2JZSA

Solution structure of the reduced form of the n-terminal domain of pilb from n. meningitidis.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
144
structure length
144
Chain Sequence
MVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title Solution structure and dynamics of the reduced and oxidized forms of the N-terminal domain of PilB from Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Electron transport
total genus 31
structure length 144
sequence length 144
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jzsA00
3Q19A 2H0GA 2REMA 2EC4A 2KP2A 4ZL9A 2EIQA 2YNXA 4L0UA 4EDYA 5G30A 4OFMA 5ECMB 1EOGA 1XZOA 4N11A 2K8SA 3KEBA 2NBSA 5G1KA 5HFGA 2TRCP 5D9TA 4KX4A 4K7NA 3HCZA 3PR8A 2LS5A 2OE1A 1MDIA 4EDZA 1GL8A 5IMFA 1T1VA 1BYEA 2QKEA 5ECHB 2V1MA 3KP8A 4Z7XA 1AQWA 5G5EA 1R26A 4RI6A 3A2VA 3A2XA 2YWNA 5DVBA 4NAXA 1TRSA 4MLYA 1Z5YE 1RK4A 2AHEA 4KW6A 3IE3A 2I1UA 5KN0A 1T3BA 4ZXGA 3C1SA 2V6OA 1TRWA 3GA4A 2FWHA 4YQMA 1WWJA 2DJ2A 1YDKA 1EV9A 3F6DA 2GLRA 4H86A 5IQYA 1K0AA 2H30A 1J9BA 1EV4A 2WRTA 3TUEA 4ACSA 2ZNMA 5ENUA 4NHWA 1J0FA 3QOUA 3APSA 1ERWA 2B5YA 2GDRA 3OR5A 2YOIA 1PRXA 5CRHA 2YN1A 1GULA 1FVJA 2C0EA 1G6WA 4GQFA 2O7KA 4X43A 4KH7A 3BD2A 1XXUA 3L4NA 2IFQA 1JZOA 3M9JA 1GRXA 2GSQA 2VLVA 5EVOA 2YV7A 3AY8A 5CYYA 2YPMA 2OACA 5EPFA 3MAKA 1Q4JA 4XS4B 2E2GA 2VCTA 3GTUB 1GLPA 3QFBC 5H5SA 2VO4A 4TR1A 2V2GA 4KUNA 5AIXA 2YP6A 1GH2A 1PD21 3FZAA 1FB6A 4BL7A 1A24A 3VI7A 5EY6A 1FB0A 5B8AA 2M80A 4OFNA 2JSZA 2P5RA 3QPMA 4K7OA 3D5JA 4F82A 3QCPA 2N5AA 1OKTA 5IMCA 2F9SA 2QGVA 2H1GA 5G31A 3HXSA 4MMMA 3LFLA 3WYWA 3FK8A 2B1KA 3HY2A 2CVDA 3UAPA 3C73A 4WF4A 1QFNA 3EVIA 2KOKA 2V6KA 1KEBA 1USBA 3LG6A 4TW5A 5DQSA 2PBJA 1TTZA 1SK0A 6GSXA 1NHOA 2G2QA 2MBTA 1M0UA 3TRPA 4LL4B 3W6GA 1IYHA 5IMDA 2O89A 2CX3A 2IPAA 3ZFLA 4TRXA 4TR0A 4TR1B 2VL3A 4IKHA 1WIKA 1KTEA 2DJJA 2N5BA 1OE8A 3CRUA 4HEA2 1Y6EA 5D73A 2OBKA 1SYRA 4ZBAA 2WZ9A 1KBNA 1K3OA 1YEPA 5CAXA 1BAYA 2HE3A 3CXGA 1O8XA 2FWGA 3PINA 3GFKA 1F37A 4OD7A 1TI3A 5CP1A 1CQGA 4Q5NA 1XOAA 3FYGA 3UMAA 3IOSA 4Q5RA 5DDLA 5F8BA 1A0FA 1ILOA 2L6DA 2H1AA 1ZGNA 1TXXA 4N30A 2RLIA 5ECRB 4NV5A 2K6VA 4KSOA 1FO5A 4OMVA 3ZZXA 2F3MA 1M7TA 1BEDA 3QAWA 5A5KA 4MJAA 4HS1A 5E59A 2XHFA 2FA8A 3IAM2 1SJ6A 3FEUA 4YH2A 2JACA 5H5QA 1EP8A 4RI7A 3VWVA 4WETA 5IO0A 18GSA 2LJRA 2OE0A 1PL2A 3CTFA 2M72A 2JADA 4D73B 1UC7A 1LBKA 3TGZA 2RIIA 2AB6A 4POBA 3KTLA 2GT6A 3L9VA 1PGTA 1BJXA 2R5GA 3KM6A 3A3TA 2HZEB 2V32A 3F4TA 1X5DA 4MABA 3DEXA 5DQYA 3KGKA 4QL9A 1YF0A 3UIWA 1G7EA 2HRNA 2B1LA 5G1LA 2H6YA 3KMNA 5IOXA 1K0NA 5FWGA 3N9JA 3ME7A 5DCHA 2CQ9A 2VCXA 1ZZYA 2CZ3A 3CYNA 2XC2A 3VWUA 5L71A 4PNFA 3GH6A 2C0GA 4I2TA 4KB3A 2VD1A 5HFIA 2QC7A 3EMXA 1A2MA 1XPVA 1H75A 4IQ1A 5B6MA 1AUCA 2HSHA 3H4KA 3J7Yb 1XWCA 3F63A 1EGOA 3MSZA 1A2LA 5LNKe 2C3QA 3E9JB 1SKSB 3P90A 3NIVA 2R2JA 3WGDA 3IK7A 5LCZA 3ZMKA 2PN8A 4J56E 4JRRA 4PGTA 3L9UA 1G0TA 2B6MA 3KTBA 22GSA 4DVCA 1B4PA 4PNGA 1GSUA 3Q6OA 2DLXA 1YY7A 2R4VA 4KCAA 5IIZA 1OE7A 5JWQB 5J3RA 4IP6A 3NZNA 4V2LA 5ELAA 1R5AA 1QQ2A 2IMIA 3MDKA 2L4CA 1MDJA 3HDCA 1W89A 2CVBA 5F05A 3IDVA 4EKZA 4O92A 4HQSA 3UL3A 1OC9A 4IELA 2YZUA 3E3EA 5KN1A 3WT2A 5A4WA 2G0FA 3V1WA 1YKCA 3D4MA 1U3AA 5CNWA 2GTUA 4MJEA 2MZCA 3HHVA 4HZ4A 1U3IA 3RPNA 3CRTA 2VM2A 5A4VA 2L5LA 2M46A 1C72A 5ECPB 3DXBA 1B48A 3US3A 2CAIA 1HNCA 3H8QA 1GUMA 1GTBA 2YV9A 4GSNA 1IYIA 14GSA 3TJFA 4DSSB 1VGLA 1WRYA 3D6IA 2VD0A 1WJKA 4K8MA 1NM3A 2LJAA 2B5EA 4V1Ap 1YZXA 3UBLA 2X8CA 4TVEA 2YJHA 1AQXA 4MCUA 1F3AA 4ZB6A 5HR1A 1OVNA 2PPTA 2NPBA 3H93A 1ABAA 2LNTA 4G9HA 2PGTA 4MF6A 5G5FA 1PN9A 4K1FA 1GTIA 1K0BA 3IR4A 4MF5A 1WOUA 3FKFA 4XIHA 5COHA 5D8IA 3JCML 4DSQA 2HLSA 4BPYA 2I3YA 1GTAA 2K8VA 1GP1A 2NTOA 5C04A 2QSIA 3ERWA 1O73A 4MF7A 3ME8A 2WB9A 3TOUA 2VUPA 1FHEA 1MD4A 2DJ1A 4WKWA 2YZHA 2A2RA 4MZWA 2K9FA 2XBIA 11GSA 4LLRA 1JZWA 2O85A 4PUAA 1V2AA 3G7JA 3EYTA 4X1UA 3M0FA 2MMNA 4L5OA 1LU4A 4IVFA 5IOWA 2O87A 4JZQA 1AIUA 3HA9A 2FWFA 4NV2A 3O6TA 1YEXA 3EC3A 1M2AA 3TKQA 3G9BA 2CZ2A 3QMXA 1I9DA 1DBYA 16GSA 1FG4A 5B8BA 5AN1A 4EUYA 2LQOA 3VLNA 2DIYA 2Z9SA 3ZREA 1AW9A 2H76A 5GAPD 4JBBA 3HVSA 3A5WA 4JR4A 2DMMA 4XS4A 4BVYA 2LUSA 3TJBA 3GTUA 2PVOC 3DGQA 2KP1A 1XIYA 4WBJA 4YQUA 3ZVJD 1SK2A 1JZDA 3HZ4A 3Q74A 2RM6A 1FOVA 1GSEA 3APOA 1A0RP 4ZB9A 2GSSA 3MNGA 3TDGA 3UJ1A 1TK5B 2H72A 3CSJA 3H1NA 3IV4A 4ZL8A 3GN3A 1WMJA 2WFCA 1SU9A 4POMA 1ON4A 3GSTA 2VL2A 4KCEA 2H6ZA 1NHYA 2C0DA 3UVHA 2IMFA 4POLA 4IGJA 2MMAA 3I9V2 4YAVA 1QMVA 3ZIJA 4ZIJA 1T7PB 6GSUA 3QDNA 3ZYWA 3D0ZA 1XVQA 2YANA 4MP4A 1SKRB 3QFAC 4G19A 5CRDA 3LQ7A 2CT6A 1YKAA 5ECSA 1ZL9A 2P31A 2H8LA 5DCGA 3QD9A 3ED3A 1S3CA 1VF2A 4K7IA 1ERUA 2H75A 3W8JA 4HUAA 1VRSD 1TW9A 3GKNA 3IK9A 4ECCA 2RUFA 4IHUA 3VFIA 4ECIA 1HD2A 3F9UA 5JCWA 1O8WA 5ABRA 2HT9A 5F0GA 4IW9A 4PQ1A 1X0RA 2A4VA 3D22A 2DBCA 3IRAA 1B9XC 1LJRA 3DKSA 3QAVA 1V40A 4BVXA 2GS3A 4K2DA 1UN2A 1O81A 2PWJA 2FD3A 5D9XA 2VCQA 2VLUA 1PL1A 2FY6A 1FAAA 4JR6A 2LRNA 2HYXA 3RDWA 3FZ4A 4I5QA 2MMOA 4HDEA 4TR3A 2VL2C 3TJJA 4D73A 3BCKA 3C7MA 2A2SA 2XBQA 3KJYA 1XOBA 4N0VA 1NSWA 5CRGA 1SENA 3HD5A 3CSIA 2HZEA 2X64A 4GSSA 4AGSA 2GSTA 4RQRA 2L6CA 3R2QA 2EIRA 4XS1A 3CMIA 3PGTA 2YWOA 4IS0A 2E2MA 3KD0A 4KNDA 5KN3A 3DRNA 3TOTA 3IC4A 1M99A 2FLSA 3KCMA 3QAGA 3EMPA 4XRDA 3Q18A 3LXZA 3RAZA 4L8EA 3GUSA 2MYGA 2DMLA 4I2UA 4HU9A 1XW9A 5E4WA 1E6BA 4BWQA 4I8BA 3SWLA 3I6AA 5F06A 2BTOT 2PERA 2VIMA 1OC8A 4JU5A 4CDOA 1ZYQB 2O8VB 1UA5A 4HI7A 2B5XA 1GNEA 4I6XA 5GAND 4JEDA 1GSFA 1MDKA 4GF0A 4HU7A 5FT3A 4FYCA 3F6FA 2L5OA 3ZFBA 4GWRA 5IPHA 3IAS2 1PKWA 1ZOFA 3WD6A 2ON7A 4N10A 2IJYA 5DJMA 2C4JA 1Z7PA 5ECNB 1PSQA 1T4ZA 4WEYA 3LJRA 4CW9A 9GSSA 1I5GA 2TRXA 3ERFA 5HFKA 4KAEA 3L78A 1F6MC 2F51A 3P7XA 1YJ6A 3G7YA 2OE3A 4TN8A 3P2AA 5DAKB 4FYBA 1R4WA 3GYKA 4WXTA 3TKSA 2VCZA 2ON5A 3VK9A 4IP1A 2BMXA 3FHKA 5J4UA 3GRXA 1O6JA 2YWMA 4HOJA 4EE0A 3GMFA 1QXHA 1KNGA 4K0NA 2OKAA 4ISDA 1JLVA 5H5RA 4WBRD 5HR2A 1BX9A 5IO2A 1MTCA 3HZ8A 1OC3A 2AAWA 2VAFA 4K0GA 5B6NA 5ID2B 3F0IA 3GKKA 2YWIA 4F0BA 5D9WA 3IA1A 1EEJA 5JWRB 1AAZA 4ULXA 1TK0B 3F3QA 4NMUA 1VF3A 4KDYA 2IL3A 3A2WA 3M9KA 1TP9A 4FYUA 4TXVA 3GKMA 4XRAA 2H6XA 2JZRA 4IBPA 1XVWA 3GX0A 4ZILA 2VLTA 10GSA 4FH8A 2AUVA 4P3YB 5G2ZA 1U88A 3D4TA 2WDUA 4DSSA 4MZCA 1HQOA 4NWYA 1Z7RA 4F0CA 4MH2A 3UARA 2FGXA 1W4VA 3N5OA 2HSYA 4KSMA 5CREA 4OWYA 2LRTA 20GSA 2P5QA 3EU4A 3FR3A 1OKDA 4YAPA 1U6TA 1TU8A 2CAQA 4GTUA 2J9HA 4GCIA 2KUCA 2VCVA 4KDUA 6GSSA 1R7HA 1S3AA 3TKSC 4BWSA 3LYKA 5HR0A 4V1Ag 6GSTA 3RHCA 4L5LA 3GSSA 2PMTA 3KP9A 1THXA 4J57E 4K9ZA 2GQMA 4YQVA 2HXKA 2LJKA 3ZL5A 2X8HA 2LEGA 1GWCA 4G2EA 1VF1A 1A2JA 1ERTA 3IXRA 4F2IA 2H1DA 1RW1A 1SD8A 4MA9A 4DEJA 1XW5A 3KXOA 3FR6A 3GL5A 1N8JA 2GZZA 2P0GA 3TRQA 4MPFA 5AGYA 2OA7A 3KZQA 7GSSA 1AQVA 1K3LA 5CRWA 5J9CA 2H66A 1M9BA 1E2YA 3DYRA 4HJMA 4ZBBA 1U87A 2C1YA 4MJBA 1TI1A 5JCUA 2DC5A 1HYUA 5D93A 3ZVJA 1SYXA 2WS2A 2GZYA 4IJIA 1GLQA 1X9MB 2NVLA 1TRVA 5ECLB 4EO3A 1K0CA 1MEKA 5ELGA 2LV3A 1Q98A 3QR6A 3DVWA 5F07A 3UVTA 1SL2B 3LSZA 4AJ8A 1T00A 1JFUA 2DIZA 4AJ7A 2LRCA 1X9SB 3P8WA 4KE3A 3F4SA 3BOAA 1K3YA 5GSTA 2YJ7A 4ML1A 2LSTA 2JSYA 2GZPA 3F4RA 4PXOA 3TB2A 2RUEA 2PUKC 1THOA 1O85A 1JHBA 3F8UA 1Z9HA 1TOFA 2ES7A 2R3XA 5ECKB 3LXTA 4GQCA 4JE1A 4LL1B 3TKPA 6GSWA 3ZRDA 1WPIA 3GL3A 4FIWA 4PQHA 2FHEA 2I81A 1EGRA 3ZIVA 3LORA 1DUGA 2E0QA 2N5FA 4AJ6A 3GH9A 2PVQA 3LEFA 4TXOB 3FZ9A 2CV4A 2H0IA 1K0DA 1V58A 5FHIA 2IWTA 5LD0A 1GUKA 5D9VA 3KMOA 3U6VA 19GSA 5DALB 2ALBA 3HJPA 1M2BA 4PURA 2GVPA 2IN3A 2DJKA 1G6YA 4XHMA 3VURA 5KN2A 1PX7A 4ECJA 1XBSA 4O32A 4PX1A 4X0XA 1XWBA 3TKRA 5IM9A 5ECQB 3ZMLA 2KLXA 4KDXA 2DJ0A 1GNWA 2H1BA 3APQA 3GKXA 3HKRA 4OCEA 4XS6A 1X9WB 1PX6A 2MBSA 3EURA 2AJQB 2F8FA 1B9YC 4O5RA 2WULA 1S3DA 1GSDA 2XPDA 3RBTA 2CVKA 3FY7A 3MWHA 3ZLPA 4KA0A 2FCHA 3E0UA 2I9HA 2LNSA 2HNLA 2R37A 1BQ7A 4GSTA 2IMKA 2GT5A 2I4AA 6GSVA 5IPGA 2B7JA 1OYJA 3CSHA 2H73A 4WR5A 2AYTA 1TKDB 1A23A 4E8EA 3TJGA 4PQIA 3WGEA 2WGRA 3LYPA 4KGIA 1B4QA 2FNOA 2H70A 4HZ2A 5KEJA 5JWOB 3M1GA 4OCFA 1PKZA 2IMEA 2IIYA 4ECBA 3S9FA 3EWLA 3DD3A 5JCGA 3ZTLA 2XPEA 4IJ3A 1O7UA 4TKYA 5DBQA 3W8SA 2CX4A 3WGXA 1V57A 1Z6NA 2GGTA 4ID0A 1G7OA 2B3SA 4AF2A 4PUFC 1AC1A 3LWAA 2WCIA 1SJZA 2IFQB 1DE2A 4NXIA 3DMLA 1ML6A 5IMAA 3TRXA 2RM5A 4LA1A 1URMA 4OFTA 1TRUA 4F03A 1HNAA 4BA7A 1J08A 2JL4A 1RQMA 1TJDA 4EL1A 3IHQA 2LKUA 4NPBA 4Q5FA 1F3BA 5GZZB 2E7PA 1PMTA 1M2DA 1N2AA 3HJOA 2FA4A 1GTUA 1SD9A 1FW1A 2VL9A 2ZCTA 2OJLA 4RQXA 3HVXA 1TDIA 1K0MA 4LMWA 3WT1A 2BJXA 3L9SA 2LQQA 3GNJA 2GQLA 2GSRA 1ZYEA 3BCIA 2ZUPA 3KIJA 5DAKA 4TR4A 1TK8B 3FRCA 4NHZA 2OBIA 4MK3A 2LTKA 1Z6MA 3M8NA 1AXDA 2X8GA 4OO5A 2OADA 3PH9A 5A4UA 4OO4A 2L4QA 3FR9A 2C3TA 1ST9A 4V2MA 2NDOA 5ID2A 5AIVA 5J5NA 2VM1A 1T8EB 3UOMA 1XWKA 5HQPA 1A8LA 4RUVA 2C3NA 4J2FA 3RHBA 1QK8A 1F2EA 2D2ZA 1F9MA 2V41A 4EC0A 2PU9C 3EE2A 2FWEA 2R6KA 3VWWA 4I97A 1JLWA 17GSA 3EINA 5HR3A 1NW2A 3C71A 12GSA 2H01A 4Q5QA 3TJKA 3ZITA 2H74A 1WE0A 2H0HA 3UBKA 1VF4A 1EOHA 4XTSA 2K18A 3F3RA 4G10A 3BBYA 5GSSA 3L0HA 4IN0A 1XWGA 4TOPA 5EL8A 4F9ZA 1XFLA 4HJ2A 3I69A 4LMVA 6GSYA 1A8YA 1GSYA 3C1RA 1ZCPA 4EVMA 1SL1B 1SL0B 2JU5A 1M9AA 1X5EA 4IQAA 4ILFA 1GUHA 4ZBDA 3GIXA 1K0OA 5DJLA 4WR4A 4MDCA 4CHSA 1V9WA 3HYPA 1DSBA 3GHAA 3GURA 3TCOA 1JZRA 3CTGA 1PA3A 1XCCA 3I43A 3DVXA 4EF0A 2C8UA 3VPTA 1QGVA 4QQ7A 5ECOB 1BG5A 1Z3EA 1R5PA 3RPPA 1T4YA 1EZKA 3O3TA 1OAZA 5D96A 2F8AA 1EWXA 5AISA 8GSSA 3CBUA 3ISOA 4GLTA 1EP7A 3UEMA 4EXJA 3BJ5A 3J7Yk 2HFDA 1XW6A 4E8HA 1UVZA 3GX8A 5CO3A 1ERVA 4O7HA 4POKA 1XWAA 2X99A 4ML6A 1HNBA 3SBCA 2DSAA 2HRFA 1X5CA 2VOCA 4WF5A 4GXZA 3HVVA 2J23A 2FUG2 2IMDA 3KH9A 3TKSE 1PQNA 3M3MA 2HZFA 3NOFA 2WJUA 5J41A 2YCDA 4MPGA 2JZTA 3HJMA 1YF1A 3LGCA 2L59A 2KHPA 3C8EA 2DJ3A 4MZBA 4DSRA 2EIOA 1V98A 4MJCA 3DWVA 1EEMA 3H79A 3DIEA 2H19A 3KH7A 4XCSA 3FW2A 1SKWB 3EU3A 1MD3A 1Y25A 5IMVA 1GSSA 2B7KA 2MMZA 1WP0A 3GV1A 4HQZA 3VPQA 4N0ZA 2AV4A 3ERGA 3FZ5A 3VI5A 2GQKA 13GSA 2CA8A 5C00A 5B7CA 1FVKA 1OC9B 1DE1A 2L57A 4FO5A 2VCWA 4MH3A 1SK1A 2H71A 1CQHA 4QL7A 4L0WA 1SJIA 5J9BA 4GRFA 3K8NA 4ZL7A 4TXOA 4ZB8A 3D21A 3IBHA 1H4OA 5IMZA 1GSQA 2C80A 4V2NA 1YQ1A 4K6XA 2HI7A 3VWXA 3U5RE 1B8XA 5DALA 5ECIB 2C0FA 1ACVA 1ZMAA 1QUWA 3O76A 2JZSA 2TIRA 5INYA 3IPZA 1TU7A 3G7IA
