2JZSA

Solution structure of the reduced form of the n-terminal domain of pilb from n. meningitidis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
MVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title Solution structure and dynamics of the reduced and oxidized forms of the N-terminal domain of PilB from Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Electron transport
total genus 31
structure length 144
sequence length 144
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jzsA00
3WT1A 5CAXA 1AW9A 2ON5A 2LJAA 3QOUA 2JZRA 3IV4A 1ILOA 2IWTA 2TIRA 5B8BA 2LRTA 2IMEA 4ML6A 1JZOA 1QK8A 5CO3A 4EL1A 3I9V2 1X0RA 4FYCA 2OADA 1GRXA 3TKPA 5HFGA 1OC3A 5A4VA 5A4WA 3UJ1A 3KH9A 2XPDA 2V2GA 5IM9A 2AUVA 1B48A 1ERVA 1FAAA 3HXSA 1URMA 2GT5A 2H1AA 5DAKA 5JCWA 5DBQA 1FB6A 3WYWA 2HZEA 2IIYA 14GSA 1SU9A 4IQ1A 2R4VA 1XOBA 3HA9A 1IYHA 3RDWA 2DJ1A 2H74A 4BVYA 2GZYA 4MJCA 3DKSA 2CV4A 4F0CA 1G7OA 1SL0B 1LBKA 3K8NA 5D96A 17GSA 2YP6A 3CTGA 2LRCA 5GSTA 4TXOA 3RPNA 5ELAA 3GIXA 3WGXA 4WXTA 1MDKA 2DIZA 2GSSA 3L9SA 4K7OA 3LORA 3TKQA 4EUYA 1WPIA 1YDKA 4WF5A 1K0OA 3GH6A 2R6KA 1TW9A 1M0UA 1U3IA 4PX1A 2VD1A 2VLTA 1KBNA 3FZAA 3LG6A 13GSA 3C8EA 3PH9A 3EU3A 2LJRA 2H1DA 3WGDA 1XXUA 4ACSA 1GP1A 3C73A 3W8JA 4KH7A 4IP6A 3IDVA 3UMAA 3TKSC 1IYIA 4MJAA 3U6VA 3HKRA 4XS6A 3VK9A 2WJUA 6GSYA 2HNLA 1AIUA 3MNGA 3TJGA 1ERUA 2B1KA 4ZILA 1ABAA 3LSZA 2RUFA 5JCUA 2AYTA 2B7JA 1XOAA 4BA7A 3VWVA 1G0TA 4G2EA 1V57A 4EF0A 4I2UA 1OC9B 1O8WA 4Q5NA 4GQFA 5A4UA 2LV3A 4PQ1A 2OE0A 2FWEA 1NM3A 4HEA2 4KAEA 1QQ2A 5ECNB 4DSSA 5LNKe 4OCEA 1BJXA 5ECRB 1M9BA 3LXTA 3GUSA 4IJIA 1KTEA 3GURA 2NBSA 3KM6A 1TXXA 2B5XA 1MD3A 2GQKA 3GA4A 1TU8A 1WWJA 3H93A 3TJFA 2EIRA 4RI7A 3ZREA 1RW1A 1DBYA 1M2BA 3I6AA 1ON4A 2H70A 4TR3A 4KDUA 2FHEA 1M2AA 1VF4A 5J5NA 5H5SA 1MDIA 2PPTA 5ELGA 3LXZA 1OC8A 5DVBA 2HRFA 2H6ZA 1PD21 1Z7RA 5CRDA 4KGIA 3GV1A 4PGTA 2A2SA 3KP8A 4TXVA 1VF1A 1EV9A 1PN9A 1A8LA 5ECSA 3KH7A 1LJRA 1T1VA 3ERWA 2H73A 5ENUA 4AF2A 3US3A 4XRAA 4IS0A 3DXBA 3CMIA 2AHEA 2O8VB 5KN2A 4OMVA 2I3YA 4HZ4A 2P5QA 1U3AA 2B1LA 3MSZA 4V1Ag 9GSSA 2JADA 2RUEA 2P31A 1JZWA 4EE0A 2K6VA 4FYBA 4X43A 4MCUA 2C0FA 3MAKA 2BJXA 5G1LA 5IOXA 5IPGA 2PUKC 2H76A 3ME7A 3TUEA 1ST9A 2DJJA 11GSA 5FT3A 1JZRA 4DEJA 3BCKA 1F3BA 2BMXA 1FW1A 3D22A 2WCIA 3IA1A 4EXJA 2WFCA 5IIZA 5DQYA 1YEXA 2VL3A 1K0DA 1I5GA 5IOWA 3NZNA 2EIQA 1WRYA 4K2DA 2C80A 1S3AA 1XW5A 5ID2B 3VI5A 2FD3A 5F8BA 3GN3A 1EOHA 5IMCA 3GX8A 3GYKA 1SENA 4L0WA 1Z6MA 2LJKA 3RHCA 2H0HA 4TW5A 1EGRA 1ZCPA 2YANA 1XWBA 5AIVA 1K0MA 3ZTLA 4HZ2A 5J41A 2LNTA 1GUHA 1EP7A 3APQA 1V9WA 2IFQA 5B6NA 5CRWA 4QQ7A 2CVBA 1BEDA 3CSIA 1KEBA 2FGXA 2WZ9A 4DSRA 2C8UA 3MWHA 1ZGNA 4MABA 2OJLA 3VPTA 2OBKA 4JE1A 1RK4A 2GDRA 2CVKA 2WS2A 4NHZA 2R2JA 3F9UA 2GQLA 1NHYA 2KP1A 4MLYA 5E59A 3FZ4A 3I69A 3G9BA 4ILFA 1M99A 3HD5A 2O87A 1J08A 2WGRA 3D5JA 5DAKB 1DE1A 2IN3A 4KX4A 5D73A 3E9JB 3WT2A 2HZEB 3IAS2 3IHQA 3HCZA 4ZL8A 5B6MA 1PKZA 1S3DA 3APSA 1SL1B 2CT6A 2R3XA 5AISA 2CAQA 2GQMA 3ZFBA 2VD0A 3O3TA 3Q6OA 3M3MA 4BPYA 2H71A 4PQHA 6GSTA 3M0FA 1ZL9A 4DVCA 1ACVA 1OKDA 4TXOB 5ECMB 2VO4A 1JZDA 1K0BA 1ZMAA 3M1GA 1G6YA 1X9WB 4HOJA 3P90A 5CREA 3VWWA 2TRXA 3ZVJA 3CRUA 3EINA 1G7EA 2N5AA 5JWQB 2X8GA 4MPFA 1FVJA 1H4OA 2JZSA 1BG5A 3LYPA 3D0ZA 3M9JA 1TK5B 2YZHA 1AQWA 4YAPA 3TRQA 7GSSA 2LQQA 3D4TA 5ECOB 3ZZXA 3ZIVA 5HQPA 4LMVA 3JCML 5G1KA 3DVWA 1X5DA 2VL9A 3C71A 1OVNA 1SK0A 5F05A 3QMXA 4I97A 3KJYA 1NW2A 3MDKA 5ABRA 4AGSA 3ED3A 4WBJA 3VFIA 1O6JA 1XCCA 4GWRA 2J23A 1E2YA 4ZL7A 1FO5A 3UOMA 4L5LA 2GS3A 5ECLB 1PX7A 4NXIA 1F6MC 1UVZA 4JBBA 2A2RA 4EC0A 1YQ1A 1VGLA 1SKRB 1TRSA 3P7XA 2ZCTA 3UARA 5ID2A 2C3QA 2O85A 5J9CA 4JZQA 2C0EA 1X9SB 1A2JA 2YZUA 1TK8B 4MH3A 3FR6A 4KNDA 4CDOA 3S9FA 3D4MA 4DSSB 3FR3A 2N5FA 4XS4A 2H0GA 3TOUA 4K7IA 1SD8A 2J9HA 4YH2A 2P0GA 4JR4A 5KN0A 4EO3A 2CX4A 4I2TA 2VL2C 3ZITA 5GAPD 1B8XA 1ZYEA 1K3YA 5G5EA 1XVWA 4IJ3A 1A2LA 2HXKA 3DD3A 4MJBA 1K0AA 3KTBA 5AN1A 3IPZA 5EL8A 3EMPA 1S3CA 2JU5A 2V41A 2Z9SA 1GWCA 1ZYQB 4QL7A 2OKAA 3LYKA 2VLVA 3I43A 1SD9A 2AV4A 2VLUA 3H8QA 10GSA 2FLSA 1B4QA 4ECJA 3EVIA 3N9JA 1JLVA 1SL2B 1TI3A 1O7UA 1PKWA 3LGCA 2KUCA 3A2XA 5JWOB 4WKWA 4WR4A 2OA7A 1JHBA 1ZOFA 4QL9A 1F37A 1ERWA 4POMA 2FUG2 1CQGA 1GTIA 1PRXA 2MMAA 2OE1A 4CW9A 2E7PA 5DALA 3L9VA 4OO4A 4EVMA 4PUFC 4ZBBA 1YKCA 1JLWA 1T4ZA 5CNWA 3TKSE 2K18A 3F4SA 5L71A 4L5OA 4YQVA 2YWMA 3EWLA 4K0NA 5E4WA 4J56E 3IBHA 3QAWA 4N0VA 1XWCA 2FWFA 1OAZA 5KEJA 3U5RE 2PBJA 3KMOA 3Q74A 2F8FA 4IP1A 1EGOA 2YOIA 1EWXA 1USBA 4NHWA 3A5WA 3DVXA 3LEFA 4TR4A 4POBA 1G6WA 1EV4A 2ZNMA 2F9SA 1JFUA 1Q4JA 4TR1A 2H66A 2CZ2A 3IK7A 3TJBA 5GZZB 1M9AA 3GL5A 3E0UA 2PVQA 3F3RA 4TR0A 2CA8A 22GSA 1SK2A 2MMOA 1J9BA 1EEJA 2NVLA 5H5QA 2IL3A 4MH2A 4D73A 4OFNA 4HU7A 1R5PA 1TRUA 4KCAA 3AY8A 2IFQB 5HR0A 3QDNA 1HQOA 3LQ7A 1X5EA 3F4TA 1C72A 1SYXA 3KZQA 4FYUA 3VWXA 1V58A 4KB3A 2XBQA 3FRCA 3O76A 3DYRA 4HUAA 1YZXA 3IOSA 2B5EA 4IELA 3VLNA 4Z7XA 2YWNA 1A0RP 2HYXA 2VIMA 1AAZA 3RAZA 5GAND 1A24A 4L8EA 3HDCA 1GNWA 1GULA 3TJJA 4K6XA 4HU9A 2HFDA 2M72A 5G2ZA 3D21A 1N2AA 1XWGA 2MMNA 3QAVA 4EDZA 5IO2A 1J0FA 3BCIA 2H6YA 3W8SA 2LNSA 4KA0A 1U6TA 3GMFA 1R7HA 4TN8A 2ZUPA 2JACA 3ZVJD 2OBIA 4GLTA 1BAYA 2OACA 3H4KA 2CQ9A 1HNAA 2DSAA 3DGQA 1QFNA 4ZB9A 3PGTA 1SJZA 1GL8A 2DJ0A 2C3TA 4LA1A 3G7JA 4GF0A 3Q19A 4K8MA 1V40A 2QSIA 2X64A 3F3QA 5COHA 2H19A 4MJEA 2B3SA 4LLRA 2RM5A 4LL4B 3H1NA 4GSTA 2WRTA 3CTFA 2EIOA 2P5RA 1NSWA 2M46A 3ERGA 2K8SA 4OFMA 3HVXA 2HSYA 1M7TA 4GRFA 2A4VA 1O81A 1A2MA 1AQVA 3NIVA 4MZWA 5HFKA 4BVXA 1OE7A 2G2QA 1SJIA 1GUMA 2REMA 2BTOT 2FNOA 2V1MA 4JEDA 3EC3A 2LKUA 1X9MB 1U88A 4KSOA 3ZMLA 2IJYA 3FR9A 3HJMA 3IK9A 4ZIJA 5DQSA 2NTOA 3KP9A 2GGTA 2VCWA 3V1WA 2H75A 3ERFA 3L9UA 1WMJA 2LTKA 2E2GA 2PMTA 2VCXA 1PA3A 5ECHB 5HR2A 4YQMA 2AJQB 1AC1A 1YJ6A 1Z3EA 3HJOA 2CAIA 4POKA 3P2AA 1XWAA 4OCFA 3F63A 2H72A 4XS4B 3GRXA 3CRTA 4F2IA 2KHPA 5DDLA 1GLQA 2XC2A 4MMMA 19GSA 4MP4A 5DCGA 1ERTA 3RHBA 3WD6A 3ZMKA 1PL2A 4PUAA 2QKEA 5JCGA 1BYEA 4OWYA 5IMAA 3J7Yb 4OO5A 2L4QA 2H0IA 4V2NA 1ZZYA 1T7PB 1Q98A 3HVVA 1O73A 12GSA 1DSBA 3DWVA 4RQXA 3KD0A 4KDYA 4WBRD 4Q5QA 5B7CA 4AJ8A 2RIIA 5J9BA 5INYA 2IMFA 3VURA 4ZB6A 2MZCA 3L0HA 2L4CA 3C7MA 4N10A 4IQAA 2IMIA 5IQYA 3M8NA 4BWQA 4N0ZA 1XBSA 3HJPA 3CSJA 1PL1A 2VM1A 5DALB 1GH2A 3IRAA 5J3RA 5KN3A 4KDXA 4PXOA 1GUKA 2PGTA 4KUNA 4NAXA 3QD9A 1TU7A 2FY6A 3O6TA 1K3LA 2GTUA 5B8AA 1K3OA 3BBYA 2GSQA 1R5AA 4NV5A 1W89A 3DRNA 3VWUA 2C4JA 4V2LA 2I4AA 4RQRA 4MZBA 4XRDA 2WULA 3F4RA 2VM2A 4RI6A 2GSTA 2AAWA 4NMUA 2LUSA 2IPAA 2DMMA 6GSWA 1T8EB 1O85A 3F6DA 4MA9A 5KN1A 4X1UA 2YCDA 3GNJA 1PGTA 4O32A 5DCHA 3IR4A 2HE3A 1WE0A 4TR1B 3C1RA 3HHVA 2L6DA 3VPQA 4MF5A 4I6XA 4O5RA 2IMDA 1FOVA 5IMVA 2DMLA 2HSHA 2L6CA 4TOPA 4OFTA 3KEBA 3IAM2 3BD2A 4ZXGA 1GTUA 2CVDA 1QGVA 1VF3A 3BJ5A 5EVOA 2VCTA 4GSSA 1XZOA 4D73B 1X5CA 3GKKA 4ZL9A 3FEUA 3UAPA 4J57E 5F0GA 4F82A 1TI1A 4I5QA 4FO5A 6GSXA 4WETA 2FWHA 1TKDB 2QGVA 3HYPA 2QC7A 1HD2A 2I1UA 4LL1B 2GZPA 5GSSA 8GSSA 4KCEA 4J2FA 4MK3A 1QMVA 2ON7A 3J7Yk 4Q5RA 3TB2A 4KW6A 2YJHA 4MZCA 3QFBC 5JWRB 2LQOA 1CQHA 3N5OA 1GSFA 4WR5A 4YAVA 3QPMA 2VAFA 2VUPA 2XBIA 1XPVA 2I81A 4EKZA 4WF4A 1Z7PA 4F0BA 3GHAA 3FK8A 2VCZA 5D9WA 1GTBA 3G7YA 3L78A 4TKYA 3LJRA 1AUCA 4GTUA 1N8JA 3W6GA 2PU9C 5A5KA 3GKXA 2H01A 3UBLA 2TRCP 5D93A 4CHSA 1KNGA 1Y25A 2YWOA 1GSDA 3QFAC 1WJKA 3A3TA 2XHFA 3GFKA 5IO0A 3HVSA 3GL3A 5G31A 2HRNA 1Z5YE 4KSMA 5FWGA 5H5RA 1QUWA 2YV7A 4E8EA 1GLPA 1B4PA 1F9MA 4XS1A 3L4NA 4GSNA 3ZIJA 1T4YA 4NV2A 2CZ3A 4O7HA 4JR6A 5EPFA 2GT6A 3CXGA 4X0XA 2JZTA 2HZFA 4XTSA 2R37A 1GTAA 1GNEA 2C3NA 4G10A 1DUGA 1MD4A 2M80A 2C0DA 1LU4A 5ECQB 1XVQA 1XIYA 16GSA 1AXDA 5CYYA 1ML6A 1FB0A 4RUVA 3F6FA 4XIHA 1THXA 4MF7A 1SYRA 4BWSA 3HZ4A 1Y6EA 1PMTA 2ES7A 3SBCA 5EY6A 2AB6A 2DJ2A 4JRRA 1MEKA 2V32A 2FA8A 2K9FA 2X8HA 1W4VA 4V1Ap 2GVPA 4HQSA 3CBUA 1TTZA 2HT9A 1PSQA 4HDEA 1H75A 1GSEA 3F8UA 1YF0A 3GTUA 3ME8A 2K8VA 5HR3A 2RLIA 2V6KA 3QR6A 4K7NA 1SKWB 3PINA 5C00A 4POLA 3QAGA 1HYUA 5HR1A 2E0QA 4H86A 6GSVA 1SKSB 2R5GA 2H30A 2HI7A 1MTCA 3CSHA 4JU5A 2V6OA 4ZBAA 2DJ3A 1XW9A 3IC4A 1HNCA 5IMDA 1SJ6A 3ISOA 3KMNA 3EMXA 1V98A 2WB9A 2PVOC 4G9HA 3OR5A 1T00A 2EC4A 1F2EA 4FH8A 3GKMA 3EE2A 2FWGA 4EDYA 5D9VA 4IHUA 5CP1A 2JSZA 4AJ7A 3TGZA 2O89A 4K0GA 2FA4A 2KP2A 4ID0A 4ZB8A 2DIYA 3FZ9A 1EOGA 2B6MA 2C0GA 4IKHA 3KGKA 1RQMA 3C1SA 2YNXA 1FHEA 4ECCA 2LEGA 4PQIA 4TVEA 5IMFA 2B5YA 3G7IA 3KTLA 4N11A 1U87A 1V2AA 4GXZA 2IMKA 1YY7A 2KLXA 18GSA 1EP8A 3APOA 3RPPA 2HLSA 5D9TA 2YJ7A 2VOCA 1TK0B 4ULXA 4WEYA 6GSSA 3HZ8A 3RBTA 3R2QA 1GSYA 2L5LA 1R4WA 1GSSA 3UEMA 4F9ZA 3M9KA 3FY7A 4XCSA 2GLRA 1GSQA 1TRWA 2F51A 4XHMA 5FHIA 4BL7A 2H8LA 3H79A 1VF2A 4DSQA 1FVKA 2DLXA 3F0IA 2B7KA 2MBTA 3ZYWA 4MDCA 2RM6A 3UIWA 5C04A 1A0FA 4Q5FA 3E3EA 2DC5A 3D6IA 3KXOA 4K9ZA 2JL4A 4HJ2A 1EEMA 3A2VA 2XPEA 5LCZA 3GSSA 1A8YA 1OE8A 1HNBA 2YWIA 2F8AA 3KCMA 2H1GA 1B9XC 4GQCA 3IXRA 5ECPB 1QXHA 1UN2A 1TP9A 1K0NA 4ECIA 2JSYA 2LS5A 2YN1A 3UVHA 2VCVA 3CYNA 3NOFA 1K0CA 3FKFA 2FCHA 3KIJA 4KE3A 1E6BA 5D8IA 4I8BA 5DJLA 2VCQA 4IN0A 3SWLA 2L5OA 1TOFA 3Q18A 4V2MA 3TDGA 3P8WA 3GH9A 3VI7A 4IVFA 4HS1A 2H6XA 4IBPA 2D2ZA 5LD0A 1WP0A 4MF6A 2L59A 4K1FA 3ZFLA 5F07A 3UVTA 3TKRA 1BQ7A 5ECIB 1OC9A 1TJDA 5J4UA 1XFLA 4ISDA 2MYGA 3TRXA 3FYGA 2E2MA 4MPGA 4NPBA 3ZRDA 1M2DA 1YEPA 5IMZA 2GSRA 4E8HA 2L57A 3DMLA 2YPMA 2NDOA 3FHKA 1EZKA 1TDIA 4G19A 4GCIA 2PN8A 1NHOA 3HY2A 2PERA 2VL2A 3UL3A 3WGEA 3GSTA 3LFLA 2ALBA 4ECBA 3TJKA 3ZL5A 1PX6A 2G0FA 1MDJA 4N30A 1I9DA 3IE3A 1BX9A 2YV9A 3BOAA 3PR8A 6GSUA 1TRVA 1THOA 2DBCA 4P3YB 1Z9HA 2PWJA 4FIWA 3FZ5A 1SK1A 5CRGA 4PNGA 4PNFA 1GSUA 20GSA 3GKNA 1B9YC 5D9XA 1OYJA 1FG4A 1T3BA 5F06A 2O7KA 5AIXA 1VRSD 2X8CA 1DE2A 4HJMA 2F3MA 1OKTA 1WOUA 1A23A 3ZLPA 3A2WA 1XW6A 2DJKA 2I9HA 1UA5A 4PURA 5ECKB 2NPBA 5CRHA 2H1BA 4O92A 1AQXA 4ZBDA 3FW2A 2C1YA 3TRPA 1XWKA 4L0UA 3EYTA 3DEXA 1YKAA 5G5FA 3EURA 1PQNA 2MBSA 2KOKA 2MMZA 3GTUB 2LSTA 1YF1A 4YQUA 3DIEA 3QCPA 4AJ6A 5AGYA 1UC7A 3LWAA 2X99A 2OE3A 2CX3A 3TCOA 2N5BA 5HFIA 1O8XA 5G30A 3GX0A 1WIKA 4IGJA 4HQZA 5IPHA 1Z6NA 2WDUA 5DJMA 4TRXA 3UBKA 3TOTA 3EU4A 1R26A 4NWYA 4OD7A 2LRNA 4ML1A 3TKSA 2GZZA 4LMWA 4F03A 4IW9A 4HI7A 1F3AA
