T A;  2ZW0 A;  5KHO A;  4H2A A;  5D2M B;  4C80 A;  3EHV A;  2PW9 A;  2NTS A;  2NPT A;  1YQ4 B;  3AN1 A;  2MBE A;  2NMQ A;  1VD2 A;  1P7F A;  2WXF A;  1VR9 A;  2ICI A;  4MM3 A;  2L32 A;  3WAP A;  2DHZ A;  3AV8 A;  2KWU B;  1N60 A;  3SD5 A;  1MPE A;  4MH8 A;  4W9C A;  2PEA A;  2X38 A;  2EEL A;  4A6Q A;  3EC8 A;  3PRE A;  1EWY C;  4IWQ A;  4BOZ B;  4ANX A;  2KVZ A;  2GBJ A;  2MJE A;  5KHQ A;  3RNG C;  3L16 A;  5L83 A;  4US9 A;  3JYU A;  4LTU A;  3IFW B;  2V1Y A;  1F52 A;  3MJ5 A;  2WWZ A;  3HIZ A;  1Q0W B;  2PE6 B;  2WYQ A;  2N7D A;  4W9H A;  1SIF A;  4L1B A;  1QZE A;  1N6Z A;  3VVW B;  2V4L A;  2IY0 B;  4HJG E;  2BKF A;  3I9V 1;  2WX0 A;  4HK2 A;  1R4M I;  4K1R B;  3ZJT A;  1T0R C;  4LK0 M;  1FXA A;  3AED B;  4CO7 A;  3D32 A;  4REZ A;  2FCN A;  3ZTD A;  4HPP A;  2VH2 A;  3ZO5 B;  1YN5 A;  3UGB B;  2FAZ A;  1ACC A;  2WX1 A;  3KLS X;  1ISN A;  2VRR B;  1E8Z A;  3EA6 A;  2ZPN A;  3ABV B;  1SSN A;  3LYY A;  1HQR D;  4C4V A;  3RNC C;  2MBB B;  4OW0 A;  2K22 A;  4S0R A;  2WLB A;  3A1Q B;  2DLB A;  3VRB B;  1WGY A;  5H8Y E;  3M3J A;  2KOX A;  3U2S C;  3DBL I;  5AZH A;  1MFW A;  3GE8 C;  1JWA D;  1VDV A;  2G3Q B;  3CMM B;  4ICU A;  5EE1 A;  1J7B A;  2JUO A;  4WJN A;  3NVY A;  4AQ7 A;  4OVZ A;  4F8C B;  5LLI A;  4DHJ D;  4PS7 A;  5IO9 A;  5IN7 A;  2LZ6 A;  4K81 A;  2FCS A;  2JZ3 B;  3KQ4 A;  3VUY A;  2I1J A;  3MHZ A;  1P7E A;  2WDQ B;  4EUT A;  2DAJ A;  2BYT A;  1F1H A;  2B76 B;  3R2I A;  4C00 A;  2V9H A;  1OFF A;  1C76 A;  2L3Z A;  3RZW C;  3U7D A;  1WJN A;  2KJR A;  4IW0 A;  4KIK B;  2AL3 A;  3AUL A;  3IG3 A;  4A90 A;  1LGR A;  2CR5 A;  2K1F A;  2KAN A;  3PT2 B;  4X57 B;  3PZ7 A;  1TTN A;  1WGH A;  1UGJ A;  2HE7 A;  2KTR B;  1F2R C;  3JSV A;  1V5O A;  2IDY A;  1ZKH A;  2JPH A;  1L0Y B;  2QIE B;  2QHO A;  4P1C C;  1ZXI A;  1JWB D;  3P4S B;  4W9K A;  1FIQ A;  3ZNI D;  2UWQ A;  1TS2 A;  4GOC A;  4HJK A;  4OVV A;  1GC6 A;  2O2V A;  4IC7 B;  1H8C A;  1WGR A;  3AI5 A;  1R4M B;  1SB3 C;  3DBR I;  3Q8C A;  4YWG G;  1WXS A;  5BMG A;  4WWM A;  1U4A A;  2H89 B;  3M95 A;  4GIV A;  2INC C;  4MEL A;  2KAJ A;  2ZCB A;  2D3C A;  4NZL B;  3QWZ B;  2DAF A;  2W3S A;  1N61 A;  3DBL B;  4XX5 A;  3N9Y C;  4K7S A;  1N5X A;  2CHW A;  3SHQ A;  2RD0 A;  2AQ1 B;  2BWF A;  1L5P A;  3B2F A;  3TBL D;  1S1Q B;  2K25 A;  4MM3 B;  1IPG A;  4S17 A;  1L6U A;  5L95 C;  1ET9 A;  2D07 B;  2MBO A;  3QQ8 B;  1V6E A;  3VH3 B;  4ZRI A;  1UNS A;  1QOB A;  1TY0 A;  4MGY E;  4PYU A;  4KKI A;  3GOE A;  2KQ7 A;  2LXA A;  4ASW C;  2K6Q A;  4TKN A;  4A20 A;  2L1A A;  2DZJ A;  1UWM A;  3AM9 A;  4MEM A;  1RYJ A;  5G2N A;  3N1Y C;  1TIF A;  3DVG Y;  4YT0 B;  4HCN B;  3PO0 A;  2N7J A;  1ZGU B;  1WSP A;  5JH5 C;  3AE6 B;  5C2T B;  4N9F 4;  4WWO A;  4MDK E;  2BT6 A;  1L4Z B;  3WCQ A;  1WXM A;  5IP4 D;  1IP9 A;  2KYW A;  3W5V B;  2YEP F;  3RMK C;  4BBN C;  3GE3 C;  2KDF B;  2LHE A;  1M94 A;  3FKY A;  1YQ3 B;  2PPH A;  2WXK A;  5BMH A;  4RGN A;  4ACF A;  3Q6B A;  2N0S B;  1GPX A;  1NYQ A;  2GBN A;  2KK8 A;  4QAY A;  4RCO A;  2D3G A;  4HPM B;  3TEZ A;  2ZPY A;  2AL6 A;  3NUH B;  1IYF A;  2IZV B;  1SEB D;  1T6B X;  1E7U A;  4AJW A;  3NVV A;  1VZ7 A;  1GB1 A;  1K8R B;  4B6W A;  5C23 A;  4B95 A;  2RDG A;  3WAM A;  2ZW1 A;  3FC4 A;  2HD5 B;  3UQB A;  1DOX A;  1JML A;  2N9L A;  3U7Z A;  2J7Q B;  2VH1 A;  5E6J A;  1WJ6 A;  4FA6 A;  3Q8A A;  2K5P A;  1XXG A;  4LJP B;  4ZYS A;  2L8J A;  4GB9 A;  1UUP A;  2L0F A;  4XE0 A;  1ZXH A;  1F0Z A;  1MG8 A; 
#chains in the Genus database with same CATH homology
 3R2T A;  1KLU D;  1WGK A;  1K51 A;  1PDX A;  4XDD A;  3ZJU A;  2V3N A;  1D5Z C;  1Y56 A;  2K9X A;  1FRD A;  1FM0 D;  3OWE B;  2K3U A;  3T3O A;  1UWX A;  1SBB B;  3Q8F A;  2J52 A;  2WXR A;  1I4Q A;  4YSY B;  3SFE B;  2PTL A;  3IT4 B;  2KMM A;  1RWS A;  4OZC A;  3UI3 A;  1I4R A;  5EE0 A;  4N6E B;  4YSX B;  1QF6 A;  3VR8 B;  1D4B A;  3BII D;  5FKA C;  1K53 A;  3SR6 A;  2PMV A;  2H88 B;  1PGA A;  3MP9 A;  1KTK A;  2Z8L A;  3P4R B;  2QEJ C;  2L52 A;  2LHD A;  1TKG A;  4JPS A;  2CU3 A;  1F77 A;  1YJJ A;  3AE3 B;  2J53 A;  3BVZ A;  3FIL A;  3HUI A;  1XLQ A;  1JWM D;  2LFI A;  2IGH A;  1NEK B;  4YTP B;  1XEE A;  5HHD G;  1C4P A;  1PUT A;  2KAC