2JZVA

Solution structure of s. aureus prsa-ppiase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
b'GPLGSDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Foldase protein prsA
publication title Solution structure of the parvulin-type PPIase domain of Staphylococcus aureus PrsA - Implications for the catalytic mechanism of parvulins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
total genus 28
structure length 111
sequence length 111
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2jzvA00
3IK8A 1FKIA 2DG4A 3O5JA 2AWGA 2PPOA 3UQIA 2DG9A 5HKGA 5HWBA 1FKDA 2MLXA 2N87A 1F40A 1BL4A 4G50A 1QPLA 2XP8A 4DROA 1QPFA 2M08A 4TW7A 3UQBA 1W26A 1QZ2A 4LAYA 4FAPA 1Q1CA 4DRKA 5HT1A 2KR7A 4BF8A 1ROTA 1KT1A 3TCZA 3UF8A 4JFMA 3KAHA 4DRMA 2PV1A 1FKKA 4ODOA 2KGJA 4DZ3A 4U84A 3JYMA 1YATA 2RUDA 1J4HA 3B7XA 1ZK6A 5B8IC 1FKHA 1NMVA 3O5OA 3O5RA 4MSPA 1NMWA 2Q5AA 2XP9A 3KAGA 1D7HA 4TW8A 4ODNA 3PRBA 2F21A 3O5QA 2DG3A 3O5IA 3O5LA 4GIVA 1JNSA 4W9QA 3KZ7A 4LAXA 1FKFA 1FKGA 4DRIA 1FKBA 1YW5A 4TYOA 3JXVA 1Q6IA 1FKTA 2ZQTA 3NRKA 4DRPA 1JVWA 2RUQA 4ODQA 3CGNA 4GGQA 2ZR5A 1KT0A 1B6CA 1M5YA 2LJ4A 2MPHA 4QT2A 4R0XA 5HTGA 1J6YA 2XP5A 1D7JA 5BXJA 3O5DA 2FAPA 4IPXA 4ODKA 4J4OA 3GPKA 4LAWA 3UQAA 2XPBA 1TCOC 3O5GA 2PPNA 3I6CA 3UI6A 1A7XA 2KO7A 3RFWA 1FKSA 1N1AA 2KE0A 4G2PA 4ODLA 4N19A 4DIPA 2M1IA 2L2SA 2RURA 4LAVA 4DRQA 3KACA 4DRJA 4TNSA 2ZR6A 1EQ3A 1EYMA 1ZCNA 3KADA 1FAPA 2PPPA 4DRNA 4DRHA 4ODRA 4U85A 2F2DA 3TDBA 2OFNA 2XPAA 2PV2A 2FKEA 2MNTA 3KABA 1FJDA 3UI4A 2F4EA 4J4NA 4O2TA 2M2AA 2VN1A 1C9HA 1T11A 3MDYB 4QIBA 3O5EA 1J4IA 1HXVA 1Q6HA 1FKRA 5HW7A 2KFWA 2ZQSA 1FKJA 1PINA 3PRDA 3TC5A 2RQSA 4DH0A 1FD9A 1R9HA 4QT3A 4DT4A 4DZ2A 3WH0A 1NSGA 2IF4A 5J6EA 5I98A 2K8IA 4IQCA 2ZR4A 2MLYA 3CGMA 2ZQUA 4W9OA 2XP6A 4ITZA 2RUCA 5D75A 3IKDA 4MGVA 3RGCA 1F8AB 4JFIA 5HW6A 2RSEA 3IHZA 3KAIA 4JFLA 2MLZA 2XP4A 3UI5A 2LKNA 3H9RB 4TW6A 3OOBA 2LPVA 3LUOA 2KI3A 3NI6A 2PBCA 3KCEA 2ZQVA 5HW8A 1ROUA 1FKLA 5DITA 4C02B 2XP3A 1U79A 2LGOA 2Y78A 3O5PA 3FAPA 1PBKA 4FN2A 4JFKA 4IQ2A 4NNRA 3O5FA 4ODMA 2XP7A 1J4RA 1D6OA 1BKFA 2VCDA 3IKGA 4JYSA 3EY6A 3O5MA 3NTPA 5HUAA 3VAWA 1Y0OA 3ODKA 3PA7A 1D7IA 1JNTA 1P5QA 3KAFA 5GPGA 2JZVA 4JFJA 4ODPA 2UZ5A 1L1PA 2MF9A 1Q6UA 5DIVA 4TX0A 4W9PA 5HWCA 2D9FA 4U86A 2ITKA 5DIUA 3O5KA 3JYJA 2PV3A
chains in the Genus database with same CATH superfamily
