2JZVA

Solution structure of s. aureus prsa-ppiase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
GPLGSDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the parvulin-type PPIase domain of Staphylococcus aureus PrsA - Implications for the catalytic mechanism of parvulins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords Foldase protein prsA
total genus 28
structure length 111
sequence length 111
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2jzvA00
1FKSA 1T11A 1FKTA 4W9QA 1W26A 1FKKA 1HXVA 2ZQTA 2F4EA 1ROTA 1EYMA 3IKDA 3O5OA 2RUDA 4TX0A 2PV3A 1QPFA 3KACA 3WH0A 1D6OA 2ZQVA 4LAWA 3OOBA 4JYSA 1FKRA 1F40A 4G2PA 1Q6IA 4DH0A 2XP9A 3O5EA 5HWBA 2PPNA 1P5QA 2VN1A 1U79A 3PA7A 4U85A 2LJ4A 3CGNA 4DRQA 4ITZA 2LGOA 3NI6A 2PPOA 3KAHA 3LUOA 4BF8A 4U84A 1NMWA 3O5MA 1BKFA 4LAXA 4FAPA 1FKHA 3UI4A 5HWCA 2UZ5A 1QZ2A 1ROUA 3O5IA 1J6YA 2MLXA 3PRBA 4ODPA 4N19A 4DRNA 2DG9A 5J6EA 2KI3A 3B7XA 1FKJA 4J4NA 1NMVA 3PRDA 4TW6A 4JFKA 1A7XA 3O5LA 4W9OA 1TCOC 3KAGA 3NTPA 1D7HA 3CGMA 4GIVA 1FKIA 1JVWA 2XPBA 1EQ3A 2DG3A 2RUQA 2LKNA 4LAVA 1FKFA 1PBKA 5BXJA 2RUCA 5DIVA 5I98A 4U86A 3TDBA 1FJDA 4TYOA 1J4IA 1YW5A 3O5PA 5D75A 1D7JA 2KO7A 3O5DA 2PV2A 2XP4A 1KT0A 3I6CA 2MLZA 2PBCA 4G50A 4J4OA 2XPAA 3ODKA 2ZR4A 1PINA 3O5FA 4DRMA 5B8IC 5HTGA 1FD9A 4DRJA 4O2TA 3KZ7A 3UI6A 1J4HA 2M2AA 2MPHA 4ODLA 1KT1A 2ZR5A 4JFJA 4TNSA 4TW8A 5HT1A 3VAWA 5HW8A 4TW7A 4IPXA 4JFLA 3KAIA 4NNRA 4FN2A 3JXVA 3TC5A 3RGCA 4DRPA 1C9HA 3O5RA 4QT2A 3RFWA 3MDYB 4R0XA 1BL4A 3IHZA 3KABA 4IQCA 5DITA 4MGVA 2MLYA 5DIUA 3UQBA 1L1PA 1M5YA 3FAPA 4LAYA 3IKGA 3NRKA 3H9RB 2DG4A 4DROA 4DRIA 1FKGA 1Q1CA 1D7IA 3JYJA 2ZQUA 2JZVA 2MF9A 2KE0A 2AWGA 2K8IA 3UI5A 5HKGA 2IF4A 2RURA 1FAPA 4JFIA 2KR7A 3TCZA 5HW6A 2VCDA 4ODKA 4QIBA 2KFWA 1JNSA 3UF8A 2FAPA 1NSGA 2FKEA 3O5GA 4DZ3A 4DZ2A 2XP3A 4C02B 3KADA 4DRHA 4DIPA 3O5JA 2XP8A 1JNTA 3GPKA 1Q6HA 2F21A 4ODNA 4ODOA 2XP5A 2F2DA 4DRKA 2D9FA 2ZR6A 1ZK6A 1FKLA 3UQIA 5GPGA 2ZQSA 3KAFA 1YATA 2Q5AA 2RSEA 4GGQA 4JFMA 4ODMA 1F8AB 2MNTA 2Y78A 5HUAA 2PV1A 3O5KA 1B6CA 4QT3A 2N87A 2XP7A 2M1IA 1J4RA 2ITKA 2LPVA 1FKBA 3O5QA 4W9PA 2M08A 2L2SA 2PPPA 1Q6UA 1FKDA 3EY6A 2RQSA 1N1AA 3KCEA 4MSPA 4IQ2A 3IK8A 4ODRA 4ODQA 1Y0OA 2OFNA 5HW7A 2XP6A 4DT4A 3UQAA 1R9HA 2KGJA 3JYMA 1QPLA 1ZCNA
chains in the Genus database with same CATH superfamily