chains in the Genus database with same CATH superfamily
1XG8A 3WT1A 3EPTA 5CAXA 1AW9A 2ON5A 2LJAA 3QOUA 2JZRA 3IV4A 1ILOA 2IWTA 2TIRA 5B8BA 2LRTA 2IMEA 4ML6A 1JZOA 1QK8A 5CO3A 4EL1A 3I9V2 1X0RA 4FYCA 2OADA 1GRXA 3TKPA 5HFGA 1OC3A 5A4VA 5A4WA 3UJ1A 3KH9A 2XPDA 2V2GA 5IM9A 2AUVA 1B48A 1ERVA 1FAAA 3HXSA 1URMA 2GT5A 2H1AA 5DAKA 5JCWA 5DBQA 1FB6A 3WYWA 2HZEA 2IIYA 3IC8A 14GSA 1SU9A 4IQ1A 2R4VA 1XOBA 3HA9A 1IYHA 3RDWA 2DJ1A 2H74A 4BVYA 2GZYA 4MJCA 3DKSA 2CV4A 4F0CA 1G7OA 1SL0B 1LBKA 3K8NA 5D96A 17GSA 2YP6A 3CTGA 2LRCA 5GSTA 4TXOA 3RPNA 5ELAA 3GIXA 3WGXA 4WXTA 1MDKA 2DIZA 2GSSA 3L9SA 4K7OA 3LORA 3TKQA 4EUYA 1WPIA 1YDKA 4WF5A 1K0OA 3GH6A 2R6KA 3MIXA 1TW9A 1M0UA 1U3IA 4PX1A 2VD1A 2VLTA 1KBNA 3FZAA 3LG6A 13GSA 3C8EA 3PH9A 2R0GA 3EU3A 2LJRA 2H1DA 3WGDA 1XXUA 4ACSA 1GP1A 3C73A 3W8JA 4KH7A 4IP6A 3IDVA 3R3EA 3UMAA 3TKSC 1IYIA 4MJAA 3U6VA 3HKRA 4XS6A 3VK9A 2WJUA 6GSYA 2HNLA 1AIUA 3MNGA 3TJGA 1ERUA 2B1KA 4ZILA 1ABAA 3LSZA 2RUFA 5JCUA 2AYTA 2B7JA 1XOAA 4BA7A 3VWVA 1G0TA 4G2EA 1V57A 4EF0A 4I2UA 1OC9B 1O8WA 4Q5NA 4GQFA 5A4UA 2LV3A 4PQ1A 2OE0A 2FWEA 1NM3A 4HEA2 4KAEA 1QQ2A 5ECNB 3HVNA 4DSSA 4OCEA 5LNKe 1BJXA 5ECRB 1M9BA 3LXTA 3GUSA 4IJIA 1KTEA 3GURA 2NBSA 3KM6A 1TXXA 2B5XA 1MD3A 2GQKA 3GA4A 1TU8A 1WWJA 3H93A 3TJFA 2EIRA 4RI7A 3ZREA 1RW1A 1DBYA 1M2BA 3I6AA 1ON4A 2H70A 4TR3A 4KDUA 2FHEA 1M2AA 1VF4A 5J5NA 5H5SA 1MDIA 2PPTA 5ELGA 3LXZA 2X49A 1OC8A 5DVBA 2HRFA 2H6ZA 1PD21 1Z7RA 5CRDA 4KGIA 3GV1A 4PGTA 2A2SA 3KP8A 4TXVA 4PTSA 1VF1A 1EV9A 1PN9A 1A8LA 5ECSA 3KH7A 2HSMA 1LJRA 1T1VA 3ERWA 2H73A 5ENUA 4AF2A 3US3A 4XRAA 4IS0A 3DXBA 3CMIA 2AHEA 2O8VB 5KN2A 4OMVA 2I3YA 4HZ4A 2P5QA 1U3AA 2B1LA 3MSZA 4V1Ag 9GSSA 2JADA 2RUEA 2P31A 1JZWA 4EE0A 2K6VA 4FYBA 4X43A 4MCUA 2C0FA 3MAKA 2BJXA 5G1LA 5IOXA 4K5RA 5IPGA 2PUKC 2H76A 2DKIA 3ME7A 3TUEA 1ST9A 2DJJA 11GSA 5FT3A 1JZRA 4DEJA 3BCKA 1F3BA 2BMXA 1FW1A 3D22A 2WCIA 3IA1A 4EXJA 2WFCA 5IIZA 5DQYA 1YEXA 2VL3A 1K0DA 1I5GA 5IOWA 3NZNA 2EIQA 1WRYA 4K2DA 2C80A 1S3AA 1XW5A 5ID2B 3VI5A 2FD3A 5F8BA 3GN3A 1EOHA 5IMCA 3GX8A 3GYKA 1SENA 4L0WA 1Z6MA 2LJKA 3RHCA 2H0HA 4TW5A 1EGRA 1ZCPA 2QA2A 2YANA 1XWBA 5AIVA 1K0MA 3ZTLA 4HZ2A 5J41A 2LNTA 1GUHA 1EP7A 3APQA 1V9WA 2IFQA 5B6NA 5CRWA 4QQ7A 2CVBA 1BEDA 3CSIA 1KEBA 2FGXA 2WZ9A 4DSRA 2C8UA 3MWHA 4EIQA 1ZGNA 4MABA 2OJLA 3VPTA 2OBKA 4JE1A 1RK4A 2GDRA 2CVKA 2WS2A 4NHZA 2R2JA 3F9UA 2GQLA 1NHYA 2KP1A 4MLYA 5E59A 3FZ4A 3I69A 3G9BA 4ILFA 1M99A 3HD5A 1FOHA 2O87A 1J08A 2WGRA 3D5JA 5DAKB 1DE1A 2IN3A 4KX4A 5D73A 3E9JB 3WT2A 2HZEB 3IAS2 3IHQA 3HCZA 4ZL8A 5B6MA 1PKZA 1S3DA 3APSA 1SL1B 2CT6A 2R3XA 5AISA 4BVYB 2CAQA 2GQMA 3ZFBA 2VD0A 3O3TA 3Q6OA 3M3MA 4BPYA 2H71A 4PQHA 6GSTA 3M0FA 1ZL9A 4DVCA 1ACVA 1OKDA 4TXOB 5ECMB 2VO4A 1JZDA 1K0BA 1ZMAA 3M1GA 1G6YA 1X9WB 3IHGA 4HOJA 3P90A 5CREA 3VWWA 2TRXA 3ZVJA 3CRUA 3EINA 1G7EA 1ZYNA 2N5AA 5JWQB 2X8GA 4MPFA 1FVJA 1H4OA 2JZSA 1BG5A 3LYPA 3D0ZA 3M9JA 1PFOA 1TK5B 2YZHA 1AQWA 4YAPA 3TRQA 7GSSA 2LQQA 3D4TA 5ECOB 3ZZXA 3ZIVA 5HQPA 4LMVA 3JCML 5G1KA 3DVWA 1X5DA 2VL9A 3C71A 1OVNA 1SK0A 2HRKA 5F05A 3QMXA 4I97A 3KJYA 1NW2A 3MDKA 5ABRA 4AGSA 3ED3A 4WBJA 3VFIA 1O6JA 1XCCA 4GWRA 2J23A 1E2YA 4ZL7A 1FO5A 3UOMA 4L5LA 2GS3A 5ECLB 1PX7A 4NXIA 1F6MC 1UVZA 4JBBA 2A2RA 4EC0A 1YQ1A 1VGLA 1SKRB 1TRSA 3P7XA 2ZCTA 3UARA 5ID2A 2C3QA 2O85A 5J9CA 4JZQA 2C0EA 1X9SB 1A2JA 2YZUA 1TK8B 4MH3A 3FR6A 4KNDA 4CDOA 3S9FA 3D4MA 4DSSB 3FR3A 2N5FA 4MNNA 4XS4A 2H0GA 3TOUA 4K7IA 1SD8A 2J9HA 4YH2A 2P0GA 4JR4A 5KN0A 4EO3A 2CX4A 4I2TA 2VL2C 3ZITA 5GAPD 1B8XA 1ZYEA 1K3YA 5G5EA 1XVWA 4FQUA 4IJ3A 1A2LA 2HXKA 3DD3A 4MJBA 1K0AA 3KTBA 5AN1A 3IPZA 3EMPA 5EL8A 1S3CA 2JU5A 2V41A 2Z9SA 1GWCA 1ZYQB 4QL7A 2OKAA 3LYKA 2VLVA 3I43A 1SD9A 2AV4A 2VLUA 3H8QA 2DKHA 10GSA 2FLSA 1B4QA 4ECJA 3EVIA 3N9JA 1JLVA 1SL2B 1TI3A 1O7UA 1PKWA 3LGCA 2KUCA 3A2XA 5JWOB 4WKWA 4WR4A 2OA7A 1JHBA 1ZOFA 4QL9A 4EIPA 1F37A 1ERWA 4POMA 2HRAA 2FUG2 1CQGA 1GTIA 1PRXA 2MMAA 2OE1A 4CW9A 2E7PA 5DALA 3L9VA 4OO4A 4X4JA 4EVMA 4PUFC 4ZBBA 1YKCA 1JLWA 1T4ZA 5CNWA 3TKSE 2K18A 3F4SA 1ZYPA 5L71A 4L5OA 4YQVA 2YWMA 3EWLA 4K0NA 5E4WA 4J56E 3IBHA 3QAWA 4N0VA 1XWCA 2FWFA 1OAZA 5KEJA 4O5UA 3U5RE 2PBJA 3KMOA 3Q74A 2F8FA 4IP1A 3MYDA 1EGOA 2YOIA 4K2XA 4YKFA 1EWXA 1USBA 4K5SA 4NHWA 3A5WA 3DVXA 3LEFA 4TR4A 4POBA 1G6WA 1EV4A 2ZNMA 2F9SA 1JFUA 1Q4JA 2A2PA 4TR1A 2H66A 2CZ2A 3IK7A 3TJBA 5GZZB 1M9AA 3GL5A 3E0UA 2PVQA 3F3RA 4TR0A 2CA8A 22GSA 1SK2A 3FMWA 2MMOA 4Z2UA 1J9BA 1EEJA 2NVLA 5H5QA 2IL3A 4MH2A 4D73A 4OFNA 4HU7A 1R5PA 1TRUA 2A4HA 4KCAA 3AY8A 2IFQB 5HR0A 3QDNA 1HQOA 3LQ7A 1X5EA 3F4TA 1C72A 1SYXA 3KZQA 4FYUA 3VWXA 1V58A 4KB3A 2XBQA 3FRCA 3O76A 3DYRA 4HUAA 1YZXA 3IOSA 2B5EA 4IELA 3VLNA 4Z7XA 2YWNA 1A0RP 2HYXA 2VIMA 1AAZA 3RAZA 4CY6A 5GAND 1A24A 4L8EA 3HDCA 1GNWA 1GULA 3TJJA 4K6XA 4HU9A 2HFDA 2M72A 5G2ZA 3D21A 1N2AA 1XWGA 2MMNA 3QAVA 4EDZA 5IO2A 1J0FA 3BCIA 2H6YA 3W8SA 2LNSA 4KA0A 1U6TA 3GMFA 1R7HA 4TN8A 2ZUPA 2JACA 3ZVJD 2OBIA 4GLTA 1BAYA 2OACA 3H4KA 2CQ9A 1HNAA 2DSAA 3DGQA 1QFNA 4ZB9A 3PGTA 1SJZA 1GL8A 2DJ0A 2C3TA 4LA1A 3G7JA 4GF0A 3Q19A 4K8MA 1V40A 2QSIA 2X64A 3F3QA 5COHA 2H19A 4MJEA 2B3SA 4KF9A 4LLRA 2RM5A 4LL4B 3H1NA 4GSTA 2WRTA 3CTFA 2EIOA 2P5RA 1NSWA 2M46A 3ERGA 2K8SA 2UZ8A 4OFMA 3HVXA 2HSYA 1M7TA 4GRFA 2A4VA 1O81A 1A2MA 1AQVA 3NIVA 4MZWA 5HFKA 4BVXA 1OE7A 2G2QA 1SJIA 1GUMA 2REMA 2BTOT 2FNOA 2V1MA 4JEDA 3EC3A 2LKUA 1X9MB 1U88A 4KSOA 3ZMLA 2IJYA 3FR9A 3HJMA 3IK9A 4ZIJA 5DQSA 2NTOA 3KP9A 4YKGA 2GGTA 2VCWA 3V1WA 2H75A 3ERFA 3PPUA 3L9UA 1WMJA 2LTKA 2E2GA 2PMTA 2VCXA 1PA3A 5ECHB 5HR2A 4YQMA 2AJQB 1AC1A 1YJ6A 1Z3EA 3HJOA 2CAIA 4POKA 3P2AA 1XWAA 4OCFA 3F63A 2H72A 4XS4B 3GRXA 3CRTA 4F2IA 2KHPA 4A5PA 5DDLA 1GLQA 2XC2A 4MMMA 19GSA 4MP4A 5DCGA 1ERTA 3RHBA 3WD6A 3ZMKA 1PL2A 4PUAA 2QKEA 5JCGA 1BYEA 4OWYA 5IMAA 3J7Yb 4OO5A 2L4QA 2H0IA 4V2NA 1ZZYA 1T7PB 1Q98A 3HVVA 1O73A 12GSA 1DSBA 4G0LA 3DWVA 4RQXA 3KD0A 4KDYA 4WBRD 2X4AA 4Q5QA 4O5QA 5B7CA 4AJ8A 2RIIA 5J9BA 5INYA 2IMFA 4USSA 3VURA 4ZB6A 2MZCA 3L0HA 5KOWA 2L4CA 3C7MA 4N10A 4IQAA 2IMIA 5IQYA 3M8NA 4BWQA 4N0ZA 1XBSA 3HJPA 3CSJA 1PL1A 2VM1A 5DALB 1GH2A 3IRAA 5J3RA 5KN3A 4KDXA 4PXOA 1GUKA 2PGTA 4KUNA 4NAXA 3QD9A 1TU7A 2FY6A 3O6TA 1K3LA 2GTUA 5B8AA 1K3OA 3BBYA 2GSQA 1R5AA 4NV5A 1W89A 3LW9A 3DRNA 3VWUA 2C4JA 4V2LA 2I4AA 4RQRA 4MZBA 4XRDA 2WULA 3F4RA 2VM2A 4RI6A 2GSTA 2AAWA 4NMUA 2LUSA 2IPAA 2DMMA 6GSWA 1T8EB 1O85A 3F6DA 4MA9A 5KN1A 4X1UA 2YCDA 3GNJA 4Z2TA 1PGTA 4O32A 5DCHA 3IR4A 2HE3A 1WE0A 4TR1B 3C1RA 3HHVA 2L6DA 3VPQA 4MF5A 4I6XA 4O5RA 2IMDA 1FOVA 5IMVA 2DMLA 2HSHA 2L6CA 4TOPA 4OFTA 3A5IA 3KEBA 3IAM2 3BD2A 4ZXGA 1GTUA 2CVDA 1QGVA 1VF3A 3BJ5A 5EVOA 2VCTA 4GSSA 1XZOA 4D73B 1X5CA 3GKKA 4ZL9A 3FEUA 3UAPA 4J57E 5F0GA 4F82A 1TI1A 4I5QA 4FO5A 6GSXA 4WETA 2FWHA 1TKDB 2QGVA 3HYPA 2QC7A 1HD2A 2I1UA 4LL1B 2GZPA 5GSSA 8GSSA 4KCEA 4J2FA 4MK3A 1QMVA 2ON7A 3J7Yk 4Q5RA 3TB2A 4KW6A 2YJHA 4MZCA 3QFBC 5JWRB 2LQOA 2R0CA 1CQHA 3N5OA 1GSFA 4CY8A 4WR5A 4YAVA 3QPMA 2VAFA 2VUPA 2XBIA 1XPVA 2I81A 4EKZA 4WF4A 1Z7PA 4F0BA 3GHAA 3FK8A 2VCZA 5D9WA 1GTBA 3G7YA 3L78A 4TKYA 3LJRA 1AUCA 4GTUA 1N8JA 3W6GA 2PU9C 5A5KA 3GKXA 2H01A 3UBLA 2TRCP 5D93A 4CHSA 1KNGA 1Y25A 2YWOA 1GSDA 3QFAC 1WJKA 3A3TA 2XHFA 3GFKA 5IO0A 3HVSA 3GL3A 5BMUA 5G31A 2HRNA 1Z5YE 4KSMA 5FWGA 5H5RA 1QUWA 2YV7A 4E8EA 1GLPA 1B4PA 1F9MA 4XS1A 3L4NA 4GSNA 3ZIJA 1T4YA 4NV2A 2CZ3A 4O7HA 4JR6A 5EPFA 2GT6A 3CXGA 4BVXB 4X0XA 4BL7B 2JZTA 2HZFA 4XTSA 2R37A 1GTAA 1GNEA 2C3NA 4G10A 1DUGA 1MD4A 2M80A 2C0DA 1LU4A 5ECQB 1XVQA 1XIYA 16GSA 1AXDA 5CYYA 1ML6A 1FB0A 4RUVA 3F6FA 4XIHA 1THXA 4MF7A 1SYRA 4BWSA 3HZ4A 1Y6EA 1PMTA 2ES7A 3SBCA 5EY6A 2AB6A 2DJ2A 4JRRA 1MEKA 2V32A 2FA8A 2K9FA 2X8HA 1W4VA 4V1Ap 2GVPA 4HQSA 3CBUA 1TTZA 2HT9A 1PSQA 4HDEA 1H75A 1GSEA 3F8UA 1YF0A 3GTUA 3ME8A 2K8VA 4Z2RA 5HR3A 2RLIA 2V6KA 3QR6A 4K7NA 1SKWB 3PINA 5C00A 4POLA 3QAGA 1HYUA 5HR1A 2E0QA 4H86A 6GSVA 1SKSB 2R5GA 2H30A 2HI7A 1MTCA 3CSHA 4JU5A 2V6OA 4ZBAA 2DJ3A 1XW9A 3IC4A 1HNCA 5IMDA 1SJ6A 3ISOA 3KMNA 3EMXA 1V98A 2WB9A 2PVOC 4G9HA 3OR5A 1T00A 2EC4A 1F2EA 4FH8A 3GKMA 3EE2A 2FWGA 4EDYA 5D9VA 4IHUA 5CP1A 2JSZA 4AJ7A 3TGZA 2O89A 4K0GA 2FA4A 2KP2A 4ID0A 4ZB8A 2DIYA 3CQFA 3FZ9A 1EOGA 2B6MA 2C0GA 4IKHA 3KGKA 1RQMA 3C1SA 2YNXA 1FHEA 4ECCA 2LEGA 4PQIA 1M3IA 4TVEA 5IMFA 2B5YA 3G7IA 3KTLA 4N11A 1U87A 1V2AA 4GXZA 2IMKA 1YY7A 2KLXA 18GSA 1EP8A 3APOA 5BRTA 3RPPA 2HLSA 5D9TA 2YJ7A 2VOCA 1TK0B 4ULXA 4WEYA 6GSSA 3HZ8A 3RBTA 3R2QA 1GSYA 2L5LA 1R4WA 1GSSA 3UEMA 4F9ZA 3M9KA 3FY7A 4XCSA 2GLRA 1GSQA 1TRWA 2F51A 4XHMA 5FHIA 4BL7A 2H8LA 3H79A 1VF2A 4DSQA 1FVKA 2DLXA 3F0IA 2B7KA 2MBTA 3ZYWA 4MDCA 2RM6A 3UIWA 