chains in the Genus database with same CATH superfamily
3Q19A 2H0GA 2REMA 2HRKA 2A4HA 2EC4A 2KP2A 4ZL9A 2EIQA 2YNXA 4L0UA 4EDYA 4YKGA 5G30A 4OFMA 5ECMB 1EOGA 1XZOA 4N11A 2K8SA 3KEBA 2NBSA 5G1KA 5HFGA 2TRCP 5D9TA 4KX4A 4K7NA 3HCZA 3PR8A 2LS5A 2OE1A 1MDIA 4EDZA 1GL8A 5IMFA 1T1VA 1BYEA 2QKEA 5ECHB 2V1MA 3KP8A 4Z7XA 1AQWA 5G5EA 1R26A 4RI6A 3A2VA 3A2XA 2YWNA 5DVBA 4NAXA 1TRSA 4MLYA 1Z5YE 1RK4A 2AHEA 4KW6A 3IE3A 2I1UA 5KN0A 1T3BA 4ZXGA 3C1SA 2V6OA 1TRWA 3GA4A 2FWHA 4YQMA 1WWJA 2DJ2A 1YDKA 1EV9A 3F6DA 2GLRA 4H86A 5IQYA 1K0AA 2H30A 1J9BA 1EV4A 2WRTA 3TUEA 2R0GA 4ACSA 2ZNMA 5ENUA 4NHWA 1J0FA 3QOUA 3APSA 1ERWA 2B5YA 2GDRA 3OR5A 2YOIA 1PRXA 5CRHA 2YN1A 1GULA 1FVJA 2C0EA 1G6WA 4GQFA 2O7KA 4X43A 5KOWA 4KH7A 3BD2A 1XXUA 3L4NA 2IFQA 1JZOA 3M9JA 1GRXA 2GSQA 2VLVA 5EVOA 4K2XA 2YV7A 3AY8A 5CYYA 2YPMA 2OACA 5EPFA 3MAKA 1Q4JA 4XS4B 2E2GA 4BVYB 2VCTA 3GTUB 1GLPA 3QFBC 5H5SA 2VO4A 4TR1A 2V2GA 4KUNA 5AIXA 2YP6A 1GH2A 1PD21 3FZAA 1FB6A 1M3IA 4BL7A 1A24A 3VI7A 5EY6A 1FB0A 5B8AA 2M80A 4OFNA 2JSZA 4CY8A 2P5RA 3QPMA 4K7OA 3D5JA 4F82A 3QCPA 2N5AA 1OKTA 5IMCA 2F9SA 2QGVA 2H1GA 5G31A 3HXSA 4MMMA 3LFLA 3WYWA 3FK8A 2B1KA 3HY2A 2CVDA 3UAPA 3C73A 4WF4A 1QFNA 3EVIA 2KOKA 2V6KA 1KEBA 1USBA 3LG6A 4TW5A 5DQSA 2PBJA 1TTZA 1SK0A 6GSXA 1NHOA 2G2QA 2MBTA 1M0UA 3TRPA 4LL4B 3W6GA 1IYHA 5IMDA 2O89A 2CX3A 2IPAA 3ZFLA 4TRXA 4TR0A 4TR1B 2VL3A 4IKHA 1WIKA 1KTEA 2DJJA 2N5BA 1OE8A 3CRUA 4HEA2 1Y6EA 5D73A 2OBKA 1SYRA 4ZBAA 2WZ9A 1KBNA 1K3OA 1YEPA 5CAXA 1BAYA 2HE3A 3CXGA 3CQFA 1O8XA 2FWGA 3PINA 3GFKA 1F37A 4OD7A 1TI3A 5CP1A 1CQGA 4Q5NA 1XOAA 3FYGA 3UMAA 3IOSA 4Q5RA 5DDLA 5F8BA 1A0FA 1ILOA 2L6DA 2H1AA 1ZGNA 1TXXA 4N30A 2RLIA 5ECRB 4NV5A 2K6VA 4KSOA 1FO5A 4OMVA 3ZZXA 2F3MA 1M7TA 1BEDA 3QAWA 4BVXB 5A5KA 4MJAA 4HS1A 5E59A 2XHFA 2FA8A 3IAM2 1SJ6A 3FEUA 4YH2A 2JACA 5H5QA 1EP8A 4RI7A 3VWVA 4WETA 5IO0A 18GSA 2LJRA 2OE0A 1PL2A 3CTFA 2M72A 2JADA 4D73B 1UC7A 1LBKA 3TGZA 2RIIA 2AB6A 4POBA 3KTLA 2GT6A 3L9VA 1PGTA 1BJXA 2R5GA 3KM6A 3A3TA 2HZEB 2V32A 3F4TA 1X5DA 4MABA 3DEXA 5DQYA 3KGKA 4QL9A 1YF0A 3UIWA 1G7EA 2HRNA 2B1LA 5G1LA 2H6YA 3KMNA 5IOXA 1K0NA 5FWGA 3N9JA 3ME7A 5DCHA 2CQ9A 2VCXA 1ZZYA 2CZ3A 3CYNA 2XC2A 3VWUA 5L71A 4PNFA 3GH6A 2C0GA 4I2TA 4KB3A 2VD1A 5HFIA 2QC7A 3EMXA 1A2MA 1XPVA 1H75A 4IQ1A 5B6MA 1AUCA 2HSHA 3H4KA 3J7Yb 1XWCA 3F63A 1EGOA 3MSZA 1A2LA 5LNKe 2C3QA 3E9JB 1SKSB 3P90A 3NIVA 2R2JA 3WGDA 3IK7A 2R0CA 4Z2TA 2X49A 5LCZA 3ZMKA 2PN8A 3FMWA 4J56E 4JRRA 4PGTA 3L9UA 1G0TA 2B6MA 3IC8A 22GSA 3KTBA 4DVCA 1B4PA 4PNGA 1GSUA 3Q6OA 2DLXA 1YY7A 2R4VA 4K5RA 4KCAA 5IIZA 1OE7A 4Z2UA 5JWQB 5J3RA 4IP6A 3NZNA 4V2LA 5ELAA 1R5AA 1QQ2A 2IMIA 3MDKA 2L4CA 1MDJA 3HDCA 1W89A 3MIXA 2CVBA 5F05A 3IDVA 4EKZA 4O92A 4HQSA 3UL3A 1OC9A 4IELA 2YZUA 3E3EA 5KN1A 3WT2A 5A4WA 2G0FA 3V1WA 1YKCA 3D4MA 1U3AA 5CNWA 2GTUA 4MJEA 2MZCA 3HHVA 4HZ4A 5BMUA 1U3IA 3RPNA 3CRTA 2VM2A 5A4VA 2L5LA 2M46A 1C72A 5ECPB 3DXBA 1B48A 3US3A 2CAIA 1HNCA 3H8QA 1GUMA 1GTBA 2YV9A 4GSNA 1IYIA 14GSA 3TJFA 4DSSB 1VGLA 1WRYA 3D6IA 2VD0A 1WJKA 4K8MA 1NM3A 2LJAA 2B5EA 4V1Ap 1YZXA 3UBLA 2HSMA 2X8CA 4TVEA 2YJHA 1AQXA 2R0PA 4MCUA 1F3AA 4ZB6A 5HR1A 1OVNA 2PPTA 2NPBA 3H93A 1ABAA 2LNTA 4G9HA 2PGTA 4MF6A 1FOHA 5G5FA 1PN9A 4K1FA 1GTIA 1K0BA 3IR4A 4MF5A 1WOUA 3FKFA 4XIHA 5COHA 5D8IA 3JCML 4DSQA 2HLSA 4BPYA 2I3YA 1GTAA 2K8VA 1GP1A 2NTOA 5C04A 2QSIA 3ERWA 1O73A 4MF7A 3ME8A 2WB9A 1PFOA 3TOUA 2VUPA 1FHEA 1MD4A 2DJ1A 4WKWA 2YZHA 2A2RA 4MZWA 2K9FA 2XBIA 11GSA 1ZYNA 4LLRA 1JZWA 2O85A 4PUAA 1V2AA 3G7JA 3EYTA 4G0LA 4X1UA 3M0FA 2MMNA 4L5OA 1LU4A 4IVFA 5IOWA 2O87A 4JZQA 1AIUA 3HA9A 2FWFA 4NV2A 3O6TA 1YEXA 3EC3A 1M2AA 3TKQA 3G9BA 2CZ2A 4ICYA 3QMXA 1I9DA 1DBYA 16GSA 1FG4A 5B8BA 5AN1A 4EUYA 2LQOA 3VLNA 2DIYA 2Z9SA 3ZREA 1AW9A 2H76A 5GAPD 4JBBA 3HVSA 3A5WA 4JR4A 2DMMA 4XS4A 4BVYA 2LUSA 3TJBA 3GTUA 2PVOC 3DGQA 2KP1A 1XIYA 4WBJA 4YQUA 3ZVJD 1SK2A 1JZDA 3HZ4A 3Q74A 2RM6A 1FOVA 1GSEA 3APOA 1A0RP 4ZB9A 2GSSA 3IHGA 3MNGA 3TDGA 3UJ1A 1TK5B 2H72A 3CSJA 3H1NA 3IV4A 4ZL8A 3GN3A 1WMJA 2WFCA 1SU9A 4POMA 1ON4A 3GSTA 2VL2A 4KCEA 2H6ZA 1NHYA 2C0DA 3UVHA 2IMFA 4POLA 4IGJA 2MMAA 3I9V2 4YAVA 1QMVA 3ZIJA 4ZIJA 1T7PB 6GSUA 3QDNA 3ZYWA 3D0ZA 1XVQA 2YANA 4MP4A 1SKRB 3QFAC 4G19A 5CRDA 3LQ7A 2CT6A 1YKAA 5ECSA 1ZL9A 1S3RA 2P31A 2H8LA 5DCGA 3QD9A 3ED3A 1S3CA 1VF2A 4K7IA 1ERUA 2H75A 3W8JA 4HUAA 1VRSD 1TW9A 3GKNA 3IK9A 4ECCA 2RUFA 4IHUA 3VFIA 4ECIA 1HD2A 3F9UA 5JCWA 1O8WA 5ABRA 2HT9A 5F0GA 4IW9A 4PQ1A 1X0RA 2A4VA 3D22A 2DBCA 3IRAA 1B9XC 4EIPA 1LJRA 3DKSA 3QAVA 1V40A 4BVXA 2GS3A 4K2DA 1UN2A 4O5UA 1O81A 2PWJA 2FD3A 5D9XA 2VCQA 2VLUA 1PL1A 2FY6A 1FAAA 4JR6A 2LRNA 2HYXA 3RDWA 3FZ4A 4I5QA 2MMOA 4HDEA 4TR3A 2VL2C 3TJJA 4D73A 3BCKA 3C7MA 2A2SA 2XBQA 3KJYA 1XOBA 4N0VA 1NSWA 5CRGA 1SENA 3HD5A 3CSIA 2HZEA 2X64A 4GSSA 4AGSA 2GSTA 4RQRA 2L6CA 3R2QA 2EIRA 4XS1A 3CMIA 3PGTA 2YWOA 4IS0A 2E2MA 3KD0A 4KNDA 5KN3A 3DRNA 3TOTA 3IC4A 1M99A 2FLSA 3KCMA 3QAGA 3EMPA 4XRDA 3Q18A 4BIKA 3LXZA 3RAZA 4L8EA 3GUSA 2MYGA 2DMLA 4I2UA 4HU9A 1XW9A 5E4WA 1E6BA 4BWQA 4I8BA 3SWLA 3I6AA 4CY6A 5F06A 2BTOT 2PERA 2VIMA 1OC8A 4JU5A 4CDOA 1ZYQB 2O8VB 1UA5A 4HI7A 2B5XA 1GNEA 4I6XA 5GAND 4JEDA 1GSFA 1MDKA 4GF0A 4HU7A 5FT3A 4FYCA 3F6FA 2L5OA 3ZFBA 4GWRA 5IPHA 3IAS2 1PKWA 1ZOFA 3WD6A 2ON7A 4N10A 2IJYA 5DJMA 2C4JA 1Z7PA 5ECNB 1PSQA 1T4ZA 4WEYA 3LJRA 4CW9A 9GSSA 3MYDA 1I5GA 2TRXA 3ERFA 5HFKA 4KAEA 3L78A 1F6MC 2F51A 3P7XA 1YJ6A 3G7YA 2OE3A 4TN8A 3P2AA 5DAKB 4FYBA 1R4WA 3GYKA 4WXTA 3TKSA 2VCZA 2ON5A 3VK9A 4IP1A 2BMXA 2QA1A 3FHKA 5J4UA 3GRXA 1O6JA 2YWMA 4HOJA 4EE0A 3GMFA 1QXHA 1KNGA 4K0NA 2OKAA 2HRAA 4ISDA 1JLVA 5H5RA 4WBRD 5HR2A 1BX9A 5IO2A 1MTCA 3HZ8A 1OC3A 4G0KA 2AAWA 2VAFA 4K0GA 5B6NA 5ID2B 3F0IA 3GKKA 2YWIA 4F0BA 5D9WA 3IA1A 1EEJA 5JWRB 1AAZA 4ULXA 1TK0B 3F3QA 4NMUA 1VF3A 4KDYA 2IL3A 3A2WA 3M9KA 1TP9A 4FYUA 4TXVA 3GKMA 4XRAA 2H6XA 2JZRA 4IBPA 1XVWA 3GX0A 4ZILA 2VLTA 10GSA 4FH8A 2AUVA 4P3YB 5G2ZA 1U88A 3D4TA 2WDUA 4DSSA 4MZCA 1HQOA 4NWYA 1Z7RA 4F0CA 4MH2A 3UARA 4MNNA 2FGXA 1W4VA 3N5OA 2HSYA 4KSMA 5CREA 4OWYA 2LRTA 20GSA 2P5QA 2A2PA 3EU4A 3FR3A 1OKDA 4YAPA 1U6TA 1TU8A 2CAQA 4GTUA 2J9HA 4GCIA 2KUCA 2VCVA 4KDUA 6GSSA 1R7HA 1S3AA 3TKSC 4BWSA 3LYKA 4PTSA 5HR0A 4V1Ag 6GSTA 3RHCA 4L5LA 3GSSA 2PMTA 3KP9A 1THXA 4J57E 4K9ZA 2GQMA 4YQVA 2HXKA 2LJKA 3ZL5A 2X8HA 2LEGA 1GWCA 4G2EA 1VF1A 1A2JA 3HVNA 1ERTA 3IXRA 4F2IA 2H1DA 1RW1A 1SD8A 4MA9A 4DEJA 1XW5A 3KXOA 3FR6A 3GL5A 1N8JA 2GZZA 2P0GA 3TRQA 4MPFA 5AGYA 2OA7A 4HSCX 3KZQA 7GSSA 1AQVA 1K3LA 5CRWA 5J9CA 2H66A 1M9BA 1E2YA 3DYRA 4HJMA 4ZBBA 1U87A 2C1YA 4MJBA 1TI1A 5JCUA 2DC5A 1HYUA 5KOXA 5D93A 3ZVJA 1SYXA 2WS2A 2GZYA 4IJIA 1GLQA 1X9MB 2NVLA 1TRVA 5ECLB 4EO3A 1K0CA 1MEKA 5ELGA 2LV3A 1Q98A 3QR6A 3DVWA 5F07A 3UVTA 1SL2B 3LSZA 4AJ8A 1T00A 1JFUA 2DIZA 4AJ7A 2LRCA 1X9SB 3P8WA 4KE3A 3F4SA 3BOAA 1K3YA 5GSTA 2YJ7A 4ML1A 2LSTA 2JSYA 2GZPA 3F4RA 4PXOA 3TB2A 2RUEA 2PUKC 1THOA 1O85A 1JHBA 3F8UA 1Z9HA 1TOFA 2ES7A 2R3XA 5ECKB 3LXTA 4GQCA 4JE1A 4LL1B 3TKPA 6GSWA 3ZRDA 1WPIA 3GL3A 4FIWA 4PQHA 2FHEA 2I81A 1EGRA 3ZIVA 3LORA 1DUGA 2E0QA 2N5FA 4AJ6A 3GH9A 2PVQA 3LEFA 4TXOB 3FZ9A 2CV4A 2H0IA 1K0DA 1V58A 5FHIA 2IWTA 5LD0A 1GUKA 3EPTA 5D9VA 3KMOA 3U6VA 19GSA 5DALB 2ALBA 3HJPA 1M2BA 4PURA 2GVPA 2IN3A 2DJKA 1G6YA 4XHMA 3VURA 5KN2A 1PX7A 4O5QA 4ECJA 1XBSA 4O32A 4PX1A 1ZYPA 4X0XA 1XWBA 3TKRA 5IM9A 5ECQB 3ZMLA 2KLXA 4KDXA 2DJ0A 1GNWA 2H1BA 3APQA 3GKXA 3HKRA 4OCEA 4XS6A 1X9WB 1PX6A 2MBSA 3EURA 2AJQB 2F8FA 1B9YC 4O5RA 2WULA 1S3DA 1GSDA 2XPDA 3RBTA 2CVKA 3FY7A 3MWHA 3ZLPA 4KA0A 2FCHA 3E0UA 2I9HA 2LNSA 2HNLA 2R37A 3R3EA 1BQ7A 4GSTA 2IMKA 2GT5A 2I4AA 6GSVA 5IPGA 2B7JA 1XG8A 3LW9A 1OYJA 3CSHA 2H73A 4WR5A 2AYTA 1TKDB 1A23A 4E8EA 3TJGA 4PQIA 3WGEA 2WGRA 5BRTA 3LYPA 4KGIA 1B4QA 2FNOA 2H70A 4HZ2A 5KEJA 5JWOB 3M1GA 4OCFA 1PKZA 2IMEA 2IIYA 4ECBA 3S9FA 3EWLA 3DD3A 5JCGA 3ZTLA 2XPEA 4IJ3A 1O7UA 4TKYA 5DBQA 3W8SA 2CX4A 3WGXA 1V57A 1Z6NA 2GGTA 4ID0A 1G7OA 2B3SA 4AF2A 4PUFC 1AC1A 3LWAA 2WCIA 1SJZA 2IFQB 1DE2A 4K5SA 4YKFA 4NXIA 3DMLA 1ML6A 5IMAA 3TRXA 2RM5A 4LA1A 1URMA 4OFTA 1TRUA 4F03A 1HNAA 4BA7A 1J08A 2JL4A 1RQMA 1TJDA 4EL1A 3IHQA 2LKUA 4NPBA 4Q5FA 1F3BA 5GZZB 4BL7B 2E7PA 1PMTA 1M2DA 1N2AA 3HJOA 2FA4A 4EIQA 1GTUA 1SD9A 1FW1A 2VL9A 2ZCTA 2OJLA 4RQXA 3HVXA 1TDIA 1K0MA 4LMWA 3WT1A 2BJXA 3L9SA 2LQQA 3GNJA 2GQLA 2GSRA 1ZYEA 3BCIA 4FQUA 2ZUPA 3KIJA 5DAKA 4TR4A 1TK8B 3FRCA 4NHZA 2OBIA 4MK3A 2LTKA 1Z6MA 3M8NA 1AXDA 4USSA 2X8GA 4OO5A 2OADA 3PH9A 5A4UA 4OO4A 2L4QA 3FR9A 2C3TA 1ST9A 4V2MA 2NDOA 5ID2A 5AIVA 5J5NA 2VM1A 1T8EB 3UOMA 1XWKA 5HQPA 1A8LA 4RUVA 2C3NA 4J2FA 3RHBA 