2JZPA

Nmr solution structure of kx5q protl mutant
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
MEEVTIKANLIFANGSTQTAEFQGTFEQATSEAYAYADTLKQDNGEWTVDVADQGYTLNIQFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Protein stabilization and the hofmeister effect: the role of hydrophobic solvation
pubmed doi rcsb
source organism Peptostreptococcus magnus
molecule tags Immune system
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2jzpA00
2GB1A 1QKZA 2JZPA 1HEZE 2J53A 2KACA 3FILA 3FILB 1Q10A 1F2RI 1YNTE 4HJGE 2IGGA 2QSDA 2ON8A 2RPVA 3GB1A 4KGTA 1K51A 1ZXHA 2LHDA 1PGXA 3MP9A 2IGDA 1IBXA 2I2YA 2JSVX 1D4BA 2JWUA 2ZW1A 4KGRA 5JXVA 2EELA 1K53A 1YMHE 1IGCA 2KN4A 2KDMA 2JU6X 4KGSA 1K52A 2LHEA 4OZAA 1GB1A 5HFYA 2KQ4X 1HZ5A 2KWDA 2N9LA 4MACA 1FCLA 1EM7A 1IGDA 5HG2A 1MHXA 2PLPA 1GB4A 1IBXB 1HZ6A 1MVKA 3UI3A 1FCCC 2ZW0A 1F2RC 1MI0A 4IKGA 4OZBA 2LGIA 1JMLA 5HI1A 2JXTA 2K0PA 1PGAA 5BMGA 4IOIE 4OZCA 2N9KA 4D2KA 2PW9A 1P7EA 2PTLA 2N7JA 2RMMA 1C9FA 1FD6A 4HKZE 1P7FA 1XF5L 2OEDA 4GLSC 2GI9A 2ONQA 1MHHE 2IGHA 5BMHA 2NMQA 1XCTL 1K50A 2QMTA 1KH0A 2J52A 5BMIA 2I38A 3V3XA 4WH4A 2LUMA 5HHDG 1XCQL 1MPEA 1UWXA 1PGBA
chains in the Genus database with same CATH superfamily
2KACA 4ZRPA 4HVBA 1KLGD 4J3OD 2W9NA 1CJEA 3P1MA 4KVGB 2KJHB 1V49A 2QSDA 4HDQA 2D07B 3DDCB 2SEBD 2J0MA 3GZNB 1Q1OA 1V81A 1Q0WB 3KLSX 4IUMB 3VUXA 4LNNA 2BW2A 1PGXA 2ICIA 1K8RB 3ETRA 2IJ0A 3AULA 2FCNA 1UD7A 2Y5CA 1P3QU 2W55A 1VJKA 1L7YA 5CHVC 4S17A 2Y5PA 1YN3A 4B9KA 3N1YC 4NY0A 2EMSA 3U7ZA 4BKGA 2KWDA 4C56C 2QHOA 3ML8A 1H4RA 3IAM1 1ISNA 4ZOHC 4NQKE 4JIOU 2WP9B 2DZJA 2M0AA 4WQMA 4EE2A 2L1AA 4HPPA 1HTQA 2NBUA 3NUHB 4XYCA 1PGAA 1LFDA 1R4MB 4CO7A 1J0GA 2JRIB 2LGDA 3QC8B 4AJYB 4PK1A 1VZ6A 1WXQA 4C00A 4ASWC 2QILA 1TZOA 4NJ6A 2LZ6A 4GMVA 1P7FA 2A4ZA 1DYQA 2DBYA 4EZLA 1MHHE 3B2FA 4LDTB 3CWIA 1WZ0A 1E7UA 1FFVA 1UNSA 1Y8RC 3M95A 4P1BC 4LCDE 4XGAB 2L0TA 4HDOA 3EUB2 2MJDA 4GDLA 4BOZB 2D10A 1D6EC 2HJ8A 3BVZA 2N1WA 4LJOB 2BTEA 2WXJA 1ZGUB 1LM8B 1N62A 1KLUD 2WNMA 2FAZA 4A3PA 3GZNI 4KIKA 2OOBB 4KDIC 1L4ZB 2JYEA 2N9PC 3RCZA 2INCC 3NRZA 3FILB 2J42A 5L83A 1L0VB 3WAMA 4II2B 4YTNB 2EKEC 1GPXA 3U8ZA 2WLBA 3VUWA 1OEYA 2DNFA 2MSED 5E6OA 2XNAC 1L0YB 3ZO5B 3BYYB 4ZHOA 2IO1B 3A9KA 2KVRA 1JWMD 1VDVA 4XC2A 3DQVA 2KN5A 2HDEA 4CHKA 2FE8A 2L7RA 2ZCBA 4EZKA 4NQLB 1NDDA 3ONSA 1WMHA 2JZZA 3PHWB 4TKNA 1WX8A 4WWNA 1R4MI 4B6WA 4IWOA 2L52A 3RN9C 4W9LA 3PS6A 2KZRA 2M1MA 1YN4A 3H8HA 5JH5C 3N9YC 4GIVA 5BMGA 2INPE 4TMAB 2J0JA 2LI5A 2JVCA 2Z0EB 1AYFA 2RGFA 3K9OB 3AEEB 3N3KB 2KWUB 4DXFA 1STEA 2G45B 2L00B 2CHZA 1WGHA 3X0WA 4YSXB 2K8HA 1N6ZA 2BYEA 1WXVA 4XZ4A 4MM3B 3IT4B 3H1UA 5D3IB 3QQ8B 5AZHA 1WJUA 3MTNB 4FHKA 4IM3A 2KNBA 4PS3A 5G2NA 3UQAA 3B2GA 1HEZE 1PYWD 4JX1C 1WWTA 2IY1B 4DK5A 4HEA1 2CJOA 3WANA 1C77A 4DHJD 3TCAA 2LRWA 1QOAA 2G4DB 1WZ3A 2Y5BB 1R7SA 2MHJA 1ZW7A 3H7PA 2WXQA 2IO0B 2M17A 3AE3B 1J7AA 1SJED 1EF1A 4KKIA 4W9IA 3AEBB 1QLBB 2GBJA 4RGOS 2G4SA 2NPTA 1AARA 4B0EA 3J9CA 4OW0A 2L05A 2RD0A 4WWOA 2J4XA 2KC2A 4MT5A 1N60A 2V9HA 3MJ5A 4PT5A 2NTSA 2IDYA 1TBEA 4OVUA 1TKYA 4NAWB 4K7WA 2YEPB 1L6VA 4P7IA 3ZUNA 2REXA 4PYZA 1QF6A 4LK0M 2JXTA 2ASQA 2LEKA 3BK1A 4XDCA 4ZRIA 1E8XA 1I4GA 3UF8A 5E6JA 4US8A 3VUYA 2ZVOA 4OVVA 3RNCC 5EE3A 2C7NB 3W5VB 1MFWA 1EF5A 2KO3A 1WX9A 2CHXA 2UU7A 1YX6B 2NMQA 3AU5A 4WQOB 3B08A 1K50A 1SE4A 2PKOA 2MJEA 2MWSB 1JRPA 1WM3A 4JPSA 1NYQA 1XCQL 3EFCA 2KMCA 4HJKA 1KM7A 4UDUC 3KYDD 2CS4A 2JZPA 1WJNA 2K8CA 1E9MA 3VRAB 4MJSA 2C9WB 3EGRA 3UGBB 2WQYB 2IGGA 4ANWA 3TMPB 2FNJB 2WXNA 3JSVB 1TZ1A 1I4XA 3DVGY 2AL6A 4J6IA 2I2YA 4RMAA 2FCQA 1C79A 5IN7A 1RM6C 3AE2B 5G5HA 1YJJA 4RF1A 2BYTA 1HZ5A 2IO2B 3LDZE 2WHIA 3Q3NC 2RDHA 3DHGC 3A9JB 1FMAD 4ZRKA 3WIMA 2PLPA 2DHZA 3B9JA 3SHQA 1FCCC 4FULA 1VRAB 2MH7A 2H88B 5IKCM 4GGQA 3N32A 1F9JA 1N63A 4MSMB 3GE3C 2K39A 4F1SA 1ET6A 2WXMA 1G6JA 1OQYA 1SE2A 2BKRB 1UUPA 3R7QA 2BYFA 4RGTA 4K3CA 2L76A 4OHJA 3CSTA 2YLMA 2W54A 4LNKA 2E6XA 1YQBA 2MBQA 4EZJA 1A70A 1MG8A 3DVGX 3AXCA 4N9F4 3RPFC 5LXHA 3ZDTA 1E8YA 3ZTDA 1FO4A 3ZLZA 4IWQA 3HVZA 3P4SB 2WXRA 2BF8B 3MC8A 2WYQA 4EUTA 2O2VB 4X57B 2HD5B 5E6NA 4IG7B 1UELA 3NZ3A 3B1LX 2LVQA 1P0RA 3RUIB 5CX3A 2LHDA 1I35A 1TKEA 3ZNID 1JWAD 1F77A 3W9CB 3WAOA 4P1CC 1YMHE 3PZ7A 3C8YA 1XLPA 5CHFA 2IY0B 1P9DU 3R3MA 2N1VA 3ECIA 4EKUA 3EA6A 4MH0E 1C3TA 1GC7A 3N1ZC 2CKHB 2IO3B 2GBRA 2O6VB 5JZEB 2K3UA 3HK0A 3VTUA 4N58A 3WAPA 3KYCD 1SBBB 3UI3A 1V86A 1MI0A 1PUTA 2L32A 3M63B 3CF6E 4XE0A 2PW9A 2XK5A 4C7ZA 5BYQA 5FR3A 1TS4A 4R3DA 3ZRFA 2N7JA 4C4VB 3ZVVA 4ARIA 4KV2A 3C19A 4FJYA 1H8CA 2M19A 3L17A 1XF5L 1TS5A 5KHOA 5DPWA 4FJVB 3Q8FA 3FKYA 3PHXB 1XXGA 1FNVA 1IP9A 2UYZB 3BIID 3VTVA 2K9XA 2G9HD 1T3QA 4GDLB 3AE1B 3LB8C 2QCZA 1E8WA 5HHDG 4W9FA 1MJDA 4BOSC 2MLBA 1L5PA 2KFKB 1WGKA 2IBIB 2AYOB 3DOWA 3DBHI 5MPOA 2HTHA 1WI0A 3L13A 3T9LA 2GBNA 1JROA 2M56B 2XN9C 1QOGA 1VZ8A 4NPNA 2KAJA 5C23A 1XEEA 1RLFA 4E71A 3B0AA 2JSVX 3A9KB 2JWUA 3ZYYX 4BFRA 2WXKA 3ZGZA 3W1YA 3PRPB 1K52A 4HK2A 1GB1A 3N1XC 1WF9A 2MA9B 2GBMA 2QEJC 1SEBD 3AECB 3R7RA 2PPHA 2KTFA 3MHSD 2BVCA 2KKCA 4YTPB 4NJCA 2EMTA 2WXIA 2QJLA 4E74A 4RFBA 4NZLB 3RNAC 3U52E 2H89B 3ZRCA 5FR6A 1YQ3B 2KQSA 1V1OA 2PMVA 2DZIA 1YJIA 2JXXA 1WXMA 3QHTA 3DWGC 3KH0A 3QA8A 1Z5SB 2WDQB 3NZSA 2D11A 4HROA 5BYRA 1ET9A 