5C04A 1A0FA 4Q5FA 3E3EA 2DC5A 3D6IA 3KXOA 4K9ZA 2JL4A 4HJ2A 1EEMA 3A2VA 2XPEA 5LCZA 3GSSA 1A8YA 1OE8A 1HNBA 2YWIA 2F8AA 3KCMA 2H1GA 1B9XC 4GQCA 3IXRA 5ECPB 1QXHA 1UN2A 1TP9A 1K0NA 4ECIA 2JSYA 2LS5A 2YN1A 3UVHA 2VCVA 3CYNA 3NOFA 4HSCX 1K0CA 3FKFA 2FCHA 3KIJA 4KE3A 1E6BA 5D8IA 4I8BA 5DJLA 2VCQA 4IN0A 3SWLA 2L5OA 1TOFA 3Q18A 4V2MA 3TDGA 3P8WA 3GH9A 3VI7A 4IVFA 4HS1A 2H6XA 4IBPA 2D2ZA 5LD0A 1WP0A 4MF6A 2L59A 4K1FA 3ZFLA 5F07A 3UVTA 3TKRA 1BQ7A 5ECIB 1OC9A 1TJDA 5J4UA 1XFLA 4ISDA 2MYGA 3TRXA 3FYGA 2E2MA 4MPGA 4NPBA 3ZRDA 1M2DA 1YEPA 5IMZA 2GSRA 4E8HA 2L57A 3DMLA 5KOXA 2YPMA 2NDOA 3FHKA 1EZKA 1TDIA 4G19A 4GCIA 2PN8A 1S3RA 1NHOA 3HY2A 2PERA 2VL2A 3UL3A 3WGEA 3GSTA 3LFLA 2ALBA 4ECBA 3TJKA 3ZL5A 1PX6A 2G0FA 1MDJA 4N30A 1I9DA 2QA1A 3IE3A 1BX9A 2YV9A 3BOAA 3PR8A 6GSUA 1TRVA 1THOA 2DBCA 4P3YB 1Z9HA 2PWJA 4FIWA 3FZ5A 1SK1A 4G0IA 5CRGA 4PNGA 4PNFA 1GSUA 1M3JA 20GSA 3GKNA 1B9YC 5D9XA 1OYJA 1FG4A 1T3BA 5F06A 2O7KA 5AIXA 1VRSD 2X8CA 1DE2A 4HJMA 2F3MA 1OKTA 1WOUA 1A23A 3ZLPA 3A2WA 1XW6A 2DJKA 2I9HA 1UA5A 4PURA 5ECKB 2NPBA 5CRHA 2H1BA 4O92A 4BIKA 1AQXA 4ZBDA 3FW2A 2C1YA 3TRPA 1XWKA 4L0UA 3EYTA 3DEXA 1YKAA 5G5FA 3EURA 2R0PA 1PQNA 2MBSA 2KOKA 2MMZA 3GTUB 2LSTA 1YF1A 4YQUA 3DIEA 3QCPA 4AJ6A 5AGYA 1UC7A 3LWAA 4ICYA 2X99A 2OE3A 2CX3A 3TCOA 2N5BA 5HFIA 1O8XA 5G30A 3GX0A 1WIKA 4IGJA 4HQZA 5IPHA 1Z6NA 2WDUA 5DJMA 4TRXA 3UBKA 3TOTA 1PN0A 3EU4A 1R26A 4NWYA 4OD7A 2LRNA 4ML1A 3TKSA 2GZZA 4LMWA 4F03A 4IW9A 4G0KA 4HI7A 1F3AA
chains in the Genus database with same CATH topology
3WT1A 3EPTA 5CAXA 1AW9A 2ON5A 2LJAA 3QOUA 2JZRA 3IV4A 1ILOA 2IWTA 2TIRA 5B8BA 2LRTA 2IMEA 4ML6A 1JZOA 1QK8A 5CO3A 4EL1A 3I9V2 1X0RA 4FYCA 2OADA 1GRXA 3TKPA 5HFGA 1OC3A 5A4VA 5A4WA 3UJ1A 3KH9A 2XPDA 2V2GA 5IM9A 2AUVA 1B48A 1ERVA 1FAAA 3HXSA 1URMA 2GT5A 2H1AA 5DAKA 5JCWA 5DBQA 1FB6A 3WYWA 2HZEA 2IIYA 3IC8A 14GSA 1SU9A 4IQ1A 2R4VA 1XOBA 3HA9A 1IYHA 3RDWA 2DJ1A 2H74A 4BVYA 2GZYA 4MJCA 3DKSA 2CV4A 4F0CA 1G7OA 1SL0B 1LBKA 3K8NA 5D96A 17GSA 2YP6A 3CTGA 2LRCA 5GSTA 4TXOA 3RPNA 5ELAA 3GIXA 3WGXA 4WXTA 1MDKA 2DIZA 2GSSA 3L9SA 4K7OA 3LORA 3TKQA 4EUYA 1WPIA 1YDKA 4WF5A 1K0OA 3GH6A 2R6KA 3MIXA 1TW9A 1M0UA 1U3IA 4PX1A 2VD1A 2VLTA 1KBNA 3FZAA 3LG6A 13GSA 3C8EA 3PH9A 2R0GA 3EU3A 2LJRA 2H1DA 3WGDA 1XXUA 4ACSA 1GP1A 3C73A 3W8JA 4KH7A 4IP6A 3IDVA 3R3EA 3UMAA 3TKSC 1IYIA 4MJAA 3U6VA 3HKRA 4XS6A 3VK9A 2WJUA 6GSYA 2HNLA 1AIUA 3MNGA 3TJGA 1ERUA 2B1KA 4ZILA 1ABAA 3LSZA 2RUFA 5JCUA 2AYTA 2B7JA 1XOAA 4BA7A 3VWVA 1G0TA 4G2EA 1V57A 4EF0A 4I2UA 1OC9B 1O8WA 4Q5NA 4GQFA 5A4UA 2LV3A 4PQ1A 2OE0A 2FWEA 1NM3A 4HEA2 4KAEA 1QQ2A 5ECNB 4DSSA 5LNKe 4OCEA 1BJXA 5ECRB 1M9BA 3LXTA 3GUSA 4IJIA 1KTEA 3GURA 2NBSA 3KM6A 1TXXA 2B5XA 1MD3A 2GQKA 3GA4A 1TU8A 1WWJA 3H93A 3TJFA 2EIRA 4RI7A 3ZREA 1RW1A 1DBYA 1M2BA 3I6AA 1ON4A 2H70A 4TR3A 4KDUA 2FHEA 1M2AA 1VF4A 5J5NA 5H5SA 1MDIA 2PPTA 5ELGA 3LXZA 2X49A 1OC8A 5DVBA 2HRFA 2H6ZA 1PD21 1Z7RA 5CRDA 4KGIA 3GV1A 4PGTA 2A2SA 3KP8A 4TXVA 4PTSA 1VF1A 1EV9A 1PN9A 1A8LA 5ECSA 3KH7A 2HSMA 1LJRA 1T1VA 3ERWA 2H73A 5ENUA 4AF2A 3US3A 4XRAA 4IS0A 3DXBA 3CMIA 2AHEA 2O8VB 5KN2A 4OMVA 2I3YA 4HZ4A 2P5QA 1U3AA 2B1LA 3MSZA 4V1Ag 9GSSA 2JADA 2RUEA 2P31A 1JZWA 4EE0A 2K6VA 4FYBA 4X43A 4MCUA 2C0FA 3MAKA 2BJXA 5G1LA 5IOXA 4K5RA 5IPGA 2PUKC 2H76A 2DKIA 3ME7A 3TUEA 1ST9A 2DJJA 11GSA 5FT3A 1JZRA 4DEJA 3BCKA 1F3BA 2BMXA 1FW1A 3D22A 2WCIA 3IA1A 4EXJA 2WFCA 5IIZA 5DQYA 1YEXA 2VL3A 1K0DA 1I5GA 5IOWA 3NZNA 2EIQA 1WRYA 4K2DA 2C80A 1S3AA 1XW5A 5ID2B 3VI5A 2FD3A 5F8BA 3GN3A 1EOHA 5IMCA 3GX8A 3GYKA 1SENA 4L0WA 1Z6MA 2LJKA 3RHCA 2H0HA 4TW5A 1EGRA 1ZCPA 2QA2A 2YANA 1XWBA 5AIVA 1K0MA 3ZTLA 4HZ2A 5J41A 2LNTA 1GUHA 1EP7A 3APQA 1V9WA 2IFQA 5B6NA 5CRWA 4QQ7A 2CVBA 1BEDA 3CSIA 1KEBA 2FGXA 2WZ9A 4DSRA 2C8UA 3MWHA 4EIQA 1ZGNA 4MABA 2OJLA 3VPTA 2OBKA 4JE1A 1RK4A 2GDRA 2CVKA 2WS2A 4NHZA 2R2JA 3F9UA 2GQLA 1NHYA 2KP1A 4MLYA 5E59A 3FZ4A 3I69A 3G9BA 4ILFA 1M99A 3HD5A 1FOHA 2O87A 1J08A 2WGRA 3D5JA 5DAKB 1DE1A 2IN3A 4KX4A 5D73A 3E9JB 3WT2A 2HZEB 3IAS2 3IHQA 3HCZA 4ZL8A 5B6MA 1PKZA 1S3DA 3APSA 1SL1B 2CT6A 2R3XA 5AISA 4BVYB 2CAQA 2GQMA 3ZFBA 2VD0A 3O3TA 3Q6OA 3M3MA 4BPYA 2H71A 4PQHA 6GSTA 3M0FA 1ZL9A 4DVCA 1ACVA 1OKDA 4TXOB 5ECMB 2VO4A 1JZDA 1K0BA 1ZMAA 3M1GA 1G6YA 1X9WB 3IHGA 4HOJA 3P90A 5CREA 3VWWA 2TRXA 3ZVJA 3CRUA 3EINA 1G7EA 1ZYNA 2N5AA 5JWQB 2X8GA 4MPFA 1FVJA 1H4OA 2JZSA 1BG5A 3LYPA 3D0ZA 3M9JA 1TK5B 2YZHA 1AQWA 4YAPA 3TRQA 7GSSA 2LQQA 3D4TA 5ECOB 3ZZXA 3ZIVA 5HQPA 4LMVA 3JCML 5G1KA 3DVWA 1X5DA 2VL9A 3C71A 1OVNA 1SK0A 2HRKA 5F05A 3QMXA 4I97A 3KJYA 1NW2A 3MDKA 5ABRA 4AGSA 3ED3A 4WBJA 3VFIA 1O6JA 1XCCA 4GWRA 2J23A 1E2YA 4ZL7A 1FO5A 3UOMA 4L5LA 2GS3A 5ECLB 1PX7A 4NXIA 1F6MC 1UVZA 4JBBA 2A2RA 4EC0A 1YQ1A 1VGLA 1SKRB 1TRSA 3P7XA 2ZCTA 3UARA 5ID2A 2C3QA 2O85A 5J9CA 4JZQA 2C0EA 1X9SB 1A2JA 2YZUA 1TK8B 4MH3A 3FR6A 4KNDA 4CDOA 3S9FA 3D4MA 4DSSB 3FR3A 2N5FA 4MNNA 4XS4A 2H0GA 3TOUA 4K7IA 1SD8A 2J9HA 4YH2A 2P0GA 4JR4A 5KN0A 4EO3A 2CX4A 4I2TA 2VL2C 3ZITA 5GAPD 1B8XA 1ZYEA 1K3YA 5G5EA 1XVWA 4FQUA 4IJ3A 1A2LA 2HXKA 3DD3A 4MJBA 1K0AA 3KTBA 5AN1A 3IPZA 3EMPA 5EL8A 1S3CA 2JU5A 2V41A 2Z9SA 1GWCA 1ZYQB 4QL7A 2OKAA 3LYKA 2VLVA 3I43A 1SD9A 2AV4A 2VLUA 3H8QA 2DKHA 10GSA 2FLSA 1B4QA 4ECJA 3EVIA 3N9JA 1JLVA 1SL2B 1TI3A 1O7UA 1PKWA 3LGCA 2KUCA 3A2XA 5JWOB 4WKWA 4WR4A 2OA7A 1JHBA 1ZOFA 4QL9A 4EIPA 1F37A 1ERWA 4POMA 2HRAA 2FUG2 1CQGA 1GTIA 1PRXA 2MMAA 2OE1A 4CW9A 2E7PA 5DALA 3L9VA 4OO4A 4X4JA 4EVMA 4PUFC 4ZBBA 1YKCA 1JLWA 1T4ZA 5CNWA 3TKSE 2K18A 3F4SA 1ZYPA 5L71A 4L5OA 4YQVA 2YWMA 3EWLA 4K0NA 5E4WA 4J56E 3IBHA 3QAWA 4N0VA 1XWCA 2FWFA 1OAZA 5KEJA 4O5UA 3U5RE 2PBJA 3KMOA 3Q74A 2F8FA 4IP1A 3MYDA 1EGOA 2YOIA 4K2XA 4YKFA 1EWXA 1USBA 4K5SA 4NHWA 3A5WA 3DVXA 3LEFA 4TR4A 4POBA 1G6WA 1EV4A 2ZNMA 2F9SA 1JFUA 1Q4JA 2A2PA 4TR1A 2H66A 2CZ2A 3IK7A 3TJBA 5GZZB 1M9AA 3GL5A 3E0UA 2PVQA 3F3RA 4TR0A 2CA8A 22GSA 1SK2A 3FMWA 2MMOA 4Z2UA 1J9BA 1EEJA 2NVLA 5H5QA 2IL3A 4MH2A 4D73A 4OFNA 4HU7A 1R5PA 1TRUA 2A4HA 4KCAA 3AY8A 2IFQB 5HR0A 3QDNA 1HQOA 3LQ7A 1X5EA 3F4TA 1C72A 1SYXA 3KZQA 4FYUA 3VWXA 1V58A 4KB3A 2XBQA 3FRCA 3O76A 3DYRA 4HUAA 1YZXA 3IOSA 2B5EA 4IELA 3VLNA 4Z7XA 2YWNA 1A0RP 2HYXA 2VIMA 1AAZA 3RAZA 4CY6A 5GAND 1A24A 4L8EA 3HDCA 1GNWA 1GULA 3TJJA 4K6XA 4HU9A 2HFDA 2M72A 5G2ZA 3D21A 1N2AA 1XWGA 2MMNA 3QAVA 4EDZA 5IO2A 1J0FA 3BCIA 2H6YA 3W8SA 2LNSA 4KA0A 1U6TA 3GMFA 1R7HA 4TN8A 2ZUPA 2JACA 3ZVJD 2OBIA 4GLTA 1BAYA 2OACA 3H4KA 2CQ9A 1HNAA 2DSAA 3DGQA 1QFNA 4ZB9A 3PGTA 1SJZA 1GL8A 2DJ0A 2C3TA 4LA1A 3G7JA 4GF0A 3Q19A 4K8MA 1V40A 2QSIA 2X64A 3F3QA 5COHA 2H19A 4MJEA 2B3SA 4KF9A 4LLRA 2RM5A 4LL4B 3H1NA 4GSTA 2WRTA 3CTFA 2EIOA 2P5RA 1NSWA 2M46A 3ERGA 2K8SA 2UZ8A 4OFMA 3HVXA 2HSYA 1M7TA 4GRFA 2A4VA 1O81A 1A2MA 1AQVA 3NIVA 4MZWA 5HFKA 4BVXA 1OE7A 2G2QA 1SJIA 1GUMA 2REMA 2BTOT 2FNOA 2V1MA 4JEDA 3EC3A 2LKUA 1X9MB 1U88A 4KSOA 3ZMLA 2IJYA 3FR9A 3HJMA 3IK9A 4ZIJA 5DQSA 2NTOA 3KP9A 4YKGA 2GGTA 2VCWA 3V1WA 2H75A 3ERFA 3PPUA 3L9UA 1WMJA 2LTKA 2E2GA 2PMTA 2VCXA 1PA3A 5ECHB 5HR2A 4YQMA 2AJQB 1AC1A 1YJ6A 1Z3EA 3HJOA 2CAIA 4POKA 3P2AA 1XWAA 4OCFA 3F63A 2H72A 4XS4B 3GRXA 3CRTA 4F2IA 2KHPA 4A5PA 5DDLA 1GLQA 2XC2A 4MMMA 19GSA 4MP4A 5DCGA 1ERTA 3RHBA 3WD6A 3ZMKA 1PL2A 4PUAA 2QKEA 5JCGA 1BYEA 4OWYA 5IMAA 3J7Yb 4OO5A 2L4QA 2H0IA 4V2NA 1ZZYA 1T7PB 1Q98A 3HVVA 1O73A 12GSA 1DSBA 4G0LA 3DWVA 4RQXA 3KD0A 4KDYA 4WBRD 2X4AA 4Q5QA 4O5QA 5B7CA 4AJ8A 2RIIA 5J9BA 5INYA 2IMFA 4USSA 3VURA 4ZB6A 2MZCA 3L0HA 5KOWA 2L4CA 3C7MA 4N10A 4IQAA 2IMIA 5IQYA 3M8NA 4BWQA 4N0ZA 1XBSA 3HJPA 3CSJA 1PL1A 2VM1A 5DALB 1GH2A 3IRAA 5J3RA 5KN3A 4KDXA 4PXOA 1GUKA 2PGTA 4KUNA 4NAXA 3QD9A 1TU7A 2FY6A 3O6TA 1K3LA 2GTUA 5B8AA 1K3OA 3BBYA 2GSQA 1R5AA 4NV5A 1W89A 3LW9A 3DRNA 3VWUA 2C4JA 4V2LA 2I4AA 4RQRA 4MZBA 4XRDA 2WULA 3F4RA 2VM2A 4RI6A 2GSTA 2AAWA 4NMUA 2LUSA 2IPAA 2DMMA 6GSWA 1T8EB 1O85A 3F6DA 4MA9A 5KN1A 4X1UA 2YCDA 3GNJA 4Z2TA 1PGTA 4O32A 5DCHA 3IR4A 2HE3A 1WE0A 4TR1B 3C1RA 3HHVA 2L6DA 3VPQA 4MF5A 4I6XA 4O5RA 2IMDA 1FOVA 5IMVA 2DMLA 2HSHA 2L6CA 4TOPA 4OFTA 3A5IA 3KEBA 3IAM2 3BD2A 4ZXGA 1GTUA 2CVDA 1QGVA 1VF3A 3BJ5A 5EVOA 2VCTA 4GSSA 1XZOA 4D73B 1X5CA 3GKKA 4ZL9A 3FEUA 3UAPA 4J57E 5F0GA 4F82A 1TI1A 4I5QA 4FO5A 6GSXA 4WETA 2FWHA 1TKDB 2QGVA 3HYPA 2QC7A 1HD2A 2I1UA 4LL1B 2GZPA 5GSSA 8GSSA 4KCEA 4J2FA 4MK3A 1QMVA 2ON7A 3J7Yk 4Q5RA 3TB2A 4KW6A 2YJHA 4MZCA 3QFBC 5JWRB 2LQOA 2R0CA 1CQHA 3N5OA 1GSFA 4CY8A 4WR5A 4YAVA 3QPMA 2VAFA 2VUPA 2XBIA 1XPVA 2I81A 4EKZA 4WF4A 1Z7PA 4F0BA 3GHAA 3FK8A 2VCZA 5D9WA 1GTBA 3G7YA 3L78A 4TKYA 3LJRA 1AUCA 4GTUA 1N8JA 3W6GA 2PU9C 5A5KA 3GKXA 2H01A 3UBLA 2TRCP 5D93A 4CHSA 1KNGA 1Y25A 2YWOA 1GSDA 3QFAC 1WJKA 3A3TA 2XHFA 3GFKA 5IO0A 3HVSA 3GL3A 5BMUA 5G31A 2HRNA 1Z5YE 4KSMA 5FWGA 5H5RA 1QUWA 2YV7A 4E8EA 1GLPA 1B4PA 1F9MA 4XS1A 3L4NA 4GSNA 3ZIJA 1T4YA 4NV2A 2CZ3A 4O7HA 4JR6A 5EPFA 2GT6A 3CXGA 4BVXB 4X0XA 4BL7B 2JZTA 2HZFA 4XTSA 2R37A 1GTAA 1GNEA 2C3NA 4G10A 1DUGA 1MD4A 2M80A 2C0DA 1LU4A 5ECQB 1XVQA 1XIYA 16GSA 1AXDA 5CYYA 1ML6A 1FB0A 4RUVA 3F6FA 4XIHA 1THXA 4MF7A 1SYRA 4BWSA 3HZ4A 1Y6EA 1PMTA 2ES7A 3SBCA 5EY6A 2AB6A 2DJ2A 4JRRA 1MEKA 2V32A 2FA8A 2K9FA 2X8HA 1W4VA 4V1Ap 2GVPA 4HQSA 3CBUA 1TTZA 2HT9A 1PSQA 4HDEA 1H75A 1GSEA 3F8UA 1YF0A 3GTUA 3ME8A 2K8VA 4Z2RA 5HR3A 2RLIA 2V6KA 3QR6A 4K7NA 1SKWB 3PINA 5C00A 4POLA 3QAGA 1HYUA 5HR1A 2E0QA 4H86A 6GSVA 1SKSB 2R5GA 2H30A 2HI7A 