1QK8A 1F2EA 2D2ZA 1F9MA 2V41A 4EC0A 2PU9C 3EE2A 2FWEA 2R6KA 3VWWA 4I97A 1JLWA 17GSA 3EINA 5HR3A 1NW2A 3C71A 12GSA 2H01A 4Q5QA 3TJKA 3ZITA 2H74A 1WE0A 4G0IA 2H0HA 3UBKA 1VF4A 1EOHA 4XTSA 2K18A 3F3RA 4G10A 3BBYA 5GSSA 3L0HA 4IN0A 1XWGA 4TOPA 5EL8A 4F9ZA 1XFLA 4HJ2A 3I69A 4LMVA 6GSYA 1A8YA 1GSYA 3C1RA 1ZCPA 4EVMA 1SL1B 1SL0B 2JU5A 2UZ8A 1M9AA 1X5EA 4IQAA 2QA2A 4ILFA 4A5PA 1GUHA 4ZBDA 3GIXA 1K0OA 5DJLA 4WR4A 4MDCA 4CHSA 1V9WA 3HYPA 1DSBA 3GHAA 3GURA 3TCOA 1JZRA 3CTGA 1PA3A 1XCCA 3I43A 3DVXA 4EF0A 2C8UA 3VPTA 1QGVA 4QQ7A 5ECOB 1BG5A 1Z3EA 1R5PA 3RPPA 1T4YA 1EZKA 3O3TA 1OAZA 2F8AA 1EWXA 5AISA 5D96A 8GSSA 3CBUA 3ISOA 4GLTA 1EP7A 3UEMA 4KF9A 4EXJA 3BJ5A 3J7Yk 2HFDA 4X4JA 1XW6A 4E8HA 1UVZA 3GX8A 5CO3A 1ERVA 4O7HA 4POKA 1XWAA 2X99A 4ML6A 1HNBA 3SBCA 2DSAA 2HRFA 1X5CA 2VOCA 4WF5A 3A5IA 4GXZA 3HVVA 2J23A 2FUG2 2IMDA 3KH9A 3TKSE 1PN0A 1PQNA 3M3MA 2HZFA 3NOFA 2WJUA 2DKIA 5J41A 2YCDA 4MPGA 2JZTA 3HJMA 1YF1A 3LGCA 2L59A 2KHPA 3C8EA 2DJ3A 4MZBA 4DSRA 2EIOA 1V98A 4MJCA 3DWVA 1M3JA 1EEMA 3H79A 3DIEA 2H19A 3KH7A 4XCSA 3FW2A 1SKWB 3EU3A 1MD3A 1Y25A 5IMVA 1GSSA 2B7KA 2MMZA 1WP0A 3GV1A 4HQZA 3VPQA 4N0ZA 2AV4A 3ERGA 3FZ5A 3VI5A 2GQKA 13GSA 2CA8A 5C00A 5B7CA 1FVKA 1OC9B 1DE1A 2L57A 4FO5A 2VCWA 4MH3A 1SK1A 2H71A 1CQHA 4Z2RA 4QL7A 4L0WA 1SJIA 5J9BA 4GRFA 2X4AA 3K8NA 4ZL7A 3PPUA 4TXOA 4ZB8A 3D21A 3IBHA 1H4OA 5IMZA 1GSQA 2C80A 4V2NA 1YQ1A 4K6XA 2HI7A 3VWXA 3U5RE 1B8XA 5DALA 5ECIB 2C0FA 1ACVA 1ZMAA 1QUWA 3O76A 2JZSA 2TIRA 2DKHA 5INYA 3IPZA 1TU7A 3G7IA
chains in the Genus database with same CATH topology
3Q19A 2H0GA 2REMA 2HRKA 2A4HA 2EC4A 2KP2A 4ZL9A 2EIQA 2YNXA 4L0UA 4EDYA 4YKGA 5G30A 4OFMA 5ECMB 1EOGA 1XZOA 4N11A 2K8SA 3KEBA 2NBSA 5G1KA 5HFGA 2TRCP 5D9TA 4KX4A 4K7NA 3HCZA 3PR8A 2LS5A 2OE1A 1MDIA 4EDZA 1GL8A 5IMFA 1T1VA 1BYEA 2QKEA 5ECHB 2V1MA 3KP8A 4Z7XA 1AQWA 5G5EA 1R26A 4RI6A 3A2VA 3A2XA 2YWNA 5DVBA 4NAXA 1TRSA 4MLYA 1Z5YE 1RK4A 2AHEA 4KW6A 3IE3A 2I1UA 5KN0A 1T3BA 4ZXGA 3C1SA 2V6OA 1TRWA 3GA4A 2FWHA 4YQMA 1WWJA 2DJ2A 1YDKA 1EV9A 3F6DA 2GLRA 4H86A 5IQYA 1K0AA 2H30A 1J9BA 1EV4A 2WRTA 3TUEA 2R0GA 4ACSA 2ZNMA 5ENUA 4NHWA 1J0FA 3QOUA 3APSA 1ERWA 2B5YA 2GDRA 3OR5A 2YOIA 1PRXA 5CRHA 2YN1A 1GULA 1FVJA 2C0EA 1G6WA 4GQFA 2O7KA 4X43A 5KOWA 4KH7A 3BD2A 1XXUA 3L4NA 2IFQA 1JZOA 3M9JA 1GRXA 2GSQA 2VLVA 5EVOA 4K2XA 2YV7A 3AY8A 5CYYA 2YPMA 2OACA 5EPFA 3MAKA 1Q4JA 4XS4B 2E2GA 4BVYB 2VCTA 3GTUB 1GLPA 3QFBC 5H5SA 2VO4A 4TR1A 2V2GA 4KUNA 5AIXA 2YP6A 1GH2A 1PD21 3FZAA 1FB6A 4BL7A 1A24A 3VI7A 5EY6A 1FB0A 5B8AA 2M80A 4OFNA 2JSZA 4CY8A 2P5RA 3QPMA 4K7OA 3D5JA 4F82A 3QCPA 2N5AA 1OKTA 5IMCA 2F9SA 2QGVA 2H1GA 5G31A 3HXSA 4MMMA 3LFLA 3WYWA 3FK8A 2B1KA 3HY2A 2CVDA 3UAPA 3C73A 4WF4A 1QFNA 3EVIA 2KOKA 2V6KA 1KEBA 1USBA 3LG6A 4TW5A 5DQSA 2PBJA 1TTZA 1SK0A 6GSXA 1NHOA 2G2QA 2MBTA 1M0UA 3TRPA 4LL4B 3W6GA 1IYHA 5IMDA 2O89A 2CX3A 2IPAA 3ZFLA 4TRXA 4TR0A 4TR1B 2VL3A 4IKHA 1WIKA 1KTEA 2DJJA 2N5BA 1OE8A 3CRUA 4HEA2 1Y6EA 5D73A 2OBKA 1SYRA 4ZBAA 2WZ9A 1KBNA 1K3OA 1YEPA 5CAXA 1BAYA 2HE3A 3CXGA 1O8XA 2FWGA 3PINA 3GFKA 1F37A 4OD7A 1TI3A 5CP1A 1CQGA 4Q5NA 1XOAA 3FYGA 3UMAA 3IOSA 4Q5RA 5DDLA 5F8BA 1A0FA 1ILOA 2L6DA 2H1AA 1ZGNA 1TXXA 4N30A 2RLIA 5ECRB 4NV5A 2K6VA 4KSOA 1FO5A 4OMVA 3ZZXA 2F3MA 1M7TA 1BEDA 3QAWA 4BVXB 5A5KA 4MJAA 4HS1A 5E59A 2XHFA 2FA8A 3IAM2 1SJ6A 3FEUA 4YH2A 2JACA 5H5QA 1EP8A 4RI7A 3VWVA 4WETA 5IO0A 18GSA 2LJRA 2OE0A 1PL2A 3CTFA 2M72A 2JADA 4D73B 1UC7A 1LBKA 3TGZA 2RIIA 2AB6A 4POBA 3KTLA 2GT6A 3L9VA 1PGTA 1BJXA 2R5GA 3KM6A 3A3TA 2HZEB 2V32A 3F4TA 1X5DA 4MABA 3DEXA 5DQYA 3KGKA 4QL9A 1YF0A 3UIWA 1G7EA 2HRNA 2B1LA 5G1LA 2H6YA 3KMNA 5IOXA 1K0NA 5FWGA 3N9JA 3ME7A 5DCHA 2CQ9A 2VCXA 1ZZYA 2CZ3A 3CYNA 2XC2A 3VWUA 5L71A 4PNFA 3GH6A 2C0GA 4I2TA 4KB3A 2VD1A 5HFIA 2QC7A 3EMXA 1A2MA 1XPVA 1H75A 4IQ1A 5B6MA 1AUCA 2HSHA 3H4KA 3J7Yb 1XWCA 3F63A 1EGOA 3MSZA 1A2LA 5LNKe 2C3QA 3E9JB 1SKSB 3P90A 3NIVA 2R2JA 3WGDA 3IK7A 2R0CA 4Z2TA 2X49A 5LCZA 3ZMKA 2PN8A 3FMWA 4J56E 4JRRA 4PGTA 3L9UA 1G0TA 2B6MA 3IC8A 22GSA 3KTBA 4DVCA 1B4PA 4PNGA 1GSUA 3Q6OA 2DLXA 1YY7A 2R4VA 4K5RA 4KCAA 5IIZA 1OE7A 4Z2UA 5JWQB 5J3RA 4IP6A 3NZNA 4V2LA 5ELAA 1R5AA 1QQ2A 2IMIA 3MDKA 2L4CA 1MDJA 3HDCA 1W89A 3MIXA 2CVBA 5F05A 3IDVA 4EKZA 4O92A 4HQSA 3UL3A 1OC9A 4IELA 2YZUA 3E3EA 5KN1A 3WT2A 5A4WA 2G0FA 3V1WA 1YKCA 3D4MA 1U3AA 5CNWA 2GTUA 4MJEA 2MZCA 3HHVA 4HZ4A 5BMUA 1U3IA 3RPNA 3CRTA 2VM2A 5A4VA 2L5LA 2M46A 1C72A 5ECPB 3DXBA 1B48A 3US3A 2CAIA 1HNCA 3H8QA 1GUMA 1GTBA 2YV9A 4GSNA 1IYIA 14GSA 3TJFA 4DSSB 1VGLA 1WRYA 3D6IA 2VD0A 1WJKA 4K8MA 1NM3A 2LJAA 2B5EA 4V1Ap 1YZXA 3UBLA 2HSMA 2X8CA 4TVEA 2YJHA 1AQXA 2R0PA 4MCUA 1F3AA 4ZB6A 5HR1A 1OVNA 2PPTA 2NPBA 3H93A 1ABAA 2LNTA 4G9HA 2PGTA 4MF6A 1FOHA 5G5FA 1PN9A 4K1FA 1GTIA 1K0BA 3IR4A 4MF5A 1WOUA 3FKFA 4XIHA 5COHA 5D8IA 3JCML 4DSQA 2HLSA 4BPYA 2I3YA 1GTAA 2K8VA 1GP1A 2NTOA 5C04A 2QSIA 3ERWA 1O73A 4MF7A 3ME8A 2WB9A 3TOUA 2VUPA 1FHEA 1MD4A 2DJ1A 4WKWA 2YZHA 2A2RA 4MZWA 2K9FA 2XBIA 11GSA 1ZYNA 4LLRA 1JZWA 2O85A 4PUAA 1V2AA 3G7JA 3EYTA 4G0LA 4X1UA 3M0FA 2MMNA 4L5OA 1LU4A 4IVFA 5IOWA 2O87A 4JZQA 1AIUA 3HA9A 2FWFA 4NV2A 3O6TA 1YEXA 3EC3A 1M2AA 3TKQA 3G9BA 2CZ2A 4ICYA 3QMXA 1I9DA 1DBYA 16GSA 1FG4A 5B8BA 5AN1A 4EUYA 2LQOA 3VLNA 2DIYA 2Z9SA 3ZREA 1AW9A 2H76A 5GAPD 4JBBA 3HVSA 3A5WA 4JR4A 2DMMA 4XS4A 4BVYA 2LUSA 3TJBA 3GTUA 2PVOC 3DGQA 2KP1A 1XIYA 4WBJA 4YQUA 3ZVJD 1SK2A 1JZDA 3HZ4A 3Q74A 2RM6A 1FOVA 1GSEA 3APOA 1A0RP 4ZB9A 2GSSA 3IHGA 3MNGA 3TDGA 3UJ1A 1TK5B 2H72A 3CSJA 3H1NA 3IV4A 4ZL8A 3GN3A 1WMJA 2WFCA 1SU9A 4POMA 1ON4A 3GSTA 2VL2A 4KCEA 2H6ZA 1NHYA 2C0DA 3UVHA 2IMFA 4POLA 4IGJA 2MMAA 3I9V2 4YAVA 1QMVA 3ZIJA 4ZIJA 1T7PB 6GSUA 3QDNA 3ZYWA 3D0ZA 1XVQA 2YANA 4MP4A 1SKRB 3QFAC 4G19A 5CRDA 3LQ7A 2CT6A 1YKAA 5ECSA 1ZL9A 2P31A 2H8LA 5DCGA 3QD9A 3ED3A 1S3CA 1VF2A 4K7IA 1ERUA 2H75A 3W8JA 4HUAA 1VRSD 1TW9A 3GKNA 3IK9A 4ECCA 2RUFA 4IHUA 3VFIA 4ECIA 1HD2A 3F9UA 5JCWA 1O8WA 5ABRA 2HT9A 5F0GA 4IW9A 4PQ1A 1X0RA 2A4VA 3D22A 2DBCA 3IRAA 1B9XC 4EIPA 1LJRA 3DKSA 3QAVA 1V40A 4BVXA 2GS3A 4K2DA 1UN2A 4O5UA 1O81A 2PWJA 2FD3A 5D9XA 2VCQA 2VLUA 1PL1A 2FY6A 1FAAA 4JR6A 2LRNA 2HYXA 3RDWA 3FZ4A 4I5QA 2MMOA 4HDEA 4TR3A 2VL2C 3TJJA 4D73A 3BCKA 3C7MA 2A2SA 2XBQA 3KJYA 1XOBA 4N0VA 1NSWA 5CRGA 1SENA 3HD5A 3CSIA 2HZEA 2X64A 4GSSA 4AGSA 2GSTA 4RQRA 2L6CA 3R2QA 2EIRA 4XS1A 3CMIA 3PGTA 2YWOA 4IS0A 2E2MA 3KD0A 4KNDA 5KN3A 3DRNA 3TOTA 3IC4A 1M99A 2FLSA 3KCMA 3QAGA 3EMPA 4XRDA 3Q18A 3LXZA 3RAZA 4L8EA 3GUSA 2MYGA 2DMLA 4I2UA 4HU9A 1XW9A 5E4WA 1E6BA 4BWQA 4I8BA 3SWLA 3I6AA 4CY6A 5F06A 2BTOT 2PERA 2VIMA 1OC8A 4JU5A 4CDOA 1ZYQB 2O8VB 1UA5A 4HI7A 2B5XA 1GNEA 4I6XA 5GAND 4JEDA 1GSFA 1MDKA 4GF0A 4HU7A 5FT3A 4FYCA 3F6FA 2L5OA 3ZFBA 4GWRA 5IPHA 3IAS2 1PKWA 1ZOFA 3WD6A 2ON7A 4N10A 2IJYA 5DJMA 2C4JA 1Z7PA 5ECNB 1PSQA 1T4ZA 4WEYA 3LJRA 4CW9A 9GSSA 3MYDA 1I5GA 2TRXA 3ERFA 5HFKA 4KAEA 3L78A 1F6MC 2F51A 3P7XA 1YJ6A 3G7YA 2OE3A 4TN8A 3P2AA 5DAKB 4FYBA 1R4WA 3GYKA 4WXTA 3TKSA 2VCZA 2ON5A 3VK9A 4IP1A 2BMXA 2QA1A 3FHKA 5J4UA 3GRXA 1O6JA 2YWMA 4HOJA 4EE0A 3GMFA 1QXHA 1KNGA 4K0NA 2OKAA 2HRAA 4ISDA 1JLVA 5H5RA 4WBRD 5HR2A 1BX9A 5IO2A 1MTCA 3HZ8A 1OC3A 4G0KA 2AAWA 2VAFA 4K0GA 5B6NA 5ID2B 3F0IA 3GKKA 2YWIA 4F0BA 5D9WA 3IA1A 1EEJA 5JWRB 1AAZA 4ULXA 1TK0B 3F3QA 4NMUA 1VF3A 4KDYA 2IL3A 3A2WA 3M9KA 1TP9A 4FYUA 4TXVA 3GKMA 4XRAA 2H6XA 2JZRA 4IBPA 1XVWA 3GX0A 4ZILA 2VLTA 10GSA 4FH8A 2AUVA 4P3YB 5G2ZA 1U88A 3D4TA 2WDUA 4DSSA 4MZCA 1HQOA 4NWYA 1Z7RA 4F0CA 4MH2A 3UARA 4MNNA 2FGXA 1W4VA 3N5OA 2HSYA 4KSMA 5CREA 4OWYA 2LRTA 20GSA 2P5QA 2A2PA 3EU4A 3FR3A 1OKDA 4YAPA 1U6TA 1TU8A 2CAQA 4GTUA 2J9HA 4GCIA 2KUCA 2VCVA 4KDUA 6GSSA 1R7HA 1S3AA 3TKSC 4BWSA 3LYKA 4PTSA 5HR0A 4V1Ag 6GSTA 3RHCA 4L5LA 3GSSA 2PMTA 3KP9A 1THXA 4J57E 4K9ZA 2GQMA 4YQVA 2HXKA 2LJKA 3ZL5A 2X8HA 2LEGA 1GWCA 4G2EA 1VF1A 1A2JA 1ERTA 3IXRA 4F2IA 2H1DA 1RW1A 1SD8A 4MA9A 4DEJA 1XW5A 3KXOA 3FR6A 3GL5A 1N8JA 2GZZA 2P0GA 3TRQA 4MPFA 5AGYA 2OA7A 3KZQA 7GSSA 1AQVA 1K3LA 5CRWA 5J9CA 2H66A 1M9BA 1E2YA 3DYRA 4HJMA 4ZBBA 1U87A 2C1YA 4MJBA 1TI1A 5JCUA 2DC5A 1HYUA 5KOXA 5D93A 3ZVJA 1SYXA 2WS2A 2GZYA 4IJIA 1GLQA 1X9MB 2NVLA 1TRVA 5ECLB 4EO3A 1K0CA 1MEKA 5ELGA 2LV3A 1Q98A 3QR6A 3DVWA 5F07A 3UVTA 1SL2B 3LSZA 4AJ8A 1T00A 1JFUA 2DIZA 4AJ7A 2LRCA 1X9SB 3P8WA 4KE3A 3F4SA 3BOAA 1K3YA 5GSTA 2YJ7A 4ML1A 2LSTA 2JSYA 2GZPA 3F4RA 4PXOA 3TB2A 2RUEA 2PUKC 1THOA 1O85A 1JHBA 3F8UA 1Z9HA 1TOFA 2ES7A 2R3XA 5ECKB 3LXTA 4GQCA 4JE1A 4LL1B 3TKPA 6GSWA 3ZRDA 1WPIA 3GL3A 4FIWA 4PQHA 2FHEA 2I81A 1EGRA 3ZIVA 3LORA 1DUGA 2E0QA 2N5FA 4AJ6A 3GH9A 2PVQA 3LEFA 4TXOB 3FZ9A 2CV4A 2H0IA 1K0DA 1V58A 5FHIA 2IWTA 5LD0A 1GUKA 3EPTA 5D9VA 3KMOA 3U6VA 19GSA 5DALB 2ALBA 3HJPA 1M2BA 4PURA 2GVPA 2IN3A 2DJKA 1G6YA 4XHMA 3VURA 5KN2A 1PX7A 4O5QA 4ECJA 1XBSA 4O32A 4PX1A 1ZYPA 4X0XA 1XWBA 3TKRA 5IM9A 5ECQB 3ZMLA 2KLXA 4KDXA 2DJ0A 1GNWA 2H1BA 3APQA 3GKXA 3HKRA 4OCEA 4XS6A 1X9WB 1PX6A 2MBSA 3EURA 2AJQB 2F8FA 1B9YC 4O5RA 2WULA 1S3DA 1GSDA 2XPDA 3RBTA 2CVKA 3FY7A 3MWHA 3ZLPA 4KA0A 2FCHA 3E0UA 2I9HA 2LNSA 2HNLA 2R37A 3R3EA 1BQ7A 4GSTA 2IMKA 2GT5A 2I4AA 6GSVA 5IPGA 2B7JA 3LW9A 1OYJA 3CSHA 2H73A 4WR5A 2AYTA 1TKDB 1A23A 4E8EA 3TJGA 4PQIA 3WGEA 2WGRA 5BRTA 3LYPA 4KGIA 1B4QA 2FNOA 2H70A 4HZ2A 5KEJA 5JWOB 3M1GA 4OCFA 1PKZA 2IMEA 2IIYA 4ECBA 3S9FA 3EWLA 3DD3A 5JCGA 3ZTLA 2XPEA 4IJ3A 1O7UA 4TKYA 5DBQA 3W8SA 2CX4A 3WGXA 1V57A 1Z6NA 