1NI2A 4RCOA 5J17A 2N0SB 5GMVA 2ZPYA 4BVUC 1AN8A 2CHWA 2WDVB 4Q2JA 1D5MC 4ACFA 3OJ3A 3RMKC 2LVOA 2K25A 3Q6BA 2LUMA 2L0FA 1D5ZC 4RM8A 2NBWB 1UWXA 3N30A 3VQIA 2D3BA 5IA7A 2AWTA 4M8MA 2W3SA 1QILA 1Q10A 4XDDA 1F52A 1CZPA 1RAXA 4W9EA 4MELA 1WX7A 3RZFA 3V60A 1ZPSA 2AQ3B 1ZXHA 3MHZA 2KFJA 3O65B 1N61A 1DOXA 2ZNVB 3PRMB 3L16A 4ANVA 3RT3B 3M62B 3ZW3A 2LHEA 4MGZE 1B9RA 3UQBA 2K6QA 4HWIB 2NS5A 1M94A 2BB6A 5BYSA 2MRPA 2WX1A 4M00A 5AUKA 2WU5B 4FXCA 4W9JA 1IBXB 4HKQA 1RYJA 4DXGA 1FFUA 3AM9A 3I57A 1WGDA 2D2QA 4WJOA 5C1ZA 4M0WB 2N9KA 1JRUA 2KDBA 2WDTB 2KDIA 3A1QA 3GP7A 1SE9A 1C9FA 3Q2AC 3VDZA 2M0XA 4GLSC 4CQNA 1P1AA 4S0RA 3AEFB 2KJRA 2AX5A 4K81A 5DCNA 3S2AA 4C80A 1RRBA 4I6NB 3V05A 2DLBA 1WM2A 1LQBA 1D5XC 2CU1A 4O1NA 1MPEA 2PVOD 4YTMB 1KF6B 3AE9B 2FCSA 4YSZB 3BVGA 4WWMA 4GSWA 1ZUD2 5DPTA 4DXAB 4AWJA 3WCQA 4GB9A 4NJ7A 1M4VA 2ON8A 1NEKB 1WR1A 4DWFA 3T8MA 4KGTA 1K51A 3TEYA 5JHBA 3LYYA 4AQ7A 2VRRB 2N7DA 1EU4A 3EFUA 1WYWB 4RGMA 2IGDA 5I4DA 3ZKJC 1XT9B 2W3RA 1OFFA 1S3SG 2K8BA 4ARCA 1QQRA 4WAAA 1LXDA 4KKJA 2KWCA 4B95A 2LASA 3FAHA 5FKAC 1ZKHA 2AEHA 4REZA 1GUAB 4ZHPA 1UWMA 3WALA 2ACZB 3ZIMA 3RNFC 4GDKB 3RZWC 2BPSA 1PQSA 1I42A 2PIAA 4URKA 1WYGA 3AEGB 2L3ZA 4OZBA 2LWPA 1OQRA 4OZCA 1E0ZA 4D2KA 2J7QB 3IT6B 4GU2A 2G1EA 1XQQA 4MH8A 3EC8A 4OVZA 1J7CA 3MC0B 2ZPNA 1KOTA 3CSFA 1V5OA 3R66C 4PS8A 1EU3A 1L2NA 1FXIA 2MJ3A 5BO4B 3TBLD 1WFYA 3DPDA 4ANXA 2R2OA 3RULA 3IBEA 3O13A 4YXDB 1QOBA 3E56A 3DVNU 3MC9A 4XX5A 5D6JB 2M4NA 2WXLA 1YD8U 5AZGA 3L0WB 2DYMA 4TQ1A 3NS8A 3ZJVA 2BT6A 4G3XB 3URYA 3IFWB 3Q8CA 2BKFA 2FIDA 3MP9A 2Y3AA 3M3JA 4PS7A 4TUUA 2D3GA 2JT4B 4KSLC 2CU3A 3DBSA 4DBGA 4L23A 1XLNA 1K53A 2LFIA 1JWUD 2KJ6A 2MBEA 2V4IB 3APCA 4IM2A 3QX1A 1KTKA 3R2IA 1UZXB 1IUEA 4MGYE 2C7HA 3RD2A 1RFKA 3ML9A 4ITKA 1AWDA 3AE6B 3PTFC 4BBNC 2X38A 1NBFC 3RNBC 5EE1A 3P63A 2IZVB 1U4AA 5HI1A 3PZDA 2K0PA 1UH6A 3Q8AA 3PLUA 4KX6B 4MM3A 3TUOA 4JL9A 4ICUA 4ZYSA 1CMXB 1GC6A 4E3CA 1L4DB 4LNFA 3ZXRA 1ZDVA 2JPHA 2KVZA 2X8XX 4W9GA 4LDTD 1WIAA 1P98A 5IOIA 3BY4B 1V9JA 1CK1A 4W9CA 2V3SA 2ONQA 4G11A 3NJTA 2KTRB 4HCNB 3VVWB 1OTRB 1TS3A 3NVVA 3JYUA 3A4SC 4RF0A 3BK2A 2J52A 3DBRB 3ZTCA 3V3XA 4AS1A 4YWGG 1TY2A 1FXAA 3Q69A 2TSSA 2GLSA 3NVYA 1PDXA 2INDC 2JUOA 2KK8A 2PVGC 2AQ2B 4JWUC 4ANUA 2Z0DB 1SJHD 5D94A 4HJGE 1TT5B 3BYTB 1WXSA 2M8SA 2ZVNA 4NAWA 2MBHA 4K3BA 1ENFA 1EO6A 3DWMA 3ENEA 2PE9A 4ICVA 2DZMA 2DX5B 1V5TA 1VR9A 1YOVB 3ABVB 4FBJB 2PEAA 3KW5B 1IYFA 2LD9A 2N9EB 3UINB 2JRHA 2OJRA 1V1PA 4IWPA 3VRBB 1Y56A 4K7SA 3T3NA 2BWES 3NHEB 1UBIA 3IG3A 1V80A 4IW0A 1JCKB 1J8CA 1NI3A 4K7UA 2JWZA 3SDLC 2NCNA 4RGNA 2N7EA 1I4RA 2KMAA 2MBBB 3VH3B 1NYRA 2LGIA 1FEHA 2ZNVC 2QDFA 4IOIE 3ALBA 3RNEC 3PRZA 4JE3B 2LGSA 3CIRB 4L2YA 1YX5B 3KUCB 4FN2A 5KHQA 5C3JB 5L95C 5DPSA 3OG5A 2GOWA 1SIFA 1S1QB 3C0RB 1WGGA 2MP2A 1WSPA 2QC8A 1SF0A 2V0GA 4MGIE 4MEMA 5LLIA 2WXGA 1V8CA 3JSVA 1T6BX 3BINA 5TSSA 1TIFA 5IO9A 3IAS1 2WDRB 4JQWC 1F2RI 2RDGA 2GMIC 4FJZA 4H2AA 1SIJA 1QZEA 3A9JA 2JZ3B 3ZNHB 1WJ4A 3DHHC 4A8XC 4DDID 1T0RC 2GRIA 2KOXA 1WRIA 4KIKB 4II3B 1HA5A 4IC7B 3HUIA 4AP4C 1CQVA 4KSKC 4RNAA 2V4LA 3I9V1 3NY5A 2YVCA 1I7HA 2KQ4X 3KQ4A 3HM6X 3R8BA 3PT2B 4JWSC 1KJTA 4LLGM 4W9KA 1EM7A 3TEXA 1WE6A 2KANA 2KQ7A 2WXPA 2PJHA 5D7GA 1FXTB 4HPMB 1WJ6A 2G3QB 1EWYC 1P7EA 1WMHB 3ZQ4A 2N4FA 4FHJA 1C76A 2ZEQA 3V6CB 1BT0A 4HRSA 4LJPB 3SFEB 3QCAA 2KXJA 3H7SA 3ZDMC 1X1MA 2FIFA 1TY0A 2O2VA 1JWBD 1VCBA 3I5JC 3OAWA 2BB5A 1VZ7A 2KWVB 3APFA 5LNK1 3GOEA 4WH4A 1WE7A 3TSSA 2CR5A 4ZYNA 4JLCA 3UIPB 1EWCA 4AJWA 1DOIA 4F7ZA 4WJNA 2R61A 3PLVA 1FM0D 3KWLA 1E7PB 1KRHA 2V3NA 4K1RB 2K5PA 2KYWA 3RI7C 1L0XB 2Z8LA 4A90A 3V62A 5IP4D 3P4RB 2UWQA 1ZP0B 3GB1A 2O6VA 1GG3A 3PVLA 4YL8A 1PFDA 3VAWA 1GAQB 3K9PB 3VTWA 2NR2A 5H8YE 1ZOYB 1I4HA 5D3DA 3OWEB 3L08A 3QWZB 2EELA 5JXVA 4LTUA 1IGCA 3AB5A 1XLOA 3QAQA 3BZDB 3W2DA 3KUZA 3PV1A 1WGYA 4WIPA 1GOZA 4C4VA 4EEWA 5AEKB 3E9SA 4M01A 4AUQC 3AI5A 3H7PB 1FIQA 4IM0A 1Q5WB 2IPKD 3NG0A 4WAFA 4C7YA 3D32A 4EFOA 1UF0A 4IKGA 4MGKE 5LXIB 2DAJA 4M8NA 1RWSA 2NPTB 3AEDB 1L6UA 3W1SC 2EKIA 1XLQA 2RMMA 2DYBA 3Q3FA 2N9XA 3CMMB 3Q8BA 4WWPA 1E8ZA 4HKZE 5J2RA 1MG4A 2KFKA 5DPRA 2KD0A 3VH4B 2B3AA 3JW0X 1SGHA 3Q3JA 1A5RA 3ZXVA 4PYUA 3H6NA 5BMHA 1RFAA 3BVMA 1OQQA 1KH0A 2LUEA 2I38A 4WURA 3X23A 5GXGB 3GS2A 1SXTA 2VZKB 4A6QA 5JHAA 2LGXA 3P42A 3LJ3A 1AW7A 1KLVA 2FUHB 4N59A 2V3PA 1YNTE 1R4NB 4ZRQA 3AU4A 2PE6B 3Q3MC 2KX0A 2KX3A 1DGJA 2RPVA 4BZAA 2D3AA 2KDFB 2I1JA 1C4PA 1Z2MA 4B0MA 2DZKA 1FNUA 3NOBA 3LXFA 4XWTA 2ZW1A 4KGRA 1HXYD 2KDEB 3KVFB 4KGSA 2O6VD 4MJSB 2AL3A 3QIJA 2R2QA 5AUIA 2JQRB 4TSSA 3APDA 1C4AA 3TEZA 1DOYA 4KZCA 2A5UA 3OLMD 1F1HA 1E10A 4W9DA 2INNE 5D2MB 1HZ6A 1JALA 2BBCA 1F2RC 2MX2A 3H9DA 4BKTA 2W82A 2WXOA 1T0SC 2PTLA 3RNGC 3V6EB 2HJ1A 2RSUA 1JWSD 4HPLB 1FD6A 3NVZA 5T8IA 3ZNGC 2LMCA 3VXWA 4A3OA 1TYGB 2IGHA 2K1FA 3AEAB 3VR9B 3T3OA 1J7BA 3DVNV 3R2TA 3RFZB 1NENB 2JYTA 1UGMA 3AE7B 3FC4A 3PSEB 2FCMA 2WWZA 4KZ0A 2BWFA 5BMIA 1YIWA 2MEKA 4HLEA 1R4NI 2Q5WD 2JF5A 1SE3A 3DBLB 2LVPA 5G5GA 2GB1A 3TL5A 1SSNA 1QKZA 1WGRA 4RM9A 2KLGA 2WXFA 2D5GA 2XBBC 3FILA 3IXSA 1T0YA 4DQOC 1T5XD 1IPGA 4BBNF 3P4QB 2KMMA 3SU8X 3NS1A 4NNJB 1WRDB 4QAYA 4DHZE 2L8JA 2NTTA 2WX0A 4LNIA 1HTOA 3V61A 5J18A 1UBQA 1BUIC 1TS2A 2I1KA 3AE8B 1ZDXA 1IBXA 3EECA 2WU2B 2KN4A 4YT0B 3L10B 