1MTCA 3CSHA 4JU5A 2V6OA 4ZBAA 2DJ3A 1XW9A 3IC4A 1HNCA 5IMDA 1SJ6A 3ISOA 3KMNA 3EMXA 1V98A 2WB9A 2PVOC 4G9HA 3OR5A 1T00A 2EC4A 1F2EA 4FH8A 3GKMA 3EE2A 2FWGA 4EDYA 5D9VA 4IHUA 5CP1A 2JSZA 4AJ7A 3TGZA 2O89A 4K0GA 2FA4A 2KP2A 4ID0A 4ZB8A 2DIYA 3FZ9A 1EOGA 2B6MA 2C0GA 4IKHA 3KGKA 1RQMA 3C1SA 2YNXA 1FHEA 4ECCA 2LEGA 4PQIA 4TVEA 5IMFA 2B5YA 3G7IA 3KTLA 4N11A 1U87A 1V2AA 4GXZA 2IMKA 1YY7A 2KLXA 18GSA 1EP8A 3APOA 5BRTA 3RPPA 2HLSA 5D9TA 2YJ7A 2VOCA 1TK0B 4ULXA 4WEYA 6GSSA 3HZ8A 3RBTA 3R2QA 1GSYA 2L5LA 1R4WA 1GSSA 3UEMA 4F9ZA 3M9KA 3FY7A 4XCSA 2GLRA 1GSQA 1TRWA 2F51A 4XHMA 5FHIA 4BL7A 2H8LA 3H79A 1VF2A 4DSQA 1FVKA 2DLXA 3F0IA 2B7KA 2MBTA 3ZYWA 4MDCA 2RM6A 3UIWA 5C04A 1A0FA 4Q5FA 3E3EA 2DC5A 3D6IA 3KXOA 4K9ZA 2JL4A 4HJ2A 1EEMA 3A2VA 2XPEA 5LCZA 3GSSA 1A8YA 1OE8A 1HNBA 2YWIA 2F8AA 3KCMA 2H1GA 1B9XC 4GQCA 3IXRA 5ECPB 1QXHA 1UN2A 1TP9A 1K0NA 4ECIA 2JSYA 2LS5A 2YN1A 3UVHA 2VCVA 3CYNA 3NOFA 1K0CA 3FKFA 2FCHA 3KIJA 4KE3A 1E6BA 5D8IA 4I8BA 5DJLA 2VCQA 4IN0A 3SWLA 2L5OA 1TOFA 3Q18A 4V2MA 3TDGA 3P8WA 3GH9A 3VI7A 4IVFA 4HS1A 2H6XA 4IBPA 2D2ZA 5LD0A 1WP0A 4MF6A 2L59A 4K1FA 3ZFLA 5F07A 3UVTA 3TKRA 1BQ7A 5ECIB 1OC9A 1TJDA 5J4UA 1XFLA 4ISDA 2MYGA 3TRXA 3FYGA 2E2MA 4MPGA 4NPBA 3ZRDA 1M2DA 1YEPA 5IMZA 2GSRA 4E8HA 2L57A 3DMLA 5KOXA 2YPMA 2NDOA 3FHKA 1EZKA 1TDIA 4G19A 4GCIA 2PN8A 1NHOA 3HY2A 2PERA 2VL2A 3UL3A 3WGEA 3GSTA 3LFLA 2ALBA 4ECBA 3TJKA 3ZL5A 1PX6A 2G0FA 1MDJA 4N30A 1I9DA 2QA1A 3IE3A 1BX9A 2YV9A 3BOAA 3PR8A 6GSUA 1TRVA 1THOA 2DBCA 4P3YB 1Z9HA 2PWJA 4FIWA 3FZ5A 1SK1A 4G0IA 5CRGA 4PNGA 4PNFA 1GSUA 20GSA 3GKNA 1B9YC 5D9XA 1OYJA 1FG4A 1T3BA 5F06A 2O7KA 5AIXA 1VRSD 2X8CA 1DE2A 4HJMA 2F3MA 1OKTA 1WOUA 1A23A 3ZLPA 3A2WA 1XW6A 2DJKA 2I9HA 1UA5A 4PURA 5ECKB 2NPBA 5CRHA 2H1BA 4O92A 1AQXA 4ZBDA 3FW2A 2C1YA 3TRPA 1XWKA 4L0UA 3EYTA 3DEXA 1YKAA 5G5FA 3EURA 2R0PA 1PQNA 2MBSA 2KOKA 2MMZA 3GTUB 2LSTA 1YF1A 4YQUA 3DIEA 3QCPA 4AJ6A 5AGYA 1UC7A 3LWAA 4ICYA 2X99A 2OE3A 2CX3A 3TCOA 2N5BA 5HFIA 1O8XA 5G30A 3GX0A 1WIKA 4IGJA 4HQZA 5IPHA 1Z6NA 2WDUA 5DJMA 4TRXA 3UBKA 3TOTA 1PN0A 3EU4A 1R26A 4NWYA 4OD7A 2LRNA 4ML1A 3TKSA 2GZZA 4LMWA 4F03A 4IW9A 4G0KA 4HI7A 1F3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WT1 A;  5CAX A;  1AW9 A;  2ON5 A;  2LJA A;  3QOU A;  2JZR A;  3IV4 A;  1ILO A;  2IWT A;  2TIR A;  5B8B A;  2LRT A;  2IME A;  4ML6 A;  1JZO A;  1QK8 A;  5CO3 A;  4EL1 A;  3I9V 2;  1X0R A;  4FYC A;  2OAD A;  1GRX A;  3TKP A;  5HFG A;  1OC3 A;  5A4V A;  5A4W A;  3UJ1 A;  3KH9 A;  2XPD A;  2V2G A;  5IM9 A;  2AUV A;  1B48 A;  1ERV A;  1FAA A;  3HXS A;  1URM A;  2GT5 A;  2H1A A;  5DAK A;  5JCW A;  5DBQ A;  1FB6 A;  3WYW A;  2HZE A;  2IIY A;  14GS A;  1SU9 A;  4IQ1 A;  2R4V A;  1XOB A;  3HA9 A;  1IYH A;  3RDW A;  2DJ1 A;  2H74 A;  4BVY A;  2GZY A;  4MJC A;  3DKS A;  2CV4 A;  4F0C A;  1G7O A;  1SL0 B;  1LBK A;  3K8N A;  5D96 A;  17GS A;  2YP6 A;  3CTG A;  2LRC A;  5GST A;  4TXO A;  3RPN A;  5ELA A;  3GIX A;  3WGX A;  4WXT A;  1MDK A;  2DIZ A;  2GSS A;  3L9S A;  4K7O A;  3LOR A;  3TKQ A;  4EUY A;  1WPI A;  1YDK A;  4WF5 A;  1K0O A;  3GH6 A;  2R6K A;  1TW9 A;  1M0U A;  1U3I A;  4PX1 A;  2VD1 A;  2VLT A;  1KBN A;  3FZA A;  3LG6 A;  13GS A;  3C8E A;  3PH9 A;  3EU3 A;  2LJR A;  2H1D A;  3WGD A;  1XXU A;  4ACS A;  1GP1 A;  3C73 A;  3W8J A;  4KH7 A;  4IP6 A;  3IDV A;  3UMA A;  3TKS C;  1IYI A;  4MJA A;  3U6V A;  3HKR A;  4XS6 A;  3VK9 A;  2WJU A;  6GSY A;  2HNL A;  1AIU A;  3MNG A;  3TJG A;  1ERU A;  2B1K A;  4ZIL A;  1ABA A;  3LSZ A;  2RUF A;  5JCU A;  2AYT A;  2B7J A;  1XOA A;  4BA7 A;  3VWV A;  1G0T A;  4G2E A;  1V57 A;  4EF0 A;  4I2U A;  1OC9 B;  1O8W A;  4Q5N A;  4GQF A;  5A4U A;  2LV3 A;  4PQ1 A;  2OE0 A;  2FWE A;  1NM3 A;  4HEA 2;  4KAE A;  1QQ2 A;  5ECN B;  4DSS A;  5LNK e;  4OCE A;  1BJX A;  5ECR B;  1M9B A;  3LXT A;  3GUS A;  4IJI A;  1KTE A;  3GUR A;  2NBS A;  3KM6 A;  1TXX A;  2B5X A;  1MD3 A;  2GQK A;  3GA4 A;  1TU8 A;  1WWJ A;  3H93 A;  3TJF A;  2EIR A;  4RI7 A;  3ZRE A;  1RW1 A;  1DBY A;  1M2B A;  3I6A A;  1ON4 A;  2H70 A;  4TR3 A;  4KDU A;  2FHE A;  1M2A A;  1VF4 A;  5J5N A;  5H5S A;  1MDI A;  2PPT A;  5ELG A;  3LXZ A;  1OC8 A;  5DVB A;  2HRF A;  2H6Z A;  1PD2 1;  1Z7R A;  5CRD A;  4KGI A;  3GV1 A;  4PGT A;  2A2S A;  3KP8 A;  4TXV A;  1VF1 A;  1EV9 A;  1PN9 A;  1A8L A;  5ECS A;  3KH7 A;  1LJR A;  1T1V A;  3ERW A;  2H73 A;  5ENU A;  4AF2 A;  3US3 A;  4XRA A;  4IS0 A;  3DXB A;  3CMI A;  2AHE A;  2O8V B;  5KN2 A;  4OMV A;  2I3Y A;  4HZ4 A;  2P5Q A;  1U3A A;  2B1L A;  3MSZ A;  4V1A g;  9GSS A;  2JAD A;  2RUE A;  2P31 A;  1JZW A;  4EE0 A;  2K6V A;  4FYB A;  4X43 A;  4MCU A;  2C0F A;  3MAK A;  2BJX A;  5G1L A;  5IOX A;  5IPG A;  2PUK C;  2H76 A;  3ME7 A;  3TUE A;  1ST9 A;  2DJJ A;  11GS A;  5FT3 A;  1JZR A;  4DEJ A;  3BCK A;  1F3B A;  2BMX A;  1FW1 A;  3D22 A;  2WCI A;  3IA1 A;  4EXJ A;  2WFC A;  5IIZ A;  5DQY A;  1YEX A;  2VL3 A;  1K0D A;  1I5G A;  5IOW A;  3NZN A;  2EIQ A;  1WRY A;  4K2D A;  2C80 A;  1S3A A;  1XW5 A;  5ID2 B;  3VI5 A;  2FD3 A;  5F8B A;  3GN3 A;  1EOH A;  5IMC A;  3GX8 A;  3GYK A;  1SEN A;  4L0W A;  1Z6M A;  2LJK A;  3RHC A;  2H0H A;  4TW5 A;  1EGR A;  1ZCP A;  2YAN A;  1XWB A;  5AIV A;  1K0M A;  3ZTL A;  4HZ2 A;  5J41 A;  2LNT A;  1GUH A;  1EP7 A;  3APQ A;  1V9W A;  2IFQ A;  5B6N A;  5CRW A;  4QQ7 A;  2CVB A;  1BED A;  3CSI A;  1KEB A;  2FGX A;  2WZ9 A;  4DSR A;  2C8U A;  3MWH A;  1ZGN A;  4MAB A;  2OJL A;  3VPT A;  2OBK A;  4JE1 A;  1RK4 A;  2GDR A;  2CVK A;  2WS2 A;  4NHZ A;  2R2J A;  3F9U A;  2GQL A;  1NHY A;  2KP1 A;  4MLY A;  5E59 A;  3FZ4 A;  3I69 A;  3G9B A;  4ILF A;  1M99 A;  3HD5 A;  2O87 A;  1J08 A;  2WGR A;  3D5J A;  5DAK B;  1DE1 A;  2IN3 A;  4KX4 A;  5D73 A;  3E9J B;  3WT2 A;  2HZE B;  3IAS 2;  3IHQ A;  3HCZ A;  4ZL8 A;  5B6M A;  1PKZ A;  1S3D A;  3APS A;  1SL1 B;  2CT6 A;  2R3X A;  5AIS A;  2CAQ A;  2GQM A;  3ZFB A;  2VD0 A;  3O3T A;  3Q6O A;  3M3M A;  4BPY A;  2H71 A;  4PQH A;  6GST A;  3M0F A;  1ZL9 A;  4DVC A;  1ACV A;  1OKD A;  4TXO B;  5ECM B;  2VO4 A;  1JZD A;  1K0B A;  1ZMA A;  3M1G A;  1G6Y A;  1X9W B;  4HOJ A;  3P90 A;  5CRE A;  3VWW A;  2TRX A;  3ZVJ A;  3CRU A;  3EIN A;  1G7E A;  2N5A A;  5JWQ B;  2X8G A;  4MPF A;  1FVJ A;  1H4O A;  2JZS A;  1BG5 A;  3LYP A;  3D0Z A;  3M9J A;  1TK5 B;  2YZH A;  1AQW A;  4YAP A;  3TRQ A;  7GSS A;  2LQQ A;  3D4T A;  5ECO B;  3ZZX A;  3ZIV A;  5HQP A;  4LMV A;  3JCM L;  5G1K A;  3DVW A;  1X5D A;  2VL9 A;  3C71 A;  1OVN A;  1SK0 A;  5F05 A;  3QMX A;  4I97 A;  3KJY A;  1NW2 A;  3MDK A;  5ABR A;  4AGS A;  3ED3 A;  4WBJ A;  3VFI A;  1O6J A;  1XCC A;  4GWR A;  2J23 A;  1E2Y A;  4ZL7 A;  1FO5 A;  3UOM A;  4L5L A;  2GS3 A;  5ECL B;  1PX7 A;  4NXI A;  1F6M C;  1UVZ A;  4JBB A;  2A2R A;  4EC0 A;  1YQ1 A;  1VGL A;  1SKR B;  1TRS A;  3P7X A;  2ZCT A;  3UAR A;  5ID2 A;  2C3Q A;  2O85 A;  5J9C A;  4JZQ A;  2C0E A;  1X9S B;  1A2J A;  2YZU A;  1TK8 B;  4MH3 A;  3FR6 A;  4KND A;  4CDO A;  3S9F A;  3D4M A;  4DSS B;  3FR3 A;  2N5F A;  4XS4 A;  2H0G A;  3TOU A;  4K7I A;  1SD8 A;  2J9H A;  4YH2 A;  2P0G A;  4JR4 A;  5KN0 A;  4EO3 A;  2CX4 A;  4I2T A;  2VL2 C;  3ZIT A;  5GAP D;  1B8X A;  1ZYE A;  1K3Y A;  5G5E A;  1XVW A;  4IJ3 A;  1A2L A;  2HXK A;  3DD3 A;  4MJB A;  1K0A A;  3KTB A;  5AN1 A;  3IPZ A;  5EL8 A;  3EMP A;  1S3C A;  2JU5 A;  2V41 A;  2Z9S A;  1GWC A;  1ZYQ B;  4QL7 A;  2OKA A;  3LYK A;  2VLV A;  3I43 A;  1SD9 A;  2AV4 A;  2VLU A;  3H8Q A;  10GS A;  2FLS A;  1B4Q A;  4ECJ A;  3EVI A;  3N9J A;  1JLV A;  1SL2 B;  1TI3 A;  1O7U A;  1PKW A;  3LGC A;  2KUC A;  3A2X A;  5JWO B;  4WKW A;  4WR4 A;  2OA7 A;  1JHB A;  1ZOF A;  4QL9 A;  1F37 A;  1ERW A;  4POM A;  2FUG 2;  1CQG A;  1GTI A;  1PRX A;  2MMA A;  2OE1 A;  4CW9 A;  2E7P A;  5DAL A;  3L9V A;  4OO4 A;  4EVM A;  4PUF C;  4ZBB A;  1YKC A;  1JLW A;  1T4Z A;  5CNW A;  3TKS E;  2K18 A;  3F4S A;  5L71 A;  4L5O A;  4YQV A;  2YWM A;  3EWL A;  4K0N A;  5E4W A;  4J56 E;  3IBH A;  3QAW A;  4N0V A;  1XWC A;  2FWF A;  1OAZ A;  5KEJ A;  3U5R E;  2PBJ A;  3KMO A;  3Q74 A;  2F8F A;  4IP1 A;  1EGO A;  2YOI A;  1EWX A;  1USB A;  4NHW A;  3A5W A;  3DVX A;  3LEF A;  4TR4 A;  4POB A;  1G6W A;  1EV4 A;  2ZNM A;  2F9S A;  1JFU A;  1Q4J A;  4TR1 A;  2H66 A;  2CZ2 A;  3IK7 A;  3TJB A;  5GZZ B;  1M9A A;  3GL5 A;  3E0U A;  2PVQ A;  3F3R A;  4TR0 A;  2CA8 A;  22GS A;  1SK2 A;  2MMO A;  1J9B A;  1EEJ A;  2NVL A;  5H5Q A;  2IL3 A;  4MH2 A;  4D73 A;  4OFN A;  4HU7 A;  1R5P A;  1TRU A;  4KCA A;  3AY8 A;  2IFQ B;  5HR0 A;  3QDN A;  1HQO A;  3LQ7 A;  1X5E A;  3F4T A;  1C72 A;  1SYX A;  3KZQ A;  4FYU A;  3VWX A;  1V58 A;  4KB3 A;  2XBQ A;  3FRC A;  3O76 A;  3DYR A;  4HUA A;  1YZX A;  3IOS A;  2B5E A;  4IEL A;  3VLN A;  4Z7X A;  2YWN A;  1A0R P;  2HYX A;  2VIM A;  1AAZ A;  3RAZ A;  5GAN D;  1A24 A;  4L8E A;  3HDC A;  1GNW A;  1GUL A;  3TJJ A;  4K6X A;  4HU9 A;  2HFD A;  2M72 A;  5G2Z A;  3D21 A;  1N2A A;  1XWG A;  2MMN A;  3QAV A;  4EDZ A;  5IO2 A;  1J0F A;  3BCI A;  2H6Y A;  3W8S A;  2LNS A;  4KA0 A;  1U6T A;  3GMF A;  1R7H A;  4TN8 A;  2ZUP A;  2JAC A;  3ZVJ D;  2OBI A;  4GLT A;  1BAY A;  2OAC A;  3H4K A;  2CQ9 A;  1HNA A;  2DSA A;  3DGQ A;  1QFN A;  4ZB9 A;  3PGT A;  1SJZ A;  1GL8 A;  2DJ0 A;  2C3T A;  4LA1 A;  3G7J A;  4GF0 A;  