3RMEA 3UQIA 2PPOA 5HWBA 1FKDA 4DROA 1UR8A 2XP8A 3CHEA 1W26A 4LAYA 3G6MA 5HT1A 3AS0A 3CHFA 3KAHA 2ETNA 4DRMA 1FKKA 4ODOA 1YATA 3RM9A 1ZK6A 1VF8A 1HKKA 1NMWA 1TFVA 3PR9A 1D7HA 3O5QA 3O5LA 4W9QA 1W1PA 3RM4A 2A3EA 1FKBA 3FY1A 4TYOA 1Q6IA 1FKTA 2ZQTA 1JVWA 4ODQA 1KT0A 4S3KA 3O5DA 2FAPA 4P8VA 3ARWA 3WQWA 3ARPA 1TCOC 2KO7A 3PRAA 2KE0A 3RM8A 1LL7A 2B31A 3AS3A 4N19A 4DIPA 3WD2A 3KACA 4TNSA 2ZR6A 2PI6A 2PPPA 3ARSA 4DRHA 2F23A 3B8SA 2MNTA 1C9HA 1T11A 4L3NA 2G8ZA 3BMBA 5HW7A 1NSGA 4Z2HA 2MLYA 4P8UA 1HKJA 1LL4A 5HW6A 2RSEA 4HBOA 4JFLA 2XP4A 3ARRA 4XAKA 3H9RB 3NI6A 2ESCA 2YBUA 4DWSA 2DPEA 2Y78A 4FN2A 2QF8A 4L72B 1LQ0A 4MPKA 1RD6A 3IKGA 2DSUA 3O5MA 5HUAA 1D7IA 1P5QA 5JH8A 5DIVA 3B9EA 3ARVA 3WL1A 4U86A 5HBFA 2WLYA 1WNOA 1FKIA 2DG9A 1ITXA 3AROA 1JCHB 2N87A 1F40A 2A3AA 1BL4A 1NWTA 4Z2LA 5DF0A 1QZ2A 4FAPA 1FFQA 3AS1A 4BF8A 4JFMA 2PV1A 4DZ3A 1XHGA 3JYMA 4DWSC 3O5OA 3O5RA 2XP9A 3KAGA 4ODNA 2DG3A 1JNSA 4R5EA 4KR0B 2DT0A 3EIPA 1X6NA 4LAXA 1EIBA 3QOKA 4MNKA 3JXVA 3NRKA 1W1TA 2RUQA 3ARTA 3CGNA 4GGQA 1B6CA 1HKMA 2LJ4A 2MPHA 3B9DA 4ODKA 2WLZA 4MNJA 3UQAA 2XPBA 4UDMA 1A7XA 2FDMA 3RFWA 4Z2JA 2P4VA 4G2PA 2L2SA 4LAVA 1GOIA 4DRJA 1EYMA 1ZCNA 1E6NA 1FAPA 4ODRA 2F2DA 3WD1A 2PV2A 3WD3A 1FJDA 2VN1A 1E44A 3MDYB 4QZVB 3O5EA 1NWUA 2KFWA 3PRDA 4HARA 4P8WA 3TC5A 1ZBCA 1FD9A 1ZL1A 1GPFA 2IF4A 5DO2A 2ZR4A 3CGMA 2XP6A 3WKZA 2RUCA 3IKDA 1X6LA 1E6PA 4DWSD 5GPRA 2OLHA 4Z2KA 3OOBA 2PBCA 2ZQVA 1W9VA 1ROUA 1HJXA 1IX5A 1FKLA 1FFRA 2XP3A 1U79A 1E9LA 3WL0A 4ODMA 1J4RA 1D6OA 1BKFA 4JYSA 1EHNA 3EY6A 3NTPA 2IUZA 1Y0OA 4HBEA 4ZPVR 4Z2GA 2UZ5A 1Q6UA 1ZBKA 2DT1A 1O6IA 5HKGA 1HJVA 2MLXA 4AY1A 4G50A 4TW7A 3UQBA 1NWSA 3ARZA 2KR7A 3GU0A 1ROTA 3TCZA 2A3CA 2PN0A 2KGJA 1E6ZA 1W9PA 4U84A 2WK2A 2RUDA 1J4HA 3B7XA 5B8IC 1FKHA 1NMVA 2Q5AA 1D2KA 3GTYX 2F21A 3PRBA 3O5IA 4GIVA 3KZ7A 3B9AA 1FKGA 1H0IA 1YW5A 4DRIA 1XRVA 4S3JA 1LL6A 2DSZA 3ALGA 1J6YA 5HTGA 4W5UA 2XP5A 1D7JA 2AOSA 4MNLA 5BXJA 1LG1A 3AQUA 4IPXA 4J4OA 1OGBA 3GPKA 4LAWA 4DWSB 3UI6A 1FKSA 2M1IA 4KQZA 4DRQA 1EQ3A 3KADA 2WM0A 3ARXA 3BXWA 3ARUA 4DRNA 3TDBA 2OFNA 5GQBA 1K9TA 1KFWA 2F4EA 4J4NA 2YBTA 4O2TA 4ZPTR 4QIBA 1J4IA 1HXVA 1Q6HA 1FKRA 2ZQSA 1NWRA 1PINA 3WD0A 2RQSA 4DH0A 4QT3A 5I98A 4IQCA 2ZQUA 2A3BA 5DEZA 5D75A 4IT4A 1F8AB 1JNEA 2MLZA 3UI5A 1E15A 4TW6A 4WKHA 4ZPWR 2LPVA 1OGGA 2KI3A 3KCEA 1W1VA 5DITA 3O5PA 3FAPA 4IQ2A 1CTNA 4NSBA 1HKIA 4URIA 1H0GA 2VCDA 4WIWA 3VAWA 3ODKA 1JNTA 4MNMA 3KAFA 5GPGA 2JZVA 2MF9A 5HWCA 4W9PA 2D9FA 1ZU8A 2ITKA 1SR0A 3O5KA 2DSVA 2B5UB 3IK8A 2DG4A 3ARQA 3O5JA 2AWGA 4IT6A 1OWQA 4Z2IA 1QPLA 1QPFA 2M08A 3OA5A 1SYTA 1Q1CA 2DSWA 4WKFA 4DRKA 4PTMA 1KT1A 3UF8A 3WD4A 4WKAA 4WJXA 4LGXA 4MSPA 2O92A 1JNDA 4TW8A 1ZB5A 1FKFA 4P8XA 4DRPA 1ZBWA 3ARYA 2ZR5A 3CHDA 1HJWA 1M5YA 4R0XA 4QT2A 3G6LA 4ML4A 4WK9A 3O5GA 2PPNA 3I6CA 1E6RA 4MAVA 1N1AA 4ODLA 4NZCA 1GUVA 2RURA 3WIJA 4U85A 3KABA 2XPAA 2FKEA 3UI4A 1GRJA 2M2AA 3FXYA 4Q7NA 3WQVA 1W1YA 1FKJA 1WB0A 4DZ2A 4DT4A 1R9HA 5J6EA 1WAWA 3CH9A 3WH0A 3CHCA 2DT2A 2K8IA 3CZ8A 1UR9A 4W9OA 4ITZA 4MGVA 4Q22A 3RGCA 4JFIA 3IHZA 3KAIA 2PV3A 2LKNA 4ZS6A 3LUOA 5HW8A 1W9UA 4C02B 2LGOA 1ZBVA 1PBKA 4JFKA 4NNRA 3ALFA 3O5FA 2XP7A 2G41A 1EDQA 3AS2A 3PA7A 1LG2A 2O9OA 4JFJA 4ODPA 1L1PA 1NH6A 4TX0A 4MTVA 5DIUA 3W4RA 1LJYA 3JYJA 2EULA 2DT3A