4JGHB 1BMLC 4M0WA 2OHFA 2OJWA 3Q3OC 2RPQA 4A20A 3I63C 2MCNB 3VHTC 1V1PB 4GOCA 3RYTA 3QJZA 4BKSA 2N9LA 2K22A 4MACA 1FCLA 1N5WA 1D3ZA 5TR5A 2BS2B 1ESFA 1SB3C 3TJPA 2IYDB 2XEWA 3TIXA 1FNWA 1LGRA 4IDIA 2KC1A 3HM3A 4TV3A 3BWUD 2C5LC 2JX5A 2MQJA 1FPYA 2RDBC 2WXHA 3U4EG 4FADA 2FBWB 1E6EB 3L54A 4ZRJA 2LXCA 2OEDA 2GI9A 4EOYA 1C1YB 4F8CB 3W5UB 4HCPB 1NVID 2E3TA 3WA0A 2ZZPB 3DBLI 1XCTL 2MP2B 2Z59B 2XK5B 3U7DA 2BGFA 3A4RA 1XO3A 4G50A 4XWWA 2FUG1 1YQ4B 1V6EA 4W9HA 2HE7A 2CJNA 1VLBA 2LJIA 1LO5D 2WGSA 2BYVE 4GXBA 4DDGD 4RH6A 2LGYA 2MBOA 1E5WA 3PREA 1C4CA 3PZ8A 3PGEA 3EHVA 1WY8A 2DAFA 1T0QC 1QT9A 3PPAA 4GDKA 5C2TB 1D4BA 3AN1A 1I4PA 3KWVA 1JQ4A 3QARA 4AOFA 2KDMA 1WR6E 2JU6X 5IAAC 4I6LB 5HFYA 4L1BA 4I6PA 3P4PB 4P16A 3AV8A 1F0ZA 3NZUA 3Q14C 3SEBA 2B76B 2HTME 1IGDA 1MHXA 1OGWA 4MDKE 2SAKA 1GB4A 4MSQB 5AZFA 3IHPC 2ZW0A 3ZJTA 1WXAA 1JMLA 3PO0A 2DENB 4BKSD 2C60A 1V97A 2QIEB 1UGJA 1ACCA 2VZKD 4ZDVA 3JVZX 1TJEA 1V2YA 1XD3B 2K6DB 3AMZA 2VH1A 3I3TB 3NVWA 3A33B 1EUVB 1KFYB 4WJPA 3AE4B 3L4PA 3VR8B 2J0KA 2C7MB 3DHIC 2QMTA 3U30A 2MW5A 2BS4B 3DBHB 3GE8C 3MFGA 1OEYJ 5FK9C 2L83A 4KDLB 1HE8A 4GN1A 3HHMA 1E90A 4LNOA 1PGBA 2ZJDA 2D3CA 4M02A 1B1ZA 3DBRI 4YSYB 1GNUA 2KT7A 2J53A 3P2BA 2AQ1B 3QK0A 5CHWA 3W1SA 4A55A 5EDSA 3TEWA 1TKGA 1YN5A 1GJZA 1TTNA 4FLHA 2GBKA 2KLCA 4USAA 1ROEA 4N6EB 2RR9A 3ZNZB 3Q8EA 1BXTA 5H92C 4HXDA 2V1YA 2JY6A 2ZCCA 2LRUA 2DYOA 1FRRA 4BAXA 3HRDD 4OZAA 3N20C 4CYEA 4DHZB 1TGZB 3SR6A 1ZE3D 1N5XA 5EE9A 2WS3B 2LJ5A 3HVDA 5G55A 2BQQA 5HG2A 4DHJB 3SFDB 1JW9D 1J19A 2KTRA 1FRDA 3U2SC 1MVKA 2KHWB 5HKHA 5CTRC 1WH3A 1C78A 4WJQA 5EE0A 3HIZA 4A9AA 4NAMA 1ZXIA 1QOFA 2VH2A 4P6VF 5E6PA 3IVFA 3AH7A 3VFKA 1HQRD 4TQ0A 2NVUI 3KUDB 3MJWA 3UIOB 4FA6A 4G0NB 4US9A 2BS3B 2YEPF 2NBVB 1YJ1A 3OJ4B 2LXAA 3DCGA 3ZJUA 3AE5B 1VD2A 1E7VA 3A1QB 3SD5A 2DWQA 1I4QA
chains in the Genus database with same CATH topology
1QOBA 1SXTA 3GS2A 3HVZA 2VZKB 3E56A 2KACA 2WXRA 3P4SB 4ZRPA 4A6QA 1KLGD 3P42A 4J3OD 1CJEA 1AW7A 4N59A 3P1MA 2V3PA 1YNTE 2WXLA 2QSDA 4ZRQA 1DGJA 2DYMA 2RPVA 2SEBD 4TQ1A 3NZ3A 3ZJVA 2BT6A 3URYA 1C4PA 3KLSX 3Q8CA 4B0MA 2BW2A 1FNUA 2LHDA 1PGXA 1TKEA 1JWAD 1F77A 2ICIA 3ETRA 3MP9A 3W9CB 2Y3AA 2IJ0A 3LXFA 2CU3A 4XWTA 2ZW1A 4KGRA 1HXYD 2Y5CA 4L23A 1XLNA 1K53A 1YMHE 2LFIA 1JWUD 3PZ7A 3C8YA 2W55A 1XLPA 4KGSA 1VJKA 2V4IB 5AUIA 2JQRB 2Y5PA 1YN3A 3EA6A 1KTKA 3R2IA 3U7ZA 1IUEA 4TSSA 2KWDA 4C56C 3IAM1 1C4AA 3TEZA 1DOYA 4ZOHC 2WP9B 4WQMA 2K3UA 2M0AA 1E10A 1RFKA 4EE2A 4ITKA 1AWDA 2INNE 3AE6B 4N58A 1HZ6A 2X38A 1JALA 2BBCA 1SBBB 2L1AA 5EE1A 1F2RC 3UI3A 1MI0A 3P63A 2W82A 3NUHB 5HI1A 1PUTA 2WXOA 2K0PA 2L32A 1PGAA 3Q8AA 4XE0A 4KX6B 2PW9A 2PTLA 3TUOA 4C7ZA 5BYQA 1VZ6A 5FR3A 4ZYSA 1TS4A 1WXQA 4R3DA 1JWSD 1L4DB 2N7JA 2QILA 4ARIA 1ZDVA 1TZOA 1FD6A 3NVZA 5T8IA 2M19A 1P7FA 2LMCA 1CK1A 1XF5L 1TS5A 1DYQA 2ONQA 2DBYA 1MHHE 3B2FA 1TYGB 3Q8FA 2IGHA 3AEAB 3VR9B 3T3OA 3CWIA 1J7BA 3R2TA 1XXGA 3RFZB 1FNVA 1FFVA 1UNSA 1NENB 2JYTA 3AE7B 3BIID 3FC4A 2K9XA 1TS3A 3NVVA 2G9HD 1T3QA 4RF0A 3BK2A 3EUB2 2MJDA 4GDLB 2J52A 5BMIA 3AE1B 3V3XA 1D6EC 3LB8C 3BVZA 4AS1A 2MEKA 4YWGG 5HHDG 2BTEA 2WXJA 2Q5WD 1TY2A 1SE3A 1N62A 1FXAA 1KLUD 2WNMA 3Q69A 5G5GA 2GB1A 1SSNA 1L5PA 2TSSA 1QKZA 1PDXA 1WGKA 3NVYA 2PVGC 2WXFA 1L4ZB 2AQ2B 2JYEA 4JWUC 3NRZA 2D5GA 3FILA 3IXSA 3FILB 5MPOA 2J42A 4DQOC 1L0VB 1SJHD 1T5XD 4HJGE 3P4QB 4YTNB 1JROA 1GPXA 2KMMA 2M56B 2XN9C 3NS1A 3BYTB 2WLBA 1QOGA 1VZ8A 2KAJA 2NTTA 1XEEA 2XNAC 1L0YB 1ENFA 1BUIC 1TS2A 3BYYB 4ZHOA 3AE8B 1ZDXA 1IBXA 1JWMD 2JSVX 1VDVA 2JWUA 3ZYYX 2WXKA 3DWMA 3ZGZA 2WU2B 2HDEA 2KN4A 4YT0B 2FE8A 1BMLC 3ABVB 1VR9A 4M0WA 2OHFA 1K52A 1GB1A 2QEJC 1SEBD 1V1PA 1V1PB 3AECB 3VRBB 1Y56A 2N9LA 2K22A 3T3NA 4MACA 1FCLA 1N5WA 2L52A 4YTPB 1JCKB 4NJCA 1NI3A 4RGNA 2WXIA 2BS2B 1ESFA 1SB3C 1YN4A 2QJLA 4RFBA 3H8HA 1I4RA 1FNWA 4NZLB 3U52E 2H89B 3N9YC 1NYRA 4IDIA 2LGIA 1YQ3B 1FEHA 1V1OA 5BMGA 2PMVA 4IOIE 2INPE 3BWUD 4TMAB 1YJIA 2JX5A 2WXHA 4JE3B 3CIRB 3U4EG 4L2YA 3DWGC 2FBWB 2WDQB 1AYFA 5C3JB 1E6EB 4HROA 2OEDA 3AEEB 2GI9A 5BYRA 1ET9A 4RCOA 4DXFA 1STEA 3W5UB 2N0SB 1NVID 2E3TA 1AN8A 2WDVB 4Q2JA 4YSXB 1XCTL 1D5MC 1WSPA 4MM3B 3IT4B 1SF0A 2V0GA 5D3IB 1XO3A 2LUMA 4XWWA 2FUG1 2WXGA 1V8CA 1YQ4B 1D5ZC 1T6BX 2CJNA 5TSSA 1VLBA 2LJIA 1UWXA 3B2GA 3VQIA 1LO5D 1HEZE 1PYWD 4JX1C 1WWTA 4RH6A 2W3SA 1QILA 3IAS1 1Q10A 4HEA1 2WDRB 4XDDA 2CJOA 1F2RI 1CZPA 1C77A 1C4CA 2RDGA 1QOAA 3PZ8A 1R7SA 4H2AA 1SIJA 1ZPSA 3O13A 2AQ3B 2WXQA 1QT9A 3AE3B 1ZXHA 3MHZA 5C2TB 1J7AA 1SJED 4A8XC 4KKIA 1N61A 2GRIA 1D4BA 1DOXA 3AN1A 3AEBB 1WRIA 1HA5A 1I4PA 1QLBB 3HUIA 3KWVA 1JQ4A 2KDMA 1CQVA 4RGOS 2JU6X 4RNAA 2LHEA 4B0EA 5HFYA 3I9V1 3J9CA 4OW0A 4L1BA 1I7HA 2KQ4X 3KQ4A 3P4PB 1B9RA 3R8BA 4P16A 4JWSC 2J4XA 3AV8A 1F0ZA 4MT5A 1N60A 3MJ5A 2BB6A 4PT5A 2NTSA 5BYSA 3SEBA 2B76B 2HTME 2IDYA 4LLGM 1EM7A 1IGDA 1TKYA 4NAWB 5AUKA 1MHXA 2WU5B 3TEXA 2YEPB 4FXCA 2SAKA 1L6VA 1GB4A 1IBXB 2WXPA 1RYJA 4HKQA 4DXGA 1FFUA 2ZW0A 5D7GA 3ZJTA 3AM9A 1QF6A 3I57A 1JMLA 4LK0M 2JXTA 3PO0A 2LEKA 3BK1A 4XDCA 1EWYC 2N9KA 1P7EA 1V97A 2QIEB 1ACCA 1UGJA 1I4GA 2VZKD 3ZQ4A 3GP7A 1C9FA 1TJEA 1C76A 5E6JA 4US8A 4HRSA 4GLSC 3AMZA 5EE3A 3SFEB 4CQNA 3W5VB 3NVWA 3AEFB 2AX5A 1KFYB 1TY0A 1JWBD 2NMQA 4C80A 2BB5A 3AE4B 1VZ7A 3L4PA 3VR8B 1K50A 3V05A 2DLBA 1SE4A 