2GGTA 4ID0A 1G7OA 2B3SA 4AF2A 4PUFC 1AC1A 3LWAA 2WCIA 1SJZA 2IFQB 1DE2A 4K5SA 4YKFA 4NXIA 3DMLA 1ML6A 5IMAA 3TRXA 2RM5A 4LA1A 1URMA 4OFTA 1TRUA 4F03A 1HNAA 4BA7A 1J08A 2JL4A 1RQMA 1TJDA 4EL1A 3IHQA 2LKUA 4NPBA 4Q5FA 1F3BA 5GZZB 4BL7B 2E7PA 1PMTA 1M2DA 1N2AA 3HJOA 2FA4A 4EIQA 1GTUA 1SD9A 1FW1A 2VL9A 2ZCTA 2OJLA 4RQXA 3HVXA 1TDIA 1K0MA 4LMWA 3WT1A 2BJXA 3L9SA 2LQQA 3GNJA 2GQLA 2GSRA 1ZYEA 3BCIA 4FQUA 2ZUPA 3KIJA 5DAKA 4TR4A 1TK8B 3FRCA 4NHZA 2OBIA 4MK3A 2LTKA 1Z6MA 3M8NA 1AXDA 4USSA 2X8GA 4OO5A 2OADA 3PH9A 5A4UA 4OO4A 2L4QA 3FR9A 2C3TA 1ST9A 4V2MA 2NDOA 5ID2A 5AIVA 5J5NA 2VM1A 1T8EB 3UOMA 1XWKA 5HQPA 1A8LA 4RUVA 2C3NA 4J2FA 3RHBA 1QK8A 1F2EA 2D2ZA 1F9MA 2V41A 4EC0A 2PU9C 3EE2A 2FWEA 2R6KA 3VWWA 4I97A 1JLWA 17GSA 3EINA 5HR3A 1NW2A 3C71A 12GSA 2H01A 4Q5QA 3TJKA 3ZITA 2H74A 1WE0A 4G0IA 2H0HA 3UBKA 1VF4A 1EOHA 4XTSA 2K18A 3F3RA 4G10A 3BBYA 5GSSA 3L0HA 4IN0A 1XWGA 4TOPA 5EL8A 4F9ZA 1XFLA 4HJ2A 3I69A 4LMVA 6GSYA 1A8YA 1GSYA 3C1RA 1ZCPA 4EVMA 1SL1B 1SL0B 2JU5A 2UZ8A 1M9AA 1X5EA 4IQAA 2QA2A 4ILFA 4A5PA 1GUHA 4ZBDA 3GIXA 1K0OA 5DJLA 4WR4A 4MDCA 4CHSA 1V9WA 3HYPA 1DSBA 3GHAA 3GURA 3TCOA 1JZRA 3CTGA 1PA3A 1XCCA 3I43A 3DVXA 4EF0A 2C8UA 3VPTA 1QGVA 4QQ7A 5ECOB 1BG5A 1Z3EA 1R5PA 3RPPA 1T4YA 1EZKA 3O3TA 1OAZA 5D96A 2F8AA 1EWXA 5AISA 8GSSA 3CBUA 3ISOA 4GLTA 1EP7A 3UEMA 4KF9A 4EXJA 3BJ5A 3J7Yk 2HFDA 4X4JA 1XW6A 4E8HA 1UVZA 3GX8A 5CO3A 1ERVA 4O7HA 4POKA 1XWAA 2X99A 4ML6A 1HNBA 3SBCA 2DSAA 2HRFA 1X5CA 2VOCA 4WF5A 3A5IA 4GXZA 3HVVA 2J23A 2FUG2 2IMDA 3KH9A 3TKSE 1PN0A 1PQNA 3M3MA 2HZFA 3NOFA 2WJUA 2DKIA 5J41A 2YCDA 4MPGA 2JZTA 3HJMA 1YF1A 3LGCA 2L59A 2KHPA 3C8EA 2DJ3A 4MZBA 4DSRA 2EIOA 1V98A 4MJCA 3DWVA 1EEMA 3H79A 3DIEA 2H19A 3KH7A 4XCSA 3FW2A 1SKWB 3EU3A 1MD3A 1Y25A 5IMVA 1GSSA 2B7KA 2MMZA 1WP0A 3GV1A 4HQZA 3VPQA 4N0ZA 2AV4A 3ERGA 3FZ5A 3VI5A 2GQKA 13GSA 2CA8A 5C00A 5B7CA 1FVKA 1OC9B 1DE1A 2L57A 4FO5A 2VCWA 4MH3A 1SK1A 2H71A 1CQHA 4Z2RA 4QL7A 4L0WA 1SJIA 5J9BA 4GRFA 2X4AA 3K8NA 4ZL7A 3PPUA 4TXOA 4ZB8A 3D21A 3IBHA 1H4OA 5IMZA 1GSQA 2C80A 4V2NA 1YQ1A 4K6XA 2HI7A 3VWXA 3U5RE 1B8XA 5DALA 5ECIB 2C0FA 1ACVA 1ZMAA 1QUWA 3O76A 2JZSA 2TIRA 2DKHA 5INYA 3IPZA 1TU7A 3G7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q19 A;  2H0G A;  2REM A;  2EC4 A;  2KP2 A;  4ZL9 A;  2EIQ A;  2YNX A;  4L0U A;  4EDY A;  5G30 A;  4OFM A;  5ECM B;  1EOG A;  1XZO A;  4N11 A;  2K8S A;  3KEB A;  2NBS A;  5G1K A;  5HFG A;  2TRC P;  5D9T A;  4KX4 A;  4K7N A;  3HCZ A;  3PR8 A;  2LS5 A;  2OE1 A;  1MDI A;  4EDZ A;  1GL8 A;  5IMF A;  1T1V A;  1BYE A;  2QKE A;  5ECH B;  2V1M A;  3KP8 A;  4Z7X A;  1AQW A;  5G5E A;  1R26 A;  4RI6 A;  3A2V A;  3A2X A;  2YWN A;  5DVB A;  4NAX A;  1TRS A;  4MLY A;  1Z5Y E;  1RK4 A;  2AHE A;  4KW6 A;  3IE3 A;  2I1U A;  5KN0 A;  1T3B A;  4ZXG A;  3C1S A;  2V6O A;  1TRW A;  3GA4 A;  2FWH A;  4YQM A;  1WWJ A;  2DJ2 A;  1YDK A;  1EV9 A;  3F6D A;  2GLR A;  4H86 A;  5IQY A;  1K0A A;  2H30 A;  1J9B A;  1EV4 A;  2WRT A;  3TUE A;  4ACS A;  2ZNM A;  5ENU A;  4NHW A;  1J0F A;  3QOU A;  3APS A;  1ERW A;  2B5Y A;  2GDR A;  3OR5 A;  2YOI A;  1PRX A;  5CRH A;  2YN1 A;  1GUL A;  1FVJ A;  2C0E A;  1G6W A;  4GQF A;  2O7K A;  4X43 A;  4KH7 A;  3BD2 A;  1XXU A;  3L4N A;  2IFQ A;  1JZO A;  3M9J A;  1GRX A;  2GSQ A;  2VLV A;  5EVO A;  2YV7 A;  3AY8 A;  5CYY A;  2YPM A;  2OAC A;  5EPF A;  3MAK A;  1Q4J A;  4XS4 B;  2E2G A;  2VCT A;  3GTU B;  1GLP A;  3QFB C;  5H5S A;  2VO4 A;  4TR1 A;  2V2G A;  4KUN A;  5AIX A;  2YP6 A;  1GH2 A;  1PD2 1;  3FZA A;  1FB6 A;  4BL7 A;  1A24 A;  3VI7 A;  5EY6 A;  1FB0 A;  5B8A A;  2M80 A;  4OFN A;  2JSZ A;  2P5R A;  3QPM A;  4K7O A;  3D5J A;  4F82 A;  3QCP A;  2N5A A;  1OKT A;  5IMC A;  2F9S A;  2QGV A;  2H1G A;  5G31 A;  3HXS A;  4MMM A;  3LFL A;  3WYW A;  3FK8 A;  2B1K A;  3HY2 A;  2CVD A;  3UAP A;  3C73 A;  4WF4 A;  1QFN A;  3EVI A;  2KOK A;  2V6K A;  1KEB A;  1USB A;  3LG6 A;  4TW5 A;  5DQS A;  2PBJ A;  1TTZ A;  1SK0 A;  6GSX A;  1NHO A;  2G2Q A;  2MBT A;  1M0U A;  3TRP A;  4LL4 B;  3W6G A;  1IYH A;  5IMD A;  2O89 A;  2CX3 A;  2IPA A;  3ZFL A;  4TRX A;  4TR0 A;  4TR1 B;  2VL3 A;  4IKH A;  1WIK A;  1KTE A;  2DJJ A;  2N5B A;  1OE8 A;  3CRU A;  4HEA 2;  1Y6E A;  5D73 A;  2OBK A;  1SYR A;  4ZBA A;  2WZ9 A;  1KBN A;  1K3O A;  1YEP A;  5CAX A;  1BAY A;  2HE3 A;  3CXG A;  1O8X A;  2FWG A;  3PIN A;  3GFK A;  1F37 A;  4OD7 A;  1TI3 A;  5CP1 A;  1CQG A;  4Q5N A;  1XOA A;  3FYG A;  3UMA A;  3IOS A;  4Q5R A;  5DDL A;  5F8B A;  1A0F A;  1ILO A;  2L6D A;  2H1A A;  1ZGN A;  1TXX A;  4N30 A;  2RLI A;  5ECR B;  4NV5 A;  2K6V A;  4KSO A;  1FO5 A;  4OMV A;  3ZZX A;  2F3M A;  1M7T A;  1BED A;  3QAW A;  5A5K A;  4MJA A;  4HS1 A;  5E59 A;  2XHF A;  2FA8 A;  3IAM 2;  1SJ6 A;  3FEU A;  4YH2 A;  2JAC A;  5H5Q A;  1EP8 A;  4RI7 A;  3VWV A;  4WET A;  5IO0 A;  18GS A;  2LJR A;  2OE0 A;  1PL2 A;  3CTF A;  2M72 A;  2JAD A;  4D73 B;  1UC7 A;  1LBK A;  3TGZ A;  2RII A;  2AB6 A;  4POB A;  3KTL A;  2GT6 A;  3L9V A;  1PGT A;  1BJX A;  2R5G A;  3KM6 A;  3A3T A;  2HZE B;  2V32 A;  3F4T A;  1X5D A;  4MAB A;  3DEX A;  5DQY A;  3KGK A;  4QL9 A;  1YF0 A;  3UIW A;  1G7E A;  2HRN A;  2B1L A;  5G1L A;  2H6Y A;  3KMN A;  5IOX A;  1K0N A;  5FWG A;  3N9J A;  3ME7 A;  5DCH A;  2CQ9 A;  2VCX A;  1ZZY A;  2CZ3 A;  3CYN A;  2XC2 A;  3VWU A;  5L71 A;  4PNF A;  3GH6 A;  2C0G A;  4I2T A;  4KB3 A;  2VD1 A;  5HFI A;  2QC7 A;  3EMX A;  1A2M A;  1XPV A;  1H75 A;  4IQ1 A;  5B6M A;  1AUC A;  2HSH A;  3H4K A;  3J7Y b;  1XWC A;  3F63 A;  1EGO A;  3MSZ A;  1A2L A;  5LNK e;  2C3Q A;  3E9J B;  1SKS B;  3P90 A;  3NIV A;  2R2J A;  3WGD A;  3IK7 A;  5LCZ A;  3ZMK A;  2PN8 A;  4J56 E;  4JRR A;  4PGT A;  3L9U A;  1G0T A;  2B6M A;  3KTB A;  22GS A;  4DVC A;  1B4P A;  4PNG A;  1GSU A;  3Q6O A;  2DLX A;  1YY7 A;  2R4V A;  4KCA A;  5IIZ A;  1OE7 A;  5JWQ B;  5J3R A;  4IP6 A;  3NZN A;  4V2L A;  5ELA A;  1R5A A;  1QQ2 A;  2IMI A;  3MDK A;  2L4C A;  1MDJ A;  3HDC A;  1W89 A;  2CVB A;  5F05 A;  3IDV A;  4EKZ A;  4O92 A;  4HQS A;  3UL3 A;  1OC9 A;  4IEL A;  2YZU A;  3E3E A;  5KN1 A;  3WT2 A;  5A4W A;  2G0F A;  3V1W A;  1YKC A;  3D4M A;  1U3A A;  5CNW A;  2GTU A;  4MJE A;  2MZC A;  3HHV A;  4HZ4 A;  1U3I A;  3RPN A;  3CRT A;  2VM2 A;  5A4V A;  2L5L A;  2M46 A;  1C72 A;  5ECP B;  3DXB A;  1B48 A;  3US3 A;  2CAI A;  1HNC A;  3H8Q A;  1GUM A;  1GTB A;  2YV9 A;  4GSN A;  1IYI A;  14GS A;  3TJF A;  4DSS B;  1VGL A;  1WRY A;  3D6I A;  2VD0 A;  1WJK A;  4K8M A;  1NM3 A;  2LJA A;  2B5E A;  4V1A p;  1YZX A;  3UBL A;  2X8C A;  4TVE A;  2YJH A;  1AQX A;  4MCU A;  1F3A A;  4ZB6 A;  5HR1 A;  1OVN A;  2PPT A;  2NPB A;  3H93 A;  1ABA A;  2LNT A;  4G9H A;  2PGT A;  4MF6 A;  5G5F A;  1PN9 A;  4K1F A;  1GTI A;  1K0B A;  3IR4 A;  4MF5 A;  1WOU A;  3FKF A;  4XIH A;  5COH A;  5D8I A;  3JCM L;  4DSQ A;  2HLS A;  4BPY A;  2I3Y A;  1GTA A;  2K8V A;  1GP1 A;  2NTO A;  5C04 A;  2QSI A;  3ERW A;  1O73 A;  4MF7 A;  3ME8 A;  2WB9 A;  3TOU A;  2VUP A;  1FHE A;  1MD4 A;  2DJ1 A;  4WKW A;  2YZH A;  2A2R A;  4MZW A;  2K9F A;  2XBI A;  11GS A;  4LLR A;  1JZW A;  2O85 A;  4PUA A;  1V2A A;  3G7J A;  3EYT A;  4X1U A;  3M0F A;  2MMN A;  4L5O A;  1LU4 A;  4IVF A;  5IOW A;  2O87 A;  4JZQ A;  1AIU A;  3HA9 A;  2FWF A;  4NV2 A;  3O6T A;  1YEX A;  3EC3 A;  1M2A A;  3TKQ A;  3G9B A;  2CZ2 A;  3QMX A;  1I9D A;  1DBY A;  16GS A;  1FG4 A;  5B8B A;  5AN1 A;  4EUY A;  2LQO A;  3VLN A;  2DIY A;  2Z9S A;  3ZRE A;  1AW9 A;  2H76 A;  5GAP D;  4JBB A;  3HVS A;  3A5W A;  4JR4 A;  2DMM A;  4XS4 A;  4BVY A;  2LUS A;  3TJB A;  3GTU A;  2PVO C;  3DGQ A;  2KP1 A;  1XIY A;  4WBJ A;  4YQU A;  3ZVJ D;  1SK2 A;  1JZD A;  3HZ4 A;  3Q74 A;  2RM6 A;  1FOV A;  1GSE A;  3APO A;  1A0R P;  4ZB9 A;  2GSS A;  3MNG A;  3TDG A;  3UJ1 A;  1TK5 B;  2H72 A;  3CSJ A;  3H1N A;  3IV4 A;  4ZL8 A;  3GN3 A;  1WMJ A;  2WFC A;  1SU9 A;  4POM A;  1ON4 A;  3GST A;  2VL2 A;  4KCE A;  2H6Z A;  1NHY A;  2C0D A;  3UVH A;  2IMF A;  4POL A;  4IGJ A;  2MMA A;  3I9V 2;  4YAV A;  1QMV A;  3ZIJ A;  4ZIJ A;  1T7P B;  6GSU A;  3QDN A;  3ZYW A;  3D0Z A;  1XVQ A;  2YAN A;  4MP4 A;  1SKR B;  3QFA C;  4G19 A;  5CRD A;  3LQ7 A;  2CT6 A;  1YKA A;  5ECS A;  1ZL9 A;  2P31 A;  2H8L A;  5DCG A;  3QD9 A;  3ED3 A;  1S3C A;  1VF2 A;  4K7I A;  1ERU A;  2H75 A;  3W8J A;  4HUA A;  1VRS D;  1TW9 A;  3GKN A;  3IK9 A;  4ECC A;  2RUF A;  4IHU A;  3VFI A;  4ECI A;  1HD2 A;  3F9U A;  5JCW A;  1O8W A;  5ABR A;  2HT9 A;  5F0G A;  4IW9 A;  4PQ1 A;  1X0R A;  2A4V A;  3D22 A;  2DBC A;  3IRA A;  1B9X C;  1LJR A;  3DKS A;  3QAV A;  1V40 A;  4BVX A;  2GS3 A;  4K2D A;  1UN2 A;  1O81 A;  2PWJ A;  2FD3 A;  5D9X A;  2VCQ A;  2VLU A;  1PL1 A;  2FY6 A;  1FAA A;  4JR6 A;  2LRN A;  2HYX A;  3RDW A;  3FZ4 A;  4I5Q A;  2MMO A;  4HDE A;  4TR3 A;  2VL2 C;  3TJJ A;  4D73 A;  3BCK A;  3C7M A;  2A2S A;  2XBQ A;  3KJY A;  1XOB A;  4N0V A;  1NSW A;  5CRG A;  1SEN A;  3HD5 A;  3CSI A;  2HZE A;  2X64 A;  4GSS A;  4AGS A;  2GST A;  4RQR A;  2L6C A;  3R2Q A;  2EIR A;  4XS1 A;  3CMI A;  3PGT A;  2YWO A;  4IS0 A;  2E2M A;  3KD0 A;  4KND A;  5KN3 A;  3DRN A;  3TOT A;  3IC4 A;  1M99 A;  2FLS A;  3KCM A;  3QAG A;  3EMP A;  4XRD A;  3Q18 A;  3LXZ A;  3RAZ A;  4L8E A;  3GUS A;  2MYG A;  2DML A;  4I2U A;  4HU9 A;  1XW9 