A;  2WXN A;  2AQ3 B;  1FRR A;  4RF1 A;  1QIL A;  2M56 B;  2V4I B;  2JYT A;  4XWT A;  4A8X C;  5BYR A;  1SE2 A;  4YSZ B;  3V3X A;  1ET6 A;  3RPF C;  1N63 A;  3VQI A;  5T8I A;  3AH7 A;  4OZB A;  1ZOY B;  3B9J A;  1B1Z A;  4WIP A;  1XF5 L;  2J4X A;  2GI9 A;  3BK2 A;  2ONQ A;  1ESF A;  4HKZ E;  1OQR A;  1FNV A;  1FXI A;  1N62 A;  1B9R A;  4RH6 A;  4ZHP A;  4R3D A;  4WQM A;  2LJI A;  4IDI A;  4RNA A;  2BS3 B;  2JYE A;  4ITK A;  2WXO A;  3EUB 2;  5EE9 A;  3I57 A;  4TQ0 A;  2KDM A;  1L0X B;  4N59 A;  1TYG B;  1V8C A;  2WP9 B;  2AX5 A;  4HRO A;  4HEA 1;  1BML C;  1TKY A;  3TEX A;  2MH7 A;  2DBY A;  4JWS C;  4J3O D;  2ZW0 A;  3KWL A;  4H2A A;  4YTM B;  2WQY B;  3R8B A;  3NZ3 A;  4C80 A;  3AE4 B;  2PW9 A;  3BYT B;  1DGJ A;  1FNW A;  2NTS A;  2BS4 B;  3W9C B;  2JXT A;  1YQ4 B;  3AN1 A;  1WWT A;  2BB6 A;  2NMQ A;  5GXG B;  1P7F A;  2WXF A;  1VR9 A;  2ICI A;  3AEC B;  3PZ8 A;  4B0M A;  2L32 A;  1GOZ A;  4YXD B;  3W5U B;  1C4A A;  3MC0 B;  2BB5 A;  1JCK B;  2JWU A;  1CQV A;  5AUK A;  3AV8 A;  1ENF A;  1N60 A;  3TSS A;  3BZD B;  4ZRP A;  3IAM 1;  2NTT A;  1MPE A;  3ETR A;  4MH8 A;  1M4V A;  5C3J B;  1JWU D;  4RGM A;  1GB4 A;  2V0G A;  2X38 A;  2EEL A;  4A6Q A;  4DXG A;  2DYM A;  1EWY C;  1QOG A;  3SEB A;  2M19 A;  2QMT A;  2E6X A;  4TMA B;  1JQ4 A;  2J42 A;  2MJE A;  2WXI A;  5HFY A;  2PVG C;  4US9 A;  3J9C A;  4LTU A;  5HI1 A;  3AEF B;  2Q5W D;  3MJ5 A;  4HRS A;  2BW2 A;  1JRP A;  3BK1 A;  1JRO A;  3MFG A;  3SFD B;  4ZHO A;  1F2R I;  4L1B A;  3RFZ B;  2PIA A;  1EU3 A;  2WDR B;  2YEP B;  2VZK D;  1ROE A;  5MPO A;  3V05 A;  3U4E G;  2OED A;  1E10 A;  4KGT A;  3AEA B;  4HJG E;  3I9V 1;  1TJE A;  5H92 C;  2MJ3 A;  1D5M C;  3ZJT A;  1SXT A;  2AQ2 B;  1FMA D;  4US8 A;  4XDC A;  1TKE A;  4WUR A;  2KWD A;  4C7Y A;  2BBC A;  5BMI A;  4LK0 M;  3TEY A;  1FXA A;  1NVI D;  3AED B;  5TSS A;  2SEB D;  1I4G A;  4REZ A;  1K52 A;  1WXQ A;  1QKZ A;  1CZP A;  1YN5 A;  1ACC A;  4RF0 A;  5AUI A;  3KLS X;  4ZRQ A;  1ZE3 D;  1VRA B;  1CK1 A;  3AE8 B;  1KF6 B;  1E6E B;  5JXV A;  1ZDX A;  3AE2 B;  3EA6 A;  1SJH D;  3L4P