3RM9A 3WD0A 2B5UB 5HBFA 2B31A 3IKDA 2WK2A 3KACA 3RMEA 2ZQVA 1JCHB 5GQBA 1FKRA 3RM4A 1E6RA 1Q6IA 3O5EA 2LJ4A 4KR0B 3NI6A 3AS2A 1BKFA 4FAPA 1QZ2A 3B9AA 3PRBA 1OGGA 5J6EA 1FKJA 4Q22A 4TW6A 4JFKA 3B8SA 1OGBA 1EQ3A 1ZBWA 2LKNA 1HJXA 4MPKA 1YW5A 1CTNA 1D7JA 2KO7A 3O5DA 3WD1A 2XP4A 4WK9A 1KT0A 4J4OA 2MLZA 1SYTA 1GPFA 3ODKA 4DRJA 1GOIA 1J4HA 1EHNA 2M2AA 2G8ZA 4IPXA 4JFLA 4DWSB 4FN2A 3JXVA 3TC5A 4DWSA 3AS0A 3IHZA 1L1PA 5DIUA 3FAPA 3NRKA 1D2KA 1Q1CA 3PRAA 3OA5A 2KE0A 2K8IA 3UI5A 2RURA 1NWUA 3AS3A 4Z2KA 1XHGA 3UF8A 1NSGA 1LQ0A 1E6ZA 4Z2HA 1LL4A 4DZ2A 4C02B 1Q6HA 2F2DA 3ARXA 1ZK6A 1FKLA 4MTVA 1FFRA 1ZU8A 1W1TA 3KAFA 1YATA 2RSEA 1F8AB 2Y78A 3O5KA 1B6CA 2XP7A 4HBOA 3O5QA 4W9PA 1ZL1A 2L2SA 4ZPTR 1Q6UA 2RQSA 4MSPA 4MNKA 2FDMA 3WL0A 2YBUA 2DT2A 3UQAA 1R9HA 1FKIA 1IX5A 1T11A 1RD6A 2DSZA 4W9QA 1FKKA 4QZVB 5GPRA 1EYMA 3CHEA 4TX0A 2PV3A 1QPFA 4WJXA 1W1PA 3WH0A 4Q7NA 3OOBA 4JYSA 4G2PA 2XP9A 1X6NA 1U79A 4DRQA 4ZPWR 4L3NA 4W5UA 1H0IA 4ITZA 2WM0A 4IT6A 2WLYA 4U84A 1OWQA 2DT3A 2O9OA 1NWTA 5HWCA 3CZ8A 1FFQA 1XRVA 2YBTA 2DG9A 2KI3A 3B7XA 3CHDA 1ITXA 3O5LA 3QOKA 2DT0A 4LAVA 1FKFA 5BXJA 4U86A 1ZB5A 4KQZA 1J4IA 1LG2A 1NWSA 5B8IC 3KZ7A 4PTMA 2OLHA 2PN0A 4TW8A 5HT1A 4JFJA 1VF8A 5HW8A 2PI6A 1UR8A 3WD2A 4NNRA 2ESCA 4UDMA 1JNEA 1C9HA 3CHFA 4QT2A 3MDYB 3KABA 4LGXA 4DRIA 1FKGA 1D7IA 1E44A 2ZQUA 4URIA 2ETNA 2IF4A 2KR7A 3CHCA 2VCDA 4QIBA 1JNSA 3O5GA 1HKKA 2XP3A 3FY1A 2XP8A 2F21A 4ODOA 2XP5A 4DRKA 2D9FA 5GPGA 1ZBCA 2MNTA 2DPEA 2M08A 2PPPA 4DWSC 4MNMA 4WKHA 3B9DA 3EY6A 4ODQA 4IQ2A 4ODRA 2XP6A 4ML4A 4DT4A 2PPNA 1QPLA 4MNJA 5DF0A 4P8UA 1FKTA 4WKFA 2ZQTA 1EIBA 1ROTA 2F4EA 3O5OA 2RUDA 1TFVA 3ARYA 2EULA 4LAWA 4HARA 1P5QA 2VN1A 3PA7A 4HBEA 2PPOA 3LUOA 4BF8A 3GU0A 4Z2IA 4ODPA 4N19A 3B9EA 1H0GA 1KFWA 4J4NA 3ALFA 3AROA 2DSVA 1W9PA 1E15A 1TCOC 3KAGA 3NTPA 1D7HA 3ARWA 3CGMA 4GIVA 4NSBA 1HJWA 2XPBA 1JVWA 3FXYA 2DG3A 1PBKA 5I98A 4ZPVR 1ZBKA 3WL1A 3O5PA 3G6LA 3ARVA 1NH6A 2ZR4A 3O5FA 1FD9A 2P4VA 1W1VA 3AQUA 3UI6A 2MPHA 5DEZA 4MNLA 2ZR5A 3VAWA 5JH8A 3ARUA 3ARRA 4DRPA 3EIPA 1WAWA 3RGCA 1W9UA 3UQBA 1NWRA 2DT1A 1W9VA 3ARZA 3BXWA 3IKGA 1W1YA 1JNDA 4XAKA 2G41A 1WNOA 1LL7A 4R5EA 5HKGA 1FAPA 4JFIA 3TCZA 5HW6A 4ODKA 2KFWA 4DZ3A 2FKEA 3KADA 3ARSA 1O6IA 4Z2GA 3O5JA 3AS1A 4WKAA 3GPKA 3ARPA 4ODNA 3ARQA 3UQIA 4WIWA 2WLZA 1LL6A 1E6NA 2IUZA 4GGQA 4ODMA 5HUAA 2PV1A 4QT3A 2N87A 3WKZA 2M1IA 1GRJA 2LPVA 1FKBA 2A3AA 4L72B 1GUVA 1FKDA 1N1AA 3KCEA 3W4RA 3IK8A 5HW7A 3PR9A 3CH9A 1ZCNA 1FKSA 1ZBVA 1W26A 1HXVA 3RM8A 4MAVA 4P8WA 1D6OA 1F40A 3G6MA 4DH0A 5HWBA 3WIJA 4U85A 3CGNA 2LGOA 3KAHA 1NMWA 3O5MA 1HKIA 4LAXA 1FKHA 2A3CA 3UI4A 2UZ5A 2A3BA 2F23A 3WQWA 1ROUA 3O5IA 1J6YA 2MLXA 4DRNA 4Z2LA 1NMVA 3PRDA 4NZCA 1A7XA 3ARTA 3BMBA 4W9OA 4ZS6A 2RUQA 2O92A 2DSUA 2RUCA 5DIVA 1FJDA 3TDBA 2AOSA 4IT4A 4TYOA 5D75A 2PV2A 3I6CA 4G50A 2PBCA 2QF8A 2XPAA 1PINA 4DRMA 4Z2JA 5HTGA 1E6PA 4O2TA 3ALGA 2DSWA 4S3KA 3WD3A 4ODLA 1KT1A 4TNSA 1E9LA 4TW7A 4P8VA 3KAIA 3WQVA 2A3EA 5DO2A 3RFWA 3O5RA 1X6LA 1HJVA 1HKMA 4R0XA 1BL4A 4IQCA 5DITA 1HKJA 4MGVA 2MLYA 1M5YA 4LAYA 4DROA 3H9RB 2DG4A 3JYJA 2JZVA 2MF9A 2AWGA 4P8XA 3WD4A 2FAPA 4DRHA 4DIPA 3GTYX 1JNTA 1WB0A 4S3JA 2ZR6A 2ZQSA 2Q5AA 4JFMA 1SR0A 1EDQA 1LG1A 1J4RA 2ITKA 4AY1A 1UR9A 1Y0OA 2OFNA 4DWSD 1LJYA 2KGJA 1K9TA 3JYMA
chains in the Genus database with same CATH topology
3RM9A 3WD0A 5HBFA 2B31A 3IKDA 2WK2A 3KACA 3RMEA 2ZQVA 5GQBA 1FKRA 3RM4A 1E6RA 1Q6IA 3O5EA 2LJ4A 4KR0B 3NI6A 3AS2A 1BKFA 4FAPA 1QZ2A 3B9AA 3PRBA 1OGGA 5J6EA 1FKJA 4Q22A 4TW6A 4JFKA 3B8SA 1OGBA 1EQ3A 1ZBWA 2LKNA 1HJXA 4MPKA 1YW5A 1CTNA 1D7JA 2KO7A 3O5DA 3WD1A 2XP4A 4WK9A 1KT0A 4J4OA 2MLZA 1SYTA 1GPFA 3ODKA 4DRJA 1GOIA 1J4HA 1EHNA 2M2AA 2G8ZA 4IPXA 4JFLA 4DWSB 4FN2A 3JXVA 3TC5A 4DWSA 3AS0A 3IHZA 1L1PA 5DIUA 3FAPA 3NRKA 1D2KA 1Q1CA 3PRAA 3OA5A 2KE0A 2K8IA 3UI5A 2RURA 1NWUA 3AS3A 4Z2KA 1XHGA 3UF8A 1NSGA 1LQ0A 1E6ZA 4Z2HA 1LL4A 4DZ2A 4C02B 1Q6HA 2F2DA 3ARXA 1ZK6A 1FKLA 4MTVA 1FFRA 1ZU8A 1W1TA 3KAFA 1YATA 2RSEA 1F8AB 2Y78A 3O5KA 1B6CA 2XP7A 4HBOA 3O5QA 4W9PA 1ZL1A 2L2SA 4ZPTR 1Q6UA 2RQSA 4MSPA 4MNKA 2FDMA 3WL0A 2YBUA 2DT2A 3UQAA 1R9HA 1FKIA 1IX5A 1T11A 1RD6A 2DSZA 4W9QA 1FKKA 4QZVB 5GPRA 1EYMA 3CHEA 4TX0A 2PV3A 1QPFA 4WJXA 1W1PA 3WH0A 4Q7NA 3OOBA 4JYSA 4G2PA 2XP9A 1X6NA 1U79A 4DRQA 4ZPWR 4L3NA 4W5UA 1H0IA 4ITZA 2WM0A 4IT6A 2WLYA 4U84A 1OWQA 2DT3A 2O9OA 1NWTA 5HWCA 3CZ8A 1FFQA 1XRVA 2YBTA 2DG9A 2KI3A 3B7XA 3CHDA 1ITXA 3O5LA 3QOKA 2DT0A 4LAVA 1FKFA 5BXJA 4U86A 4KQZA 1ZB5A 1J4IA 1LG2A 1NWSA 5B8IC 3KZ7A 4PTMA 2OLHA 4TW8A 5HT1A 4JFJA 1VF8A 5HW8A 2PI6A 1UR8A 3WD2A 4NNRA 2ESCA 1JNEA 1C9HA 3CHFA 4QT2A 3MDYB 3KABA 4LGXA 4DRIA 1FKGA 1D7IA 2ZQUA 4URIA 2IF4A 2KR7A 3CHCA 2VCDA 4QIBA 1JNSA 3O5GA 1HKKA 2XP3A 3FY1A 2XP8A 2F21A 4ODOA 2XP5A 4DRKA 2D9FA 5GPGA 1ZBCA 2MNTA 2DPEA 2M08A 2PPPA 4DWSC 4MNMA 4WKHA 3B9DA 3EY6A 4ODQA 4IQ2A 4ODRA 2XP6A 4ML4A 4DT4A 2PPNA 1QPLA 4MNJA 5DF0A 4P8UA 1FKTA 4WKFA 2ZQTA 1EIBA 1ROTA 2F4EA 3O5OA 2RUDA 1TFVA 3ARYA 4LAWA 4HARA 1P5QA 2VN1A 3PA7A 4HBEA 2PPOA 3LUOA 4BF8A 4Z2IA 4ODPA 4N19A 3B9EA 1H0GA 1KFWA 4J4NA 3ALFA 3AROA 2DSVA 1W9PA 1E15A 1TCOC 3KAGA 3NTPA 1D7HA 3ARWA 3CGMA 4GIVA 4NSBA 1HJWA 2XPBA 1JVWA 3FXYA 2DG3A 1PBKA 5I98A 4ZPVR 1ZBKA 3WL1A 3O5PA 3G6LA 3ARVA 1NH6A 2ZR4A 3O5FA 1FD9A 1W1VA 3AQUA 3UI6A 2MPHA 5DEZA 4MNLA 2ZR5A 3VAWA 5JH8A 3ARUA 3ARRA 4DRPA 3RGCA 1WAWA 1W9UA 3UQBA 1NWRA 2DT1A 1W9VA 3ARZA 3BXWA 3IKGA 1W1YA 1JNDA 4XAKA 2G41A 1WNOA 1LL7A 4R5EA 5HKGA 1FAPA 4JFIA 3TCZA 5HW6A 4ODKA 2KFWA 4DZ3A 2FKEA 3KADA 3ARSA 1O6IA 4Z2GA 3O5JA 3AS1A 4WKAA 3GPKA 3ARPA 4ODNA 3ARQA 3UQIA 4WIWA 2WLZA 1LL6A 1E6NA 2IUZA 4GGQA 4ODMA 5HUAA 2PV1A 4QT3A 2N87A 3WKZA 2M1IA 2LPVA 1FKBA 2A3AA 4L72B 1GUVA 1FKDA 1N1AA 