A;  5E4W A;  1E6B A;  4BWQ A;  4I8B A;  3SWL A;  3I6A A;  5F06 A;  2BTO T;  2PER A;  2VIM A;  1OC8 A;  4JU5 A;  4CDO A;  1ZYQ B;  2O8V B;  1UA5 A;  4HI7 A;  2B5X A;  1GNE A;  4I6X A;  5GAN D;  4JED A;  1GSF A;  1MDK A;  4GF0 A;  4HU7 A;  5FT3 A;  4FYC A;  3F6F A;  2L5O A;  3ZFB A;  4GWR A;  5IPH A;  3IAS 2;  1PKW A;  1ZOF A;  3WD6 A;  2ON7 A;  4N10 A;  2IJY A;  5DJM A;  2C4J A;  1Z7P A;  5ECN B;  1PSQ A;  1T4Z A;  4WEY A;  3LJR A;  4CW9 A;  9GSS A;  1I5G A;  2TRX A;  3ERF A;  5HFK A;  4KAE A;  3L78 A;  1F6M C;  2F51 A;  3P7X A;  1YJ6 A;  3G7Y A;  2OE3 A;  4TN8 A;  3P2A A;  5DAK B;  4FYB A;  1R4W A;  3GYK A;  4WXT A;  3TKS A;  2VCZ A;  2ON5 A;  3VK9 A;  4IP1 A;  2BMX A;  3FHK A;  5J4U A;  3GRX A;  1O6J A;  2YWM A;  4HOJ A;  4EE0 A;  3GMF A;  1QXH A;  1KNG A;  4K0N A;  2OKA A;  4ISD A;  1JLV A;  5H5R A;  4WBR D;  5HR2 A;  1BX9 A;  5IO2 A;  1MTC A;  3HZ8 A;  1OC3 A;  2AAW A;  2VAF A;  4K0G A;  5B6N A;  5ID2 B;  3F0I A;  3GKK A;  2YWI A;  4F0B A;  5D9W A;  3IA1 A;  1EEJ A;  5JWR B;  1AAZ A;  4ULX A;  1TK0 B;  3F3Q A;  4NMU A;  1VF3 A;  4KDY A;  2IL3 A;  3A2W A;  3M9K A;  1TP9 A;  4FYU A;  4TXV A;  3GKM A;  4XRA A;  2H6X A;  2JZR A;  4IBP A;  1XVW A;  3GX0 A;  4ZIL A;  2VLT A;  10GS A;  4FH8 A;  2AUV A;  4P3Y B;  5G2Z A;  1U88 A;  3D4T A;  2WDU A;  4DSS A;  4MZC A;  1HQO A;  4NWY A;  1Z7R A;  4F0C A;  4MH2 A;  3UAR A;  2FGX A;  1W4V A;  3N5O A;  2HSY A;  4KSM A;  5CRE A;  4OWY A;  2LRT A;  20GS A;  2P5Q A;  3EU4 A;  3FR3 A;  1OKD A;  4YAP A;  1U6T A;  1TU8 A;  2CAQ A;  4GTU A;  2J9H A;  4GCI A;  2KUC A;  2VCV A;  4KDU A;  6GSS A;  1R7H A;  1S3A A;  3TKS C;  4BWS A;  3LYK A;  5HR0 A;  4V1A g;  6GST A;  3RHC A;  4L5L A;  3GSS A;  2PMT A;  3KP9 A;  1THX A;  4J57 E;  4K9Z A;  2GQM A;  4YQV A;  2HXK A;  2LJK A;  3ZL5 A;  2X8H A;  2LEG A;  1GWC A;  4G2E A;  1VF1 A;  1A2J A;  1ERT A;  3IXR A;  4F2I A;  2H1D A;  1RW1 A;  1SD8 A;  4MA9 A;  4DEJ A;  1XW5 A;  3KXO A;  3FR6 A;  3GL5 A;  1N8J A;  2GZZ A;  2P0G A;  3TRQ A;  4MPF A;  5AGY A;  2OA7 A;  3KZQ A;  7GSS A;  1AQV A;  1K3L A;  5CRW A;  5J9C A;  2H66 A;  1M9B A;  1E2Y A;  3DYR A;  4HJM A;  4ZBB A;  1U87 A;  2C1Y A;  4MJB A;  1TI1 A;  5JCU A;  2DC5 A;  1HYU A;  5D93 A;  3ZVJ A;  1SYX A;  2WS2 A;  2GZY A;  4IJI A;  1GLQ A;  1X9M B;  2NVL A;  1TRV A;  5ECL B;  4EO3 A;  1K0C A;  1MEK A;  5ELG A;  2LV3 A;  1Q98 A;  3QR6 A;  3DVW A;  5F07 A;  3UVT A;  1SL2 B;  3LSZ A;  4AJ8 A;  1T00 A;  1JFU A;  2DIZ A;  4AJ7 A;  2LRC A;  1X9S B;  3P8W A;  4KE3 A;  3F4S A;  3BOA A;  1K3Y A;  5GST A;  2YJ7 A;  4ML1 A;  2LST A;  2JSY A;  2GZP A;  3F4R A;  4PXO A;  3TB2 A;  2RUE A;  2PUK C;  1THO A;  1O85 A;  1JHB A;  3F8U A;  1Z9H A;  1TOF A;  2ES7 A;  2R3X A;  5ECK B;  3LXT A;  4GQC A;  4JE1 A;  4LL1 B;  3TKP A;  6GSW A;  3ZRD A;  1WPI A;  3GL3 A;  4FIW A;  4PQH A;  2FHE A;  2I81 A;  1EGR A;  3ZIV A;  3LOR A;  1DUG A;  2E0Q A;  2N5F A;  4AJ6 A;  3GH9 A;  2PVQ A;  3LEF A;  4TXO B;  3FZ9 A;  2CV4 A;  2H0I A;  1K0D A;  1V58 A;  5FHI A;  2IWT A;  5LD0 A;  1GUK A;  5D9V A;  3KMO A;  3U6V A;  19GS A;  5DAL B;  2ALB A;  3HJP A;  1M2B A;  4PUR A;  2GVP A;  2IN3 A;  2DJK A;  1G6Y A;  4XHM A;  3VUR A;  5KN2 A;  1PX7 A;  4ECJ A;  1XBS A;  4O32 A;  4PX1 A;  4X0X A;  1XWB A;  3TKR A;  5IM9 A;  5ECQ B;  3ZML A;  2KLX A;  4KDX A;  2DJ0 A;  1GNW A;  2H1B A;  3APQ A;  3GKX A;  3HKR A;  4OCE A;  4XS6 A;  1X9W B;  1PX6 A;  2MBS A;  3EUR A;  2AJQ B;  2F8F A;  1B9Y C;  4O5R A;  2WUL A;  1S3D A;  1GSD A;  2XPD A;  3RBT A;  2CVK A;  3FY7 A;  3MWH A;  3ZLP A;  4KA0 A;  2FCH A;  3E0U A;  2I9H A;  2LNS A;  2HNL A;  2R37 A;  1BQ7 A;  4GST A;  2IMK A;  2GT5 A;  2I4A A;  6GSV A;  5IPG A;  2B7J A;  1OYJ A;  3CSH A;  2H73 A;  4WR5 A;  2AYT A;  1TKD B;  1A23 A;  4E8E A;  3TJG A;  4PQI A;  3WGE A;  2WGR A;  3LYP A;  4KGI A;  1B4Q A;  2FNO A;  2H70 A;  4HZ2 A;  5KEJ A;  5JWO B;  3M1G A;  4OCF A;  1PKZ A;  2IME A;  2IIY A;  4ECB A;  3S9F A;  3EWL A;  3DD3 A;  5JCG A;  3ZTL A;  2XPE A;  4IJ3 A;  1O7U A;  4TKY A;  5DBQ A;  3W8S A;  2CX4 A;  3WGX A;  1V57 A;  1Z6N A;  2GGT A;  4ID0 A;  1G7O A;  2B3S A;  4AF2 A;  4PUF C;  1AC1 A;  3LWA A;  2WCI A;  1SJZ A;  2IFQ B;  1DE2 A;  4NXI A;  3DML A;  1ML6 A;  5IMA A;  3TRX A;  2RM5 A;  4LA1 A;  1URM A;  4OFT A;  1TRU A;  4F03 A;  1HNA A;  4BA7 A;  1J08 A;  2JL4 A;  1RQM A;  1TJD A;  4EL1 A;  3IHQ A;  2LKU A;  4NPB A;  4Q5F A;  1F3B A;  5GZZ B;  2E7P A;  1PMT A;  1M2D A;  1N2A A;  3HJO A;  2FA4 A;  1GTU A;  1SD9 A;  1FW1 A;  2VL9 A;  2ZCT A;  2OJL A;  4RQX A;  3HVX A;  1TDI A;  1K0M A;  4LMW A;  3WT1 A;  2BJX A;  3L9S A;  2LQQ A;  3GNJ A;  2GQL A;  2GSR A;  1ZYE A;  3BCI A;  2ZUP A;  3KIJ A;  5DAK A;  4TR4 A;  1TK8 B;  3FRC A;  4NHZ A;  2OBI A;  4MK3 A;  2LTK A;  1Z6M A;  3M8N A;  1AXD A;  2X8G A;  4OO5 A;  2OAD A;  3PH9 A;  5A4U A;  4OO4 A;  2L4Q A;  3FR9 A;  2C3T A;  1ST9 A;  4V2M A;  2NDO A;  5ID2 A;  5AIV A;  5J5N A;  2VM1 A;  1T8E B;  3UOM A;  1XWK A;  5HQP A;  1A8L A;  4RUV A;  2C3N A;  4J2F A;  3RHB A;  1QK8 A;  1F2E A;  2D2Z A;  1F9M A;  2V41 A;  4EC0 A;  2PU9 C;  3EE2 A;  2FWE A;  2R6K A;  3VWW A;  4I97 A;  1JLW A;  17GS A;  3EIN A;  5HR3 A;  1NW2 A;  3C71 A;  12GS A;  2H01 A;  4Q5Q A;  3TJK A;  3ZIT A;  2H74 A;  1WE0 A;  2H0H A;  3UBK A;  1VF4 A;  1EOH A;  4XTS A;  2K18 A;  3F3R A;  4G10 A;  3BBY A;  5GSS A;  3L0H A;  4IN0 A;  1XWG A;  4TOP A;  5EL8 A;  4F9Z A;  1XFL A;  4HJ2 A;  3I69 A;  4LMV A;  6GSY A;  1A8Y A;  1GSY A;  3C1R A;  1ZCP A;  4EVM A;  1SL1 B;  1SL0 B;  2JU5 A;  1M9A A;  1X5E A;  4IQA A;  4ILF A;  1GUH A;  4ZBD A;  3GIX A;  1K0O A;  5DJL A;  4WR4 A;  4MDC A;  4CHS A;  1V9W A;  3HYP A;  1DSB A;  3GHA A;  3GUR A;  3TCO A;  1JZR A;  3CTG A;  1PA3 A;  1XCC A;  3I43 A;  3DVX A;  4EF0 A;  2C8U A;  3VPT A;  1QGV A;  4QQ7 A;  5ECO B;  1BG5 A;  1Z3E A;  1R5P A;  3RPP A;  1T4Y A;  1EZK A;  3O3T A;  1OAZ A;  5D96 A;  2F8A A;  1EWX A;  5AIS A;  8GSS A;  3CBU A;  3ISO A;  4GLT A;  1EP7 A;  3UEM A;  4EXJ A;  3BJ5 A;  3J7Y k;  2HFD A;  1XW6 A;  4E8H A;  1UVZ A;  3GX8 A;  5CO3 A;  1ERV A;  4O7H A;  4POK A;  1XWA A;  2X99 A;  4ML6 A;  1HNB A;  3SBC A;  2DSA A;  2HRF A;  1X5C A;  2VOC A;  4WF5 A;  4GXZ A;  3HVV A;  2J23 A;  2FUG 2;  2IMD A;  3KH9 A;  3TKS E;  1PQN A;  3M3M A;  2HZF A;  3NOF A;  2WJU A;  5J41 A;  2YCD A;  4MPG A;  2JZT A;  3HJM A;  1YF1 A;  3LGC A;  2L59 A;  2KHP A;  3C8E A;  2DJ3 A;  4MZB A;  4DSR A;  2EIO A;  1V98 A;  4MJC A;  3DWV A;  1EEM A;  3H79 A;  3DIE A;  2H19 A;  3KH7 A;  4XCS A;  3FW2 A;  1SKW B;  3EU3 A;  1MD3 A;  1Y25 A;  5IMV A;  1GSS A;  2B7K A;  2MMZ A;  1WP0 A;  3GV1 A;  4HQZ A;  3VPQ A;  4N0Z A;  2AV4 A;  3ERG A;  3FZ5 A;  3VI5 A;  2GQK A;  13GS A;  2CA8 A;  5C00 A;  5B7C A;  1FVK A;  1OC9 B;  1DE1 A;  2L57 A;  4FO5 A;  2VCW A;  4MH3 A;  1SK1 A;  2H71 A;  1CQH A;  4QL7 A;  4L0W A;  1SJI A;  5J9B A;  4GRF A;  3K8N A;  4ZL7 A;  4TXO A;  4ZB8 A;  3D21 A;  3IBH A;  1H4O A;  5IMZ A;  1GSQ A;  2C80 A;  4V2N A;  1YQ1 A;  4K6X A;  2HI7 A;  3VWX A;  3U5R E;  1B8X A;  5DAL A;  5ECI B;  2C0F A;  1ACV A;  1ZMA A;  1QUW A;  3O76 A;  2JZS A;  2TIR A;  5INY A;  3IPZ A;  1TU7 A;  3G7I A; 
#chains in the Genus database with same CATH topology
 3Q19 A;  2H0G A;  2REM A;  2HRK A;  2A4H A;  2EC4 A;  2KP2 A;  4ZL9 A;  2EIQ A;  2YNX A;  4L0U A;  4EDY A;  4YKG A;  5G30 A;  4OFM A;  5ECM B;  1EOG A;  1XZO A;  4N11 A;  2K8S A;  3KEB A;  2NBS A;  5G1K A;  5HFG A;  2TRC P;  5D9T A;  4KX4 A;  4K7N A;  3HCZ A;  3PR8 A;  2LS5 A;  2OE1 A;  1MDI A;  4EDZ A;  1GL8 A;  5IMF A;  1T1V A;  1BYE A;  2QKE A;  5ECH B;  2V1M A;  3KP8 A;  4Z7X A;  1AQW A;  5G5E A;  1R26 A;  4RI6 A;  3A2V A;  3A2X A;  2YWN A;  5DVB A;  4NAX A;  1TRS A;  4MLY A;  1Z5Y E;  1RK4 A;  2AHE A;  4KW6 A;  3IE3 A;  2I1U A;  5KN0 A;  1T3B A;  4ZXG A;  3C1S A;  2V6O A;  1TRW A;  3GA4 A;  2FWH A;  4YQM A;  1WWJ A;  2DJ2 A;  1YDK A;  1EV9 A;  3F6D A;  2GLR A;  4H86 A;  5IQY A;  1K0A A;  2H30 A;  1J9B A;  1EV4 A;  2WRT A;  3TUE A;  2R0G A;  4ACS A;  2ZNM A;  5ENU A;  4NHW A;  1J0F A;  3QOU A;  3APS A;  1ERW A;  2B5Y A;  2GDR A;  3OR5 A;  2YOI A;  1PRX A;  5CRH A;  2YN1 A;  1GUL A;  1FVJ A;  2C0E A;  1G6W A;  4GQF A;  2O7K A;  4X43 A;  5KOW A;  4KH7 A;  3BD2 A;  1XXU A;  3L4N A;  2IFQ A;  1JZO A;  3M9J A;  1GRX A;  2GSQ A;  2VLV A;  5EVO A;  4K2X A;  2YV7 A;  3AY8 A;  5CYY A;  2YPM A;  2OAC A;  5EPF A;  3MAK A;  1Q4J A;  4XS4 B;  2E2G A;  4BVY B;  2VCT A;  3GTU B;  1GLP A;  3QFB C;  5H5S A;  2VO4 A;  4TR1 A;  2V2G A;  4KUN A;  5AIX A;  2YP6 A;  1GH2 A;  1PD2 1;  3FZA A;  1FB6 A;  1M3I A;  4BL7 A;  1A24 A;  3VI7 A;  5EY6 A;  1FB0 A;  5B8A A;  2M80 A;  4OFN A;  2JSZ A;  4CY8 A;  2P5R A;  3QPM A;  4K7O A;  3D5J A;  4F82 A;  3QCP A;  2N5A A;  1OKT A;  5IMC A;  2F9S A;  2QGV A;  2H1G A;  5G31 A;  3HXS A;  4MMM A;  3LFL A;  3WYW A;  3FK8 A;  2B1K A;  3HY2 A;  2CVD A;  3UAP A;  3C73 A;  4WF4 A;  1QFN A;  3EVI A;  2KOK A;  2V6K A;  1KEB A;  1USB A;  3LG6 A;  4TW5 A;  5DQS A;  2PBJ A;  1TTZ A;  1SK0 A;  6GSX A;  1NHO A;  2G2Q A;  2MBT A;  1M0U A;  3TRP A;  4LL4 B;  3W6G A;  1IYH A;  5IMD A;  2O89 A;  2CX3 A;  2IPA A;  3ZFL A;  4TRX A;  4TR0 A;  4TR1 B;  2VL3 A;  4IKH A;  1WIK A;  1KTE A;  2DJJ A;  2N5B A;  1OE8 A;  3CRU A;  4HEA 2;  1Y6E A;  5D73 A;  2OBK A;  1SYR A;  4ZBA A;  2WZ9 A;  1KBN A;  1K3O A;  1YEP A;  5CAX A;  1BAY A;  2HE3 A;  3CXG A;  3CQF A;  1O8X A;  2FWG A;  3PIN A;  3GFK A;  1F37 A;  4OD7 A;  1TI3 A;  5CP1 A;  1CQG A;  4Q5N A;  1XOA A;  3FYG A;  3UMA A;  3IOS A;  4Q5R A;  5DDL A;  5F8B A;  1A0F A;  1ILO A;  2L6D A;  2H1A A;  1ZGN A;  1TXX A;  4N30 A;  2RLI A;  5ECR B;  4NV5 A;  2K6V A;  4KSO A;  1FO5 A;  4OMV A;  3ZZX A;  2F3M A;  1M7T A;  1BED A;  3QAW A;  4BVX B;  5A5K A;  4MJA A;  4HS1 A;  5E59 A;  2XHF A;  2FA8 A;  3IAM 2;  1SJ6 A;  3FEU A;  4YH2 A;  2JAC A;  5H5Q A;  1EP8 A;  4RI7 A;  3VWV A;  4WET A;  5IO0 A;  18GS A;  2LJR A;  2OE0 A;  1PL2 A;  3CTF A;  2M72 A;  2JAD A;  4D73 B;  1UC7 A;  1LBK A;  3TGZ A;  2RII A;  2AB6 A;  4POB A;  3KTL A;  2GT6 A;  3L9V A;  1PGT A;  1BJX A;  2R5G A;  3KM6 A;  3A3T A;  2HZE B;  2V32 A;  3F4T A;  1X5D A;  4MAB A;  3DEX A;  5DQY A;  3KGK A;  4QL9 A;  1YF0 A;  3UIW A;  1G7E A;  2HRN A;  2B1L A;  5G1L A;  2H6Y A;  3KMN A;  5IOX A;  1K0N A;  5FWG A;  3N9J A;  3ME7 A;  5DCH A;  2CQ9 A;  2VCX A;  1ZZY A;  2CZ3 A;  3CYN A;  2XC2 A;  3VWU A;  5L71 A;  4PNF A;  3GH6 A;  2C0G A;  4I2T A;  4KB3 A;  2VD1 A;  5HFI A;  2QC7 A;  3EMX A;  1A2M A;  1XPV A;  1H75 A;  4IQ1 A;  5B6M A;  1AUC A;  2HSH A;  3H4K A;  3J7Y b;  1XWC A;  3F63 A;  1EGO A;  3MSZ A;  1A2L A;  5LNK e;  2C3Q A;  3E9J B;  1SKS B;  3P90 A;  3NIV A;  2R2J A;  3WGD A;  3IK7 A;  2R0C A;  4Z2T A;  2X49 A;  5LCZ A;  3ZMK A;  2PN8 A;  3FMW A;  4J56 E;  4JRR A;  4PGT A;  3L9U A;  1G0T A;  2B6M A;  3IC8 A;  22GS A;  3KTB A;  4DVC A;  1B4P A;  4PNG A;  1GSU A;  3Q6O A;  2DLX A;  1YY7 A;  2R4V A;  4K5R A;  4KCA A;  5IIZ A;  1OE7 A;  4Z2U A;  5JWQ B;  5J3R A;  4IP6 A;  3NZN A;  4V2L A;  5ELA A;  1R5A A;  1QQ2 A;  2IMI A;  3MDK A;  2L4C A;  1MDJ A;  3HDC A;  1W89 A;  3MIX A;  2CVB A;  5F05 A;  3IDV A;  4EKZ A;  4O92 A;  4HQS A;  3UL3 A;  1OC9 A;  4IEL A;  2YZU A;  3E3E A;  5KN1 A;  3WT2 A;  5A4W A;  2G0F A;  3V1W A;  1YKC A;  3D4M A;  1U3A A;  5CNW A;  2GTU A;  4MJE A;  2MZC A;  3HHV A;  4HZ4 A;  5BMU A;  1U3I A;  3RPN A;  3CRT A;  2VM2 A;  5A4V A;  2L5L A;  2M46 A;  1C72 A;  5ECP B;  3DXB A;  1B48 A;  3US3 A;  2CAI A;  1HNC A;  3H8Q A;  1GUM A;  1GTB A;  2YV9 A;  4GSN A;  1IYI A;  14GS A;  3TJF A;  4DSS B;  1VGL A;  1WRY A;  3D6I A;  2VD0 A;  1WJK A;  4K8M A;  1NM3 A;  2LJA A;  2B5E A;  4V1A p;  1YZX A;  3UBL A;  2HSM A;  2X8C A;  4TVE A;  2YJH A;  1AQX A;  2R0P A;  4MCU A;  1F3A A;  4ZB6 A;  5HR1 A;  1OVN A;  2PPT A;  2NPB A;  3H93 A;  1ABA A;  2LNT A;  4G9H A;  2PGT A;  4MF6 A;  1FOH A;  5G5F A;  1PN9 A;  4K1F A;  1GTI A;  1K0B A;  3IR4 A;  4MF5 A;  1WOU A;  3FKF A;  4XIH A;  5COH A;  5D8I A;  3JCM L;  4DSQ A;  2HLS A;  4BPY A;  2I3Y A;  1GTA A;  2K8V A;  1GP1 A;  2NTO A;  5C04 A;  2QSI A;  3ERW A;  1O73 A;  4MF7 A;  3ME8 A;  2WB9 A;  1PFO A;  3TOU A;  2VUP A;  1FHE A;  1MD4 A;  2DJ1 A;  4WKW A;  2YZH A;  2A2R A;  4MZW A;  2K9F A;  2XBI A;  11GS A;  1ZYN A;  4LLR A;  1JZW A;  2O85 A;  4PUA A;  1V2A A;  3G7J A;  3EYT A;  4G0L A;  4X1U A;  3M0F A;  2MMN A;  4L5O A;  1LU4 A;  4IVF A;  5IOW A;  2O87 A;  4JZQ A;  1AIU A;  3HA9 A;  2FWF A;  4NV2 A;  3O6T A;  1YEX A;  3EC3 A;  1M2A A;  3TKQ A;  3G9B A;  2CZ2 A;  4ICY A;  3QMX A;  1I9D A;  1DBY A;  16GS A;  1FG4 A;  5B8B A;  5AN1 A;  4EUY A;  2LQO A;  3VLN A;  2DIY A;  2Z9S A;  3ZRE A;  1AW9 A;  2H76 A;  5GAP D;  4JBB A;  3HVS A;  3A5W A;  4JR4 A;  2DMM A;  4XS4 A;  4BVY A;  2LUS A;  3TJB A;  3GTU A;  2PVO C;  3DGQ A;  2KP1 A;  1XIY A;  4WBJ A;  4YQU A;  3ZVJ D;  1SK2 A;  1JZD A;  3HZ4 A;  3Q74 A;  2RM6 A;  1FOV A;  1GSE A;  3APO A;  1A0R P;  4ZB9 A;  2GSS A;  3IHG A;  3MNG A;  3TDG A;  3UJ1 A;  1TK5 B;  2H72 A;  3CSJ A;  3H1N A;  3IV4 A;  4ZL8 A;  3GN3 A;  1WMJ A;  2WFC A;  1SU9 A;  4POM A;  1ON4 A;  3GST A;  2VL2 A;  4KCE A;  2H6Z A;  1NHY A;  2C0D A;  3UVH A;  2IMF A;  4POL A;  4IGJ A;  2MMA A;  3I9V 2;  4YAV A;  1QMV A;  3ZIJ A;  4ZIJ A;  1T7P B;  6GSU A;  3QDN A;  3ZYW A;  3D0Z A;  1XVQ A;  2YAN A;  4MP4 A;  1SKR B;  3QFA C;  4G19 A;  5CRD A;  3LQ7 A;  2CT6 A;  1YKA A;  5ECS A;  1ZL9 A;  1S3R A;  2P31 A;  2H8L A;  5DCG A;  3QD9 A;  3ED3 A;  1S3C A;  1VF2 A;  4K7I A;  1ERU A;  2H75 A;  3W8J A;  4HUA A;  1VRS D;  1TW9 A;  3GKN A;  3IK9 A;  4ECC A;  2RUF A;  4IHU A;  3VFI A;  4ECI A;  1HD2 A;  3F9U A;  5JCW A;  1O8W A;  5ABR A;  2HT9 A;  5F0G A;  4IW9 A;  4PQ1 A;  1X0R A;  2A4V A;  3D22 A;  2DBC A;  3IRA A;  1B9X C;  4EIP A;  1LJR A;  3DKS A;  3QAV A;  1V40 A;  4BVX A;  2GS3 A;  4K2D A;  1UN2 A;  4O5U A;  1O81 A;  2PWJ A;  2FD3 A;  5D9X A;  2VCQ A;  2VLU A;  1PL1 A;  2FY6 A;  1FAA A;  4JR6 A;  2LRN A;  2HYX A;  3RDW A;  3FZ4 A;  4I5Q A;  2MMO A;  4HDE A;  4TR3 A;  2VL2 C;  3TJJ A;  4D73 A;  3BCK A;  3C7M A;  2A2S A;  2XBQ A;  3KJY A;  1XOB A;  4N0V A;  1NSW A;  5CRG A;  1SEN A;  3HD5 A;  3CSI A;  2HZE A;  2X64 A;  4GSS A;  4AGS A;  2GST A;  4RQR A;  2L6C A;  3R2Q A;  2EIR A;  4XS1 A;  3CMI A;  3PGT A;  2YWO A;  4IS0 A;  2E2M A;  3KD0 A;  4KND A;  5KN3 A;  3DRN A;  3TOT A;  3IC4 A;  1M99 A;  2FLS A;  3KCM A;  3QAG A;  3EMP A;  4XRD A;  3Q18 A;  4BIK A;  3LXZ A;  3RAZ A;  4L8E A;  3GUS A;  2MYG A;  2DML A;  4I2U A;  4HU9 A;  1XW9 A;  5E4W A;  1E6B A;  4BWQ A;  4I8B A;  3SWL A;  3I6A A;  4CY6 A;  5F06 A;  2BTO T;  2PER A;  2VIM A;  1OC8 A;  4JU5 A;  4CDO A;  1ZYQ B;  2O8V B;  1UA5 A;  4HI7 A;  2B5X A;  1GNE A;  4I6X A;  5GAN D;  4JED A;  1GSF A;  1MDK A;  4GF0 A;  4HU7 A;  5FT3 A;  4FYC A;  3F6F A;  2L5O A;  3ZFB A;  4GWR A;  5IPH A;  3IAS 2;  1PKW A;  1ZOF A;  3WD6 A;  2ON7 A;  4N10 A;  2IJY A;  5DJM A;  2C4J A;  1Z7P A;  5ECN B;  1PSQ A;  1T4Z A;  4WEY A;  3LJR A;  4CW9 A;  9GSS A;  3MYD A;  1I5G A;  2TRX A;  3ERF A;  5HFK A;  4KAE A;  3L78 A;  1F6M C;  2F51 A;  3P7X A;  1YJ6 A;  3G7Y A;  2OE3 A;  4TN8 A;  3P2A A;  5DAK B;  4FYB A;  1R4W A;  3GYK A;  4WXT A;  3TKS A;  2VCZ A;  2ON5 A;  3VK9 A;  4IP1 A;  2BMX A;  2QA1 A;  3FHK A;  5J4U A;  3GRX A;  1O6J A;  2YWM A;  4HOJ A;  4EE0 A;  3GMF A;  1QXH A;  1KNG A;  4K0N A;  2OKA A;  2HRA A;  4ISD A;  1JLV A;  5H5R A;  4WBR D;  5HR2 A;  1BX9 A;  5IO2 A;  1MTC A;  3HZ8 A;  1OC3 A;  4G0K A;  2AAW A;  2VAF A;  4K0G A;  5B6N A;  5ID2 B;  3F0I A;  3GKK A;  2YWI A;  4F0B A;  5D9W A;  3IA1 A;  1EEJ A;  5JWR B;  1AAZ A;  4ULX A;  1TK0 B;  3F3Q A;  4NMU A;  1VF3 A;  4KDY A;  2IL3 A;  3A2W A;  3M9K A;  1TP9 A;  4FYU A;  4TXV A;  3GKM A;  4XRA A;  2H6X A;  2JZR A;  4IBP A;  1XVW A;  3GX0 A;  4ZIL A;  2VLT A;  10GS A;  4FH8 A;  2AUV A;  4P3Y B;  5G2Z A;  1U88 A;  3D4T A;  2WDU A;  4DSS A;  4MZC A;  1HQO A;  4NWY A;  1Z7R A;  4F0C A;  4MH2 A;  3UAR A;  4MNN A;  2FGX A;  1W4V A;  3N5O A;  2HSY A;  4KSM A;  5CRE A;  4OWY A;  2LRT A;  20GS A;  2P5Q A;  2A2P A;  3EU4 A;  3FR3 A;  1OKD A;  4YAP A;  1U6T A;  1TU8 A;  2CAQ A;  4GTU A;  2J9H A;  4GCI A;  2KUC A;  2VCV A;  4KDU A;  6GSS A;  1R7H A;  1S3A A;  3TKS C;  4BWS A;  3LYK A;  4PTS A;  5HR0 A;  4V1A g;  6GST A;  3RHC A;  4L5L A;  3GSS A;  2PMT A;  3KP9 A;  1THX A;  4J57 E;  4K9Z A;  2GQM A;  4YQV A;  2HXK A;  2LJK A;  3ZL5 A;  2X8H A;  2LEG A;  1GWC A;  4G2E A;  1VF1 A;  1A2J A;  3HVN A;  1ERT A;  3IXR A;  4F2I A;  2H1D A;  1RW1 A;  1SD8 A;  4MA9 A;  4DEJ A;  1XW5 A;  3KXO A;  3FR6 A;  3GL5 A;  1N8J A;  2GZZ A;  2P0G A;  3TRQ A;  4MPF A;  5AGY A;  2OA7 A;  4HSC X;  3KZQ A;  7GSS A;  1AQV A;  1K3L A;  5CRW A;  5J9C A;  2H66 A;  1M9B A;  1E2Y A;  3DYR A;  4HJM A;  4ZBB A;  1U87 A;  2C1Y A;  4MJB A;  1TI1 A;  5JCU A;  2DC5 A;  1HYU A;  5KOX A;  5D93 A;  3ZVJ A;  1SYX A;  2WS2 A;  2GZY A;  4IJI A;  1GLQ A;  1X9M B;  2NVL A;  1TRV A;  5ECL B;  4EO3 A;  1K0C A;  1MEK A;  5ELG A;  2LV3 A;  1Q98 A;  3QR6 A;  3DVW A;  5F07 A;  3UVT A;  1SL2 B;  3LSZ A;  4AJ8 A;  1T00 A;  1JFU A;  2DIZ A;  4AJ7 A;  2LRC A;  1X9S B;  3P8W A;  4KE3 A;  3F4S A;  3BOA A;  1K3Y A;  5GST A;  2YJ7 A;  4ML1 A;  2LST A;  2JSY A;  2GZP A;  3F4R A;  4PXO A;  3TB2 A;  2RUE A;  2PUK C;  1THO A;  1O85 A;  1JHB A;  3F8U A;  1Z9H A;  1TOF A;  2ES7 A;  2R3X A;  5ECK B;  3LXT A;  4GQC A;  4JE1 A;  4LL1 B;  3TKP A;  6GSW A;  3ZRD A;  1WPI A;  3GL3 A;  4FIW A;  4PQH A;  2FHE A;  2I81 A;  1EGR A;  3ZIV A;  3LOR A;  1DUG A;  2E0Q A;  2N5F A;  4AJ6 A;  3GH9 A;  2PVQ A;  3LEF A;  4TXO B;  3FZ9 A;  2CV4 A;  2H0I A;  1K0D A;  1V58 A;  5FHI A;  2IWT A;  5LD0 A;  1GUK A;  3EPT A;  5D9V A;  3KMO A;  3U6V A;  19GS A;  5DAL B;  2ALB A;  3HJP A;  1M2B A;  4PUR A;  2GVP A;  2IN3 A;  2DJK A;  1G6Y A;  4XHM A;  3VUR A;  5KN2 A;  1PX7 A;  4O5Q A;  4ECJ A;  1XBS A;  4O32 A;  4PX1 A;  1ZYP A;  4X0X A;  1XWB A;  3TKR A;  5IM9 A;  5ECQ B;  3ZML A;  2KLX A;  4KDX A;  2DJ0 A;  1GNW A;  2H1B A;  3APQ A;  3GKX A;  3HKR A;  4OCE A;  4XS6 A;  1X9W B;  1PX6 A;  2MBS A;  3EUR A;  2AJQ B;  2F8F A;  1B9Y C;  4O5R A;  2WUL A;  1S3D A;  1GSD A;  2XPD A;  3RBT A;  2CVK A;  3FY7 A;  3MWH A;  3ZLP A;  4KA0 A;  2FCH A;  3E0U A;  2I9H A;  2LNS A;  2HNL A;  2R37 A;  3R3E A;  1BQ7 A;  4GST A;  2IMK A;  2GT5 A;  2I4A A;  6GSV A;  5IPG A;  2B7J A;  1XG8 A;  3LW9 A;  1OYJ A;  3CSH A;  2H73 A;  4WR5 A;  2AYT A;  1TKD B;  