2QMTA 1D5XC 2PKOA 2MJEA 5LNK1 2BS4B 3MFGA 4WH4A 5FK9C 3TSSA 1JRPA 2L83A 4JPSA 4O1NA 1NYQA 1XCQL 1MPEA 2PVOD 4YTMB 1KF6B 3AE9B 1EWCA 1PGBA 1DOIA 4UDUC 4YSZB 2R61A 3BVGA 1B1ZA 1FM0D 4YSYB 4WWMA 2JZPA 2J53A 1ZUD2 3KWLA 1E7PB 1E9MA 3VRAB 1KRHA 2AQ1B 3WCQA 2V3NA 4A55A 3W1SA 3TEWA 3EGRA 1TKGA 2K5PA 1YN5A 1M4VA 1L0XB 2WQYB 2Z8LA 2IGGA 4A90A 2ON8A 1NEKB 3P4RB 1ZP0B 3GB1A 4USAA 1ROEA 1K51A 4KGTA 4N6EB 3TEYA 3LYYA 4AQ7A 2WXNA 1PFDA 1EU4A 3Q8EA 1BXTA 1GAQB 1I4XA 4RGMA 5H92C 2IGDA 5I4DA 2I2YA 5H8YE 1ZOYB 1I4HA 5D3DA 2W3RA 3OWEB 1OFFA 5JXVA 2EELA 1C79A 1IGCA 3AB5A 4LTUA 2DYOA 1FRRA 1XLOA 1RM6C 1QQRA 3AE2B 4ARCA 3BZDB 4KKJA 3W2DA 3HRDD 4OZAA 4WIPA 5G5HA 1YJJA 3FAHA 5FKAC 4RF1A 2BYTA 1HZ5A 1GOZA 4REZA 3SR6A 1ZE3D 1N5XA 5EE9A 3E9SA 4ZHPA 2WS3B 2RDHA 3HVDA 1UWMA 1FMAD 5HG2A 3SFDB 1FIQA 2ACZB 2PLPA 1JW9D 2IPKD 4GDKB 4WAFA 1FRDA 3U2SC 1MVKA 4C7YA 2PIAA 3B9JA 1WYGA 1FCCC 3AEGB 4IKGA 4OZBA 1VRAB 1OQRA 2MH7A 2H88B 1C78A 1RWSA 4OZCA 5EE0A 1E0ZA 4A9AA 4D2KA 4NAMA 3AEDB 1ZXIA 1L6UA 1QOFA 1N63A 2EKIA 1XLQA 2RMMA 4P6VF 3IT6B 3Q8BA 4HKZE 1ET6A 2WXMA 1SE2A 2G1EA 3AH7A 4MH8A 1HQRD 1UUPA 4TQ0A 4OVZA 4RGTA 4OHJA 1J7CA 3MC0B 4US9A 5BMHA 1EU3A 2BS3B 1FXIA 2MJ3A 2YEPF 2W54A 3BVMA 2E6XA 1OQQA 1KH0A 1A70A 2I38A 3ZJUA 3AE5B 4WURA 2DWQA 3RPFC 1I4QA 4YXDB 1FO4A 5GXGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GB1 A;  1QKZ A;  2JZP A;  1HEZ E;  2J53 A;  2KAC A;  3FIL A;  3FIL B;  1Q10 A;  1F2R I;  1YNT E;  4HJG E;  2IGG A;  2QSD A;  2ON8 A;  2RPV A;  3GB1 A;  4KGT A;  1K51 A;  1ZXH A;  2LHD A;  1PGX A;  3MP9 A;  2IGD A;  1IBX A;  2I2Y A;  2JSV X;  1D4B A;  2JWU A;  2ZW1 A;  4KGR A;  5JXV A;  2EEL A;  1K53 A;  1YMH E;  1IGC A;  2KN4 A;  2KDM A;  2JU6 X;  4KGS A;  1K52 A;  2LHE A;  4OZA A;  1GB1 A;  5HFY A;  2KQ4 X;  1HZ5 A;  2KWD A;  2N9L A;  4MAC A;  1FCL A;  1EM7 A;  1IGD A;  5HG2 A;  1MHX A;  2PLP A;  1GB4 A;  1IBX B;  1HZ6 A;  1MVK A;  3UI3 A;  1FCC C;  2ZW0 A;  1F2R C;  1MI0 A;  4IKG A;  4OZB A;  2LGI A;  1JML A;  5HI1 A;  2JXT A;  2K0P A;  1PGA A;  5BMG A;  4IOI E;  4OZC A;  2N9K A;  4D2K A;  2PW9 A;  1P7E A;  2PTL A;  2N7J A;  2RMM A;  1C9F A;  1FD6 A;  4HKZ E;  1P7F A;  1XF5 L;  2OED A;  4GLS C;  2GI9 A;  2ONQ A;  1MHH E;  2IGH A;  5BMH A;  2NMQ A;  1XCT L;  1K50 A;  2QMT A;  1KH0 A;  2J52 A;  5BMI A;  2I38 A;  3V3X A;  4WH4 A;  2LUM A;  5HHD G;  1XCQ L;  1MPE A;  1UWX A;  1PGB A; 
#chains in the Genus database with same CATH topology
 2KAC A;  4ZRP A;  4HVB A;  1KLG D;  4J3O D;  2W9N A;  1CJE A;  3P1M A;  4KVG B;  2KJH B;  1V49 A;  2QSD A;  4HDQ A;  2D07 B;  3DDC B;  2SEB D;  2J0M A;  3GZN B;  1Q1O A;  1V81 A;  1Q0W B;  3KLS X;  4IUM B;  3VUX A;  4LNN A;  2BW2 A;  1PGX A;  2ICI A;  1K8R B;  3ETR A;  2IJ0 A;  3AUL A;  2FCN A;  1UD7 A;  2Y5C A;  1P3Q U;  2W55 A;  1VJK A;  1L7Y A;  5CHV C;  4S17 A;  2Y5P A;  1YN3 A;  4B9K A;  3N1Y C;  4NY0 A;  2EMS A;  3U7Z A;  4BKG A;  2KWD A;  4C56 C;  2QHO A;  3ML8 A;  1H4R A;  3IAM 1;  1ISN A;  4ZOH C;  4NQK E;  4JIO U;  2WP9 B;  2DZJ A;  2M0A A;  4WQM A;  4EE2 A;  2L1A A;  4HPP A;  1HTQ A;  2NBU A;  3NUH B;  4XYC A;  1PGA A;  1LFD A;  1R4M B;  4CO7 A;  1J0G A;  2JRI B;  2LGD A;  3QC8 B;  4AJY B;  4PK1 A;  1VZ6 A;  1WXQ A;  4C00 A;  4ASW C;  2QIL A;  1TZO A;  4NJ6 A;  2LZ6 A;  4GMV A;  1P7F A;  2A4Z A;  1DYQ A;  2DBY A;  4EZL A;  1MHH E;  3B2F A;  4LDT B;  3CWI A;  1WZ0 A;  1E7U A;  1FFV A;  1UNS A;  1Y8R C;  3M95 A;  4P1B C;  4LCD E;  4XGA B;  2L0T A;  4HDO A;  3EUB 2;  2MJD A;  4GDL A;  4BOZ B;  2D10 A;  1D6E C;  2HJ8 A;  3BVZ A;  2N1W A;  4LJO B;  2BTE A;  2WXJ A;  1ZGU B;  1LM8 B;  1N62 A;  1KLU D;  2WNM A;  2FAZ A;  4A3P A;  3GZN I;  4KIK A;  2OOB B;  4KDI C;  1L4Z B;  2JYE A;  2N9P C;  3RCZ A;  2INC C;  3NRZ A;  3FIL B;  2J42 A;  5L83 A;  1L0V B;  3WAM A;  4II2 B;  4YTN B;  2EKE C;  1GPX A;  3U8Z A;  2WLB A;  3VUW A;  1OEY A;  2DNF A;  2MSE D;  5E6O A;  2XNA C;  1L0Y B;  3ZO5 B;  3BYY B;  4ZHO A;  2IO1 B;  3A9K A;  2KVR A;  1JWM D;  1VDV A;  4XC2 A;  3DQV A;  2KN5 A;  2HDE A;  4CHK A;  2FE8 A;  2L7R A;  2ZCB A;  4EZK A;  4NQL B;  1NDD A;  3ONS A;  1WMH A;  2JZZ A;  3PHW B;  4TKN A;  1WX8 A;  4WWN A;  1R4M I;  4B6W A;  4IWO A;  2L52 A;  3RN9 C;  4W9L A;  3PS6 A;  2KZR A;  2M1M A;  1YN4 A;  3H8H A;  5JH5 C;  3N9Y C;  4GIV A;  5BMG A;  2INP E;  4TMA B;  2J0J A;  2LI5 A;  2JVC A;  2Z0E B;  1AYF A;  2RGF A;  3K9O B;  3AEE B;  3N3K B;  2KWU B;  4DXF A;  1STE A;  2G45 B;  2L00 B;  2CHZ A;  1WGH A;  3X0W A;  4YSX B;  2K8H A;  1N6Z A;  2BYE A;  1WXV A;  4XZ4 A;  4MM3 B;  3IT4 B;  3H1U A;  5D3I B;  3QQ8 B;  5AZH A;  1WJU A;  3MTN B;  4FHK A;  4IM3 A;  2KNB A;  4PS3 A;  5G2N A;  3UQA A;  3B2G A;  1HEZ E;  1PYW D;  4JX1 C;  1WWT A;  2IY1 B;  4DK5 A;  4HEA 1;  2CJO A;  3WAN A;  1C77 A;  4DHJ D;  3TCA A;  2LRW A;  1QOA A;  2G4D B;  1WZ3 A;  2Y5B B;  1R7S A;  2MHJ A;  1ZW7 A;  3H7P A;  2WXQ A;  2IO0 B;  2M17 A;  3AE3 B;  1J7A A;  1SJE D;  1EF1 A;  4KKI A;  4W9I A;  3AEB B;  1QLB B;  2GBJ A;  4RGO S;  2G4S A;  2NPT A;  1AAR A;  4B0E A;  3J9C A;  4OW0 A;  2L05 A;  2RD0 A;  4WWO A;  2J4X A;  2KC2 A;  4MT5 A;  1N60 A;  2V9H A;  3MJ5 A;  4PT5 A;  2NTS A;  2IDY A;  1TBE A;  4OVU A;  1TKY A;  