chains in the Genus database with same CATH topology
3RMEA 3UQIA 2PPOA 5HWBA 1FKDA 4DROA 1UR8A 2XP8A 3CHEA 1W26A 4LAYA 3G6MA 5HT1A 3AS0A 3CHFA 3KAHA 4DRMA 1FKKA 4ODOA 1YATA 3RM9A 1ZK6A 1VF8A 1HKKA 1NMWA 1TFVA 3PR9A 1D7HA 3O5QA 3O5LA 4W9QA 1W1PA 3RM4A 2A3EA 1FKBA 3FY1A 4TYOA 1Q6IA 1FKTA 2ZQTA 1JVWA 4ODQA 1KT0A 4S3KA 3O5DA 2FAPA 4P8VA 3ARWA 3WQWA 3ARPA 1TCOC 2KO7A 3PRAA 2KE0A 3RM8A 1LL7A 2B31A 3AS3A 4N19A 4DIPA 3WD2A 3KACA 4TNSA 2ZR6A 2PI6A 2PPPA 3ARSA 4DRHA 3B8SA 2MNTA 1C9HA 1T11A 4L3NA 2G8ZA 5HW7A 1NSGA 4Z2HA 2MLYA 4P8UA 1HKJA 1LL4A 5HW6A 2RSEA 4HBOA 4JFLA 2XP4A 3ARRA 4XAKA 3H9RB 3NI6A 2ESCA 2YBUA 4DWSA 2DPEA 2Y78A 4FN2A 2QF8A 4L72B 1LQ0A 4MPKA 1RD6A 3IKGA 2DSUA 3O5MA 5HUAA 1D7IA 1P5QA 5JH8A 5DIVA 3B9EA 3ARVA 3WL1A 4U86A 5HBFA 2WLYA 1WNOA 1FKIA 2DG9A 1ITXA 3AROA 2N87A 1F40A 2A3AA 1BL4A 1NWTA 4Z2LA 5DF0A 1QZ2A 4FAPA 1FFQA 3AS1A 4BF8A 4JFMA 2PV1A 4DZ3A 1XHGA 3JYMA 4DWSC 3O5OA 3O5RA 2XP9A 3KAGA 4ODNA 2DG3A 1JNSA 4R5EA 4KR0B 2DT0A 1X6NA 4LAXA 1EIBA 3QOKA 4MNKA 3JXVA 3NRKA 1W1TA 2RUQA 3ARTA 3CGNA 4GGQA 1B6CA 1HKMA 2LJ4A 2MPHA 3B9DA 4ODKA 2WLZA 4MNJA 3UQAA 2XPBA 1A7XA 2FDMA 3RFWA 4Z2JA 4G2PA 2L2SA 4LAVA 1GOIA 4DRJA 1EYMA 1ZCNA 1E6NA 1FAPA 4ODRA 2F2DA 3WD1A 2PV2A 3WD3A 1FJDA 2VN1A 3MDYB 4QZVB 3O5EA 1NWUA 2KFWA 3PRDA 4HARA 4P8WA 3TC5A 1ZBCA 1FD9A 1ZL1A 1GPFA 2IF4A 5DO2A 2ZR4A 3CGMA 2XP6A 3WKZA 2RUCA 3IKDA 1X6LA 1E6PA 4DWSD 5GPRA 2OLHA 4Z2KA 3OOBA 2PBCA 2ZQVA 1W9VA 1ROUA 1HJXA 1IX5A 1FKLA 1FFRA 2XP3A 1U79A 1E9LA 3WL0A 4ODMA 1J4RA 1D6OA 1BKFA 4JYSA 1EHNA 3EY6A 3NTPA 2IUZA 1Y0OA 4HBEA 4ZPVR 4Z2GA 2UZ5A 1Q6UA 1ZBKA 2DT1A 1O6IA 5HKGA 1HJVA 2MLXA 4AY1A 4G50A 4TW7A 3UQBA 1NWSA 3ARZA 2KR7A 1ROTA 3TCZA 2A3CA 2KGJA 1E6ZA 1W9PA 4U84A 2WK2A 2RUDA 1J4HA 3B7XA 5B8IC 1FKHA 1NMVA 2Q5AA 1D2KA 3PRBA 2F21A 3O5IA 4GIVA 3KZ7A 3B9AA 1FKGA 1H0IA 1YW5A 4DRIA 1XRVA 4S3JA 1LL6A 2DSZA 3ALGA 1J6YA 5HTGA 4W5UA 2XP5A 1D7JA 2AOSA 4MNLA 5BXJA 1LG1A 3AQUA 4IPXA 4J4OA 1OGBA 3GPKA 4LAWA 4DWSB 3UI6A 1FKSA 2M1IA 4KQZA 4DRQA 1EQ3A 3KADA 2WM0A 3ARXA 3BXWA 3ARUA 4DRNA 3TDBA 2OFNA 5GQBA 1K9TA 1KFWA 2F4EA 4J4NA 2YBTA 4O2TA 4ZPTR 4QIBA 1J4IA 1HXVA 1Q6HA 1FKRA 2ZQSA 1NWRA 1PINA 3WD0A 2RQSA 4DH0A 4QT3A 5I98A 4IQCA 2ZQUA 2A3BA 5DEZA 5D75A 4IT4A 1F8AB 1JNEA 2MLZA 3UI5A 1E15A 4TW6A 4WKHA 4ZPWR 2LPVA 1OGGA 2KI3A 3KCEA 1W1VA 5DITA 3O5PA 3FAPA 4IQ2A 1CTNA 4NSBA 1HKIA 4URIA 1H0GA 2VCDA 4WIWA 3VAWA 