3Q19 A;  4K8M A;  1V40 A;  2QSI A;  2X64 A;  3F3Q A;  5COH A;  2H19 A;  4MJE A;  2B3S A;  4LLR A;  2RM5 A;  4LL4 B;  3H1N A;  4GST A;  2WRT A;  3CTF A;  2EIO A;  2P5R A;  1NSW A;  2M46 A;  3ERG A;  2K8S A;  4OFM A;  3HVX A;  2HSY A;  1M7T A;  4GRF A;  2A4V A;  1O81 A;  1A2M A;  1AQV A;  3NIV A;  4MZW A;  5HFK A;  4BVX A;  1OE7 A;  2G2Q A;  1SJI A;  1GUM A;  2REM A;  2BTO T;  2FNO A;  2V1M A;  4JED A;  3EC3 A;  2LKU A;  1X9M B;  1U88 A;  4KSO A;  3ZML A;  2IJY A;  3FR9 A;  3HJM A;  3IK9 A;  4ZIJ A;  5DQS A;  2NTO A;  3KP9 A;  2GGT A;  2VCW A;  3V1W A;  2H75 A;  3ERF A;  3L9U A;  1WMJ A;  2LTK A;  2E2G A;  2PMT A;  2VCX A;  1PA3 A;  5ECH B;  5HR2 A;  4YQM A;  2AJQ B;  1AC1 A;  1YJ6 A;  1Z3E A;  3HJO A;  2CAI A;  4POK A;  3P2A A;  1XWA A;  4OCF A;  3F63 A;  2H72 A;  4XS4 B;  3GRX A;  3CRT A;  4F2I A;  2KHP A;  5DDL A;  1GLQ A;  2XC2 A;  4MMM A;  19GS A;  4MP4 A;  5DCG A;  1ERT A;  3RHB A;  3WD6 A;  3ZMK A;  1PL2 A;  4PUA A;  2QKE A;  5JCG A;  1BYE A;  4OWY A;  5IMA A;  3J7Y b;  4OO5 A;  2L4Q A;  2H0I A;  4V2N A;  1ZZY A;  1T7P B;  1Q98 A;  3HVV A;  1O73 A;  12GS A;  1DSB A;  3DWV A;  4RQX A;  3KD0 A;  4KDY A;  4WBR D;  4Q5Q A;  5B7C A;  4AJ8 A;  2RII A;  5J9B A;  5INY A;  2IMF A;  3VUR A;  4ZB6 A;  2MZC A;  3L0H A;  2L4C A;  3C7M A;  4N10 A;  4IQA A;  2IMI A;  5IQY A;  3M8N A;  4BWQ A;  4N0Z A;  1XBS A;  3HJP A;  3CSJ A;  1PL1 A;  2VM1 A;  5DAL B;  1GH2 A;  3IRA A;  5J3R A;  5KN3 A;  4KDX A;  4PXO A;  1GUK A;  2PGT A;  4KUN A;  4NAX A;  3QD9 A;  1TU7 A;  2FY6 A;  3O6T A;  1K3L A;  2GTU A;  5B8A A;  1K3O A;  3BBY A;  2GSQ A;  1R5A A;  4NV5 A;  1W89 A;  3DRN A;  3VWU A;  2C4J A;  4V2L A;  2I4A A;  4RQR A;  4MZB A;  4XRD A;  2WUL A;  3F4R A;  2VM2 A;  4RI6 A;  2GST A;  2AAW A;  4NMU A;  2LUS A;  2IPA A;  2DMM A;  6GSW A;  1T8E B;  1O85 A;  3F6D A;  4MA9 A;  5KN1 A;  4X1U A;  2YCD A;  3GNJ A;  1PGT A;  4O32 A;  5DCH A;  3IR4 A;  2HE3 A;  1WE0 A;  4TR1 B;  3C1R A;  3HHV A;  2L6D A;  3VPQ A;  4MF5 A;  4I6X A;  4O5R A;  2IMD A;  1FOV A;  5IMV A;  2DML A;  2HSH A;  2L6C A;  4TOP A;  4OFT A;  3KEB A;  3IAM 2;  3BD2 A;  4ZXG A;  1GTU A;  2CVD A;  1QGV A;  1VF3 A;  3BJ5 A;  5EVO A;  2VCT A;  4GSS A;  1XZO A;  4D73 B;  1X5C A;  3GKK A;  4ZL9 A;  3FEU A;  3UAP A;  4J57 E;  5F0G A;  4F82 A;  1TI1 A;  4I5Q A;  4FO5 A;  6GSX A;  4WET A;  2FWH A;  1TKD B;  2QGV A;  3HYP A;  2QC7 A;  1HD2 A;  2I1U A;  4LL1 B;  2GZP A;  5GSS A;  8GSS A;  4KCE A;  4J2F A;  4MK3 A;  1QMV A;  2ON7 A;  3J7Y k;  4Q5R A;  3TB2 A;  4KW6 A;  2YJH A;  4MZC A;  3QFB C;  5JWR B;  2LQO A;  1CQH A;  3N5O A;  1GSF A;  4WR5 A;  4YAV A;  3QPM A;  2VAF A;  2VUP A;  2XBI A;  1XPV A;  2I81 A;  4EKZ A;  4WF4 A;  1Z7P A;  4F0B A;  3GHA A;  3FK8 A;  2VCZ A;  5D9W A;  1GTB A;  3G7Y A;  3L78 A;  4TKY A;  3LJR A;  1AUC A;  4GTU A;  1N8J A;  3W6G A;  2PU9 C;  5A5K A;  3GKX A;  2H01 A;  3UBL A;  2TRC P;  5D93 A;  4CHS A;  1KNG A;  1Y25 A;  2YWO A;  1GSD A;  3QFA C;  1WJK A;  3A3T A;  2XHF A;  3GFK A;  5IO0 A;  3HVS A;  3GL3 A;  5G31 A;  2HRN A;  1Z5Y E;  4KSM A;  5FWG A;  5H5R A;  1QUW A;  2YV7 A;  4E8E A;  1GLP A;  1B4P A;  1F9M A;  4XS1 A;  3L4N A;  4GSN A;  3ZIJ A;  1T4Y A;  4NV2 A;  2CZ3 A;  4O7H A;  4JR6 A;  5EPF A;  2GT6 A;  3CXG A;  4X0X A;  2JZT A;  2HZF A;  4XTS A;  2R37 A;  1GTA A;  1GNE A;  2C3N A;  4G10 A;  1DUG A;  1MD4 A;  2M80 A;  2C0D A;  1LU4 A;  5ECQ B;  1XVQ A;  1XIY A;  16GS A;  1AXD A;  5CYY A;  1ML6 A;  1FB0 A;  4RUV A;  3F6F A;  4XIH A;  1THX A;  4MF7 A;  1SYR A;  4BWS A;  3HZ4 A;  1Y6E A;  1PMT A;  2ES7 A;  3SBC A;  5EY6 A;  2AB6 A;  2DJ2 A;  4JRR A;  1MEK A;  2V32 A;  2FA8 A;  2K9F A;  2X8H A;  1W4V A;  4V1A p;  2GVP A;  4HQS A;  3CBU A;  1TTZ A;  2HT9 A;  1PSQ A;  4HDE A;  1H75 A;  1GSE A;  3F8U A;  1YF0 A;  3GTU A;  3ME8 A;  2K8V A;  5HR3 A;  2RLI A;  2V6K A;  3QR6 A;  4K7N A;  1SKW B;  3PIN A;  5C00 A;  4POL A;  3QAG A;  1HYU A;  5HR1 A;  2E0Q A;  4H86 A;  6GSV A;  1SKS B;  2R5G A;  2H30 A;  2HI7 A;  1MTC A;  3CSH A;  4JU5 A;  2V6O A;  4ZBA A;  2DJ3 A;  1XW9 A;  3IC4 A;  1HNC A;  5IMD A;  1SJ6 A;  3ISO A;  3KMN A;  3EMX A;  1V98 A;  2WB9 A;  2PVO C;  4G9H A;  3OR5 A;  1T00 A;  2EC4 A;  1F2E A;  4FH8 A;  3GKM A;  3EE2 A;  2FWG A;  4EDY A;  5D9V A;  4IHU A;  5CP1 A;  2JSZ A;  4AJ7 A;  3TGZ A;  2O89 A;  4K0G A;  2FA4 A;  2KP2 A;  4ID0 A;  4ZB8 A;  2DIY A;  3FZ9 A;  1EOG A;  2B6M A;  2C0G A;  4IKH A;  3KGK A;  1RQM A;  3C1S A;  2YNX A;  1FHE A;  4ECC A;  2LEG A;  4PQI A;  4TVE A;  5IMF A;  2B5Y A;  3G7I A;  3KTL A;  4N11 A;  1U87 A;  1V2A A;  4GXZ A;  2IMK A;  1YY7 A;  2KLX A;  18GS A;  1EP8 A;  3APO A;  3RPP A;  2HLS A;  5D9T A;  2YJ7 A;  2VOC A;  1TK0 B;  4ULX A;  4WEY A;  6GSS A;  3HZ8 A;  3RBT A;  3R2Q A;  1GSY A;  2L5L A;  1R4W A;  1GSS A;  3UEM A;  4F9Z A;  3M9K A;  3FY7 A;  4XCS A;  2GLR A;  1GSQ A;  1TRW A;  2F51 A;  4XHM A;  5FHI A;  4BL7 A;  2H8L A;  3H79 A;  1VF2 A;  4DSQ A;  1FVK A;  2DLX A;  3F0I A;  2B7K A;  2MBT A;  3ZYW A;  4MDC A;  2RM6 A;  3UIW A;  5C04 A;  1A0F A;  4Q5F A;  3E3E A;  2DC5 A;  3D6I A;  3KXO A;  4K9Z A;  2JL4 A;  4HJ2 A;  1EEM A;  3A2V A;  2XPE A;  5LCZ A;  3GSS A;  1A8Y A;  1OE8 A;  1HNB A;  2YWI A;  2F8A A;  3KCM A;  2H1G A;  1B9X C;  4GQC A;  3IXR A;  5ECP B;  1QXH A;  1UN2 A;  1TP9 A;  1K0N A;  4ECI A;  2JSY A;  2LS5 A;  2YN1 A;  3UVH A;  2VCV A;  3CYN A;  3NOF A;  1K0C A;  3FKF A;  2FCH A;  3KIJ A;  4KE3 A;  1E6B A;  5D8I A;  4I8B A;  5DJL A;  2VCQ A;  4IN0 A;  3SWL A;  2L5O A;  1TOF A;  3Q18 A;  4V2M A;  3TDG A;  3P8W A;  3GH9 A;  3VI7 A;  4IVF A;  4HS1 A;  2H6X A;  4IBP A;  2D2Z A;  5LD0 A;  1WP0 A;  4MF6 A;  2L59 A;  4K1F A;  3ZFL A;  5F07 A;  3UVT A;  3TKR A;  1BQ7 A;  5ECI B;  1OC9 A;  1TJD A;  5J4U A;  1XFL A;  4ISD A;  2MYG A;  3TRX A;  3FYG A;  2E2M A;  4MPG A;  4NPB A;  3ZRD A;  1M2D A;  1YEP A;  5IMZ A;  2GSR A;  4E8H A;  2L57 A;  3DML A;  2YPM A;  2NDO A;  3FHK A;  1EZK A;  1TDI A;  4G19 A;  4GCI A;  2PN8 A;  1NHO A;  3HY2 A;  2PER A;  2VL2 A;  3UL3 A;  3WGE A;  3GST A;  3LFL A;  2ALB A;  4ECB A;  3TJK A;  3ZL5 A;  1PX6 A;  2G0F A;  1MDJ A;  4N30 A;  1I9D A;  3IE3 A;  1BX9 A;  2YV9 A;  3BOA A;  3PR8 A;  6GSU A;  1TRV A;  1THO A;  2DBC A;  4P3Y B;  1Z9H A;  2PWJ A;  4FIW A;  3FZ5 A;  1SK1 A;  5CRG A;  4PNG A;  4PNF A;  1GSU A;  20GS A;  3GKN A;  1B9Y C;  5D9X A;  1OYJ A;  1FG4 A;  1T3B A;  5F06 A;  2O7K A;  5AIX A;  1VRS D;  2X8C A;  1DE2 A;  4HJM A;  2F3M A;  1OKT A;  1WOU A;  1A23 A;  3ZLP A;  3A2W A;  1XW6 A;  2DJK A;  2I9H A;  1UA5 A;  4PUR A;  5ECK B;  2NPB A;  5CRH A;  2H1B A;  4O92 A;  1AQX A;  4ZBD A;  3FW2 A;  2C1Y A;  3TRP A;  1XWK A;  4L0U A;  3EYT A;  3DEX A;  1YKA A;  5G5F A;  3EUR A;  1PQN A;  2MBS A;  2KOK A;  2MMZ A;  3GTU B;  2LST A;  1YF1 A;  4YQU A;  3DIE A;  3QCP A;  4AJ6 A;  5AGY A;  1UC7 A;  3LWA A;  2X99 A;  2OE3 A;  2CX3 A;  3TCO A;  2N5B A;  5HFI A;  1O8X A;  5G30 A;  3GX0 A;  1WIK A;  4IGJ A;  4HQZ A;  5IPH A;  1Z6N A;  2WDU A;  5DJM A;  4TRX A;  3UBK A;  3TOT A;  3EU4 A;  1R26 A;  4NWY A;  4OD7 A;  2LRN A;  4ML1 A;  3TKS A;  2GZZ A;  4LMW A;  4F03 A;  4IW9 A;  4HI7 A;  1F3A A; 
#chains in the Genus database with same CATH topology
 1XG8 A;  3WT1 A;  3EPT A;  5CAX A;  1AW9 A;  2ON5 A;  2LJA A;  3QOU A;  2JZR A;  3IV4 A;  1ILO A;  2IWT A;  2TIR A;  5B8B A;  2LRT A;  2IME A;  4ML6 A;  1JZO A;  1QK8 A;  5CO3 A;  4EL1 A;  3I9V 2;  1X0R A;  4FYC A;  2OAD A;  1GRX A;  3TKP A;  5HFG A;  1OC3 A;  5A4V A;  5A4W A;  3UJ1 A;  3KH9 A;  2XPD A;  2V2G A;  5IM9 A;  2AUV A;  1B48 A;  1ERV A;  1FAA A;  3HXS A;  1URM A;  2GT5 A;  2H1A A;  5DAK A;  5JCW A;  5DBQ A;  1FB6 A;  3WYW A;  2HZE A;  2IIY A;  3IC8 A;  14GS A;  1SU9 A;  4IQ1 A;  2R4V A;  1XOB A;  3HA9 A;  1IYH A;  3RDW A;  2DJ1 A;  2H74 A;  4BVY A;  2GZY A;  4MJC A;  3DKS A;  2CV4 A;  4F0C A;  1G7O A;  1SL0 B;  1LBK A;  3K8N A;  5D96 A;  17GS A;  2YP6 A;  3CTG A;  2LRC A;  5GST A;  4TXO A;  3RPN A;  5ELA A;  3GIX A;  3WGX A;  4WXT A;  1MDK A;  2DIZ A;  2GSS A;  3L9S A;  4K7O A;  3LOR A;  3TKQ A;  4EUY A;  1WPI A;  1YDK A;  4WF5 A;  1K0O A;  3GH6 A;  2R6K A;  3MIX A;  1TW9 A;  1M0U A;  1U3I A;  4PX1 A;  2VD1 A;  2VLT A;  1KBN A;  3FZA A;  3LG6 A;  13GS A;  3C8E A;  3PH9 A;  2R0G A;  3EU3 A;  2LJR A;  2H1D A;  3WGD A;  1XXU A;  4ACS A;  1GP1 A;  3C73 A;  3W8J A;  4KH7 A;  4IP6 A;  3IDV A;  3R3E A;  3UMA A;  3TKS C;  1IYI A;  4MJA A;  3U6V A;  3HKR A;  4XS6 A;  3VK9 A;  2WJU A;  6GSY A;  2HNL A;  1AIU A;  3MNG A;  3TJG A;  1ERU A;  2B1K A;  4ZIL A;  1ABA A;  3LSZ A;  2RUF A;  5JCU A;  2AYT A;  2B7J A;  1XOA A;  4BA7 A;  3VWV A;  1G0T A;  4G2E A;  1V57 A;  4EF0 A;  4I2U A;  1OC9 B;  1O8W A;  4Q5N A;  4GQF A;  5A4U A;  2LV3 A;  4PQ1 A;  2OE0 A;  2FWE A;  1NM3 A;  4HEA 2;  4KAE A;  1QQ2 A;  5ECN B;  3HVN A;  4DSS A;  4OCE A;  5LNK e;  1BJX A;  5ECR B;  1M9B A;  3LXT A;  3GUS A;  4IJI A;  1KTE A;  3GUR A;  2NBS A;  3KM6 A;  1TXX A;  2B5X A;  1MD3 A;  2GQK A;  3GA4 A;  1TU8 A;  1WWJ A;  3H93 A;  3TJF A;  2EIR A;  4RI7 A;  3ZRE A;  1RW1 A;  1DBY A;  1M2B A;  3I6A A;  1ON4 A;  2H70 A;  4TR3 A;  4KDU A;  2FHE A;  1M2A A;  1VF4 A;  5J5N A;  5H5S A;  1MDI A;  2PPT A;  5ELG A;  3LXZ A;  2X49 A;  1OC8 A;  