A;  4A55 A;  3ABV B;  1SSN A;  5LNK 1;  1AW7 A;  3LYY A;  1HQR D;  2SAK A;  1XLP A;  4N58 A;  3W1S A;  2KQ4 X;  1ZP0 B;  3AB5 A;  4OW0 A;  2K22 A;  1BXT A;  1PFD A;  3Q69 A;  2WLB A;  1TY2 A;  1IGC A;  4RGO S;  3VRB B;  1ZPS A;  2DLB A;  5H8Y E;  3IAS 1;  1VZ8 A;  1EWC A;  3U2S C;  3DWM A;  5FR3 A;  2HDE A;  1E9M A;  1A70 A;  2BS2 B;  1QQR A;  2JU6 X;  1JWA D;  1IUE A;  1N5W A;  4TSS A;  4IKG A;  1VDV A;  1STE A;  2R61 A;  5HG2 A;  1SJE D;  5EE1 A;  1BUI C;  1FCL A;  3LB8 C;  1IGD A;  2W54 A;  3CIR B;  1KH0 A;  2RDH A;  1J7B A;  3NVY A;  3Q8B A;  4P6V F;  4AQ7 A;  4OVZ A;  2WXL A;  1L0V B;  1HXY D;  2WU2 B;  4ARC A;  4O1N A;  3Q8E A;  1VZ6 A;  4EE2 A;  2DWQ A;  1HA5 A;  2EKI A;  1IBX A;  3KQ4 A;  3B2G A;  1RFK A;  1SE3 A;  1VJK A;  3MHZ A;  1LO5 D;  3NVW A;  4LLG M;  1P7E A;  2WDQ B;  4JWU C;  3AEG B;  4KKJ A;  4B0E A;  4HKQ A;  2BYT A;  3NS1 A;  5D3D A;  2B76 B;  3E9S A;  3R2I A;  2TSS A;  4RGT A;  1FNU A;  1V1P A;  1OFF A;  1C76 A;  1I7H A;  1JW9 D;  3FIL B;  1QLB B;  4M0W A;  1MVK A;  1FO4 A;  3P4P B;  1YN4 A;  2LMC A;  2HTM E;  4NAM A;  3DWG C;  4A90 A;  1EM7 A;  3TEW A;  5G5H A;  2IGG A;  1C77 A;  1V1O A;  5D3I B;  4FXC A;  1DOY A;  3PZ7 A;  1XO3 A;  1RM6 C;  1KRH A;  4RFB A;  1UGJ A;  1F2R C;  1SIJ A;  2PLP A;  1SF0 A;  4L2Y A;  2IDY A;  1QT9 A;  1D6E C;  1FEH A;  1JAL A;  1L0Y B;  5FK9 C;  2CJO A;  2QIE B;  1OQQ A;  1NI3 A;  3AE7 B;  1ZXI A;  4C56 C;  1HZ6 A;  2QIL A;  1JWB D;  3EGR A;  3P4S B;  1FIQ A;  3AMZ A;  1MI0 A;  1TS2 A;  1ZDV A;  3E56 A;  3URY A;  1PGB A;  2WXG A;  2XNA C;  1AN8 A;  2N9K A;  1C79 A;  2WXQ A;  2DYO A;  4WAF A;  2QSD A;  1ZUD 2;  3P4Q B;  4P16 A;  1SB3 C;  2PVO D;  3BVG A;  2WNM A;  3Q8C A;  2W82 A;  3NRZ A;  3H8H A;  4YWG G;  5BMG A;  2PKO A;  4WWM A;  2OHF A;  2Y5C A;  2H89 B;  3ZQ4 A;  4GLS C;  2WXP A;  3HVZ A;  5I4D A;  2IJ0 A;  4IOI E;  2KAJ A;  4NZL B;  2W3S A;  2D5G A;  1K50 A;  1N61 A;  1TZO A;  2IGD A;  5EE3 A;  3N9Y C;  2E3T A;  3P1M A;  2WXH A;  2W3R A;  2ACZ B;  3AE9 B;  1N5X A;  2GB1 A;  2KN4 A;  2AQ1 B;  3GS2 A;  2LEK A;  1YMH E;  4ARI