3ODKA 1JNTA 4MNMA 3KAFA 5GPGA 2JZVA 2MF9A 5HWCA 4W9PA 2D9FA 1ZU8A 2ITKA 1SR0A 3O5KA 2DSVA 3IK8A 2DG4A 3ARQA 3O5JA 2AWGA 4IT6A 1OWQA 4Z2IA 1QPLA 1QPFA 2M08A 3OA5A 1SYTA 1Q1CA 2DSWA 4WKFA 4DRKA 4PTMA 1KT1A 3UF8A 3WD4A 4WKAA 4WJXA 4LGXA 4MSPA 2O92A 1JNDA 4TW8A 1ZB5A 1FKFA 4P8XA 4DRPA 1ZBWA 3ARYA 2ZR5A 3CHDA 1HJWA 1M5YA 4R0XA 4QT2A 3G6LA 4ML4A 4WK9A 3O5GA 2PPNA 3I6CA 1E6RA 4MAVA 1N1AA 4ODLA 4NZCA 1GUVA 2RURA 3WIJA 4U85A 3KABA 2XPAA 2FKEA 3UI4A 2M2AA 3FXYA 4Q7NA 3WQVA 1W1YA 1FKJA 1WB0A 4DZ2A 4DT4A 1R9HA 5J6EA 1WAWA 3CH9A 3WH0A 3CHCA 2DT2A 2K8IA 3CZ8A 1UR9A 4W9OA 4ITZA 4MGVA 4Q22A 3RGCA 4JFIA 3IHZA 3KAIA 2LKNA 4ZS6A 3LUOA 5HW8A 1W9UA 4C02B 2LGOA 1ZBVA 1PBKA 4JFKA 4NNRA 3ALFA 3O5FA 2XP7A 2G41A 1EDQA 3AS2A 3PA7A 1LG2A 2O9OA 4JFJA 4ODPA 1L1PA 1NH6A 4TX0A 4MTVA 5DIUA 3W4RA 1LJYA 3JYJA 2PV3A 2DT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IK8 A;  1FKI A;  2DG4 A;  3O5J A;  2AWG A;  2PPO A;  3UQI A;  2DG9 A;  5HKG A;  5HWB A;  1FKD A;  2MLX A;  2N87 A;  1F40 A;  1BL4 A;  4G50 A;  1QPL A;  2XP8 A;  4DRO A;  1QPF A;  2M08 A;  4TW7 A;  3UQB A;  1W26 A;  1QZ2 A;  4LAY A;  4FAP A;  1Q1C A;  4DRK A;  5HT1 A;  2KR7 A;  4BF8 A;  1ROT A;  1KT1 A;  3TCZ A;  3UF8 A;  4JFM A;  3KAH A;  4DRM A;  2PV1 A;  1FKK A;  4ODO A;  2KGJ A;  4DZ3 A;  4U84 A;  3JYM A;  1YAT A;  2RUD A;  1J4H A;  3B7X A;  1ZK6 A;  5B8I C;  1FKH A;  1NMV A;  3O5O A;  3O5R A;  4MSP A;  1NMW A;  2Q5A A;  2XP9 A;  3KAG A;  1D7H A;  4TW8 A;  4ODN A;  3PRB A;  2F21 A;  3O5Q A;  2DG3 A;  3O5I A;  3O5L A;  4GIV A;  1JNS A;  4W9Q A;  3KZ7 A;  4LAX A;  1FKF A;  1FKG A;  4DRI A;  1FKB A;  1YW5 A;  4TYO A;  3JXV A;  1Q6I A;  1FKT A;  2ZQT A;  3NRK A;  4DRP A;  1JVW A;  2RUQ A;  4ODQ A;  3CGN A;  4GGQ A;  2ZR5 A;  1KT0 A;  1B6C A;  1M5Y A;  2LJ4 A;  2MPH A;  4QT2 A;  4R0X A;  5HTG A;  1J6Y A;  2XP5 A;  1D7J A;  5BXJ A;  3O5D A;  2FAP A;  4IPX A;  4ODK A;  4J4O A;  3GPK A;  4LAW A;  3UQA A;  2XPB A;  1TCO C;  3O5G A;  2PPN A;  3I6C A;  3UI6 A;  1A7X A;  2KO7 A;  3RFW A;  1FKS A;  1N1A A;  2KE0 A;  4G2P A;  4ODL A;  4N19 A;  4DIP A;  2M1I A;  2L2S A;  2RUR A;  4LAV A;  4DRQ A;  3KAC A;  4DRJ A;  4TNS A;  2ZR6 A;  1EQ3 A;  1EYM A;  1ZCN A;  3KAD A;  1FAP A;  2PPP A;  4DRN A;  4DRH A;  4ODR A;  4U85 A;  2F2D A;  3TDB A;  2OFN A;  2XPA A;  2PV2 A;  2FKE A;  2MNT A;  3KAB A;  1FJD A;  3UI4 A;  2F4E A;  4J4N A;  4O2T A;  2M2A A;  2VN1 A;  1C9H A;  1T11 A;  3MDY B;  4QIB A;  3O5E A;  1J4I A;  1HXV A;  1Q6H A;  1FKR A;  5HW7 A;  2KFW A;  2ZQS A;  1FKJ A;  1PIN A;  3PRD A;  3TC5 A;  2RQS A;  4DH0 A;  1FD9 A;  1R9H A;  4QT3 A;  4DT4 A;  4DZ2 A;  3WH0 A;  1NSG A;  2IF4 A;  