3KCEA 3W4RA 3IK8A 5HW7A 3PR9A 3CH9A 1ZCNA 1FKSA 1ZBVA 1W26A 1HXVA 3RM8A 4MAVA 4P8WA 1D6OA 1F40A 3G6MA 4DH0A 5HWBA 3WIJA 4U85A 3CGNA 2LGOA 3KAHA 1NMWA 3O5MA 1HKIA 4LAXA 1FKHA 2A3CA 3UI4A 2UZ5A 2A3BA 3WQWA 1ROUA 3O5IA 1J6YA 2MLXA 4DRNA 4Z2LA 1NMVA 3PRDA 4NZCA 1A7XA 3ARTA 4W9OA 4ZS6A 2RUQA 2O92A 2DSUA 2RUCA 5DIVA 1FJDA 3TDBA 2AOSA 4IT4A 4TYOA 5D75A 2PV2A 3I6CA 4G50A 2PBCA 2QF8A 2XPAA 1PINA 4DRMA 4Z2JA 5HTGA 1E6PA 4O2TA 3ALGA 2DSWA 4S3KA 3WD3A 4ODLA 1KT1A 4TNSA 1E9LA 4TW7A 4P8VA 3KAIA 3WQVA 2A3EA 5DO2A 3RFWA 3O5RA 1X6LA 1HJVA 1HKMA 4R0XA 1BL4A 4IQCA 5DITA 1HKJA 4MGVA 2MLYA 1M5YA 4LAYA 4DROA 3H9RB 2DG4A 3JYJA 2JZVA 2MF9A 2AWGA 4P8XA 3WD4A 2FAPA 4DRHA 4DIPA 1JNTA 1WB0A 4S3JA 2ZR6A 2ZQSA 2Q5AA 4JFMA 1SR0A 1EDQA 1LG1A 1J4RA 2ITKA 4AY1A 1UR9A 1Y0OA 2OFNA 4DWSD 1LJYA 2KGJA 1K9TA 3JYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  1T11 A;  1FKT A;  4W9Q A;  1W26 A;  1FKK A;  1HXV A;  2ZQT A;  2F4E A;  1ROT A;  1EYM A;  3IKD A;  3O5O A;  2RUD A;  4TX0 A;  2PV3 A;  1QPF A;  3KAC A;  3WH0 A;  1D6O A;  2ZQV A;  4LAW A;  3OOB A;  4JYS A;  1FKR A;  1F40 A;  4G2P A;  1Q6I A;  4DH0 A;  2XP9 A;  3O5E A;  5HWB A;  2PPN A;  1P5Q A;  2VN1 A;  1U79 A;  3PA7 A;  4U85 A;  2LJ4 A;  3CGN A;  4DRQ A;  4ITZ A;  2LGO A;  3NI6 A;  2PPO A;  3KAH A;  3LUO A;  4BF8 A;  4U84 A;  1NMW A;  3O5M A;  1BKF A;  4LAX A;  4FAP A;  1FKH A;  3UI4 A;  5HWC A;  2UZ5 A;  1QZ2 A;  1ROU A;  3O5I A;  1J6Y A;  2MLX A;  3PRB A;  4ODP A;  4N19 A;  4DRN A;  2DG9 A;  5J6E A;  2KI3 A;  3B7X A;  1FKJ A;  4J4N A;  1NMV A;  3PRD A;  4TW6 A;  4JFK A;  1A7X A;  3O5L A;  4W9O A;  1TCO C;  3KAG A;  3NTP A;  1D7H A;  3CGM A;  4GIV A;  1FKI A;  1JVW A;  2XPB A;  1EQ3 A;  2DG3 A;  2RUQ A;  2LKN A;  4LAV A;  1FKF A;  1PBK A;  5BXJ A;  2RUC A;  5DIV A;  5I98 A;  4U86 A;  3TDB A;  1FJD A;  4TYO A;  1J4I A;  1YW5 A;  3O5P A;  5D75 A;  1D7J A;  2KO7 A;  3O5D A;  2PV2 A;  2XP4 A;  1KT0 A;  3I6C A;  2MLZ A;  2PBC A;  4G50 A;  4J4O A;  2XPA A;  3ODK A;  2ZR4 A;  1PIN A;  3O5F A;  4DRM A;  5B8I C;  5HTG A;  1FD9 A;  4DRJ A;  4O2T A;  3KZ7 A;  3UI6 A;  1J4H A;  2M2A A;  2MPH A;  4ODL A;  1KT1 A;  2ZR5 A;  4JFJ A;  4TNS A;  4TW8 A;  5HT1 A;  3VAW A;  5HW8 A;  4TW7 A;  4IPX A;  4JFL A;  3KAI A;  4NNR A;  4FN2 A;  3JXV A;  3TC5 A;  3RGC A;  4DRP A;  1C9H A;  3O5R A;  4QT2 A;  3RFW A;  3MDY B;  4R0X A;  1BL4 A;  3IHZ A;  3KAB A;  4IQC A;  5DIT A;  4MGV A;  2MLY A;  5DIU A;  3UQB A;  1L1P A;  1M5Y A;  3FAP A;  4LAY A;  3IKG A;  3NRK A;  3H9R B;  2DG4 A;  4DRO A;  4DRI A;  1FKG A;  1Q1C A;  1D7I A;  3JYJ A;  2ZQU A;  2JZV A;  2MF9 A;  2KE0 A;  2AWG A;  2K8I A;  3UI5 A;  