4NAW B;  4K7W A;  2YEP B;  1L6V A;  4P7I A;  3ZUN A;  2REX A;  4PYZ A;  1QF6 A;  4LK0 M;  2JXT A;  2ASQ A;  2LEK A;  3BK1 A;  4XDC A;  4ZRI A;  1E8X A;  1I4G A;  3UF8 A;  5E6J A;  4US8 A;  3VUY A;  2ZVO A;  4OVV A;  3RNC C;  5EE3 A;  2C7N B;  3W5V B;  1MFW A;  1EF5 A;  2KO3 A;  1WX9 A;  2CHX A;  2UU7 A;  1YX6 B;  2NMQ A;  3AU5 A;  4WQO B;  3B08 A;  1K50 A;  1SE4 A;  2PKO A;  2MJE A;  2MWS B;  1JRP A;  1WM3 A;  4JPS A;  1NYQ A;  1XCQ L;  3EFC A;  2KMC A;  4HJK A;  1KM7 A;  4UDU C;  3KYD D;  2CS4 A;  2JZP A;  1WJN A;  2K8C A;  1E9M A;  3VRA B;  4MJS A;  2C9W B;  3EGR A;  3UGB B;  2WQY B;  2IGG A;  4ANW A;  3TMP B;  2FNJ B;  2WXN A;  3JSV B;  1TZ1 A;  1I4X A;  3DVG Y;  2AL6 A;  4J6I A;  2I2Y A;  4RMA A;  2FCQ A;  1C79 A;  5IN7 A;  1RM6 C;  3AE2 B;  5G5H A;  1YJJ A;  4RF1 A;  2BYT A;  1HZ5 A;  2IO2 B;  3LDZ E;  2WHI A;  3Q3N C;  2RDH A;  3DHG C;  3A9J B;  1FMA D;  4ZRK A;  3WIM A;  2PLP A;  2DHZ A;  3B9J A;  3SHQ A;  1FCC C;  4FUL A;  1VRA B;  2MH7 A;  2H88 B;  5IKC M;  4GGQ A;  3N32 A;  1F9J A;  1N63 A;  4MSM B;  3GE3 C;  2K39 A;  4F1S A;  1ET6 A;  2WXM A;  1G6J A;  1OQY A;  1SE2 A;  2BKR B;  1UUP A;  3R7Q A;  2BYF A;  4RGT A;  4K3C A;  2L76 A;  4OHJ A;  3CST A;  2YLM A;  2W54 A;  4LNK A;  2E6X A;  1YQB A;  2MBQ A;  4EZJ A;  1A70 A;  1MG8 A;  3DVG X;  3AXC A;  4N9F 4;  3RPF C;  5LXH A;  3ZDT A;  1E8Y A;  3ZTD A;  1FO4 A;  3ZLZ A;  4IWQ A;  3HVZ A;  3P4S B;  2WXR A;  2BF8 B;  3MC8 A;  2WYQ A;  4EUT A;  2O2V B;  4X57 B;  2HD5 B;  5E6N A;  4IG7 B;  1UEL A;  3NZ3 A;  3B1L X;  2LVQ A;  1P0R A;  3RUI B;  5CX3 A;  2LHD A;  1I35 A;  1TKE A;  3ZNI D;  1JWA D;  1F77 A;  3W9C B;  3WAO A;  4P1C C;  1YMH E;  3PZ7 A;  3C8Y A;  1XLP A;  5CHF A;  2IY0 B;  1P9D U;  3R3M A;  2N1V A;  3ECI A;  4EKU A;  3EA6 A;  4MH0 E;  1C3T A;  1GC7 A;  3N1Z C;  2CKH B;  2IO3 B;  2GBR A;  2O6V B;  5JZE B;  2K3U A;  3HK0 A;  3VTU A;  4N58 A;  3WAP A;  3KYC D;  1SBB B;  3UI3 A;  1V86 A;  1MI0 A;  1PUT A;  2L32 A;  3M63 B;  3CF6 E;  4XE0 A;  2PW9 A;  2XK5 A;  4C7Z A;  5BYQ A;  5FR3 A;  1TS4 A;  4R3D A;  3ZRF A;  2N7J A;  4C4V B;  3ZVV A;  4ARI A;  4KV2 A;  3C19 A;  4FJY A;  1H8C A;  2M19 A;  3L17 A;  1XF5 L;  1TS5 A;  5KHO A;  5DPW A;  4FJV B;  3Q8F A;  3FKY A;  3PHX B;  1XXG A;  1FNV A;  1IP9 A;  2UYZ B;  3BII D;  3VTV A;  2K9X A;  2G9H D;  1T3Q A;  4GDL B;  3AE1 B;  3LB8 C;  2QCZ A;  1E8W A;  5HHD G;  4W9F A;  1MJD A;  4BOS C;  2MLB A;  1L5P A;  2KFK B;  1WGK A;  2IBI B;  2AYO B;  3DOW A;  3DBH I;  5MPO A;  2HTH A;  1WI0 A;  3L13 A;  3T9L A;  2GBN A;  1JRO A;  2M56 B;  2XN9 C;  1QOG A;  1VZ8 A;  4NPN A;  2KAJ A;  5C23 A;  1XEE A;  1RLF A;  4E71 A;  3B0A A;  2JSV X;  3A9K B;  2JWU A;  3ZYY X;  4BFR A;  2WXK A;  3ZGZ A;  3W1Y A;  3PRP B;  1K52 A;  4HK2 A;  1GB1 A;  3N1X C;  1WF9 A;  2MA9 B;  2GBM A;  2QEJ C;  1SEB D;  3AEC B;  3R7R A;  2PPH A;  2KTF A;  3MHS D;  2BVC A;  2KKC A;  4YTP B;  4NJC A;  2EMT A;  2WXI A;  2QJL A;  4E74 A;  4RFB A;  4NZL B;  3RNA C;  3U52 E;  2H89 B;  3ZRC A;  5FR6 A;  1YQ3 B;  2KQS A;  1V1O A;  2PMV A;  2DZI A;  1YJI A;  2JXX A;  1WXM A;  3QHT A;  3DWG C;  3KH0 A;  3QA8 A;  1Z5S B;  2WDQ B;  3NZS A;  2D11 A;  4HRO A;  5BYR A;  1ET9 A;  1NI2 A;  4RCO A;  5J17 A;  2N0S B;  5GMV A;  2ZPY A;  4BVU C;  1AN8 A;  2CHW A;  2WDV B;  4Q2J A;  1D5M C;  4ACF A;  3OJ3 A;  3RMK C;  2LVO A;  2K25 A;  3Q6B A;  2LUM A;  2L0F A;  1D5Z C;  4RM8 A;  2NBW B;  1UWX A;  3N30 A;  3VQI A;  2D3B A;  5IA7 A;  2AWT A;  4M8M A;  2W3S A;  1QIL A;  1Q10 A;  4XDD A;  1F52 A;  1CZP A;  1RAX A;  4W9E A;  4MEL A;  1WX7 A;  3RZF A;  3V60 A;  1ZPS A;  2AQ3 B;  1ZXH A;  3MHZ A;  2KFJ A;  3O65 B;  1N61 A;  1DOX A;  2ZNV B;  3PRM B;  3L16 A;  4ANV A;  3RT3 B;  3M62 B;  3ZW3 A;  2LHE A;  4MGZ E;  1B9R A;  3UQB A;  2K6Q A;  4HWI B;  2NS5 A;  1M94 A;  2BB6 A;  5BYS A;  2MRP A;  2WX1 A;  4M00 A;  5AUK A;  2WU5 B;  4FXC A;  4W9J A;  1IBX B;  4HKQ A;  1RYJ A;  4DXG A;  1FFU A;  3AM9 A;  3I57 A;  1WGD A;  2D2Q A;  4WJO A;  5C1Z A;  4M0W B;  2N9K A;  1JRU A;  2KDB A;  2WDT B;  2KDI A;  3A1Q A;  3GP7 A;  1SE9 A;  1C9F A;  3Q2A C;  3VDZ A;  2M0X A;  4GLS C;  4CQN A;  1P1A A;  4S0R A;  3AEF B;  2KJR A;  2AX5 A;  4K81 A;  5DCN A;  3S2A A;  4C80 A;  1RRB A;  4I6N B;  3V05 A;  2DLB A;  1WM2 A;  1LQB A;  1D5X C;  2CU1 A;  4O1N A;  1MPE A;  2PVO D;  4YTM B;  1KF6 B;  3AE9 B;  2FCS A;  4YSZ B;  3BVG A;  4WWM A;  4GSW A;  1ZUD 2;  5DPT A;  4DXA B;  4AWJ A;  3WCQ A;  4GB9 A;  4NJ7 A;  1M4V A;  2ON8 A;  1NEK B;  1WR1 A;  4DWF A;  3T8M A;  4KGT A;  1K51 A;  3TEY A;  5JHB A;  3LYY A;  4AQ7 A;  2VRR B;  2N7D A;  1EU4 A;  3EFU A;  1WYW B;  4RGM A;  2IGD A;  5I4D A;  3ZKJ C;  1XT9 B;  2W3R A;  1OFF A;  1S3S G;  2K8B A;  4ARC A;  1QQR A;  4WAA A;  1LXD A;  4KKJ A;  2KWC A;  4B95 A;  2LAS A;  3FAH A;  5FKA C;  1ZKH A;  2AEH A;  4REZ A;  1GUA B;  4ZHP A;  1UWM A;  3WAL A;  2ACZ B;  3ZIM A;  3RNF C;  4GDK B;  3RZW C;  2BPS A;  1PQS A;  1I42 A;  2PIA A;  4URK A;  1WYG A;  3AEG B;  2L3Z A;  4OZB A;  2LWP A;  1OQR A;  4OZC A;  1E0Z A;  4D2K A;  2J7Q B;  3IT6 B;  4GU2 A;  2G1E A;  1XQQ A;  4MH8 A;  3EC8 A;  4OVZ A;  1J7C A;  3MC0 B;  2ZPN A;  1KOT A;  3CSF A;  1V5O A;  3R66 C;  4PS8 A;  1EU3 A;  1L2N A;  1FXI A;  2MJ3 A;  5BO4 B;  3TBL D;  1WFY A;  3DPD A;  4ANX A;  2R2O A;  3RUL A;  3IBE A;  3O13 A;  4YXD B;  1QOB A;  3E56 A;  3DVN U;  3MC9 A;  4XX5 A;  5D6J B;  2M4N A;  2WXL A;  1YD8 U;  5AZG A;  3L0W B;  2DYM A;  4TQ1 A;  3NS8 A;  3ZJV A;  2BT6 A;  4G3X B;  3URY A;  3IFW B;  3Q8C A;  2BKF A;  2FID A;  3MP9 A;  2Y3A A;  3M3J A;  4PS7 A;  4TUU A;  2D3G A;  2JT4 B;  4KSL C;  2CU3 A;  3DBS A;  4DBG A;  4L23 A;  1XLN A;  1K53 A;  2LFI A;  1JWU D;  2KJ6 A;  2MBE A;  2V4I B;  3APC A;  4IM2 A;  3QX1 A;  1KTK A;  3R2I A;  1UZX B;  1IUE A;  4MGY E;  2C7H A;  3RD2 A;  1RFK A;  3ML9 A;  4ITK A;  1AWD A;  3AE6 B;  3PTF C;  4BBN C;  2X38 A;  1NBF C;  3RNB C;  5EE1 A;  3P63 A;  2IZV B;  1U4A A;  5HI1 A;  3PZD A;  2K0P A;  1UH6 A;  3Q8A A;  3PLU A;  4KX6 B;  4MM3 A;  3TUO A;  4JL9 A;  4ICU A;  4ZYS A;  1CMX B;  1GC6 A;  4E3C A;  1L4D B;  4LNF A;  3ZXR A;  1ZDV A;  2JPH A;  2KVZ A;  2X8X X;  4W9G A;  4LDT D;  1WIA A;  1P98 A;  5IOI A;  3BY4 B;  1V9J A;  1CK1 A;  4W9C A;  2V3S A;  2ONQ A;  4G11 A;  3NJT A;  2KTR B;  4HCN B;  3VVW B;  1OTR B;  1TS3 A;  3NVV A;  3JYU A;  3A4S C;  4RF0 A;  3BK2 A;  2J52 A;  3DBR B;  3ZTC A;  3V3X A;  4AS1 A;  4YWG G;  1TY2 A;  1FXA A;  3Q69 A;  2TSS A;  2GLS A;  3NVY A;  1PDX A;  2IND C;  2JUO A;  2KK8 A;  2PVG C;  2AQ2 B;  4JWU C;  4ANU A;  2Z0D B;  1SJH D;  5D94 A;  4HJG E;  1TT5 B;  3BYT B;  1WXS A;  2M8S A;  2ZVN A;  4NAW A;  2MBH A;  4K3B A;  1ENF A;  1EO6 A;  3DWM A;  3ENE A;  2PE9 A;  4ICV A;  2DZM A;  2DX5 B;  1V5T A;  1VR9 A;  1YOV B;  3ABV B;  4FBJ B;  2PEA A;  3KW5 B;  1IYF A;  2LD9 A;  2N9E B;  3UIN B;  2JRH A;  2OJR A;  1V1P A;  4IWP A;  3VRB B;  1Y56 A;  4K7S A;  3T3N A;  2BWE S;  3NHE B;  1UBI A;  3IG3 A;  1V80 A;  4IW0 A;  1JCK B;  1J8C A;  1NI3 A;  4K7U A;  2JWZ A;  3SDL C;  2NCN A;  4RGN A;  2N7E A;  1I4R A;  2KMA A;  2MBB B;  3VH3 B;  1NYR A;  2LGI A;  1FEH A;  2ZNV C;  2QDF A;  4IOI E;  3ALB A;  3RNE C;  3PRZ A;  4JE3 B;  2LGS A;  3CIR B;  4L2Y A;  1YX5 B;  3KUC B;  4FN2 A;  5KHQ A;  5C3J B;  5L95 C;  5DPS A;  3OG5 A;  2GOW A;  1SIF A;  1S1Q B;  3C0R B;  1WGG A;  2MP2 A;  1WSP A;  2QC8 A;  1SF0 A;  2V0G A;  4MGI E;  4MEM A;  5LLI A;  2WXG A;  1V8C A;  3JSV A;  1T6B X;  3BIN A;  5TSS A;  1TIF A;  5IO9 A;  3IAS 1;  2WDR B;  4JQW C;  1F2R I;  2RDG A;  2GMI C;  4FJZ A;  4H2A A;  1SIJ A;  1QZE A;  3A9J A;  2JZ3 B;  3ZNH B;  1WJ4 A;  3DHH C;  4A8X C;  4DDI D;  1T0R C;  2GRI A;  2KOX A;  1WRI A;  4KIK B;  4II3 B;  1HA5 A;  4IC7 B;  3HUI A;  4AP4 C;  1CQV A;  4KSK C;  4RNA A;  2V4L A;  3I9V 1;  3NY5 A;  2YVC A;  1I7H A;  2KQ4 X;  3KQ4 A;  3HM6 X;  3R8B A;  3PT2 B;  4JWS C;  1KJT A;  4LLG M;  4W9K A;  1EM7 A;  3TEX A;  1WE6 A;  2KAN A;  2KQ7 A;  2WXP A;  2PJH A;  5D7G A;  1FXT B;  4HPM B;  1WJ6 A;  2G3Q B;  1EWY C;  1P7E A;  1WMH B;  3ZQ4 A;  2N4F A;  4FHJ A;  1C76 A;  2ZEQ A;  3V6C B;  1BT0 A;  4HRS A;  4LJP B;  3SFE B;  3QCA A;  2KXJ A;  3H7S A;  3ZDM C;  1X1M A;  2FIF A;  1TY0 A;  2O2V A;  1JWB D;  1VCB A;  3I5J C;  3OAW A;  2BB5 A;  1VZ7 A;  2KWV B;  3APF A;  5LNK 1;  3GOE A;  4WH4 A;  1WE7 A;  3TSS A;  2CR5 A;  4ZYN A;  4JLC A;  3UIP B;  1EWC A;  4AJW A;  1DOI A;  4F7Z A;  4WJN A;  2R61 A;  3PLV A;  1FM0 D;  3KWL A;  1E7P B;  1KRH A;  2V3N A;  4K1R B;  2K5P A;  2KYW A;  3RI7 C;  1L0X B;  2Z8L A;  4A90 A;  3V62 A;  5IP4 D;  3P4R B;  2UWQ A;  1ZP0 B;  3GB1 A;  2O6V A;  1GG3 A;  3PVL A;  4YL8 A;  1PFD A;  3VAW A;  1GAQ B;  3K9P B;  3VTW A;  2NR2 A;  5H8Y E;  1ZOY B;  1I4H A;  5D3D A;  3OWE B;  3L08 A;  3QWZ B;  2EEL A;  5JXV A;  4LTU A;  1IGC A;  3AB5 A;  1XLO A;  3QAQ A;  3BZD B;  3W2D A;  3KUZ A;  3PV1 A;  1WGY A;  4WIP A;  1GOZ A;  4C4V A;  4EEW A;  5AEK B;  3E9S A;  4M01 A;  4AUQ C;  3AI5 A;  3H7P B;  1FIQ A;  4IM0 A;  1Q5W B;  2IPK D;  3NG0 A;  4WAF A;  4C7Y A;  3D32 A;  4EFO A;  1UF0 A;  4IKG A;  4MGK E;  5LXI B;  2DAJ A;  4M8N A;  1RWS A;  2NPT B;  3AED B;  1L6U A;  3W1S C;  2EKI A;  1XLQ A;  2RMM A;  2DYB A;  3Q3F A;  2N9X A;  3CMM B;  3Q8B A;  4WWP A;  1E8Z A;  4HKZ E;  5J2R A;  1MG4 A;  2KFK A;  5DPR A;  2KD0 A;  3VH4 B;  2B3A A;  3JW0 X;  1SGH A;  3Q3J A;  1A5R A;  3ZXV A;  4PYU A;  3H6N A;  5BMH A;  1RFA A;  3BVM A;  1OQQ A;  1KH0 A;  2LUE A;  2I38 A;  4WUR A;  3X23 A;  5GXG B;  3GS2 A;  1SXT A;  2VZK B;  4A6Q A;  5JHA A;  2LGX A;  3P42 A;  3LJ3 A;  1AW7 A;  1KLV A;  2FUH B;  4N59 A;  2V3P A;  1YNT E;  1R4N B;  4ZRQ A;  3AU4 A;  2PE6 B;  3Q3M C;  2KX0 A;  2KX3 A;  1DGJ A;  2RPV A;  4BZA A;  2D3A A;  2KDF B;  2I1J A;  1C4P A;  1Z2M A;  4B0M A;  2DZK A;  1FNU A;  3NOB A;  3LXF A;  4XWT A;  2ZW1 A;  4KGR A;  1HXY D;  2KDE B;  3KVF B;  4KGS A;  2O6V D;  4MJS B;  2AL3 A;  3QIJ A;  2R2Q A;  5AUI A;  2JQR B;  4TSS A;  3APD A;  1C4A A;  3TEZ A;  1DOY A;  4KZC A;  2A5U A;  3OLM D;  1F1H A;  1E10 A;  4W9D A;  2INN E;  5D2M B;  1HZ6 A;  1JAL A;  2BBC A;  1F2R C;  2MX2 A;  3H9D A;  4BKT A;  2W82 A;  2WXO A;  1T0S C;  2PTL A;  3RNG C;  3V6E B;  2HJ1 A;  2RSU A;  1JWS D;  4HPL B;  1FD6 A;  3NVZ A;  5T8I A;  3ZNG C;  2LMC A;  3VXW A;  4A3O A;  1TYG B;  2IGH A;  2K1F A;  3AEA B;  3VR9 B;  3T3O A;  1J7B A;  3DVN V;  3R2T A;  