5J6E A;  5I98 A;  2K8I A;  4IQC A;  2ZR4 A;  2MLY A;  3CGM A;  2ZQU A;  4W9O A;  2XP6 A;  4ITZ A;  2RUC A;  5D75 A;  3IKD A;  4MGV A;  3RGC A;  1F8A B;  4JFI A;  5HW6 A;  2RSE A;  3IHZ A;  3KAI A;  4JFL A;  2MLZ A;  2XP4 A;  3UI5 A;  2LKN A;  3H9R B;  4TW6 A;  3OOB A;  2LPV A;  3LUO A;  2KI3 A;  3NI6 A;  2PBC A;  3KCE A;  2ZQV A;  5HW8 A;  1ROU A;  1FKL A;  5DIT A;  4C02 B;  2XP3 A;  1U79 A;  2LGO A;  2Y78 A;  3O5P A;  3FAP A;  1PBK A;  4FN2 A;  4JFK A;  4IQ2 A;  4NNR A;  3O5F A;  4ODM A;  2XP7 A;  1J4R A;  1D6O A;  1BKF A;  2VCD A;  3IKG A;  4JYS A;  3EY6 A;  3O5M A;  3NTP A;  5HUA A;  3VAW A;  1Y0O A;  3ODK A;  3PA7 A;  1D7I A;  1JNT A;  1P5Q A;  3KAF A;  5GPG A;  2JZV A;  4JFJ A;  4ODP A;  2UZ5 A;  1L1P A;  2MF9 A;  1Q6U A;  5DIV A;  4TX0 A;  4W9P A;  5HWC A;  2D9F A;  4U86 A;  2ITK A;  5DIU A;  3O5K A;  3JYJ A;  2PV3 A; 
#chains in the Genus database with same CATH topology
 3RME A;  3UQI A;  2PPO A;  5HWB A;  1FKD A;  4DRO A;  1UR8 A;  2XP8 A;  3CHE A;  1W26 A;  4LAY A;  3G6M A;  5HT1 A;  3AS0 A;  3CHF A;  3KAH A;  2ETN A;  4DRM A;  1FKK A;  4ODO A;  1YAT A;  3RM9 A;  1ZK6 A;  1VF8 A;  1HKK A;  1NMW A;  1TFV A;  3PR9 A;  1D7H A;  3O5Q A;  3O5L A;  4W9Q A;  1W1P A;  3RM4 A;  2A3E A;  1FKB A;  3FY1 A;  4TYO A;  1Q6I A;  1FKT A;  2ZQT A;  1JVW A;  4ODQ A;  1KT0 A;  4S3K A;  3O5D A;  2FAP A;  4P8V A;  3ARW A;  3WQW A;  3ARP A;  1TCO C;  2KO7 A;  3PRA A;  2KE0 A;  3RM8 A;  1LL7 A;  2B31 A;  3AS3 A;  4N19 A;  4DIP A;  3WD2 A;  3KAC A;  4TNS A;  2ZR6 A;  2PI6 A;  2PPP A;  3ARS A;  4DRH A;  2F23 A;  3B8S A;  2MNT A;  1C9H A;  1T11 A;  4L3N A;  2G8Z A;  3BMB A;  5HW7 A;  1NSG A;  4Z2H A;  2MLY A;  4P8U A;  1HKJ A;  1LL4 A;  5HW6 A;  2RSE A;  4HBO A;  4JFL A;  2XP4 A;  3ARR A;  4XAK A;  3H9R B;  3NI6 A;  2ESC A;  2YBU A;  4DWS A;  2DPE A;  2Y78 A;  4FN2 A;  2QF8 A;  4L72 B;  1LQ0 A;  4MPK A;  1RD6 A;  3IKG A;  2DSU A;  3O5M A;  5HUA A;  1D7I A;  1P5Q A;  5JH8 A;  5DIV A;  3B9E A;  3ARV A;  3WL1 A;  4U86 A;  5HBF A;  2WLY A;  1WNO A;  1FKI A;  2DG9 A;  1ITX A;  3ARO A;  1JCH B;  2N87 A;  1F40 A;  2A3A A;  1BL4 A;  1NWT A;  4Z2L A;  5DF0 A;  1QZ2 A;  4FAP A;  1FFQ A;  3AS1 A;  4BF8 A;  4JFM A;  2PV1 A;  4DZ3 A;  1XHG A;  3JYM A;  4DWS C;  3O5O A;  3O5R A;  2XP9 A;  3KAG A;  4ODN A;  2DG3 A;  1JNS A;  4R5E A;  4KR0 B;  2DT0 A;  3EIP A;  1X6N A;  4LAX A;  1EIB A;  3QOK A;  4MNK A;  3JXV A;  3NRK A;  1W1T A;  2RUQ A;  3ART A;  3CGN A;  4GGQ A;  1B6C A;  1HKM A;  2LJ4 A;  2MPH A;  3B9D A;  4ODK A;  2WLZ A;  4MNJ A;  3UQA A;  2XPB A;  4UDM A;  1A7X A;  2FDM A;  3RFW A;  4Z2J A;  2P4V A;  4G2P A;  2L2S A;  4LAV A;  