5HKG A;  2IF4 A;  2RUR A;  1FAP A;  4JFI A;  2KR7 A;  3TCZ A;  5HW6 A;  2VCD A;  4ODK A;  4QIB A;  2KFW A;  1JNS A;  3UF8 A;  2FAP A;  1NSG A;  2FKE A;  3O5G A;  4DZ3 A;  4DZ2 A;  2XP3 A;  4C02 B;  3KAD A;  4DRH A;  4DIP A;  3O5J A;  2XP8 A;  1JNT A;  3GPK A;  1Q6H A;  2F21 A;  4ODN A;  4ODO A;  2XP5 A;  2F2D A;  4DRK A;  2D9F A;  2ZR6 A;  1ZK6 A;  1FKL A;  3UQI A;  5GPG A;  2ZQS A;  3KAF A;  1YAT A;  2Q5A A;  2RSE A;  4GGQ A;  4JFM A;  4ODM A;  1F8A B;  2MNT A;  2Y78 A;  5HUA A;  2PV1 A;  3O5K A;  1B6C A;  4QT3 A;  2N87 A;  2XP7 A;  2M1I A;  1J4R A;  2ITK A;  2LPV A;  1FKB A;  3O5Q A;  4W9P A;  2M08 A;  2L2S A;  2PPP A;  1Q6U A;  1FKD A;  3EY6 A;  2RQS A;  1N1A A;  3KCE A;  4MSP A;  4IQ2 A;  3IK8 A;  4ODR A;  4ODQ A;  1Y0O A;  2OFN A;  5HW7 A;  2XP6 A;  4DT4 A;  3UQA A;  1R9H A;  2KGJ A;  3JYM A;  1QPL A;  1ZCN A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  3WD0 A;  2B5U B;  5HBF A;  2B31 A;  3IKD A;  2WK2 A;  3KAC A;  3RME A;  2ZQV A;  1JCH B;  5GQB A;  1FKR A;  3RM4 A;  1E6R A;  1Q6I A;  3O5E A;  2LJ4 A;  4KR0 B;  3NI6 A;  3AS2 A;  1BKF A;  4FAP A;  1QZ2 A;  3B9A A;  3PRB A;  1OGG A;  5J6E A;  1FKJ A;  4Q22 A;  4TW6 A;  4JFK A;  3B8S A;  1OGB A;  1EQ3 A;  1ZBW A;  2LKN A;  1HJX A;  4MPK A;  1YW5 A;  1CTN A;  1D7J A;  2KO7 A;  3O5D A;  3WD1 A;  2XP4 A;  4WK9 A;  1KT0 A;  4J4O A;  2MLZ A;  1SYT A;  1GPF A;  3ODK A;  4DRJ A;  1GOI A;  1J4H A;  1EHN A;  2M2A A;  2G8Z A;  4IPX A;  4JFL A;  4DWS B;  4FN2 A;  3JXV A;  3TC5 A;  4DWS A;  3AS0 A;  3IHZ A;  1L1P A;  5DIU A;  3FAP A;  3NRK A;  1D2K A;  1Q1C A;  3PRA A;  3OA5 A;  2KE0 A;  2K8I A;  3UI5 A;  2RUR A;  1NWU A;  3AS3 A;  4Z2K A;  1XHG A;  3UF8 A;  1NSG A;  1LQ0 A;  1E6Z A;  4Z2H A;  1LL4 A;  4DZ2 A;  4C02 B;  1Q6H A;  2F2D A;  3ARX A;  1ZK6 A;  1FKL A;  4MTV A;  1FFR A;  1ZU8 A;  1W1T A;  3KAF A;  1YAT A;  2RSE A;  1F8A B;  2Y78 A;  3O5K A;  1B6C A;  2XP7 A;  4HBO A;  3O5Q A;  4W9P A;  1ZL1 A;  2L2S A;  4ZPT R;  1Q6U A;  2RQS A;  4MSP A;  4MNK A;  2FDM A;  3WL0 A;  2YBU A;  2DT2 A;  3UQA A;  1R9H A;  1FKI A;  1IX5 A;  1T11 A;  1RD6 A;  2DSZ A;  4W9Q A;  1FKK A;  4QZV B;  5GPR A;  1EYM A;  3CHE A;  4TX0 A;  2PV3 A;  1QPF A;  4WJX A;  1W1P A;  3WH0 A;  4Q7N A;  3OOB A;  4JYS A;  4G2P A;  2XP9 A;  1X6N A;  1U79 A;  4DRQ A;  4ZPW R;  4L3N A;  4W5U A;  1H0I A;  4ITZ A;  2WM0 A;  4IT6 A;  2WLY A;  4U84 A;  1OWQ A;  2DT3 A;  2O9O A;  1NWT A;  5HWC A;  3CZ8 A;  1FFQ A;  1XRV A;  2YBT A;  2DG9 A;  2KI3 A;  3B7X A;  3CHD A;  1ITX A;  3O5L A;  3QOK A;  2DT0 A;  4LAV A;  1FKF A;  5BXJ A;  4U86 A;  1ZB5 A;  4KQZ A;  1J4I A;  1LG2 A;  1NWS A;  5B8I