A;  1FD6 A;  1L5P A;  3B2F A;  3VRA B;  2JZP A;  4MM3 B;  2INN E;  4UDU C;  1L6U A;  1ET9 A;  4MAC A;  1QOA A;  4NJC A;  1MHH E;  1E0Z A;  2Y3A A;  1PGX A;  1T3Q A;  4GDL B;  2FBW B;  1FCC C;  2JQR B;  4DXF A;  3GP7 A;  1UNS A;  1TS4 A;  1J7A A;  1QOB A;  1TY0 A;  4D2K A;  3IT6 B;  2LUM A;  3BWU D;  1TS3 A;  3KWV A;  4KKI A;  2WXJ A;  1XLO A;  3HVD A;  3GB1 A;  2V3P A;  4JX1 C;  1EU4 A;  1PYW D;  3P42 A;  2JSV X;  4KGR A;  3T3N A;  1XCQ L;  1R7S A;  1I4H A;  2L1A A;  2INP E;  1XCT L;  2LGI A;  1UWM A;  3AM9 A;  1WRI A;  2ON8 A;  1NEN B;  1KFY B;  1RYJ A;  2VZK B;  1YNT E;  2RMM A;  1J7C A;  4YT0 B;  4KX6 B;  2FE8 A;  1MHX A;  1JWS D;  4KGS A;  3W2D A;  3PO0 A;  2N7J A;  1E7P B;  1WSP A;  2FUG 1;  3AE6 B;  3AE1 B;  1YJI A;  2WXM A;  5C2T B;  4XWW A;  1GAQ B;  4GDK B;  4TQ1 A;  2QJL A;  1AYF A;  3C8Y A;  1C4C A;  2BT6 A;  4WH4 A;  1L4Z B;  3WCQ A;  2GRI A;  3ZJV A;  1FFU A;  1NYR A;  1DOI A;  4JE3 B;  1TS5 A;  3W5V B;  1KLG D;  2YEP F;  3U52 E;  3TUO A;  1YN3 A;  2JX5 A;  4CQN A;  3VR9 B;  4PT5 A;  3AE5 B;  2MJD A;  4DQO C;  1I4X A;  4L23 A;  2Y5P A;  4OHJ A;  2LHE A;  1YQ3 B;  2WXK A;  5BMH A;  1AWD A;  1VLB A;  4RGN A;  5D7G A;  2I2Y A;  2N0S B;  1GPX A;  1NYQ A;  4AS1 A;  1L4D B;  2MEK A;  2G9H D;  4Q2J A;  1I4P A;  4RCO A;  3CWI A;  1HEZ E;  2IPK D;  2CJN A;  3TEZ A;  1FFV A;  4MT5 A;  1V1P B;  3NUH B;  2L83 A;  2RPV A;  4NAW B;  3BYY B;  3ZGZ A;  1SEB D;  1T6B X;  1T5X D;  3NVV A;  4USA A;  1VZ7 A;  3AEE B;  2I38 A;  4YTN B;  1GB1 A;  3ZYY X;  1SE4 A;  2RDG A;  1CJE A;  2ZW1 A;  3BVM A;  4A9A A;  3FC4 A;  1HZ5 A;  3FAH A;  5BYS A;  1DOX A;  1L6V A;  2WDV B;  1JML A;  2M0A A;  2N9L A;  2W55 A;  3P63 A;  5G5G A;  3U7Z A;  1DYQ A;  2XN9 C;  1C9F A;  5E6J A;  1QOF A;  5BYQ A;  3Q8A A;  2BTE A;  2K5P A;  2G1E A;  1XXG A;  4ZOH C;  3AEB B;  3NVZ A;  3IXS A;  4OZA A;  4ZYS A;  3O13 A;  3LXF A;  1UUP A;  1XLN A;  4C7Z A;  4XE0 A;  1C78 A;  1ZXH A;  1WYG A;  3HRD D;  1F0Z A;  1Q10 A;  2WU5 B;  1D5X C;  2WS3 B;  1IBX B;  1V97 A;  2K0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...