5DVB A;  2HRF A;  2H6Z A;  1PD2 1;  1Z7R A;  5CRD A;  4KGI A;  3GV1 A;  4PGT A;  2A2S A;  3KP8 A;  4TXV A;  4PTS A;  1VF1 A;  1EV9 A;  1PN9 A;  1A8L A;  5ECS A;  3KH7 A;  2HSM A;  1LJR A;  1T1V A;  3ERW A;  2H73 A;  5ENU A;  4AF2 A;  3US3 A;  4XRA A;  4IS0 A;  3DXB A;  3CMI A;  2AHE A;  2O8V B;  5KN2 A;  4OMV A;  2I3Y A;  4HZ4 A;  2P5Q A;  1U3A A;  2B1L A;  3MSZ A;  4V1A g;  9GSS A;  2JAD A;  2RUE A;  2P31 A;  1JZW A;  4EE0 A;  2K6V A;  4FYB A;  4X43 A;  4MCU A;  2C0F A;  3MAK A;  2BJX A;  5G1L A;  5IOX A;  4K5R A;  5IPG A;  2PUK C;  2H76 A;  2DKI A;  3ME7 A;  3TUE A;  1ST9 A;  2DJJ A;  11GS A;  5FT3 A;  1JZR A;  4DEJ A;  3BCK A;  1F3B A;  2BMX A;  1FW1 A;  3D22 A;  2WCI A;  3IA1 A;  4EXJ A;  2WFC A;  5IIZ A;  5DQY A;  1YEX A;  2VL3 A;  1K0D A;  1I5G A;  5IOW A;  3NZN A;  2EIQ A;  1WRY A;  4K2D A;  2C80 A;  1S3A A;  1XW5 A;  5ID2 B;  3VI5 A;  2FD3 A;  5F8B A;  3GN3 A;  1EOH A;  5IMC A;  3GX8 A;  3GYK A;  1SEN A;  4L0W A;  1Z6M A;  2LJK A;  3RHC A;  2H0H A;  4TW5 A;  1EGR A;  1ZCP A;  2QA2 A;  2YAN A;  1XWB A;  5AIV A;  1K0M A;  3ZTL A;  4HZ2 A;  5J41 A;  2LNT A;  1GUH A;  1EP7 A;  3APQ A;  1V9W A;  2IFQ A;  5B6N A;  5CRW A;  4QQ7 A;  2CVB A;  1BED A;  3CSI A;  1KEB A;  2FGX A;  2WZ9 A;  4DSR A;  2C8U A;  3MWH A;  4EIQ A;  1ZGN A;  4MAB A;  2OJL A;  3VPT A;  2OBK A;  4JE1 A;  1RK4 A;  2GDR A;  2CVK A;  2WS2 A;  4NHZ A;  2R2J A;  3F9U A;  2GQL A;  1NHY A;  2KP1 A;  4MLY A;  5E59 A;  3FZ4 A;  3I69 A;  3G9B A;  4ILF A;  1M99 A;  3HD5 A;  1FOH A;  2O87 A;  1J08 A;  2WGR A;  3D5J A;  5DAK B;  1DE1 A;  2IN3 A;  4KX4 A;  5D73 A;  3E9J B;  3WT2 A;  2HZE B;  3IAS 2;  3IHQ A;  3HCZ A;  4ZL8 A;  5B6M A;  1PKZ A;  1S3D A;  3APS A;  1SL1 B;  2CT6 A;  2R3X A;  5AIS A;  4BVY B;  2CAQ A;  2GQM A;  3ZFB A;  2VD0 A;  3O3T A;  3Q6O A;  3M3M A;  4BPY A;  2H71 A;  4PQH A;  6GST A;  3M0F A;  1ZL9 A;  4DVC A;  1ACV A;  1OKD A;  4TXO B;  5ECM B;  2VO4 A;  1JZD A;  1K0B A;  1ZMA A;  3M1G A;  1G6Y A;  1X9W B;  3IHG A;  4HOJ A;  3P90 A;  5CRE A;  3VWW A;  2TRX A;  3ZVJ A;  3CRU A;  3EIN A;  1G7E A;  1ZYN A;  2N5A A;  5JWQ B;  2X8G A;  4MPF A;  1FVJ A;  1H4O A;  2JZS A;  1BG5 A;  3LYP A;  3D0Z A;  3M9J A;  1PFO A;  1TK5 B;  2YZH A;  1AQW A;  4YAP A;  3TRQ A;  7GSS A;  2LQQ A;  3D4T A;  5ECO B;  3ZZX A;  3ZIV A;  5HQP A;  4LMV A;  3JCM L;  5G1K A;  3DVW A;  1X5D A;  2VL9 A;  3C71 A;  1OVN A;  1SK0 A;  2HRK A;  5F05 A;  3QMX A;  4I97 A;  3KJY A;  1NW2 A;  3MDK A;  5ABR A;  4AGS A;  3ED3 A;  4WBJ A;  3VFI A;  1O6J A;  1XCC A;  4GWR A;  2J23 A;  1E2Y A;  4ZL7 A;  1FO5 A;  3UOM A;  4L5L A;  2GS3 A;  5ECL B;  1PX7 A;  4NXI A;  1F6M C;  1UVZ A;  4JBB A;  2A2R A;  4EC0 A;  1YQ1 A;  1VGL A;  1SKR B;  1TRS A;  3P7X A;  2ZCT A;  3UAR A;  5ID2 A;  2C3Q A;  2O85 A;  5J9C A;  4JZQ A;  2C0E A;  1X9S B;  1A2J A;  2YZU A;  1TK8 B;  4MH3 A;  3FR6 A;  4KND A;  4CDO A;  3S9F A;  3D4M A;  4DSS B;  3FR3 A;  2N5F A;  4MNN A;  4XS4 A;  2H0G A;  3TOU A;  4K7I A;  1SD8 A;  2J9H A;  4YH2 A;  2P0G A;  4JR4 A;  5KN0 A;  4EO3 A;  2CX4 A;  4I2T A;  2VL2 C;  3ZIT A;  5GAP D;  1B8X A;  1ZYE A;  1K3Y A;  5G5E A;  1XVW A;  4FQU A;  4IJ3 A;  1A2L A;  2HXK A;  3DD3 A;  4MJB A;  1K0A A;  3KTB A;  5AN1 A;  3IPZ A;  3EMP A;  5EL8 A;  1S3C A;  2JU5 A;  2V41 A;  2Z9S A;  1GWC A;  1ZYQ B;  4QL7 A;  2OKA A;  3LYK A;  2VLV A;  3I43 A;  1SD9 A;  2AV4 A;  2VLU A;  3H8Q A;  2DKH A;  10GS A;  2FLS A;  1B4Q A;  4ECJ A;  3EVI A;  3N9J A;  1JLV A;  1SL2 B;  1TI3 A;  1O7U A;  1PKW A;  3LGC A;  2KUC A;  3A2X A;  5JWO B;  4WKW A;  4WR4 A;  2OA7 A;  1JHB A;  1ZOF A;  4QL9 A;  4EIP A;  1F37 A;  1ERW A;  4POM A;  2HRA A;  2FUG 2;  1CQG A;  1GTI A;  1PRX A;  2MMA A;  2OE1 A;  4CW9 A;  2E7P A;  5DAL A;  3L9V A;  4OO4 A;  4X4J A;  4EVM A;  4PUF C;  4ZBB A;  1YKC A;  1JLW A;  1T4Z A;  5CNW A;  3TKS E;  2K18 A;  3F4S A;  1ZYP A;  5L71 A;  4L5O A;  4YQV A;  2YWM A;  3EWL A;  4K0N A;  5E4W A;  4J56 E;  3IBH A;  3QAW A;  4N0V A;  1XWC A;  2FWF A;  1OAZ A;  5KEJ A;  4O5U A;  3U5R E;  2PBJ A;  3KMO A;  3Q74 A;  2F8F A;  4IP1 A;  3MYD A;  1EGO A;  2YOI A;  4K2X A;  4YKF A;  1EWX A;  1USB A;  4K5S A;  4NHW A;  3A5W A;  3DVX A;  3LEF A;  4TR4 A;  4POB A;  1G6W A;  1EV4 A;  2ZNM A;  2F9S A;  1JFU A;  1Q4J A;  2A2P A;  4TR1 A;  2H66 A;  2CZ2 A;  3IK7 A;  3TJB A;  5GZZ B;  1M9A A;  3GL5 A;  3E0U A;  2PVQ A;  3F3R A;  4TR0 A;  2CA8 A;  22GS A;  1SK2 A;  3FMW A;  2MMO A;  4Z2U A;  1J9B A;  1EEJ A;  2NVL A;  5H5Q A;  2IL3 A;  4MH2 A;  4D73 A;  4OFN A;  4HU7 A;  1R5P A;  1TRU A;  2A4H A;  4KCA A;  3AY8 A;  2IFQ B;  5HR0 A;  3QDN A;  1HQO A;  3LQ7 A;  1X5E A;  3F4T A;  1C72 A;  1SYX A;  3KZQ A;  4FYU A;  3VWX A;  1V58 A;  4KB3 A;  2XBQ A;  3FRC A;  3O76 A;  3DYR A;  4HUA A;  1YZX A;  3IOS A;  2B5E A;  4IEL A;  3VLN A;  4Z7X A;  2YWN A;  1A0R P;  2HYX A;  2VIM A;  1AAZ A;  3RAZ A;  4CY6 A;  5GAN D;  1A24 A;  4L8E A;  3HDC A;  1GNW A;  1GUL A;  3TJJ A;  4K6X A;  4HU9 A;  2HFD A;  2M72 A;  5G2Z A;  3D21 A;  1N2A A;  1XWG A;  2MMN A;  3QAV A;  4EDZ A;  5IO2 A;  1J0F A;  3BCI A;  2H6Y A;  3W8S A;  2LNS A;  4KA0 A;  1U6T A;  3GMF A;  1R7H A;  4TN8 A;  2ZUP A;  2JAC A;  3ZVJ D;  2OBI A;  4GLT A;  1BAY A;  2OAC A;  3H4K A;  2CQ9 A;  1HNA A;  2DSA A;  3DGQ A;  1QFN A;  4ZB9 A;  3PGT A;  1SJZ A;  1GL8 A;  2DJ0 A;  2C3T A;  4LA1 A;  3G7J A;  4GF0 A;  3Q19 A;  4K8M A;  1V40 A;  2QSI A;  2X64 A;  3F3Q A;  5COH A;  2H19 A;  4MJE A;  2B3S A;  4KF9 A;  4LLR A;  2RM5 A;  4LL4 B;  3H1N A;  4GST A;  2WRT A;  3CTF A;  2EIO A;  2P5R A;  1NSW A;  2M46 A;  3ERG A;  2K8S A;  2UZ8 A;  4OFM A;  3HVX A;  2HSY A;  1M7T A;  4GRF A;  2A4V A;  1O81 A;  1A2M A;  1AQV A;  3NIV A;  4MZW A;  5HFK A;  4BVX A;  1OE7 A;  2G2Q A;  1SJI A;  1GUM A;  2REM A;  2BTO T;  2FNO A;  2V1M A;  4JED A;  3EC3 A;  2LKU A;  1X9M B;  1U88 A;  4KSO A;  3ZML A;  2IJY A;  3FR9 A;  3HJM A;  3IK9 A;  4ZIJ A;  5DQS A;  2NTO A;  3KP9 A;  4YKG A;  2GGT A;  2VCW A;  3V1W A;  2H75 A;  3ERF A;  3PPU A;  3L9U A;  1WMJ A;  2LTK A;  2E2G A;  2PMT A;  2VCX A;  1PA3 A;  5ECH B;  5HR2 A;  4YQM A;  2AJQ B;  1AC1 A;  1YJ6 A;  1Z3E A;  3HJO A;  2CAI A;  4POK A;  3P2A A;  1XWA A;  4OCF A;  3F63 A;  2H72 A;  4XS4 B;  3GRX A;  3CRT A;  4F2I A;  2KHP A;  4A5P A;  5DDL A;  1GLQ A;  2XC2 A;  4MMM A;  19GS A;  4MP4 A;  5DCG A;  1ERT A;  3RHB A;  3WD6 A;  3ZMK A;  1PL2 A;  4PUA A;  2QKE A;  5JCG A;  1BYE A;  4OWY A;  5IMA A;  3J7Y b;  4OO5 A;  2L4Q A;  2H0I A;  4V2N A;  1ZZY A;  1T7P B;  1Q98 A;  3HVV A;  1O73 A;  12GS A;  1DSB A;  4G0L A;  3DWV A;  4RQX A;  3KD0 A;  4KDY A;  4WBR D;  2X4A A;  4Q5Q A;  4O5Q A;  5B7C A;  4AJ8 A;  2RII A;  5J9B A;  5INY A;  2IMF A;  4USS A;  3VUR A;  4ZB6 A;  2MZC A;  3L0H A;  5KOW A;  2L4C A;  3C7M A;  4N10 A;  4IQA A;  2IMI A;  5IQY A;  3M8N A;  4BWQ A;  4N0Z A;  1XBS A;  3HJP A;  3CSJ A;  1PL1 A;  2VM1 A;  5DAL B;  1GH2 A;  3IRA A;  5J3R A;  5KN3 A;  4KDX A;  4PXO A;  1GUK A;  2PGT A;  4KUN A;  4NAX A;  3QD9 A;  1TU7 A;  2FY6 A;  3O6T A;  1K3L A;  2GTU A;  5B8A A;  1K3O A;  3BBY A;  2GSQ A;  1R5A A;  4NV5 A;  1W89 A;  3LW9 A;  3DRN A;  3VWU A;  2C4J A;  4V2L A;  2I4A A;  4RQR A;  4MZB A;  4XRD A;  2WUL A;  3F4R A;  2VM2 A;  4RI6 A;  2GST A;  2AAW A;  4NMU A;  2LUS A;  2IPA A;  2DMM A;  6GSW A;  1T8E B;  1O85 A;  3F6D A;  4MA9 A;  5KN1 A;  4X1U A;  2YCD A;  3GNJ A;  4Z2T A;  1PGT A;  4O32 A;  5DCH A;  3IR4 A;  2HE3 A;  1WE0 A;  4TR1 B;  3C1R A;  3HHV A;  2L6D A;  3VPQ A;  4MF5 A;  4I6X A;  4O5R A;  2IMD A;  1FOV A;  5IMV A;  2DML A;  2HSH A;  2L6C A;  4TOP A;  4OFT A;  3A5I A;  3KEB A;  3IAM 2;  3BD2 A;  4ZXG A;  1GTU A;  2CVD A;  1QGV A;  1VF3 A;  3BJ5 A;  5EVO A;  2VCT A;  4GSS A;  1XZO A;  4D73 B;  1X5C A;  3GKK A;  4ZL9 A;  3FEU A;  3UAP A;  4J57 E;  5F0G A;  4F82 A;  1TI1 A;  4I5Q A;  4FO5 A;  6GSX A;  4WET A;  2FWH A;  1TKD B;  2QGV A;  3HYP A;  2QC7 A;  1HD2 A;  2I1U A;  4LL1 B;  2GZP A;  5GSS A;  8GSS A;  4KCE A;  4J2F A;  4MK3 A;  1QMV A;  2ON7 A;  3J7Y k;  4Q5R A;  3TB2 A;  4KW6 A;  2YJH A;  4MZC A;  3QFB C;  5JWR B;  2LQO A;  2R0C A;  1CQH A;  3N5O A;  1GSF A;  4CY8 A;  4WR5 A;  4YAV A;  3QPM A;  2VAF A;  2VUP A;  2XBI A;  1XPV A;  2I81 A;  4EKZ A;  4WF4 A;  1Z7P A;  4F0B A;  3GHA A;  3FK8 A;  2VCZ A;  5D9W A;  1GTB A;  3G7Y A;  3L78 A;  4TKY A;  3LJR A;  1AUC A;  4GTU A;  1N8J A;  3W6G A;  2PU9 C;  5A5K A;  3GKX A;  2H01 A;  3UBL A;  2TRC P;  5D93 A;  4CHS A;  1KNG A;  1Y25 A;  2YWO A;  1GSD A;  3QFA C;  1WJK A;  3A3T A;  2XHF A;  3GFK A;  5IO0 A;  3HVS A;  3GL3 A;  5BMU A;  5G31 A;  2HRN A;  1Z5Y E;  4KSM A;  5FWG A;  5H5R A;  1QUW A;  2YV7 A;  4E8E A;  1GLP A;  1B4P A;  1F9M A;  4XS1 A;  3L4N A;  4GSN A;  3ZIJ A;  1T4Y A;  4NV2 A;  2CZ3 A;  4O7H A;  4JR6 A;  5EPF A;  2GT6 A;  3CXG A;  4BVX B;  4X0X A;  4BL7 B;  2JZT A;  2HZF A;  4XTS A;  2R37 A;  1GTA A;  1GNE A;  2C3N A;  4G10 A;  1DUG A;  1MD4 A;  2M80 A;  2C0D A;  1LU4 A;  5ECQ B;  1XVQ A;  1XIY A;  16GS A;  1AXD A;  5CYY A;  1ML6 A;  1FB0 A;  4RUV A;  3F6F A;  4XIH A;  1THX A;  4MF7 A;  1SYR A;  4BWS A;  3HZ4 A;  1Y6E A;  1PMT A;  2ES7 A;  3SBC A;  5EY6 A;  2AB6 A;  2DJ2 A;  4JRR A;  1MEK A;  2V32 A;  2FA8 A;  2K9F A;  2X8H A;  1W4V A;  4V1A p;  