C;  3KZ7 A;  4PTM A;  2OLH A;  2PN0 A;  4TW8 A;  5HT1 A;  4JFJ A;  1VF8 A;  5HW8 A;  2PI6 A;  1UR8 A;  3WD2 A;  4NNR A;  2ESC A;  4UDM A;  1JNE A;  1C9H A;  3CHF A;  4QT2 A;  3MDY B;  3KAB A;  4LGX A;  4DRI A;  1FKG A;  1D7I A;  1E44 A;  2ZQU A;  4URI A;  2ETN A;  2IF4 A;  2KR7 A;  3CHC A;  2VCD A;  4QIB A;  1JNS A;  3O5G A;  1HKK A;  2XP3 A;  3FY1 A;  2XP8 A;  2F21 A;  4ODO A;  2XP5 A;  4DRK A;  2D9F A;  5GPG A;  1ZBC A;  2MNT A;  2DPE A;  2M08 A;  2PPP A;  4DWS C;  4MNM A;  4WKH A;  3B9D A;  3EY6 A;  4ODQ A;  4IQ2 A;  4ODR A;  2XP6 A;  4ML4 A;  4DT4 A;  2PPN A;  1QPL A;  4MNJ A;  5DF0 A;  4P8U A;  1FKT A;  4WKF A;  2ZQT A;  1EIB A;  1ROT A;  2F4E A;  3O5O A;  2RUD A;  1TFV A;  3ARY A;  2EUL A;  4LAW A;  4HAR A;  1P5Q A;  2VN1 A;  3PA7 A;  4HBE A;  2PPO A;  3LUO A;  4BF8 A;  3GU0 A;  4Z2I A;  4ODP A;  4N19 A;  3B9E A;  1H0G A;  1KFW A;  4J4N A;  3ALF A;  3ARO A;  2DSV A;  1W9P A;  1E15 A;  1TCO C;  3KAG A;  3NTP A;  1D7H A;  3ARW A;  3CGM A;  4GIV A;  4NSB A;  1HJW A;  2XPB A;  1JVW A;  3FXY A;  2DG3 A;  1PBK A;  5I98 A;  4ZPV R;  1ZBK A;  3WL1 A;  3O5P A;  3G6L A;  3ARV A;  1NH6 A;  2ZR4 A;  3O5F A;  1FD9 A;  2P4V A;  1W1V A;  3AQU A;  3UI6 A;  2MPH A;  5DEZ A;  4MNL A;  2ZR5 A;  3VAW A;  5JH8 A;  3ARU A;  3ARR A;  4DRP A;  3EIP A;  1WAW A;  3RGC A;  1W9U A;  3UQB A;  1NWR A;  2DT1 A;  1W9V A;  3ARZ A;  3BXW A;  3IKG A;  1W1Y A;  1JND A;  4XAK A;  2G41 A;  1WNO A;  1LL7 A;  4R5E A;  5HKG A;  1FAP A;  4JFI A;  3TCZ A;  5HW6 A;  4ODK A;  2KFW A;  4DZ3 A;  2FKE A;  3KAD A;  3ARS A;  1O6I A;  4Z2G A;  3O5J A;  3AS1 A;  4WKA A;  3GPK A;  3ARP A;  4ODN A;  3ARQ A;  3UQI A;  4WIW A;  2WLZ A;  1LL6 A;  1E6N A;  2IUZ A;  4GGQ A;  4ODM A;  5HUA A;  2PV1 A;  4QT3 A;  2N87 A;  3WKZ A;  2M1I A;  1GRJ A;  2LPV A;  1FKB A;  2A3A A;  4L72 B;  1GUV A;  1FKD A;  1N1A A;  3KCE A;  3W4R A;  3IK8 A;  5HW7 A;  3PR9 A;  3CH9 A;  1ZCN A;  1FKS A;  1ZBV A;  1W26 A;  1HXV A;  3RM8 A;  4MAV A;  4P8W A;  1D6O A;  1F40 A;  3G6M A;  4DH0 A;  5HWB A;  3WIJ A;  4U85 A;  3CGN A;  2LGO A;  3KAH A;  1NMW A;  3O5M A;  1HKI A;  4LAX A;  1FKH A;  2A3C A;  3UI4 A;  2UZ5 A;  2A3B A;  2F23 A;  3WQW A;  1ROU A;  3O5I A;  1J6Y A;  2MLX A;  4DRN A;  4Z2L A;  1NMV A;  3PRD A;  4NZC A;  1A7X A;  3ART A;  3BMB A;  4W9O A;  4ZS6 A;  2RUQ A;  2O92 A;  2DSU A;  2RUC A;  5DIV A;  1FJD A;  3TDB A;  2AOS A;  4IT4 A;  4TYO A;  5D75 A;  2PV2 A;  3I6C A;  4G50 A;  2PBC A;  2QF8 A;  2XPA A;  1PIN A;  4DRM A;  4Z2J A;  5HTG A;  1E6P A;  4O2T A;  3ALG A;  2DSW A;  4S3K A;  3WD3 A;  4ODL A;  1KT1 A;  4TNS A;  1E9L A;  4TW7 A;  4P8V A;  3KAI A;  3WQV