1GOI A;  4DRJ A;  1EYM A;  1ZCN A;  1E6N A;  1FAP A;  4ODR A;  2F2D A;  3WD1 A;  2PV2 A;  3WD3 A;  1FJD A;  2VN1 A;  1E44 A;  3MDY B;  4QZV B;  3O5E A;  1NWU A;  2KFW A;  3PRD A;  4HAR A;  4P8W A;  3TC5 A;  1ZBC A;  1FD9 A;  1ZL1 A;  1GPF A;  2IF4 A;  5DO2 A;  2ZR4 A;  3CGM A;  2XP6 A;  3WKZ A;  2RUC A;  3IKD A;  1X6L A;  1E6P A;  4DWS D;  5GPR A;  2OLH A;  4Z2K A;  3OOB A;  2PBC A;  2ZQV A;  1W9V A;  1ROU A;  1HJX A;  1IX5 A;  1FKL A;  1FFR A;  2XP3 A;  1U79 A;  1E9L A;  3WL0 A;  4ODM A;  1J4R A;  1D6O A;  1BKF A;  4JYS A;  1EHN A;  3EY6 A;  3NTP A;  2IUZ A;  1Y0O A;  4HBE A;  4ZPV R;  4Z2G A;  2UZ5 A;  1Q6U A;  1ZBK A;  2DT1 A;  1O6I A;  5HKG A;  1HJV A;  2MLX A;  4AY1 A;  4G50 A;  4TW7 A;  3UQB A;  1NWS A;  3ARZ A;  2KR7 A;  3GU0 A;  1ROT A;  3TCZ A;  2A3C A;  2PN0 A;  2KGJ A;  1E6Z A;  1W9P A;  4U84 A;  2WK2 A;  2RUD A;  1J4H A;  3B7X A;  5B8I C;  1FKH A;  1NMV A;  2Q5A A;  1D2K A;  3GTY X;  2F21 A;  3PRB A;  3O5I A;  4GIV A;  3KZ7 A;  3B9A A;  1FKG A;  1H0I A;  1YW5 A;  4DRI A;  1XRV A;  4S3J A;  1LL6 A;  2DSZ A;  3ALG A;  1J6Y A;  5HTG A;  4W5U A;  2XP5 A;  1D7J A;  2AOS A;  4MNL A;  5BXJ A;  1LG1 A;  3AQU A;  4IPX A;  4J4O A;  1OGB A;  3GPK A;  4LAW A;  4DWS B;  3UI6 A;  1FKS A;  2M1I A;  4KQZ A;  4DRQ A;  1EQ3 A;  3KAD A;  2WM0 A;  3ARX A;  3BXW A;  3ARU A;  4DRN A;  3TDB A;  2OFN A;  5GQB A;  1K9T A;  1KFW A;  2F4E A;  4J4N A;  2YBT A;  4O2T A;  4ZPT R;  4QIB A;  1J4I A;  1HXV A;  1Q6H A;  1FKR A;  2ZQS A;  1NWR A;  1PIN A;  3WD0 A;  2RQS A;  4DH0 A;  4QT3 A;  5I98 A;  4IQC A;  2ZQU A;  2A3B A;  5DEZ A;  5D75 A;  4IT4 A;  1F8A B;  1JNE A;  2MLZ A;  3UI5 A;  1E15 A;  4TW6 A;  4WKH A;  4ZPW R;  2LPV A;  1OGG A;  2KI3 A;  3KCE A;  1W1V A;  5DIT A;  3O5P A;  3FAP A;  4IQ2 A;  1CTN A;  4NSB A;  1HKI A;  4URI A;  1H0G A;  2VCD A;  4WIW A;  3VAW A;  3ODK A;  1JNT A;  4MNM A;  3KAF A;  5GPG A;  2JZV A;  2MF9 A;  5HWC A;  4W9P A;  2D9F A;  1ZU8 A;  2ITK A;  1SR0 A;  3O5K A;  2DSV A;  2B5U B;  3IK8 A;  2DG4 A;  3ARQ A;  3O5J A;  2AWG A;  4IT6 A;  1OWQ A;  4Z2I A;  1QPL A;  1QPF A;  2M08 A;  3OA5 A;  1SYT A;  1Q1C A;  2DSW A;  4WKF A;  4DRK A;  4PTM A;  1KT1 A;  3UF8 A;  3WD4 A;  4WKA A;  4WJX A;  4LGX A;  4MSP A;  2O92 A;  1JND A;  4TW8 A;  1ZB5 A;  1FKF A;  4P8X A;  4DRP A;  1ZBW A;  3ARY A;  2ZR5 A;  3CHD A;  1HJW A;  1M5Y A;  4R0X A;  4QT2 A;  3G6L A;  4ML4 A;  4WK9 A;  3O5G A;  2PPN A;  3I6C A;  1E6R A;  4MAV A;  1N1A A;  4ODL A;  4NZC A;  1GUV A;  2RUR A;  3WIJ A;  4U85 A;  3KAB A;  2XPA A;  2FKE A;  3UI4 A;  1GRJ A;  2M2A A;  3FXY A;  4Q7N A;  3WQV A;  1W1Y A;  1FKJ A;  1WB0 A;  4DZ2 A;  4DT4 A;  