2GVP A;  4HQS A;  3CBU A;  1TTZ A;  2HT9 A;  1PSQ A;  4HDE A;  1H75 A;  1GSE A;  3F8U A;  1YF0 A;  3GTU A;  3ME8 A;  2K8V A;  4Z2R A;  5HR3 A;  2RLI A;  2V6K A;  3QR6 A;  4K7N A;  1SKW B;  3PIN A;  5C00 A;  4POL A;  3QAG A;  1HYU A;  5HR1 A;  2E0Q A;  4H86 A;  6GSV A;  1SKS B;  2R5G A;  2H30 A;  2HI7 A;  1MTC A;  3CSH A;  4JU5 A;  2V6O A;  4ZBA A;  2DJ3 A;  1XW9 A;  3IC4 A;  1HNC A;  5IMD A;  1SJ6 A;  3ISO A;  3KMN A;  3EMX A;  1V98 A;  2WB9 A;  2PVO C;  4G9H A;  3OR5 A;  1T00 A;  2EC4 A;  1F2E A;  4FH8 A;  3GKM A;  3EE2 A;  2FWG A;  4EDY A;  5D9V A;  4IHU A;  5CP1 A;  2JSZ A;  4AJ7 A;  3TGZ A;  2O89 A;  4K0G A;  2FA4 A;  2KP2 A;  4ID0 A;  4ZB8 A;  2DIY A;  3CQF A;  3FZ9 A;  1EOG A;  2B6M A;  2C0G A;  4IKH A;  3KGK A;  1RQM A;  3C1S A;  2YNX A;  1FHE A;  4ECC A;  2LEG A;  4PQI A;  1M3I A;  4TVE A;  5IMF A;  2B5Y A;  3G7I A;  3KTL A;  4N11 A;  1U87 A;  1V2A A;  4GXZ A;  2IMK A;  1YY7 A;  2KLX A;  18GS A;  1EP8 A;  3APO A;  5BRT A;  3RPP A;  2HLS A;  5D9T A;  2YJ7 A;  2VOC A;  1TK0 B;  4ULX A;  4WEY A;  6GSS A;  3HZ8 A;  3RBT A;  3R2Q A;  1GSY A;  2L5L A;  1R4W A;  1GSS A;  3UEM A;  4F9Z A;  3M9K A;  3FY7 A;  4XCS A;  2GLR A;  1GSQ A;  1TRW A;  2F51 A;  4XHM A;  5FHI A;  4BL7 A;  2H8L A;  3H79 A;  1VF2 A;  4DSQ A;  1FVK A;  2DLX A;  3F0I A;  2B7K A;  2MBT A;  3ZYW A;  4MDC A;  2RM6 A;  3UIW A;  5C04 A;  1A0F A;  4Q5F A;  3E3E A;  2DC5 A;  3D6I A;  3KXO A;  4K9Z A;  2JL4 A;  4HJ2 A;  1EEM A;  3A2V A;  2XPE A;  5LCZ A;  3GSS A;  1A8Y A;  1OE8 A;  1HNB A;  2YWI A;  2F8A A;  3KCM A;  2H1G A;  1B9X C;  4GQC A;  3IXR A;  5ECP B;  1QXH A;  1UN2 A;  1TP9 A;  1K0N A;  4ECI A;  2JSY A;  2LS5 A;  2YN1 A;  3UVH A;  2VCV A;  3CYN A;  3NOF A;  4HSC X;  1K0C A;  3FKF A;  2FCH A;  3KIJ A;  4KE3 A;  1E6B A;  5D8I A;  4I8B A;  5DJL A;  2VCQ A;  4IN0 A;  3SWL A;  2L5O A;  1TOF A;  3Q18 A;  4V2M A;  3TDG A;  3P8W A;  3GH9 A;  3VI7 A;  4IVF A;  4HS1 A;  2H6X A;  4IBP A;  2D2Z A;  5LD0 A;  1WP0 A;  4MF6 A;  2L59 A;  4K1F A;  3ZFL A;  5F07 A;  3UVT A;  3TKR A;  1BQ7 A;  5ECI B;  1OC9 A;  1TJD A;  5J4U A;  1XFL A;  4ISD A;  2MYG A;  3TRX A;  3FYG A;  2E2M A;  4MPG A;  4NPB A;  3ZRD A;  1M2D A;  1YEP A;  5IMZ A;  2GSR A;  4E8H A;  2L57 A;  3DML A;  5KOX A;  2YPM A;  2NDO A;  3FHK A;  1EZK A;  1TDI A;  4G19 A;  4GCI A;  2PN8 A;  1S3R A;  1NHO A;  3HY2 A;  2PER A;  2VL2 A;  3UL3 A;  3WGE A;  3GST A;  3LFL A;  2ALB A;  4ECB A;  3TJK A;  3ZL5 A;  1PX6 A;  2G0F A;  1MDJ A;  4N30 A;  1I9D A;  2QA1 A;  3IE3 A;  1BX9 A;  2YV9 A;  3BOA A;  3PR8 A;  6GSU A;  1TRV A;  1THO A;  2DBC A;  4P3Y B;  1Z9H A;  2PWJ A;  4FIW A;  3FZ5 A;  1SK1 A;  4G0I A;  5CRG A;  4PNG A;  4PNF A;  1GSU A;  1M3J A;  20GS A;  3GKN A;  1B9Y C;  5D9X A;  1OYJ A;  1FG4 A;  1T3B A;  5F06 A;  2O7K A;  5AIX A;  1VRS D;  2X8C A;  1DE2 A;  4HJM A;  2F3M A;  1OKT A;  1WOU A;  1A23 A;  3ZLP A;  3A2W A;  1XW6 A;  2DJK A;  2I9H A;  1UA5 A;  4PUR A;  5ECK B;  2NPB A;  5CRH A;  2H1B A;  4O92 A;  4BIK A;  1AQX A;  4ZBD A;  3FW2 A;  2C1Y A;  3TRP A;  1XWK A;  4L0U A;  3EYT A;  3DEX A;  1YKA A;  5G5F A;  3EUR A;  2R0P A;  1PQN A;  2MBS A;  2KOK A;  2MMZ A;  3GTU B;  2LST A;  1YF1 A;  4YQU A;  3DIE A;  3QCP A;  4AJ6 A;  5AGY A;  1UC7 A;  3LWA A;  4ICY A;  2X99 A;  2OE3 A;  2CX3 A;  3TCO A;  2N5B A;  5HFI A;  1O8X A;  5G30 A;  3GX0 A;  1WIK A;  4IGJ A;  4HQZ A;  5IPH A;  1Z6N A;  2WDU A;  5DJM A;  4TRX A;  3UBK A;  3TOT A;  1PN0 A;  3EU4 A;  1R26 A;  4NWY A;  4OD7 A;  2LRN A;  4ML1 A;  3TKS A;  2GZZ A;  4LMW A;  4F03 A;  4IW9 A;  4G0K A;  4HI7 A;  1F3A A; 
#chains in the Genus database with same CATH homology
 3WT1 A;  3EPT A;  5CAX A;  1AW9 A;  2ON5 A;  2LJA A;  3QOU A;  2JZR A;  3IV4 A;  1ILO A;  2IWT A;  2TIR A;  5B8B A;  2LRT A;  2IME A;  4ML6 A;  1JZO A;  1QK8 A;  5CO3 A;  4EL1 A;  3I9V 2;  1X0R A;  4FYC A;  2OAD A;  1GRX A;  3TKP A;  5HFG A;  1OC3 A;  5A4V A;  5A4W A;  3UJ1 A;  3KH9 A;  2XPD A;  2V2G A;  5IM9 A;  2AUV A;  1B48 A;  1ERV A;  1FAA A;  3HXS A;  1URM A;  2GT5 A;  2H1A A;  5DAK A;  5JCW A;  5DBQ A;  1FB6 A;  3WYW A;  2HZE A;  2IIY A;  3IC8 A;  14GS A;  1SU9 A;  4IQ1 A;  2R4V A;  1XOB A;  3HA9 A;  1IYH A;  3RDW A;  2DJ1 A;  2H74 A;  4BVY A;  2GZY A;  4MJC A;  3DKS A;  2CV4 A;  4F0C A;  1G7O A;  1SL0 B;  1LBK A;  3K8N A;  5D96 A;  17GS A;  2YP6 A;  3CTG A;  2LRC A;  5GST A;  4TXO A;  3RPN A;  5ELA A;  3GIX A;  3WGX A;  4WXT A;  1MDK A;  2DIZ A;  2GSS A;  3L9S A;  4K7O A;  3LOR A;  3TKQ A;  4EUY A;  1WPI A;  1YDK A;  4WF5 A;  1K0O A;  3GH6 A;  2R6K A;  3MIX A;  1TW9 A;  1M0U A;  1U3I A;  4PX1 A;  2VD1 A;  2VLT A;  1KBN A;  3FZA A;  3LG6 A;  13GS A;  3C8E A;  3PH9 A;  2R0G A;  3EU3 A;  2LJR A;  2H1D A;  3WGD A;  1XXU A;  4ACS A;  1GP1 A;  3C73 A;  3W8J A;  4KH7 A;  4IP6 A;  3IDV A;  3R3E A;  3UMA A;  3TKS C;  1IYI A;  4MJA A;  3U6V A;  3HKR A;  4XS6 A;  3VK9 A;  2WJU A;  6GSY A;  2HNL A;  1AIU A;  3MNG A;  3TJG A;  1ERU A;  2B1K A;  4ZIL A;  1ABA A;  3LSZ A;  2RUF A;  5JCU A;  2AYT A;  2B7J A;  1XOA A;  4BA7 A;  3VWV A;  1G0T A;  4G2E A;  1V57 A;  4EF0 A;  4I2U A;  1OC9 B;  1O8W A;  4Q5N A;  4GQF A;  5A4U A;  2LV3 A;  4PQ1 A;  2OE0 A;  2FWE A;  1NM3 A;  4HEA 2;  4KAE A;  1QQ2 A;  5ECN B;  4DSS A;  5LNK e;  4OCE A;  1BJX A;  5ECR B;  1M9B A;  3LXT A;  3GUS A;  4IJI A;  1KTE A;  3GUR A;  2NBS A;  3KM6 A;  1TXX A;  2B5X A;  1MD3 A;  2GQK A;  3GA4 A;  1TU8 A;  1WWJ A;  3H93 A;  3TJF A;  2EIR A;  4RI7 A;  3ZRE A;  1RW1 A;  1DBY A;  1M2B A;  3I6A A;  1ON4 A;  2H70 A;  4TR3 A;  4KDU A;  2FHE A;  1M2A A;  1VF4 A;  5J5N A;  5H5S A;  1MDI A;  2PPT A;  5ELG A;  3LXZ A;  2X49 A;  1OC8 A;  5DVB A;  2HRF A;  2H6Z A;  1PD2 1;  1Z7R A;  5CRD A;  4KGI A;  3GV1 A;  4PGT A;  2A2S A;  3KP8 A;  4TXV A;  4PTS A;  1VF1 A;  1EV9 A;  1PN9 A;  1A8L A;  5ECS A;  3KH7 A;  2HSM A;  1LJR A;  1T1V A;  3ERW A;  2H73 A;  5ENU A;  4AF2 A;  3US3 A;  4XRA A;  4IS0 A;  3DXB A;  3CMI A;  2AHE A;  2O8V B;  5KN2 A;  4OMV A;  2I3Y A;  4HZ4 A;  2P5Q A;  1U3A A;  2B1L A;  3MSZ A;  4V1A g;  9GSS A;  2JAD A;  2RUE A;  2P31 A;  1JZW A;  4EE0 A;  2K6V A;  4FYB A;  4X43 A;  4MCU A;  2C0F A;  3MAK A;  2BJX A;  5G1L A;  5IOX A;  4K5R A;  5IPG A;  2PUK C;  2H76 A;  2DKI A;  3ME7 A;  3TUE A;  1ST9 A;  2DJJ A;  11GS A;  5FT3 A;  1JZR A;  4DEJ A;  3BCK A;  1F3B A;  2BMX A;  1FW1 A;  3D22 A;  2WCI A;  3IA1 A;  4EXJ A;  2WFC A;  5IIZ A;  5DQY A;  1YEX A;  2VL3 A;  1K0D A;  1I5G A;  5IOW A;  3NZN A;  2EIQ A;  1WRY A;  4K2D A;  2C80 A;  1S3A A;  1XW5 A;  5ID2 B;  3VI5 A;  2FD3 A;  5F8B A;  3GN3 A;  1EOH A;  5IMC A;  3GX8 A;  3GYK A;  1SEN A;  4L0W A;  1Z6M A;  2LJK A;  3RHC A;  2H0H A;  4TW5 A;  1EGR A;  1ZCP A;  2QA2 A;  2YAN A;  1XWB A;  5AIV A;  1K0M A;  3ZTL A;  4HZ2 A;  5J41 A;  2LNT A;  1GUH A;  1EP7 A;  3APQ A;  1V9W A;  2IFQ A;  5B6N A;  5CRW A;  4QQ7 A;  2CVB A;  1BED A;  3CSI A;  1KEB A;  2FGX A;  2WZ9 A;  4DSR A;  2C8U A;  3MWH A;  4EIQ A;  1ZGN A;  4MAB A;  2OJL A;  3VPT A;  2OBK A;  4JE1 A;  1RK4 A;  2GDR A;  2CVK A;  2WS2 A;  4NHZ A;  2R2J A;  3F9U A;  2GQL A;  1NHY A;  2KP1 A;  4MLY A;  5E59 A;  3FZ4 A;  3I69 A;  3G9B A;  4ILF A;  1M99 A;  3HD5 A;  1FOH A;  2O87 A;  1J08 A;  2WGR A;  3D5J A;  5DAK B;  1DE1 A;  2IN3 A;  4KX4 A;  5D73 A;  3E9J B;  3WT2 A;  2HZE B;  3IAS 2;  3IHQ A;  3HCZ A;  4ZL8 A;  5B6M A;  1PKZ A;  1S3D A;  3APS A;  1SL1 B;  2CT6 A;  2R3X A;  5AIS A;  4BVY B;  2CAQ A;  2GQM A;  3ZFB A;  2VD0 A;  3O3T A;  3Q6O A;  3M3M A;  4BPY A;  2H71 A;  4PQH A;  6GST A;  3M0F A;  1ZL9 A;  4DVC A;  1ACV A;  1OKD A;  4TXO B;  5ECM B;  2VO4 A;  1JZD A;  1K0B A;  1ZMA A;  3M1G A;  1G6Y A;  1X9W B;  3IHG A;  4HOJ A;  3P90 A;  5CRE A;  3VWW A;  2TRX A;  3ZVJ A;  3CRU A;  3EIN A;  1G7E A;  1ZYN A;  2N5A A;  5JWQ B;  2X8G A;  4MPF A;  1FVJ A;  1H4O A;  2JZS A;  1BG5 A;  3LYP A;  3D0Z A;  3M9J A;  1TK5 B;  2YZH A;  1AQW A;  4YAP A;  3TRQ A;  7GSS A;  2LQQ A;  3D4T A;  5ECO B;  3ZZX A;  3ZIV A;  5HQP A;  4LMV A;  3JCM L;  5G1K A;  3DVW A;  1X5D A;  2VL9 A;  3C71 A;  1OVN A;  1SK0 A;  2HRK A;  5F05 A;  3QMX A;  4I97 A;  3KJY A;  1NW2 A;  3MDK A;  5ABR A;  4AGS A;  3ED3 A;  4WBJ A;  3VFI A;  1O6J A;  1XCC A;  4GWR A;  2J23 A;  1E2Y A;  4ZL7 A;  1FO5 A;  3UOM A;  4L5L A;  2GS3 A;  5ECL B;  1PX7 A;  4NXI A;  1F6M C;  1UVZ A;  4JBB A;  2A2R A;  4EC0 A;  1YQ1 A;  1VGL A;  1SKR B;  1TRS A;  3P7X A;  2ZCT A;  3UAR A;  5ID2 A;  2C3Q A;  2O85 A;  5J9C A;  4JZQ A;  2C0E A;  1X9S B;  1A2J A;  2YZU A;  1TK8 B;  4MH3 A;  3FR6 A;  4KND A;  4CDO A;  3S9F A;  3D4M A;  4DSS B;  3FR3 A;  2N5F A;  4MNN A;  4XS4 A;  2H0G A;  3TOU A;  4K7I A;  1SD8 A;  2J9H A;  4YH2 A;  2P0G A;  4JR4 A;  5KN0 A;  4EO3 A;  2CX4 A;  4I2T A;  2VL2 C;  3ZIT A;  5GAP D;  1B8X A;  1ZYE A;  1K3Y A;  5G5E A;  1XVW A;  4FQU A;  4IJ3 A;  1A2L A;  2HXK A;  3DD3 A;  4MJB A;  1K0A A;  3KTB A;  5AN1 A;  3IPZ A;  3EMP A;  5EL8 A;  1S3C A;  2JU5 A;  2V41 A;  2Z9S A;  1GWC A;  1ZYQ B;  4QL7 A;  2OKA A;  3LYK A;  2VLV A;  3I43 A;  1SD9 A;  2AV4 A;  2VLU A;  3H8Q A;  2DKH A;  10GS A;  2FLS A;  1B4Q A;  4ECJ A;  3EVI A;  3N9J A;  1JLV A;  1SL2 B;  1TI3 A;  1O7U A;  1PKW A;  3LGC A;  2KUC A;  3A2X A;  5JWO B;  4WKW A;  4WR4 A;  2OA7 A;  1JHB