A;  2A3E A;  5DO2 A;  3RFW A;  3O5R A;  1X6L A;  1HJV A;  1HKM A;  4R0X A;  1BL4 A;  4IQC A;  5DIT A;  1HKJ A;  4MGV A;  2MLY A;  1M5Y A;  4LAY A;  4DRO A;  3H9R B;  2DG4 A;  3JYJ A;  2JZV A;  2MF9 A;  2AWG A;  4P8X A;  3WD4 A;  2FAP A;  4DRH A;  4DIP A;  3GTY X;  1JNT A;  1WB0 A;  4S3J A;  2ZR6 A;  2ZQS A;  2Q5A A;  4JFM A;  1SR0 A;  1EDQ A;  1LG1 A;  1J4R A;  2ITK A;  4AY1 A;  1UR9 A;  1Y0O A;  2OFN A;  4DWS D;  1LJY A;  2KGJ A;  1K9T A;  3JYM A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  3WD0 A;  5HBF A;  2B31 A;  3IKD A;  2WK2 A;  3KAC A;  3RME A;  2ZQV A;  5GQB A;  1FKR A;  3RM4 A;  1E6R A;  1Q6I A;  3O5E A;  2LJ4 A;  4KR0 B;  3NI6 A;  3AS2 A;  1BKF A;  4FAP A;  1QZ2 A;  3B9A A;  3PRB A;  1OGG A;  5J6E A;  1FKJ A;  4Q22 A;  4TW6 A;  4JFK A;  3B8S A;  1OGB A;  1EQ3 A;  1ZBW A;  2LKN A;  1HJX A;  4MPK A;  1YW5 A;  1CTN A;  1D7J A;  2KO7 A;  3O5D A;  3WD1 A;  2XP4 A;  4WK9 A;  1KT0 A;  4J4O A;  2MLZ A;  1SYT A;  1GPF A;  3ODK A;  4DRJ A;  1GOI A;  1J4H A;  1EHN A;  2M2A A;  2G8Z A;  4IPX A;  4JFL A;  4DWS B;  4FN2 A;  3JXV A;  3TC5 A;  4DWS A;  3AS0 A;  3IHZ A;  1L1P A;  5DIU A;  3FAP A;  3NRK A;  1D2K A;  1Q1C A;  3PRA A;  3OA5 A;  2KE0 A;  2K8I A;  3UI5 A;  2RUR A;  1NWU A;  3AS3 A;  4Z2K A;  1XHG A;  3UF8 A;  1NSG A;  1LQ0 A;  1E6Z A;  4Z2H A;  1LL4 A;  4DZ2 A;  4C02 B;  1Q6H A;  2F2D A;  3ARX A;  1ZK6 A;  1FKL A;  4MTV A;  1FFR A;  1ZU8 A;  1W1T A;  3KAF A;  1YAT A;  2RSE A;  1F8A B;  2Y78 A;  3O5K A;  1B6C A;  2XP7 A;  4HBO A;  3O5Q A;  4W9P A;  1ZL1 A;  2L2S A;  4ZPT R;  1Q6U A;  2RQS A;  4MSP A;  4MNK A;  2FDM A;  3WL0 A;  2YBU A;  2DT2 A;  3UQA A;  1R9H A;  1FKI A;  1IX5 A;  1T11 A;  1RD6 A;  2DSZ A;  4W9Q A;  1FKK A;  4QZV B;  5GPR A;  1EYM A;  3CHE A;  4TX0 A;  2PV3 A;  1QPF A;  4WJX A;  1W1P A;  3WH0 A;  4Q7N A;  3OOB A;  4JYS A;  4G2P A;  2XP9 A;  1X6N A;  1U79 A;  4DRQ A;  4ZPW R;  4L3N A;  4W5U A;  1H0I A;  4ITZ A;  2WM0 A;  4IT6 A;  2WLY A;  4U84 A;  1OWQ A;  2DT3 A;  2O9O A;  1NWT A;  5HWC A;  3CZ8 A;  1FFQ A;  1XRV A;  2YBT A;  2DG9 A;  2KI3 A;  3B7X A;  3CHD A;  1ITX A;  3O5L A;  3QOK A;  2DT0 A;  4LAV A;  1FKF A;  5BXJ A;  4U86 A;  4KQZ A;  1ZB5 A;  1J4I A;  1LG2 A;  1NWS A;  5B8I C;  3KZ7 A;  4PTM A;  2OLH A;  4TW8 A;  5HT1 A;  4JFJ A;  1VF8 A;  5HW8 A;  2PI6 A;  1UR8 A;  3WD2 A;  4NNR A;  2ESC A;  1JNE A;  1C9H A;  3CHF A;  4QT2 A;  3MDY B;  3KAB A;  4LGX A;  4DRI A;  1FKG A;  1D7I A;  2ZQU A;  4URI A;  2IF4 A;  2KR7 A;  3CHC A;  2VCD A;  4QIB A;  1JNS A;  3O5G A;  1HKK A;  2XP3 A;  3FY1 A;  2XP8 A;  2F21 A;  4ODO A;  2XP5 A;  4DRK A;  2D9F A;  5GPG A;  1ZBC A;  