1R9H A;  5J6E A;  1WAW A;  3CH9 A;  3WH0 A;  3CHC A;  2DT2 A;  2K8I A;  3CZ8 A;  1UR9 A;  4W9O A;  4ITZ A;  4MGV A;  4Q22 A;  3RGC A;  4JFI A;  3IHZ A;  3KAI A;  2PV3 A;  2LKN A;  4ZS6 A;  3LUO A;  5HW8 A;  1W9U A;  4C02 B;  2LGO A;  1ZBV A;  1PBK A;  4JFK A;  4NNR A;  3ALF A;  3O5F A;  2XP7 A;  2G41 A;  1EDQ A;  3AS2 A;  3PA7 A;  1LG2 A;  2O9O A;  4JFJ A;  4ODP A;  1L1P A;  1NH6 A;  4TX0 A;  4MTV A;  5DIU A;  3W4R A;  1LJY A;  3JYJ A;  2EUL A;  2DT3 A; 
#chains in the Genus database with same CATH homology
 3RME A;  3UQI A;  2PPO A;  5HWB A;  1FKD A;  4DRO A;  1UR8 A;  2XP8 A;  3CHE A;  1W26 A;  4LAY A;  3G6M A;  5HT1 A;  3AS0 A;  3CHF A;  3KAH A;  4DRM A;  1FKK A;  4ODO A;  1YAT A;  3RM9 A;  1ZK6 A;  1VF8 A;  1HKK A;  1NMW A;  1TFV A;  3PR9 A;  1D7H A;  3O5Q A;  3O5L A;  4W9Q A;  1W1P A;  3RM4 A;  2A3E A;  1FKB A;  3FY1 A;  4TYO A;  1Q6I A;  1FKT A;  2ZQT A;  1JVW A;  4ODQ A;  1KT0 A;  4S3K A;  3O5D A;  2FAP A;  4P8V A;  3ARW A;  3WQW A;  3ARP A;  1TCO C;  2KO7 A;  3PRA A;  2KE0 A;  3RM8 A;  1LL7 A;  2B31 A;  3AS3 A;  4N19 A;  4DIP A;  3WD2 A;  3KAC A;  4TNS A;  2ZR6 A;  2PI6 A;  2PPP A;  3ARS A;  4DRH A;  3B8S A;  2MNT A;  1C9H A;  1T11 A;  4L3N A;  2G8Z A;  5HW7 A;  1NSG A;  4Z2H A;  2MLY A;  4P8U A;  1HKJ A;  1LL4 A;  5HW6 A;  2RSE A;  4HBO A;  4JFL A;  2XP4 A;  3ARR A;  4XAK A;  3H9R B;  3NI6 A;  2ESC A;  2YBU A;  4DWS A;  2DPE A;  2Y78 A;  4FN2 A;  2QF8 A;  4L72 B;  1LQ0 A;  4MPK A;  1RD6 A;  3IKG A;  2DSU A;  3O5M A;  5HUA A;  1D7I A;  1P5Q A;  5JH8 A;  5DIV A;  3B9E A;  3ARV A;  3WL1 A;  4U86 A;  5HBF A;  2WLY A;  1WNO A;  1FKI A;  2DG9 A;  1ITX A;  3ARO A;  2N87 A;  1F40 A;  2A3A A;  1BL4 A;  1NWT A;  4Z2L A;  5DF0 A;  1QZ2 A;  4FAP A;  1FFQ A;  3AS1 A;  4BF8 A;  4JFM A;  2PV1 A;  4DZ3 A;  1XHG A;  3JYM A;  4DWS C;  3O5O A;  3O5R A;  2XP9 A;  3KAG A;  4ODN A;  2DG3 A;  1JNS A;  4R5E A;  4KR0 B;  2DT0 A;  1X6N A;  4LAX A;  1EIB A;  3QOK A;  4MNK A;  3JXV A;  3NRK A;  1W1T A;  2RUQ A;  3ART A;  3CGN A;  4GGQ A;  1B6C A;  1HKM A;  2LJ4 A;  2MPH A;  3B9D A;  4ODK A;  2WLZ A;  4MNJ A;  3UQA A;  2XPB A;  1A7X A;  2FDM A;  3RFW A;  4Z2J A;  4G2P A;  2L2S A;  4LAV A;  1GOI A;  4DRJ A;  1EYM A;  1ZCN A;  1E6N A;  1FAP A;  4ODR A;  2F2D A;  3WD1 A;  2PV2 A;  3WD3 A;  1FJD A;  2VN1 A;  3MDY B;  4QZV B;  3O5E A;  1NWU A;  2KFW A;  3PRD A;  4HAR A;  4P8W A;  3TC5 A;  1ZBC A;  1FD9 A;  1ZL1 A;  1GPF A;  2IF4 A;  5DO2 A;  2ZR4 A;  3CGM A;  2XP6 A;  3WKZ A;  2RUC A;  3IKD A;  1X6L A;  1E6P A;  4DWS D;  5GPR A;  2OLH A;  4Z2K A;  3OOB A;  2PBC A;  2ZQV A;  1W9V A;  1ROU A;  1HJX A;  1IX5 A;  1FKL A;  1FFR A;  2XP3 