A;  1ZOF A;  4QL9 A;  4EIP A;  1F37 A;  1ERW A;  4POM A;  2HRA A;  2FUG 2;  1CQG A;  1GTI A;  1PRX A;  2MMA A;  2OE1 A;  4CW9 A;  2E7P A;  5DAL A;  3L9V A;  4OO4 A;  4X4J A;  4EVM A;  4PUF C;  4ZBB A;  1YKC A;  1JLW A;  1T4Z A;  5CNW A;  3TKS E;  2K18 A;  3F4S A;  1ZYP A;  5L71 A;  4L5O A;  4YQV A;  2YWM A;  3EWL A;  4K0N A;  5E4W A;  4J56 E;  3IBH A;  3QAW A;  4N0V A;  1XWC A;  2FWF A;  1OAZ A;  5KEJ A;  4O5U A;  3U5R E;  2PBJ A;  3KMO A;  3Q74 A;  2F8F A;  4IP1 A;  3MYD A;  1EGO A;  2YOI A;  4K2X A;  4YKF A;  1EWX A;  1USB A;  4K5S A;  4NHW A;  3A5W A;  3DVX A;  3LEF A;  4TR4 A;  4POB A;  1G6W A;  1EV4 A;  2ZNM A;  2F9S A;  1JFU A;  1Q4J A;  2A2P A;  4TR1 A;  2H66 A;  2CZ2 A;  3IK7 A;  3TJB A;  5GZZ B;  1M9A A;  3GL5 A;  3E0U A;  2PVQ A;  3F3R A;  4TR0 A;  2CA8 A;  22GS A;  1SK2 A;  3FMW A;  2MMO A;  4Z2U A;  1J9B A;  1EEJ A;  2NVL A;  5H5Q A;  2IL3 A;  4MH2 A;  4D73 A;  4OFN A;  4HU7 A;  1R5P A;  1TRU A;  2A4H A;  4KCA A;  3AY8 A;  2IFQ B;  5HR0 A;  3QDN A;  1HQO A;  3LQ7 A;  1X5E A;  3F4T A;  1C72 A;  1SYX A;  3KZQ A;  4FYU A;  3VWX A;  1V58 A;  4KB3 A;  2XBQ A;  3FRC A;  3O76 A;  3DYR A;  4HUA A;  1YZX A;  3IOS A;  2B5E A;  4IEL A;  3VLN A;  4Z7X A;  2YWN A;  1A0R P;  2HYX A;  2VIM A;  1AAZ A;  3RAZ A;  4CY6 A;  5GAN D;  1A24 A;  4L8E A;  3HDC A;  1GNW A;  1GUL A;  3TJJ A;  4K6X A;  4HU9 A;  2HFD A;  2M72 A;  5G2Z A;  3D21 A;  1N2A A;  1XWG A;  2MMN A;  3QAV A;  4EDZ A;  5IO2 A;  1J0F A;  3BCI A;  2H6Y A;  3W8S A;  2LNS A;  4KA0 A;  1U6T A;  3GMF A;  1R7H A;  4TN8 A;  2ZUP A;  2JAC A;  3ZVJ D;  2OBI A;  4GLT A;  1BAY A;  2OAC A;  3H4K A;  2CQ9 A;  1HNA A;  2DSA A;  3DGQ A;  1QFN A;  4ZB9 A;  3PGT A;  1SJZ A;  1GL8 A;  2DJ0 A;  2C3T A;  4LA1 A;  3G7J A;  4GF0 A;  3Q19 A;  4K8M A;  1V40 A;  2QSI A;  2X64 A;  3F3Q A;  5COH A;  2H19 A;  4MJE A;  2B3S A;  4KF9 A;  4LLR A;  2RM5 A;  4LL4 B;  3H1N A;  4GST A;  2WRT A;  3CTF A;  2EIO A;  2P5R A;  1NSW A;  2M46 A;  3ERG A;  2K8S A;  2UZ8 A;  4OFM A;  3HVX A;  2HSY A;  1M7T A;  4GRF A;  2A4V A;  1O81 A;  1A2M A;  1AQV A;  3NIV A;  4MZW A;  5HFK A;  4BVX A;  1OE7 A;  2G2Q A;  1SJI A;  1GUM A;  2REM A;  2BTO T;  2FNO A;  2V1M A;  4JED A;  3EC3 A;  2LKU A;  1X9M B;  1U88 A;  4KSO A;  3ZML A;  2IJY A;  3FR9 A;  3HJM A;  3IK9 A;  4ZIJ A;  5DQS A;  2NTO A;  3KP9 A;  4YKG A;  2GGT A;  2VCW A;  3V1W A;  2H75 A;  3ERF A;  3PPU A;  3L9U A;  1WMJ A;  2LTK A;  2E2G A;  2PMT A;  2VCX A;  1PA3 A;  5ECH B;  5HR2 A;  4YQM A;  2AJQ B;  1AC1 A;  1YJ6 A;  1Z3E A;  3HJO A;  2CAI A;  4POK A;  3P2A A;  1XWA A;  4OCF A;  3F63 A;  2H72 A;  4XS4 B;  3GRX A;  3CRT A;  4F2I A;  2KHP A;  4A5P A;  5DDL A;  1GLQ A;  2XC2 A;  4MMM A;  19GS A;  4MP4 A;  5DCG A;  1ERT A;  3RHB A;  3WD6 A;  3ZMK A;  1PL2 A;  4PUA A;  2QKE A;  5JCG A;  1BYE A;  4OWY A;  5IMA A;  3J7Y b;  4OO5 A;  2L4Q A;  2H0I A;  4V2N A;  1ZZY A;  1T7P B;  1Q98 A;  3HVV A;  1O73 A;  12GS A;  1DSB A;  4G0L A;  3DWV A;  4RQX A;  3KD0 A;  4KDY A;  4WBR D;  2X4A A;  4Q5Q A;  4O5Q A;  5B7C A;  4AJ8 A;  2RII A;  5J9B A;  5INY A;  2IMF A;  4USS A;  3VUR A;  4ZB6 A;  2MZC A;  3L0H A;  5KOW A;  2L4C A;  3C7M A;  4N10 A;  4IQA A;  2IMI A;  5IQY A;  3M8N A;  4BWQ A;  4N0Z A;  1XBS A;  3HJP A;  3CSJ A;  1PL1 A;  2VM1 A;  5DAL B;  1GH2 A;  3IRA A;  5J3R A;  5KN3 A;  4KDX A;  4PXO A;  1GUK A;  2PGT A;  4KUN A;  4NAX A;  3QD9 A;  1TU7 A;  2FY6 A;  3O6T A;  1K3L A;  2GTU A;  5B8A A;  1K3O A;  3BBY A;  2GSQ A;  1R5A A;  4NV5 A;  1W89 A;  3LW9 A;  3DRN A;  3VWU A;  2C4J A;  4V2L A;  2I4A A;  4RQR A;  4MZB A;  4XRD A;  2WUL A;  3F4R A;  2VM2 A;  4RI6 A;  2GST A;  2AAW A;  4NMU A;  2LUS A;  2IPA A;  2DMM A;  6GSW A;  1T8E B;  1O85 A;  3F6D A;  4MA9 A;  5KN1 A;  4X1U A;  2YCD A;  3GNJ A;  4Z2T A;  1PGT A;  4O32 A;  5DCH A;  3IR4 A;  2HE3 A;  1WE0 A;  4TR1 B;  3C1R A;  3HHV A;  2L6D A;  3VPQ A;  4MF5 A;  4I6X A;  4O5R A;  2IMD A;  1FOV A;  5IMV A;  2DML A;  2HSH A;  2L6C A;  4TOP A;  4OFT A;  3A5I A;  3KEB A;  3IAM 2;  3BD2 A;  4ZXG A;  1GTU A;  2CVD A;  1QGV A;  1VF3 A;  3BJ5 A;  5EVO A;  2VCT A;  4GSS A;  1XZO A;  4D73 B;  1X5C A;  3GKK A;  4ZL9 A;  3FEU A;  3UAP A;  4J57 E;  5F0G A;  4F82 A;  1TI1 A;  4I5Q A;  4FO5 A;  6GSX A;  4WET A;  2FWH A;  1TKD B;  2QGV A;  3HYP A;  2QC7 A;  1HD2 A;  2I1U A;  4LL1 B;  2GZP A;  5GSS A;  8GSS A;  4KCE A;  4J2F A;  4MK3 A;  1QMV A;  2ON7 A;  3J7Y k;  4Q5R A;  3TB2 A;  4KW6 A;  2YJH A;  4MZC A;  3QFB C;  5JWR B;  2LQO A;  2R0C A;  1CQH A;  3N5O A;  1GSF A;  4CY8 A;  4WR5 A;  4YAV A;  3QPM A;  2VAF A;  2VUP A;  2XBI A;  1XPV A;  2I81 A;  4EKZ A;  4WF4 A;  1Z7P A;  4F0B A;  3GHA A;  3FK8 A;  2VCZ A;  5D9W A;  1GTB A;  3G7Y A;  3L78 A;  4TKY A;  3LJR A;  1AUC A;  4GTU A;  1N8J A;  3W6G A;  2PU9 C;  5A5K A;  3GKX A;  2H01 A;  3UBL A;  2TRC P;  5D93 A;  4CHS A;  1KNG A;  1Y25 A;  2YWO A;  1GSD A;  3QFA C;  1WJK A;  3A3T A;  2XHF A;  3GFK A;  5IO0 A;  3HVS A;  3GL3 A;  5BMU A;  5G31 A;  2HRN A;  1Z5Y E;  4KSM A;  5FWG A;  5H5R A;  1QUW A;  2YV7 A;  4E8E A;  1GLP A;  1B4P A;  1F9M A;  4XS1 A;  3L4N A;  4GSN A;  3ZIJ A;  1T4Y A;  4NV2 A;  2CZ3 A;  4O7H A;  4JR6 A;  5EPF A;  2GT6 A;  3CXG A;  4BVX B;  4X0X A;  4BL7 B;  2JZT A;  2HZF A;  4XTS A;  2R37 A;  1GTA A;  1GNE A;  2C3N A;  4G10 A;  1DUG A;  1MD4 A;  2M80 A;  2C0D A;  1LU4 A;  5ECQ B;  1XVQ A;  1XIY A;  16GS A;  1AXD A;  5CYY A;  1ML6 A;  1FB0 A;  4RUV A;  3F6F A;  4XIH A;  1THX A;  4MF7 A;  1SYR A;  4BWS A;  3HZ4 A;  1Y6E A;  1PMT A;  2ES7 A;  3SBC A;  5EY6 A;  2AB6 A;  2DJ2 A;  4JRR A;  1MEK A;  2V32 A;  2FA8 A;  2K9F A;  2X8H A;  1W4V A;  4V1A p;  2GVP A;  4HQS A;  3CBU A;  1TTZ A;  2HT9 A;  1PSQ A;  4HDE A;  1H75 A;  1GSE A;  3F8U A;  1YF0 A;  3GTU A;  3ME8 A;  2K8V A;  4Z2R A;  5HR3 A;  2RLI A;  2V6K A;  3QR6 A;  4K7N A;  1SKW B;  3PIN A;  5C00 A;  4POL A;  3QAG A;  1HYU A;  5HR1 A;  2E0Q A;  4H86 A;  6GSV A;  1SKS B;  2R5G A;  2H30 A;  2HI7 A;  1MTC A;  3CSH A;  4JU5 A;  2V6O A;  4ZBA A;  2DJ3 A;  1XW9 A;  3IC4 A;  1HNC A;  5IMD A;  1SJ6 A;  3ISO A;  3KMN A;  3EMX A;  1V98 A;  2WB9 A;  2PVO C;  4G9H A;  3OR5 A;  1T00 A;  2EC4 A;  1F2E A;  4FH8 A;  3GKM A;  3EE2 A;  2FWG A;  4EDY A;  5D9V A;  4IHU A;  5CP1 A;  2JSZ A;  4AJ7 A;  3TGZ A;  2O89 A;  4K0G A;  2FA4 A;  2KP2 A;  4ID0 A;  4ZB8 A;  2DIY A;  3FZ9 A;  1EOG A;  2B6M A;  2C0G A;  4IKH A;  3KGK A;  1RQM A;  3C1S A;  2YNX A;  1FHE A;  4ECC A;  2LEG A;  4PQI A;  4TVE A;  5IMF A;  2B5Y A;  3G7I A;  3KTL A;  4N11 A;  1U87 A;  1V2A A;  4GXZ A;  2IMK A;  1YY7 A;  2KLX A;  18GS A;  1EP8 A;  3APO A;  5BRT A;  3RPP A;  2HLS A;  5D9T A;  2YJ7 A;  2VOC A;  1TK0 B;  4ULX A;  4WEY A;  6GSS A;  3HZ8 A;  3RBT A;  3R2Q A;  1GSY A;  2L5L A;  1R4W A;  1GSS A;  3UEM A;  4F9Z A;  3M9K A;  3FY7 A;  4XCS A;  2GLR A;  1GSQ A;  1TRW A;  2F51 A;  4XHM A;  5FHI A;  4BL7 A;  2H8L A;  3H79 A;  1VF2 A;  4DSQ A;  1FVK A;  2DLX A;  3F0I A;  2B7K A;  2MBT A;  3ZYW A;  4MDC A;  2RM6 A;  3UIW A;  5C04 A;  1A0F A;  4Q5F A;  3E3E A;  2DC5 A;  3D6I A;  3KXO A;  4K9Z A;  2JL4 A;  4HJ2 A;  1EEM A;  3A2V A;  2XPE A;  5LCZ A;  3GSS A;  1A8Y A;  1OE8 A;  1HNB A;  2YWI A;  2F8A A;  3KCM A;  2H1G A;  1B9X C;  4GQC A;  3IXR A;  5ECP B;  1QXH A;  1UN2 A;  1TP9 A;  1K0N A;  4ECI A;  2JSY A;  2LS5 A;  2YN1 A;  3UVH A;  2VCV A;  3CYN A;  3NOF A;  1K0C A;  3FKF A;  2FCH A;  3KIJ A;  4KE3 A;  1E6B A;  5D8I A;  4I8B A;  5DJL A;  2VCQ A;  4IN0 A;  3SWL A;  2L5O A;  1TOF A;  3Q18 A;  4V2M A;  3TDG A;  3P8W A;  3GH9 A;  3VI7 A;  4IVF A;  4HS1 A;  2H6X A;  4IBP A;  2D2Z A;  5LD0 A;  1WP0 A;  4MF6 A;  2L59 A;  4K1F A;  3ZFL A;  5F07 A;  3UVT A;  3TKR A;  1BQ7 A;  5ECI B;  1OC9 A;  1TJD A;  5J4U A;  1XFL A;  4ISD A;  2MYG A;  3TRX A;  3FYG A;  2E2M A;  4MPG A;  4NPB A;  3ZRD A;  1M2D A;  1YEP A;  5IMZ A;  2GSR A;  4E8H A;  2L57 A;  3DML A;  5KOX A;  2YPM A;  2NDO A;  3FHK A;  1EZK A;  1TDI A;  4G19 A;  4GCI A;  2PN8 A;  1NHO A;  3HY2 A;  2PER A;  2VL2 A;  3UL3 A;  3WGE A;  3GST A;  3LFL A;  2ALB A;  4ECB A;  3TJK A;  3ZL5 A;  1PX6 A;  2G0F A;  1MDJ A;  4N30 A;  1I9D A;  2QA1 A;  3IE3 A;  1BX9 A;  2YV9 A;  3BOA A;  3PR8 A;  6GSU A;  1TRV A;  1THO A;  2DBC A;  4P3Y B;  1Z9H A;  2PWJ A;  4FIW A;  3FZ5 A;  1SK1 A;  4G0I A;  5CRG A;  4PNG A;  4PNF A;  1GSU A;  20GS A;  3GKN A;  1B9Y C;  5D9X A;  1OYJ A;  1FG4 A;  1T3B A;  5F06 A;  2O7K A;  5AIX A;  1VRS D;  2X8C A;  1DE2 A;  4HJM A;  2F3M A;  1OKT A;  1WOU A;  1A23 A;  3ZLP A;  3A2W A;  1XW6 A;  2DJK A;  2I9H A;  1UA5 A;  4PUR A;  5ECK B;  2NPB A;  5CRH A;  2H1B A;  4O92 A;  1AQX A;  4ZBD A;  3FW2 A;  2C1Y A;  3TRP A;  1XWK A;  4L0U A;  3EYT A;  3DEX A;  1YKA A;  5G5F A;  3EUR A;  2R0P A;  1PQN A;  2MBS A;  2KOK A;  2MMZ A;  3GTU B;  2LST A;  1YF1 A;  4YQU A;  3DIE A;  3QCP A;  4AJ6 A;  5AGY A;  1UC7 A;  3LWA A;  4ICY A;  2X99 A;  2OE3 A;  2CX3 A;  3TCO A;  2N5B A;  5HFI A;  1O8X A;  5G30 A;  3GX0 A;  1WIK A;  4IGJ A;  4HQZ A;  5IPH A;  1Z6N A;  2WDU A;  5DJM A;  4TRX A;  3UBK A;  3TOT A;  1PN0 A;  3EU4 A;  1R26 A;  4NWY A;  4OD7 A;  2LRN A;  4ML1 A;  3TKS A;  2GZZ A;  4LMW A;  4F03 A;  4IW9 A;  4G0K A;  4HI7 A;  1F3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...