1A23 A;  4E8E A;  3TJG A;  4PQI A;  3WGE A;  2WGR A;  5BRT A;  3LYP A;  4KGI A;  1B4Q A;  2FNO A;  2H70 A;  4HZ2 A;  5KEJ A;  5JWO B;  3M1G A;  4OCF A;  1PKZ A;  2IME A;  2IIY A;  4ECB A;  3S9F A;  3EWL A;  3DD3 A;  5JCG A;  3ZTL A;  2XPE A;  4IJ3 A;  1O7U A;  4TKY A;  5DBQ A;  3W8S A;  2CX4 A;  3WGX A;  1V57 A;  1Z6N A;  2GGT A;  4ID0 A;  1G7O A;  2B3S A;  4AF2 A;  4PUF C;  1AC1 A;  3LWA A;  2WCI A;  1SJZ A;  2IFQ B;  1DE2 A;  4K5S A;  4YKF A;  4NXI A;  3DML A;  1ML6 A;  5IMA A;  3TRX A;  2RM5 A;  4LA1 A;  1URM A;  4OFT A;  1TRU A;  4F03 A;  1HNA A;  4BA7 A;  1J08 A;  2JL4 A;  1RQM A;  1TJD A;  4EL1 A;  3IHQ A;  2LKU A;  4NPB A;  4Q5F A;  1F3B A;  5GZZ B;  4BL7 B;  2E7P A;  1PMT A;  1M2D A;  1N2A A;  3HJO A;  2FA4 A;  4EIQ A;  1GTU A;  1SD9 A;  1FW1 A;  2VL9 A;  2ZCT A;  2OJL A;  4RQX A;  3HVX A;  1TDI A;  1K0M A;  4LMW A;  3WT1 A;  2BJX A;  3L9S A;  2LQQ A;  3GNJ A;  2GQL A;  2GSR A;  1ZYE A;  3BCI A;  4FQU A;  2ZUP A;  3KIJ A;  5DAK A;  4TR4 A;  1TK8 B;  3FRC A;  4NHZ A;  2OBI A;  4MK3 A;  2LTK A;  1Z6M A;  3M8N A;  1AXD A;  4USS A;  2X8G A;  4OO5 A;  2OAD A;  3PH9 A;  5A4U A;  4OO4 A;  2L4Q A;  3FR9 A;  2C3T A;  1ST9 A;  4V2M A;  2NDO A;  5ID2 A;  5AIV A;  5J5N A;  2VM1 A;  1T8E B;  3UOM A;  1XWK A;  5HQP A;  1A8L A;  4RUV A;  2C3N A;  4J2F A;  3RHB A;  1QK8 A;  1F2E A;  2D2Z A;  1F9M A;  2V41 A;  4EC0 A;  2PU9 C;  3EE2 A;  2FWE A;  2R6K A;  3VWW A;  4I97 A;  1JLW A;  17GS A;  3EIN A;  5HR3 A;  1NW2 A;  3C71 A;  12GS A;  2H01 A;  4Q5Q A;  3TJK A;  3ZIT A;  2H74 A;  1WE0 A;  4G0I A;  2H0H A;  3UBK A;  1VF4 A;  1EOH A;  4XTS A;  2K18 A;  3F3R A;  4G10 A;  3BBY A;  5GSS A;  3L0H A;  4IN0 A;  1XWG A;  4TOP A;  5EL8 A;  4F9Z A;  1XFL A;  4HJ2 A;  3I69 A;  4LMV A;  6GSY A;  1A8Y A;  1GSY A;  3C1R A;  1ZCP A;  4EVM A;  1SL1 B;  1SL0 B;  2JU5 A;  2UZ8 A;  1M9A A;  1X5E A;  4IQA A;  2QA2 A;  4ILF A;  4A5P A;  1GUH A;  4ZBD A;  3GIX A;  1K0O A;  5DJL A;  4WR4 A;  4MDC A;  4CHS A;  1V9W A;  3HYP A;  1DSB A;  3GHA A;  3GUR A;  3TCO A;  1JZR A;  3CTG A;  1PA3 A;  1XCC A;  3I43 A;  3DVX A;  4EF0 A;  2C8U A;  3VPT A;  1QGV A;  4QQ7 A;  5ECO B;  1BG5 A;  1Z3E A;  1R5P A;  3RPP A;  1T4Y A;  1EZK A;  3O3T A;  1OAZ A;  2F8A A;  1EWX A;  5AIS A;  5D96 A;  8GSS A;  3CBU A;  3ISO A;  4GLT A;  1EP7 A;  3UEM A;  4KF9 A;  4EXJ A;  3BJ5 A;  3J7Y k;  2HFD A;  4X4J A;  1XW6 A;  4E8H A;  1UVZ A;  3GX8 A;  5CO3 A;  1ERV A;  4O7H A;  4POK A;  1XWA A;  2X99 A;  4ML6 A;  1HNB A;  3SBC A;  2DSA A;  2HRF A;  1X5C A;  2VOC A;  4WF5 A;  3A5I A;  4GXZ A;  3HVV A;  2J23 A;  2FUG 2;  2IMD A;  3KH9 A;  3TKS E;  1PN0 A;  1PQN A;  3M3M A;  2HZF A;  3NOF A;  2WJU A;  2DKI A;  5J41 A;  2YCD A;  4MPG A;  2JZT A;  3HJM A;  1YF1 A;  3LGC A;  2L59 A;  2KHP A;  3C8E A;  2DJ3 A;  4MZB A;  4DSR A;  2EIO A;  1V98 A;  4MJC A;  3DWV A;  1M3J A;  1EEM A;  3H79 A;  3DIE A;  2H19 A;  3KH7 A;  4XCS A;  3FW2 A;  1SKW B;  3EU3 A;  1MD3 A;  1Y25 A;  5IMV A;  1GSS A;  2B7K A;  2MMZ A;  1WP0 A;  3GV1 A;  4HQZ A;  3VPQ A;  4N0Z A;  2AV4 A;  3ERG A;  3FZ5 A;  3VI5 A;  2GQK A;  13GS A;  2CA8 A;  5C00 A;  5B7C A;  1FVK A;  1OC9 B;  1DE1 A;  2L57 A;  4FO5 A;  2VCW A;  4MH3 A;  1SK1 A;  2H71 A;  1CQH A;  4Z2R A;  4QL7 A;  4L0W A;  1SJI A;  5J9B A;  4GRF A;  2X4A A;  3K8N A;  4ZL7 A;  3PPU A;  4TXO A;  4ZB8 A;  3D21 A;  3IBH A;  1H4O A;  5IMZ A;  1GSQ A;  2C80 A;  4V2N A;  1YQ1 A;  4K6X A;  2HI7 A;  3VWX A;  3U5R E;  1B8X A;  5DAL A;  5ECI B;  2C0F A;  1ACV A;  1ZMA A;  1QUW A;  3O76 A;  2JZS A;  2TIR A;  2DKH A;  5INY A;  3IPZ A;  1TU7 A;  3G7I A; 
#chains in the Genus database with same CATH homology
 3Q19 A;  2H0G A;  2REM A;  2HRK A;  2A4H A;  2EC4 A;  2KP2 A;  4ZL9 A;  2EIQ A;  2YNX A;  4L0U A;  4EDY A;  4YKG A;  5G30 A;  4OFM A;  5ECM B;  1EOG A;  1XZO A;  4N11 A;  2K8S A;  3KEB A;  2NBS A;  5G1K A;  5HFG A;  2TRC P;  5D9T A;  4KX4 A;  4K7N A;  3HCZ A;  3PR8 A;  2LS5 A;  2OE1 A;  1MDI A;  4EDZ A;  1GL8 A;  5IMF A;  1T1V A;  1BYE A;  2QKE A;  5ECH B;  2V1M A;  3KP8 A;  4Z7X A;  1AQW A;  5G5E A;  1R26 A;  4RI6 A;  3A2V A;  3A2X A;  2YWN A;  5DVB A;  4NAX A;  1TRS A;  4MLY A;  1Z5Y E;  1RK4 A;  2AHE A;  4KW6 A;  3IE3 A;  2I1U A;  5KN0 A;  1T3B A;  4ZXG A;  3C1S A;  2V6O A;  1TRW A;  3GA4 A;  2FWH A;  4YQM A;  1WWJ A;  2DJ2 A;  1YDK A;  1EV9 A;  3F6D A;  2GLR A;  4H86 A;  5IQY A;  1K0A A;  2H30 A;  1J9B A;  1EV4 A;  2WRT A;  3TUE A;  2R0G A;  4ACS A;  2ZNM A;  5ENU A;  4NHW A;  1J0F A;  3QOU A;  3APS A;  1ERW A;  2B5Y A;  2GDR A;  3OR5 A;  2YOI A;  1PRX A;  5CRH A;  2YN1 A;  1GUL A;  1FVJ A;  2C0E A;  1G6W A;  4GQF A;  2O7K A;  4X43 A;  5KOW A;  4KH7 A;  3BD2 A;  1XXU A;  3L4N A;  2IFQ A;  1JZO A;  3M9J A;  1GRX A;  2GSQ A;  2VLV A;  5EVO A;  4K2X A;  2YV7 A;  3AY8 A;  5CYY A;  2YPM A;  2OAC A;  5EPF A;  3MAK A;  1Q4J A;  4XS4 B;  2E2G A;  4BVY B;  2VCT A;  3GTU B;  1GLP A;  3QFB C;  5H5S A;  2VO4 A;  4TR1 A;  2V2G A;  4KUN A;  5AIX A;  2YP6 A;  1GH2 A;  1PD2 1;  3FZA A;  1FB6 A;  4BL7 A;  1A24 A;  3VI7 A;  5EY6 A;  1FB0 A;  5B8A A;  2M80 A;  4OFN A;  2JSZ A;  4CY8 A;  2P5R A;  3QPM A;  4K7O A;  3D5J A;  4F82 A;  3QCP A;  2N5A A;  1OKT A;  5IMC A;  2F9S A;  2QGV A;  2H1G A;  5G31 A;  3HXS A;  4MMM A;  3LFL A;  3WYW A;  3FK8 A;  2B1K A;  3HY2 A;  2CVD A;  3UAP A;  3C73 A;  4WF4 A;  1QFN A;  3EVI A;  2KOK A;  2V6K A;  1KEB A;  1USB A;  3LG6 A;  4TW5 A;  5DQS A;  2PBJ A;  1TTZ A;  1SK0 A;  6GSX A;  1NHO A;  2G2Q A;  2MBT A;  1M0U A;  3TRP A;  4LL4 B;  3W6G A;  1IYH A;  5IMD A;  2O89 A;  2CX3 A;  2IPA A;  3ZFL A;  4TRX A;  4TR0 A;  4TR1 B;  2VL3 A;  4IKH A;  1WIK A;  1KTE A;  2DJJ A;  2N5B A;  1OE8 A;  3CRU A;  4HEA 2;  1Y6E A;  5D73 A;  2OBK A;  1SYR A;  4ZBA A;  2WZ9 A;  1KBN A;  1K3O A;  1YEP A;  5CAX A;  1BAY A;  2HE3 A;  3CXG A;  1O8X A;  2FWG A;  3PIN A;  3GFK A;  1F37 A;  4OD7 A;  1TI3 A;  5CP1 A;  1CQG A;  4Q5N A;  1XOA A;  3FYG A;  3UMA A;  3IOS A;  4Q5R A;  5DDL A;  5F8B A;  1A0F A;  1ILO A;  2L6D A;  2H1A A;  1ZGN A;  1TXX A;  4N30 A;  2RLI A;  5ECR B;  4NV5 A;  2K6V A;  4KSO A;  1FO5 A;  4OMV A;  3ZZX A;  2F3M A;  1M7T A;  1BED A;  3QAW A;  4BVX B;  5A5K A;  4MJA A;  4HS1 A;  5E59 A;  2XHF A;  2FA8 A;  3IAM 2;  1SJ6 A;  3FEU A;  4YH2 A;  2JAC A;  5H5Q A;  1EP8 A;  4RI7 A;  3VWV A;  4WET A;  5IO0 A;  18GS A;  2LJR A;  2OE0 A;  1PL2 A;  3CTF A;  2M72 A;  2JAD A;  4D73 B;  1UC7 A;  1LBK A;  3TGZ A;  2RII A;  2AB6 A;  4POB A;  3KTL A;  2GT6 A;  3L9V A;  1PGT A;  1BJX A;  2R5G A;  3KM6 A;  3A3T A;  2HZE B;  2V32 A;  3F4T A;  1X5D A;  4MAB A;  3DEX A;  5DQY A;  3KGK A;  4QL9 A;  1YF0 A;  3UIW A;  1G7E A;  2HRN A;  2B1L A;  5G1L A;  2H6Y A;  3KMN A;  5IOX A;  1K0N A;  5FWG A;  3N9J A;  3ME7 A;  5DCH A;  2CQ9 A;  2VCX A;  1ZZY A;  2CZ3 A;  3CYN A;  2XC2 A;  3VWU A;  5L71 A;  4PNF A;  3GH6 A;  2C0G A;  4I2T A;  4KB3 A;  2VD1 A;  5HFI A;  2QC7 A;  3EMX A;  1A2M A;  1XPV A;  1H75 A;  4IQ1 A;  5B6M A;  1AUC A;  2HSH A;  3H4K A;  3J7Y b;  1XWC A;  3F63 A;  1EGO A;  3MSZ A;  1A2L A;  5LNK e;  2C3Q A;  3E9J B;  1SKS B;  3P90 A;  3NIV A;  2R2J A;  3WGD A;  3IK7 A;  2R0C A;  4Z2T A;  2X49 A;  5LCZ A;  3ZMK A;  2PN8 A;  3FMW A;  4J56 E;  4JRR A;  4PGT A;  3L9U A;  1G0T A;  2B6M A;  3IC8 A;  22GS A;  3KTB A;  4DVC A;  1B4P A;  4PNG A;  1GSU A;  3Q6O A;  2DLX A;  1YY7 A;  2R4V A;  4K5R A;  4KCA A;  5IIZ A;  1OE7 A;  4Z2U A;  5JWQ B;  5J3R A;  4IP6 A;  3NZN A;  4V2L A;  5ELA A;  1R5A A;  1QQ2 A;  2IMI A;  3MDK A;  2L4C A;  1MDJ A;  3HDC A;  1W89 A;  3MIX A;  2CVB A;  5F05 A;  3IDV A;  4EKZ A;  4O92 A;  4HQS A;  3UL3 A;  1OC9 A;  4IEL A;  2YZU A;  3E3E A;  5KN1 A;  3WT2 A;  5A4W A;  2G0F A;  3V1W A;  1YKC A;  3D4M A;  1U3A A;  5CNW A;  2GTU A;  4MJE A;  2MZC A;  3HHV A;  4HZ4 A;  5BMU A;  1U3I A;  3RPN A;  3CRT A;  2VM2 A;  5A4V A;  2L5L A;  2M46 A;  1C72 A;  5ECP B;  3DXB A;  1B48 A;  3US3 A;  2CAI A;  1HNC A;  3H8Q A;  1GUM A;  1GTB A;  2YV9 A;  4GSN A;  1IYI A;  14GS A;  3TJF A;  4DSS B;  1VGL A;  1WRY A;  3D6I A;  2VD0 A;  1WJK A;  4K8M A;  1NM3 A;  2LJA A;  2B5E A;  4V1A p;  1YZX A;  3UBL A;  2HSM A;  2X8C A;  4TVE A;  2YJH A;  1AQX A;  2R0P A;  4MCU A;  1F3A A;  4ZB6 A;  5HR1 A;  1OVN A;  2PPT A;  2NPB A;  3H93 A;  1ABA A;  2LNT A;  4G9H A;  2PGT A;  4MF6 A;  1FOH A;  5G5F A;  1PN9 A;  4K1F A;  1GTI A;  1K0B A;  3IR4 A;  4MF5 A;  1WOU A;  3FKF A;  4XIH A;  5COH A;  5D8I A;  3JCM L;  4DSQ A;  2HLS A;  4BPY A;  2I3Y A;  1GTA A;  2K8V A;  1GP1 A;  2NTO A;  5C04 A;  2QSI A;  3ERW A;  1O73 A;  4MF7 A;  3ME8 A;  2WB9 A;  3TOU A;  2VUP A;  1FHE A;  1MD4 A;  2DJ1 A;  4WKW A;  2YZH A;  2A2R A;  4MZW A;  2K9F A;  2XBI A;  11GS A;  1ZYN A;  4LLR A;  1JZW A;  2O85 A;  4PUA A;  1V2A A;  3G7J A;  3EYT A;  4G0L A;  4X1U A;  3M0F A;  2MMN A;  4L5O A;  1LU4 A;  4IVF A;  5IOW A;  2O87 A;  4JZQ A;  1AIU A;  3HA9 A;  2FWF A;  4NV2 A;  3O6T A;  1YEX A;  3EC3 A;  1M2A A;  3TKQ A;  3G9B A;  2CZ2 A;  4ICY A;  3QMX A;  1I9D A;  1DBY A;  16GS A;  1FG4 A;  5B8B A;  5AN1 A;  4EUY A;  2LQO A;  3VLN A;  2DIY A;  2Z9S A;  3ZRE A;  1AW9 A;  2H76 A;  5GAP D;  4JBB A;  3HVS A;  3A5W A;  4JR4 A;  2DMM A;  4XS4 A;  4BVY A;  2LUS A;  3TJB A;  3GTU A;  2PVO C;  3DGQ A;  2KP1 