A;  1U79 A;  1E9L A;  3WL0 A;  4ODM A;  1J4R A;  1D6O A;  1BKF A;  4JYS A;  1EHN A;  3EY6 A;  3NTP A;  2IUZ A;  1Y0O A;  4HBE A;  4ZPV R;  4Z2G A;  2UZ5 A;  1Q6U A;  1ZBK A;  2DT1 A;  1O6I A;  5HKG A;  1HJV A;  2MLX A;  4AY1 A;  4G50 A;  4TW7 A;  3UQB A;  1NWS A;  3ARZ A;  2KR7 A;  1ROT A;  3TCZ A;  2A3C A;  2KGJ A;  1E6Z A;  1W9P A;  4U84 A;  2WK2 A;  2RUD A;  1J4H A;  3B7X A;  5B8I C;  1FKH A;  1NMV A;  2Q5A A;  1D2K A;  3PRB A;  2F21 A;  3O5I A;  4GIV A;  3KZ7 A;  3B9A A;  1FKG A;  1H0I A;  1YW5 A;  4DRI A;  1XRV A;  4S3J A;  1LL6 A;  2DSZ A;  3ALG A;  1J6Y A;  5HTG A;  4W5U A;  2XP5 A;  1D7J A;  2AOS A;  4MNL A;  5BXJ A;  1LG1 A;  3AQU A;  4IPX A;  4J4O A;  1OGB A;  3GPK A;  4LAW A;  4DWS B;  3UI6 A;  1FKS A;  2M1I A;  4KQZ A;  4DRQ A;  1EQ3 A;  3KAD A;  2WM0 A;  3ARX A;  3BXW A;  3ARU A;  4DRN A;  3TDB A;  2OFN A;  5GQB A;  1K9T A;  1KFW A;  2F4E A;  4J4N A;  2YBT A;  4O2T A;  4ZPT R;  4QIB A;  1J4I A;  1HXV A;  1Q6H A;  1FKR A;  2ZQS A;  1NWR A;  1PIN A;  3WD0 A;  2RQS A;  4DH0 A;  4QT3 A;  5I98 A;  4IQC A;  2ZQU A;  2A3B A;  5DEZ A;  5D75 A;  4IT4 A;  1F8A B;  1JNE A;  2MLZ A;  3UI5 A;  1E15 A;  4TW6 A;  4WKH A;  4ZPW R;  2LPV A;  1OGG A;  2KI3 A;  3KCE A;  1W1V A;  5DIT A;  3O5P A;  3FAP A;  4IQ2 A;  1CTN A;  4NSB A;  1HKI A;  4URI A;  1H0G A;  2VCD A;  4WIW A;  3VAW A;  3ODK A;  1JNT A;  4MNM A;  3KAF A;  5GPG A;  2JZV A;  2MF9 A;  5HWC A;  4W9P A;  2D9F A;  1ZU8 A;  2ITK A;  1SR0 A;  3O5K A;  2DSV A;  3IK8 A;  2DG4 A;  3ARQ A;  3O5J A;  2AWG A;  4IT6 A;  1OWQ A;  4Z2I A;  1QPL A;  1QPF A;  2M08 A;  3OA5 A;  1SYT A;  1Q1C A;  2DSW A;  4WKF A;  4DRK A;  4PTM A;  1KT1 A;  3UF8 A;  3WD4 A;  4WKA A;  4WJX A;  4LGX A;  4MSP A;  2O92 A;  1JND A;  4TW8 A;  1ZB5 A;  1FKF A;  4P8X A;  4DRP A;  1ZBW A;  3ARY A;  2ZR5 A;  3CHD A;  1HJW A;  1M5Y A;  4R0X A;  4QT2 A;  3G6L A;  4ML4 A;  4WK9 A;  3O5G A;  2PPN A;  3I6C A;  1E6R A;  4MAV A;  1N1A A;  4ODL A;  4NZC A;  1GUV A;  2RUR A;  3WIJ A;  4U85 A;  3KAB A;  2XPA A;  2FKE A;  3UI4 A;  2M2A A;  3FXY A;  4Q7N A;  3WQV A;  1W1Y A;  1FKJ A;  1WB0 A;  4DZ2 A;  4DT4 A;  1R9H A;  5J6E A;  1WAW A;  3CH9 A;  3WH0 A;  3CHC A;  2DT2 A;  2K8I A;  3CZ8 A;  1UR9 A;  4W9O A;  4ITZ A;  4MGV A;  4Q22 A;  3RGC A;  4JFI A;  3IHZ A;  3KAI A;  2LKN A;  4ZS6 A;  3LUO A;  5HW8 A;  1W9U A;  4C02 B;  2LGO A;  1ZBV A;  1PBK A;  4JFK A;  4NNR A;  3ALF A;  3O5F A;  2XP7 A;  2G41 A;  1EDQ A;  3AS2 A;  3PA7 A;  1LG2 A;  2O9O A;  4JFJ A;  4ODP A;  1L1P A;  1NH6 A;  4TX0 A;  4MTV A;  5DIU A;  3W4R A;  1LJY A;  3JYJ A;  2PV3 A;  2DT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...