3RFZ B;  1NEN B;  2JYT A;  1UGM A;  3AE7 B;  3FC4 A;  3PSE B;  2FCM A;  2WWZ A;  4KZ0 A;  2BWF A;  5BMI A;  1YIW A;  2MEK A;  4HLE A;  1R4N I;  2Q5W D;  2JF5 A;  1SE3 A;  3DBL B;  2LVP A;  5G5G A;  2GB1 A;  3TL5 A;  1SSN A;  1QKZ A;  1WGR A;  4RM9 A;  2KLG A;  2WXF A;  2D5G A;  2XBB C;  3FIL A;  3IXS A;  1T0Y A;  4DQO C;  1T5X D;  1IPG A;  4BBN F;  3P4Q B;  2KMM A;  3SU8 X;  3NS1 A;  4NNJ B;  1WRD B;  4QAY A;  4DHZ E;  2L8J A;  2NTT A;  2WX0 A;  4LNI A;  1HTO A;  3V61 A;  5J18 A;  1UBQ A;  1BUI C;  1TS2 A;  2I1K A;  3AE8 B;  1ZDX A;  1IBX A;  3EEC A;  2WU2 B;  2KN4 A;  4YT0 B;  3L10 B;  4JGH B;  1BML C;  4M0W A;  2OHF A;  2OJW A;  3Q3O C;  2RPQ A;  4A20 A;  3I63 C;  2MCN B;  3VHT C;  1V1P B;  4GOC A;  3RYT A;  3QJZ A;  4BKS A;  2N9L A;  2K22 A;  4MAC A;  1FCL A;  1N5W A;  1D3Z A;  5TR5 A;  2BS2 B;  1ESF A;  1SB3 C;  3TJP A;  2IYD B;  2XEW A;  3TIX A;  1FNW A;  1LGR A;  4IDI A;  2KC1 A;  3HM3 A;  4TV3 A;  3BWU D;  2C5L C;  2JX5 A;  2MQJ A;  1FPY A;  2RDB C;  2WXH A;  3U4E G;  4FAD A;  2FBW B;  1E6E B;  3L54 A;  4ZRJ A;  2LXC A;  2OED A;  2GI9 A;  4EOY A;  1C1Y B;  4F8C B;  3W5U B;  4HCP B;  1NVI D;  2E3T A;  3WA0 A;  2ZZP B;  3DBL I;  1XCT L;  2MP2 B;  2Z59 B;  2XK5 B;  3U7D A;  2BGF A;  3A4R A;  1XO3 A;  4G50 A;  4XWW A;  2FUG 1;  1YQ4 B;  1V6E A;  4W9H A;  2HE7 A;  2CJN A;  1VLB A;  2LJI A;  1LO5 D;  2WGS A;  2BYV E;  4GXB A;  4DDG D;  4RH6 A;  2LGY A;  2MBO A;  1E5W A;  3PRE A;  1C4C A;  3PZ8 A;  3PGE A;  3EHV A;  1WY8 A;  2DAF A;  1T0Q C;  1QT9 A;  3PPA A;  4GDK A;  5C2T B;  1D4B A;  3AN1 A;  1I4P A;  3KWV A;  1JQ4 A;  3QAR A;  4AOF A;  2KDM A;  1WR6 E;  2JU6 X;  5IAA C;  4I6L B;  5HFY A;  4L1B A;  4I6P A;  3P4P B;  4P16 A;  3AV8 A;  1F0Z A;  3NZU A;  3Q14 C;  3SEB A;  2B76 B;  2HTM E;  1IGD A;  1MHX A;  1OGW A;  4MDK E;  2SAK A;  1GB4 A;  4MSQ B;  5AZF A;  3IHP C;  2ZW0 A;  3ZJT A;  1WXA A;  1JML A;  3PO0 A;  2DEN B;  4BKS D;  2C60 A;  1V97 A;  2QIE B;  1UGJ A;  1ACC A;  2VZK D;  4ZDV A;  3JVZ X;  1TJE A;  1V2Y A;  1XD3 B;  2K6D B;  3AMZ A;  2VH1 A;  3I3T B;  3NVW A;  3A33 B;  1EUV B;  1KFY B;  4WJP A;  3AE4 B;  3L4P A;  3VR8 B;  2J0K A;  2C7M B;  3DHI C;  2QMT A;  3U30 A;  2MW5 A;  2BS4 B;  3DBH B;  3GE8 C;  3MFG A;  1OEY J;  5FK9 C;  2L83 A;  4KDL B;  1HE8 A;  4GN1 A;  3HHM A;  1E90 A;  4LNO A;  1PGB A;  2ZJD A;  2D3C A;  4M02 A;  1B1Z A;  3DBR I;  4YSY B;  1GNU A;  2KT7 A;  2J53 A;  3P2B A;  2AQ1 B;  3QK0 A;  5CHW A;  3W1S A;  4A55 A;  5EDS A;  3TEW A;  1TKG A;  1YN5 A;  1GJZ A;  1TTN A;  4FLH A;  2GBK A;  2KLC A;  4USA A;  1ROE A;  4N6E B;  2RR9 A;  3ZNZ B;  3Q8E A;  1BXT A;  5H92 C;  4HXD A;  2V1Y A;  2JY6 A;  2ZCC A;  2LRU A;  2DYO A;  1FRR A;  4BAX A;  3HRD D;  4OZA A;  3N20 C;  4CYE A;  4DHZ B;  1TGZ B;  3SR6 A;  1ZE3 D;  1N5X A;  5EE9 A;  2WS3 B;  2LJ5 A;  3HVD A;  5G55 A;  2BQQ A;  5HG2 A;  4DHJ B;  3SFD B;  1JW9 D;  1J19 A;  2KTR A;  1FRD A;  3U2S C;  1MVK A;  2KHW B;  5HKH A;  5CTR C;  1WH3 A;  1C78 A;  4WJQ A;  5EE0 A;  3HIZ A;  4A9A A;  4NAM A;  1ZXI A;  1QOF A;  2VH2 A;  4P6V F;  5E6P A;  3IVF A;  3AH7 A;  3VFK A;  1HQR D;  4TQ0 A;  2NVU I;  3KUD B;  3MJW A;  3UIO B;  4FA6 A;  4G0N B;  4US9 A;  2BS3 B;  2YEP F;  2NBV B;  1YJ1 A;  3OJ4 B;  2LXA A;  3DCG A;  3ZJU A;  3AE5 B;  1VD2 A;  1E7V A;  3A1Q B;  3SD5 A;  2DWQ A;  1I4Q A; 
#chains in the Genus database with same CATH homology
 1QOB A;  1SXT A;  3GS2 A;  3HVZ A;  2VZK B;  3E56 A;  2KAC A;  2WXR A;  3P4S B;  4ZRP A;  4A6Q A;  1KLG D;  3P42 A;  4J3O D;  1CJE A;  1AW7 A;  4N59 A;  3P1M A;  2V3P A;  1YNT E;  2WXL A;  2QSD A;  4ZRQ A;  1DGJ A;  2DYM A;  2RPV A;  2SEB D;  4TQ1 A;  3NZ3 A;  3ZJV A;  2BT6 A;  3URY A;  1C4P A;  3KLS X;  3Q8C A;  4B0M A;  2BW2 A;  1FNU A;  2LHD A;  1PGX A;  1TKE A;  1JWA D;  1F77 A;  2ICI A;  3ETR A;  3MP9 A;  3W9C B;  2Y3A A;  2IJ0 A;  3LXF A;  2CU3 A;  4XWT A;  2ZW1 A;  4KGR A;  1HXY D;  2Y5C A;  4L23 A;  1XLN A;  1K53 A;  1YMH E;  2LFI A;  1JWU D;  3PZ7 A;  3C8Y A;  2W55 A;  1XLP A;  4KGS A;  1VJK A;  2V4I B;  5AUI A;  2JQR B;  2Y5P A;  1YN3 A;  3EA6 A;  1KTK A;  3R2I A;  3U7Z A;  1IUE A;  4TSS A;  2KWD A;  4C56 C;  3IAM 1;  1C4A A;  3TEZ A;  1DOY A;  4ZOH C;  2WP9 B;  4WQM A;  2K3U A;  2M0A A;  1E10 A;  1RFK A;  4EE2 A;  4ITK A;  1AWD A;  2INN E;  3AE6 B;  4N58 A;  1HZ6 A;  2X38 A;  1JAL A;  2BBC A;  1SBB B;  2L1A A;  5EE1 A;  1F2R C;  3UI3 A;  1MI0 A;  3P63 A;  2W82 A;  3NUH B;  5HI1 A;  1PUT A;  2WXO A;  2K0P A;  2L32 A;  1PGA A;  3Q8A A;  4XE0 A;  4KX6 B;  2PW9 A;  2PTL A;  3TUO A;  4C7Z A;  5BYQ A;  1VZ6 A;  5FR3 A;  4ZYS A;  1TS4 A;  1WXQ A;  4R3D A;  1JWS D;  1L4D B;  2N7J A;  2QIL A;  4ARI A;  1ZDV A;  1TZO A;  1FD6 A;  3NVZ A;  5T8I A;  2M19 A;  1P7F A;  2LMC A;  1CK1 A;  1XF5 L;  1TS5 A;  1DYQ A;  2ONQ A;  2DBY A;  1MHH E;  3B2F A;  1TYG B;  3Q8F A;  2IGH A;  3AEA B;  3VR9 B;  3T3O A;  3CWI A;  1J7B A;  3R2T A;  1XXG A;  3RFZ B;  1FNV A;  1FFV A;  1UNS A;  1NEN B;  2JYT A;  3AE7 B;  3BII D;  3FC4 A;  2K9X A;  1TS3 A;  3NVV A;  2G9H D;  1T3Q A;  4RF0 A;  3BK2 A;  3EUB 2;  2MJD A;  4GDL B;  2J52 A;  5BMI A;  3AE1 B;  3V3X A;  1D6E C;  3LB8 C;  3BVZ A;  4AS1 A;  2MEK A;  4YWG