A;  1XIY A;  4WBJ A;  4YQU A;  3ZVJ D;  1SK2 A;  1JZD A;  3HZ4 A;  3Q74 A;  2RM6 A;  1FOV A;  1GSE A;  3APO A;  1A0R P;  4ZB9 A;  2GSS A;  3IHG A;  3MNG A;  3TDG A;  3UJ1 A;  1TK5 B;  2H72 A;  3CSJ A;  3H1N A;  3IV4 A;  4ZL8 A;  3GN3 A;  1WMJ A;  2WFC A;  1SU9 A;  4POM A;  1ON4 A;  3GST A;  2VL2 A;  4KCE A;  2H6Z A;  1NHY A;  2C0D A;  3UVH A;  2IMF A;  4POL A;  4IGJ A;  2MMA A;  3I9V 2;  4YAV A;  1QMV A;  3ZIJ A;  4ZIJ A;  1T7P B;  6GSU A;  3QDN A;  3ZYW A;  3D0Z A;  1XVQ A;  2YAN A;  4MP4 A;  1SKR B;  3QFA C;  4G19 A;  5CRD A;  3LQ7 A;  2CT6 A;  1YKA A;  5ECS A;  1ZL9 A;  2P31 A;  2H8L A;  5DCG A;  3QD9 A;  3ED3 A;  1S3C A;  1VF2 A;  4K7I A;  1ERU A;  2H75 A;  3W8J A;  4HUA A;  1VRS D;  1TW9 A;  3GKN A;  3IK9 A;  4ECC A;  2RUF A;  4IHU A;  3VFI A;  4ECI A;  1HD2 A;  3F9U A;  5JCW A;  1O8W A;  5ABR A;  2HT9 A;  5F0G A;  4IW9 A;  4PQ1 A;  1X0R A;  2A4V A;  3D22 A;  2DBC A;  3IRA A;  1B9X C;  4EIP A;  1LJR A;  3DKS A;  3QAV A;  1V40 A;  4BVX A;  2GS3 A;  4K2D A;  1UN2 A;  4O5U A;  1O81 A;  2PWJ A;  2FD3 A;  5D9X A;  2VCQ A;  2VLU A;  1PL1 A;  2FY6 A;  1FAA A;  4JR6 A;  2LRN A;  2HYX A;  3RDW A;  3FZ4 A;  4I5Q A;  2MMO A;  4HDE A;  4TR3 A;  2VL2 C;  3TJJ A;  4D73 A;  3BCK A;  3C7M A;  2A2S A;  2XBQ A;  3KJY A;  1XOB A;  4N0V A;  1NSW A;  5CRG A;  1SEN A;  3HD5 A;  3CSI A;  2HZE A;  2X64 A;  4GSS A;  4AGS A;  2GST A;  4RQR A;  2L6C A;  3R2Q A;  2EIR A;  4XS1 A;  3CMI A;  3PGT A;  2YWO A;  4IS0 A;  2E2M A;  3KD0 A;  4KND A;  5KN3 A;  3DRN A;  3TOT A;  3IC4 A;  1M99 A;  2FLS A;  3KCM A;  3QAG A;  3EMP A;  4XRD A;  3Q18 A;  3LXZ A;  3RAZ A;  4L8E A;  3GUS A;  2MYG A;  2DML A;  4I2U A;  4HU9 A;  1XW9 A;  5E4W A;  1E6B A;  4BWQ A;  4I8B A;  3SWL A;  3I6A A;  4CY6 A;  5F06 A;  2BTO T;  2PER A;  2VIM A;  1OC8 A;  4JU5 A;  4CDO A;  1ZYQ B;  2O8V B;  1UA5 A;  4HI7 A;  2B5X A;  1GNE A;  4I6X A;  5GAN D;  4JED A;  1GSF A;  1MDK A;  4GF0 A;  4HU7 A;  5FT3 A;  4FYC A;  3F6F A;  2L5O A;  3ZFB A;  4GWR A;  5IPH A;  3IAS 2;  1PKW A;  1ZOF A;  3WD6 A;  2ON7 A;  4N10 A;  2IJY A;  5DJM A;  2C4J A;  1Z7P A;  5ECN B;  1PSQ A;  1T4Z A;  4WEY A;  3LJR A;  4CW9 A;  9GSS A;  3MYD A;  1I5G A;  2TRX A;  3ERF A;  5HFK A;  4KAE A;  3L78 A;  1F6M C;  2F51 A;  3P7X A;  1YJ6 A;  3G7Y A;  2OE3 A;  4TN8 A;  3P2A A;  5DAK B;  4FYB A;  1R4W A;  3GYK A;  4WXT A;  3TKS A;  2VCZ A;  2ON5 A;  3VK9 A;  4IP1 A;  2BMX A;  2QA1 A;  3FHK A;  5J4U A;  3GRX A;  1O6J A;  2YWM A;  4HOJ A;  4EE0 A;  3GMF A;  1QXH A;  1KNG A;  4K0N A;  2OKA A;  2HRA A;  4ISD A;  1JLV A;  5H5R A;  4WBR D;  5HR2 A;  1BX9 A;  5IO2 A;  1MTC A;  3HZ8 A;  1OC3 A;  4G0K A;  2AAW A;  2VAF A;  4K0G A;  5B6N A;  5ID2 B;  3F0I A;  3GKK A;  2YWI A;  4F0B A;  5D9W A;  3IA1 A;  1EEJ A;  5JWR B;  1AAZ A;  4ULX A;  1TK0 B;  3F3Q A;  4NMU A;  1VF3 A;  4KDY A;  2IL3 A;  3A2W A;  3M9K A;  1TP9 A;  4FYU A;  4TXV A;  3GKM A;  4XRA A;  2H6X A;  2JZR A;  4IBP A;  1XVW A;  3GX0 A;  4ZIL A;  2VLT A;  10GS A;  4FH8 A;  2AUV A;  4P3Y B;  5G2Z A;  1U88 A;  3D4T A;  2WDU A;  4DSS A;  4MZC A;  1HQO A;  4NWY A;  1Z7R A;  4F0C A;  4MH2 A;  3UAR A;  4MNN A;  2FGX A;  1W4V A;  3N5O A;  2HSY A;  4KSM A;  5CRE A;  4OWY A;  2LRT A;  20GS A;  2P5Q A;  2A2P A;  3EU4 A;  3FR3 A;  1OKD A;  4YAP A;  1U6T A;  1TU8 A;  2CAQ A;  4GTU A;  2J9H A;  4GCI A;  2KUC A;  2VCV A;  4KDU A;  6GSS A;  1R7H A;  1S3A A;  3TKS C;  4BWS A;  3LYK A;  4PTS A;  5HR0 A;  4V1A g;  6GST A;  3RHC A;  4L5L A;  3GSS A;  2PMT A;  3KP9 A;  1THX A;  4J57 E;  4K9Z A;  2GQM A;  4YQV A;  2HXK A;  2LJK A;  3ZL5 A;  2X8H A;  2LEG A;  1GWC A;  4G2E A;  1VF1 A;  1A2J A;  1ERT A;  3IXR A;  4F2I A;  2H1D A;  1RW1 A;  1SD8 A;  4MA9 A;  4DEJ A;  1XW5 A;  3KXO A;  3FR6 A;  3GL5 A;  1N8J A;  2GZZ A;  2P0G A;  3TRQ A;  4MPF A;  5AGY A;  2OA7 A;  3KZQ A;  7GSS A;  1AQV A;  1K3L A;  5CRW A;  5J9C A;  2H66 A;  1M9B A;  1E2Y A;  3DYR A;  4HJM A;  4ZBB A;  1U87 A;  2C1Y A;  4MJB A;  1TI1 A;  5JCU A;  2DC5 A;  1HYU A;  5KOX A;  5D93 A;  3ZVJ A;  1SYX A;  2WS2 A;  2GZY A;  4IJI A;  1GLQ A;  1X9M B;  2NVL A;  1TRV A;  5ECL B;  4EO3 A;  1K0C A;  1MEK A;  5ELG A;  2LV3 A;  1Q98 A;  3QR6 A;  3DVW A;  5F07 A;  3UVT A;  1SL2 B;  3LSZ A;  4AJ8 A;  1T00 A;  1JFU A;  2DIZ A;  4AJ7 A;  2LRC A;  1X9S B;  3P8W A;  4KE3 A;  3F4S A;  3BOA A;  1K3Y A;  5GST A;  2YJ7 A;  4ML1 A;  2LST A;  2JSY A;  2GZP A;  3F4R A;  4PXO A;  3TB2 A;  2RUE A;  2PUK C;  1THO A;  1O85 A;  1JHB A;  3F8U A;  1Z9H A;  1TOF A;  2ES7 A;  2R3X A;  5ECK B;  3LXT A;  4GQC A;  4JE1 A;  4LL1 B;  3TKP A;  6GSW A;  3ZRD A;  1WPI A;  3GL3 A;  4FIW A;  4PQH A;  2FHE A;  2I81 A;  1EGR A;  3ZIV A;  3LOR A;  1DUG A;  2E0Q A;  2N5F A;  4AJ6 A;  3GH9 A;  2PVQ A;  3LEF A;  4TXO B;  3FZ9 A;  2CV4 A;  2H0I A;  1K0D A;  1V58 A;  5FHI A;  2IWT A;  5LD0 A;  1GUK A;  3EPT A;  5D9V A;  3KMO A;  3U6V A;  19GS A;  5DAL B;  2ALB A;  3HJP A;  1M2B A;  4PUR A;  2GVP A;  2IN3 A;  2DJK A;  1G6Y A;  4XHM A;  3VUR A;  5KN2 A;  1PX7 A;  4O5Q A;  4ECJ A;  1XBS A;  4O32 A;  4PX1 A;  1ZYP A;  4X0X A;  1XWB A;  3TKR A;  5IM9 A;  5ECQ B;  3ZML A;  2KLX A;  4KDX A;  2DJ0 A;  1GNW A;  2H1B A;  3APQ A;  3GKX A;  3HKR A;  4OCE A;  4XS6 A;  1X9W B;  1PX6 A;  2MBS A;  3EUR A;  2AJQ B;  2F8F A;  1B9Y C;  4O5R A;  2WUL A;  1S3D A;  1GSD A;  2XPD A;  3RBT A;  2CVK A;  3FY7 A;  3MWH A;  3ZLP A;  4KA0 A;  2FCH A;  3E0U A;  2I9H A;  2LNS A;  2HNL A;  2R37 A;  3R3E A;  1BQ7 A;  4GST A;  2IMK A;  2GT5 A;  2I4A A;  6GSV A;  5IPG A;  2B7J A;  3LW9 A;  1OYJ A;  3CSH A;  2H73 A;  4WR5 A;  2AYT A;  1TKD B;  1A23 A;  4E8E A;  3TJG A;  4PQI A;  3WGE A;  2WGR A;  5BRT A;  3LYP A;  4KGI A;  1B4Q A;  2FNO A;  2H70 A;  4HZ2 A;  5KEJ A;  5JWO B;  3M1G A;  4OCF A;  1PKZ A;  2IME A;  2IIY A;  4ECB A;  3S9F A;  3EWL A;  3DD3 A;  5JCG A;  3ZTL A;  2XPE A;  4IJ3 A;  1O7U A;  4TKY A;  5DBQ A;  3W8S A;  2CX4 A;  3WGX A;  1V57 A;  1Z6N A;  2GGT A;  4ID0 A;  1G7O A;  2B3S A;  4AF2 A;  4PUF C;  1AC1 A;  3LWA A;  2WCI A;  1SJZ A;  2IFQ B;  1DE2 A;  4K5S A;  4YKF A;  4NXI A;  3DML A;  1ML6 A;  5IMA A;  3TRX A;  2RM5 A;  4LA1 A;  1URM A;  4OFT A;  1TRU A;  4F03 A;  1HNA A;  4BA7 A;  1J08 A;  2JL4 A;  1RQM A;  1TJD A;  4EL1 A;  3IHQ A;  2LKU A;  4NPB A;  4Q5F A;  1F3B A;  5GZZ B;  4BL7 B;  2E7P A;  1PMT A;  1M2D A;  1N2A A;  3HJO A;  2FA4 A;  4EIQ A;  1GTU A;  1SD9 A;  1FW1 A;  2VL9 A;  2ZCT A;  2OJL A;  4RQX A;  3HVX A;  1TDI A;  1K0M A;  4LMW A;  3WT1 A;  2BJX A;  3L9S A;  2LQQ A;  3GNJ A;  2GQL A;  2GSR A;  1ZYE A;  3BCI A;  4FQU A;  2ZUP A;  3KIJ A;  5DAK A;  4TR4 A;  1TK8 B;  3FRC A;  4NHZ A;  2OBI A;  4MK3 A;  2LTK A;  1Z6M A;  3M8N A;  1AXD A;  4USS A;  2X8G A;  4OO5 A;  2OAD A;  3PH9 A;  5A4U A;  4OO4 A;  2L4Q A;  3FR9 A;  2C3T A;  1ST9 A;  4V2M A;  2NDO A;  5ID2 A;  5AIV A;  5J5N A;  2VM1 A;  1T8E B;  3UOM A;  1XWK A;  5HQP A;  1A8L A;  4RUV A;  2C3N A;  4J2F A;  3RHB A;  1QK8 A;  1F2E A;  2D2Z A;  1F9M A;  2V41 A;  4EC0 A;  2PU9 C;  3EE2 A;  2FWE A;  2R6K A;  3VWW A;  4I97 A;  1JLW A;  17GS A;  3EIN A;  5HR3 A;  1NW2 A;  3C71 A;  12GS A;  2H01 A;  4Q5Q A;  3TJK A;  3ZIT A;  2H74 A;  1WE0 A;  4G0I A;  2H0H A;  3UBK A;  1VF4 A;  1EOH A;  4XTS A;  2K18 A;  3F3R A;  4G10 A;  3BBY A;  5GSS A;  3L0H A;  4IN0 A;  1XWG A;  4TOP A;  5EL8 A;  4F9Z A;  1XFL A;  4HJ2 A;  3I69 A;  4LMV A;  6GSY A;  1A8Y A;  1GSY A;  3C1R A;  1ZCP A;  4EVM A;  1SL1 B;  1SL0 B;  2JU5 A;  2UZ8 A;  1M9A A;  1X5E A;  4IQA A;  2QA2 A;  4ILF A;  4A5P A;  1GUH A;  4ZBD A;  3GIX A;  1K0O A;  5DJL A;  4WR4 A;  4MDC A;  4CHS A;  1V9W A;  3HYP A;  1DSB A;  3GHA A;  3GUR A;  3TCO A;  1JZR A;  3CTG A;  1PA3 A;  1XCC A;  3I43 A;  3DVX A;  4EF0 A;  2C8U A;  3VPT A;  1QGV A;  4QQ7 A;  5ECO B;  1BG5 A;  1Z3E A;  1R5P A;  3RPP A;  1T4Y A;  1EZK A;  3O3T A;  1OAZ A;  5D96 A;  2F8A A;  1EWX A;  5AIS A;  8GSS A;  3CBU A;  3ISO A;  4GLT A;  1EP7 A;  3UEM A;  4KF9 A;  4EXJ A;  3BJ5 A;  3J7Y k;  2HFD A;  4X4J A;  1XW6 A;  4E8H A;  1UVZ A;  3GX8 A;  5CO3 A;  1ERV A;  4O7H A;  4POK A;  1XWA A;  2X99 A;  4ML6 A;  1HNB A;  3SBC A;  2DSA A;  2HRF A;  1X5C A;  2VOC A;  4WF5 A;  3A5I A;  4GXZ A;  3HVV A;  2J23 A;  2FUG 2;  2IMD A;  3KH9 A;  3TKS E;  1PN0 A;  1PQN A;  3M3M A;  2HZF A;  3NOF A;  2WJU A;  2DKI A;  5J41 A;  2YCD A;  4MPG A;  2JZT A;  3HJM A;  1YF1 A;  3LGC A;  2L59 A;  2KHP A;  3C8E A;  2DJ3 A;  4MZB A;  4DSR A;  2EIO A;  1V98 A;  4MJC A;  3DWV A;  1EEM A;  3H79 A;  3DIE A;  2H19 A;  3KH7 A;  4XCS A;  3FW2 A;  1SKW B;  3EU3 A;  1MD3 A;  1Y25 A;  5IMV A;  1GSS A;  2B7K A;  2MMZ A;  1WP0 A;  3GV1 A;  4HQZ A;  3VPQ A;  4N0Z A;  2AV4 A;  3ERG A;  3FZ5 A;  3VI5 A;  2GQK A;  13GS A;  2CA8 A;  5C00 A;  5B7C A;  1FVK A;  1OC9 B;  1DE1 A;  2L57 A;  4FO5 A;  2VCW A;  4MH3 A;  1SK1 A;  2H71 A;  1CQH A;  4Z2R A;  4QL7 A;  4L0W A;  1SJI A;  5J9B A;  4GRF A;  2X4A A;  3K8N A;  4ZL7 A;  3PPU A;  4TXO A;  4ZB8 A;  3D21 A;  3IBH A;  1H4O A;  5IMZ A;  1GSQ A;  2C80 A;  4V2N A;  1YQ1 A;  4K6X A;  2HI7 A;  3VWX A;  3U5R E;  1B8X A;  5DAL A;  5ECI B;  2C0F A;  1ACV A;  1ZMA A;  1QUW A;  3O76 A;  2JZS A;  2TIR A;  2DKH A;  5INY A;  3IPZ A;  1TU7 A;  3G7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...