2MNT A;  2DPE A;  2M08 A;  2PPP A;  4DWS C;  4MNM A;  4WKH A;  3B9D A;  3EY6 A;  4ODQ A;  4IQ2 A;  4ODR A;  2XP6 A;  4ML4 A;  4DT4 A;  2PPN A;  1QPL A;  4MNJ A;  5DF0 A;  4P8U A;  1FKT A;  4WKF A;  2ZQT A;  1EIB A;  1ROT A;  2F4E A;  3O5O A;  2RUD A;  1TFV A;  3ARY A;  4LAW A;  4HAR A;  1P5Q A;  2VN1 A;  3PA7 A;  4HBE A;  2PPO A;  3LUO A;  4BF8 A;  4Z2I A;  4ODP A;  4N19 A;  3B9E A;  1H0G A;  1KFW A;  4J4N A;  3ALF A;  3ARO A;  2DSV A;  1W9P A;  1E15 A;  1TCO C;  3KAG A;  3NTP A;  1D7H A;  3ARW A;  3CGM A;  4GIV A;  4NSB A;  1HJW A;  2XPB A;  1JVW A;  3FXY A;  2DG3 A;  1PBK A;  5I98 A;  4ZPV R;  1ZBK A;  3WL1 A;  3O5P A;  3G6L A;  3ARV A;  1NH6 A;  2ZR4 A;  3O5F A;  1FD9 A;  1W1V A;  3AQU A;  3UI6 A;  2MPH A;  5DEZ A;  4MNL A;  2ZR5 A;  3VAW A;  5JH8 A;  3ARU A;  3ARR A;  4DRP A;  3RGC A;  1WAW A;  1W9U A;  3UQB A;  1NWR A;  2DT1 A;  1W9V A;  3ARZ A;  3BXW A;  3IKG A;  1W1Y A;  1JND A;  4XAK A;  2G41 A;  1WNO A;  1LL7 A;  4R5E A;  5HKG A;  1FAP A;  4JFI A;  3TCZ A;  5HW6 A;  4ODK A;  2KFW A;  4DZ3 A;  2FKE A;  3KAD A;  3ARS A;  1O6I A;  4Z2G A;  3O5J A;  3AS1 A;  4WKA A;  3GPK A;  3ARP A;  4ODN A;  3ARQ A;  3UQI A;  4WIW A;  2WLZ A;  1LL6 A;  1E6N A;  2IUZ A;  4GGQ A;  4ODM A;  5HUA A;  2PV1 A;  4QT3 A;  2N87 A;  3WKZ A;  2M1I A;  2LPV A;  1FKB A;  2A3A A;  4L72 B;  1GUV A;  1FKD A;  1N1A A;  3KCE A;  3W4R A;  3IK8 A;  5HW7 A;  3PR9 A;  3CH9 A;  1ZCN A;  1FKS A;  1ZBV A;  1W26 A;  1HXV A;  3RM8 A;  4MAV A;  4P8W A;  1D6O A;  1F40 A;  3G6M A;  4DH0 A;  5HWB A;  3WIJ A;  4U85 A;  3CGN A;  2LGO A;  3KAH A;  1NMW A;  3O5M A;  1HKI A;  4LAX A;  1FKH A;  2A3C A;  3UI4 A;  2UZ5 A;  2A3B A;  3WQW A;  1ROU A;  3O5I A;  1J6Y A;  2MLX A;  4DRN A;  4Z2L A;  1NMV A;  3PRD A;  4NZC A;  1A7X A;  3ART A;  4W9O A;  4ZS6 A;  2RUQ A;  2O92 A;  2DSU A;  2RUC A;  5DIV A;  1FJD A;  3TDB A;  2AOS A;  4IT4 A;  4TYO A;  5D75 A;  2PV2 A;  3I6C A;  4G50 A;  2PBC A;  2QF8 A;  2XPA A;  1PIN A;  4DRM A;  4Z2J A;  5HTG A;  1E6P A;  4O2T A;  3ALG A;  2DSW A;  4S3K A;  3WD3 A;  4ODL A;  1KT1 A;  4TNS A;  1E9L A;  4TW7 A;  4P8V A;  3KAI A;  3WQV A;  2A3E A;  5DO2 A;  3RFW A;  3O5R A;  1X6L A;  1HJV A;  1HKM A;  4R0X A;  1BL4 A;  4IQC A;  5DIT A;  1HKJ A;  4MGV A;  2MLY A;  1M5Y A;  4LAY A;  4DRO A;  3H9R B;  2DG4 A;  3JYJ A;  2JZV A;  2MF9 A;  2AWG A;  4P8X A;  3WD4 A;  2FAP A;  4DRH A;  4DIP A;  1JNT A;  1WB0 A;  4S3J A;  2ZR6 A;  2ZQS A;  2Q5A A;  4JFM A;  1SR0 A;  1EDQ A;  1LG1 A;  1J4R A;  2ITK A;  4AY1 A;  1UR9 A;  1Y0O A;  2OFN A;  4DWS D;  1LJY A;  2KGJ A;  1K9T A;  3JYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...