G;  5HHD G;  2BTE A;  2WXJ A;  2Q5W D;  1TY2 A;  1SE3 A;  1N62 A;  1FXA A;  1KLU D;  2WNM A;  3Q69 A;  5G5G A;  2GB1 A;  1SSN A;  1L5P A;  2TSS A;  1QKZ A;  1PDX A;  1WGK A;  3NVY A;  2PVG C;  2WXF A;  1L4Z B;  2AQ2 B;  2JYE A;  4JWU C;  3NRZ A;  2D5G A;  3FIL A;  3IXS A;  3FIL B;  5MPO A;  2J42 A;  4DQO C;  1L0V B;  1SJH D;  1T5X D;  4HJG E;  3P4Q B;  4YTN B;  1JRO A;  1GPX A;  2KMM A;  2M56 B;  2XN9 C;  3NS1 A;  3BYT B;  2WLB A;  1QOG A;  1VZ8 A;  2KAJ A;  2NTT A;  1XEE A;  2XNA C;  1L0Y B;  1ENF A;  1BUI C;  1TS2 A;  3BYY B;  4ZHO A;  3AE8 B;  1ZDX A;  1IBX A;  1JWM D;  2JSV X;  1VDV A;  2JWU A;  3ZYY X;  2WXK A;  3DWM A;  3ZGZ A;  2WU2 B;  2HDE A;  2KN4 A;  4YT0 B;  2FE8 A;  1BML C;  3ABV B;  1VR9 A;  4M0W A;  2OHF A;  1K52 A;  1GB1 A;  2QEJ C;  1SEB D;  1V1P A;  1V1P B;  3AEC B;  3VRB B;  1Y56 A;  2N9L A;  2K22 A;  3T3N A;  4MAC A;  1FCL A;  1N5W A;  2L52 A;  4YTP B;  1JCK B;  4NJC A;  1NI3 A;  4RGN A;  2WXI A;  2BS2 B;  1ESF A;  1SB3 C;  1YN4 A;  2QJL A;  4RFB A;  3H8H A;  1I4R A;  1FNW A;  4NZL B;  3U52 E;  2H89 B;  3N9Y C;  1NYR A;  4IDI A;  2LGI A;  1YQ3 B;  1FEH A;  1V1O A;  5BMG A;  2PMV A;  4IOI E;  2INP E;  3BWU D;  4TMA B;  1YJI A;  2JX5 A;  2WXH A;  4JE3 B;  3CIR B;  3U4E G;  4L2Y A;  3DWG C;  2FBW B;  2WDQ B;  1AYF A;  5C3J B;  1E6E B;  4HRO A;  2OED A;  3AEE B;  2GI9 A;  5BYR A;  1ET9 A;  4RCO A;  4DXF A;  1STE A;  3W5U B;  2N0S B;  1NVI D;  2E3T A;  1AN8 A;  2WDV B;  4Q2J A;  4YSX B;  1XCT L;  1D5M C;  1WSP A;  4MM3 B;  3IT4 B;  1SF0 A;  2V0G A;  5D3I B;  1XO3 A;  2LUM A;  4XWW A;  2FUG 1;  2WXG A;  1V8C A;  1YQ4 B;  1D5Z C;  1T6B X;  2CJN A;  5TSS A;  1VLB A;  2LJI A;  1UWX A;  3B2G A;  3VQI A;  1LO5 D;  1HEZ E;  1PYW D;  4JX1 C;  1WWT A;  4RH6 A;  2W3S A;  1QIL A;  3IAS 1;  1Q10 A;  4HEA 1;  2WDR B;  4XDD A;  2CJO A;  1F2R I;  1CZP A;  1C77 A;  1C4C A;  2RDG A;  1QOA A;  3PZ8 A;  1R7S A;  4H2A A;  1SIJ A;  1ZPS A;  3O13 A;  2AQ3 B;  2WXQ A;  1QT9 A;  3AE3 B;  1ZXH A;  3MHZ A;  5C2T B;  1J7A A;  1SJE D;  4A8X C;  4KKI A;  1N61 A;  2GRI A;  1D4B A;  1DOX A;  3AN1 A;  3AEB B;  1WRI A;  1HA5 A;  1I4P A;  1QLB B;  3HUI A;  3KWV A;  1JQ4 A;  2KDM A;  1CQV A;  4RGO S;  2JU6 X;  4RNA A;  2LHE A;  4B0E A;  5HFY A;  3I9V 1;  3J9C A;  4OW0 A;  4L1B A;  1I7H A;  2KQ4 X;  3KQ4 A;  3P4P B;  1B9R A;  3R8B A;  4P16 A;  4JWS C;  2J4X A;  3AV8 A;  1F0Z A;  4MT5 A;  1N60 A;  3MJ5 A;  2BB6 A;  4PT5 A;  2NTS A;  5BYS A;  3SEB A;  2B76 B;  2HTM E;  2IDY A;  4LLG M;  1EM7 A;  1IGD A;  1TKY A;  4NAW B;  5AUK A;  1MHX A;  2WU5 B;  3TEX A;  2YEP B;  4FXC A;  2SAK A;  1L6V A;  1GB4 A;  1IBX B;  2WXP A;  1RYJ A;  4HKQ A;  4DXG A;  1FFU A;  2ZW0 A;  5D7G A;  3ZJT A;  3AM9 A;  1QF6 A;  3I57 A;  1JML A;  4LK0 M;  2JXT A;  3PO0 A;  2LEK A;  3BK1 A;  4XDC A;  1EWY C;  2N9K A;  1P7E A;  1V97 A;  2QIE B;  1ACC A;  1UGJ A;  1I4G A;  2VZK D;  3ZQ4 A;  3GP7 A;  1C9F A;  1TJE A;  1C76 A;  5E6J A;  4US8 A;  4HRS A;  4GLS C;  3AMZ A;  5EE3 A;  3SFE B;  4CQN A;  3W5V B;  3NVW A;  3AEF B;  2AX5 A;  1KFY B;  1TY0 A;  1JWB D;  2NMQ A;  4C80 A;  2BB5 A;  3AE4 B;  1VZ7 A;  3L4P A;  3VR8 B;  1K50 A;  3V05 A;  2DLB A;  1SE4 A;  2QMT A;  1D5X C;  2PKO A;  2MJE A;  5LNK 1;  2BS4 B;  3MFG A;  4WH4 A;  5FK9 C;  3TSS A;  1JRP A;  2L83 A;  4JPS A;  4O1N A;  1NYQ A;  1XCQ L;  1MPE A;  2PVO D;  4YTM B;  1KF6 B;  3AE9 B;  1EWC A;  1PGB A;  1DOI A;  4UDU C;  4YSZ B;  2R61 A;  3BVG A;  1B1Z A;  1FM0 D;  4YSY B;  4WWM A;  2JZP A;  2J53 A;  1ZUD 2;  3KWL A;  1E7P B;  1E9M A;  3VRA B;  1KRH A;  2AQ1 B;  3WCQ A;  2V3N A;  4A55 A;  3W1S A;  3TEW A;  3EGR A;  1TKG A;  2K5P A;  1YN5 A;  1M4V A;  1L0X B;  2WQY B;  2Z8L A;  2IGG A;  4A90 A;  2ON8 A;  1NEK B;  3P4R B;  1ZP0 B;  3GB1 A;  4USA A;  1ROE A;  1K51 A;  4KGT A;  4N6E B;  3TEY A;  3LYY A;  4AQ7 A;  2WXN A;  1PFD A;  1EU4 A;  3Q8E A;  1BXT A;  1GAQ B;  1I4X A;  4RGM A;  5H92 C;  2IGD A;  5I4D A;  2I2Y A;  5H8Y E;  1ZOY B;  1I4H A;  5D3D A;  2W3R A;  3OWE B;  1OFF A;  5JXV A;  2EEL A;  1C79 A;  1IGC A;  3AB5 A;  4LTU A;  2DYO A;  1FRR A;  1XLO A;  1RM6 C;  1QQR A;  3AE2 B;  4ARC A;  3BZD B;  4KKJ A;  3W2D A;  3HRD D;  4OZA A;  4WIP A;  5G5H A;  1YJJ A;  3FAH A;  5FKA C;  4RF1 A;  2BYT A;  1HZ5 A;  1GOZ A;  4REZ A;  3SR6 A;  1ZE3 D;  1N5X A;  5EE9 A;  3E9S A;  4ZHP A;  2WS3 B;  2RDH A;  3HVD A;  1UWM A;  1FMA D;  5HG2 A;  3SFD B;  1FIQ A;  2ACZ B;  2PLP A;  1JW9 D;  2IPK D;  4GDK B;  4WAF A;  1FRD A;  3U2S C;  1MVK A;  4C7Y A;  2PIA A;  3B9J A;  1WYG A;  1FCC C;  3AEG B;  4IKG A;  4OZB A;  1VRA B;  1OQR A;  2MH7 A;  2H88 B;  1C78 A;  1RWS A;  4OZC A;  5EE0 A;  1E0Z A;  4A9A A;  4D2K A;  4NAM A;  3AED B;  1ZXI A;  1L6U A;  1QOF A;  1N63 A;  2EKI A;  1XLQ A;  2RMM A;  4P6V F;  3IT6 B;  3Q8B A;  4HKZ E;  1ET6 A;  2WXM A;  1SE2 A;  2G1E A;  3AH7 A;  4MH8 A;  1HQR D;  1UUP A;  4TQ0 A;  4OVZ A;  4RGT A;  4OHJ A;  1J7C A;  3MC0 B;  4US9 A;  5BMH A;  1EU3 A;  2BS3 B;  1FXI A;  2MJ3 A;  2YEP F;  2W54 A;  3BVM A;  2E6X A;  1OQQ A;  1KH0 A;  1A70 A;  2I38 A;  3ZJU A;  3AE5 B;  4WUR A;  2DWQ A;  3RPF C;  1I4Q A;  4YXD B;  1FO4 A;  5GXG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...