2JZVA

Solution structure of s. aureus prsa-ppiase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
GPLGSDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Foldase protein prsA
publication title Solution structure of the parvulin-type PPIase domain of Staphylococcus aureus PrsA - Implications for the catalytic mechanism of parvulins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
total genus 28
structure length 111
sequence length 111
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2jzvA00
1Q6UA 4DRKA 3O5OA 3B7XA 2ZR5A 1FKKA 2ZR4A 1P5QA 3TDBA 5HTGA 4JFIA 4ODMA 1JNSA 1NMWA 1FKTA 1ZCNA 1FKJA 3RFWA 1BL4A 2M08A 4IPXA 1JNTA 4MSPA 3O5JA 1JVWA 1HXVA 1FKFA 4W9PA 2F2DA 2PPOA 3O5DA 4O2TA 1J4HA 5B8IC 4JFKA 4W9QA 4MGVA 3H9RB 1EQ3A 3O5RA 3PA7A 4FAPA 2IF4A 3UI5A 1J4RA 5GPGA 1ROUA 4BF8A 3ODKA 1FJDA 3KAGA 3O5EA 3O5QA 4QT2A 2Y78A 1QZ2A 3UQIA 4DIPA 2XP5A 2RUDA 4ODPA 5DIVA 2D9FA 2XP6A 4DRQA 4ODLA 2F21A 2PV1A 4N19A 3KCEA 1NSGA 2ZR6A 3GPKA 4IQCA 1U79A 5HW6A 1L1PA 1QPFA 2MPHA 2ITKA 4TNSA 4FN2A 2FAPA 2PV3A 2ZQUA 2PPPA 1M5YA 4DRJA 4IQ2A 4DRPA 4DRIA 1Q1CA 2F4EA 2XP4A 3O5IA 4DH0A 1Q6HA 2XP7A 1NMVA 3KZ7A 4U86A 1FAPA 2LKNA 1D7IA 1YATA 1ZK6A 3IHZA 3JYMA 3TCZA 2UZ5A 2RURA 5HUAA 2KO7A 2RQSA 2PV2A 1B6CA 2MNTA 3NRKA 5DITA 3MDYB 3VAWA 3WH0A 1FKBA 3FAPA 1EYMA 3KABA 3PRBA 4W9OA 2LGOA 2RUCA 4DZ3A 3O5PA 2PPNA 2RSEA 4G50A 2N87A 4TW8A 4C02B 4JFJA 5DIUA 2MLXA 2LPVA 2JZVA 1FKLA 4LAYA 3O5LA 4DT4A 1KT1A 4DRMA 1D6OA 2KFWA 1FD9A 5HW8A 1W26A 3JYJA 3UQAA 1BKFA 2FKEA 2KI3A 2VCDA 1TCOC 3NTPA 4ODKA 2XP3A 5BXJA 3CGMA 1A7XA 4DZ2A 2M1IA 5HWCA 1J6YA 2DG4A 2K8IA 2LJ4A 4ODOA 3KAFA 4ODNA 4QT3A 2MLYA 3TC5A 4NNRA 5HW7A 3IK8A 4G2PA 4ODQA 2MLZA 2KR7A 2ZQTA 4TX0A 2KE0A 4J4NA 1R9HA 1FKHA 1FKGA 1FKIA 1QPLA 4R0XA 4U84A 5D75A 3EY6A 2MF9A 1D7JA 4JYSA 4TYOA 1PBKA 2AWGA 4JFLA 1N1AA 4U85A 2XP8A 3UF8A 4GGQA 4DROA 2VN1A 3UQBA 2L2SA 3LUOA 2DG3A 3UI6A 2OFNA 4J4OA 3RGCA 4DRNA 5HWBA 1FKSA 1PINA 2XP9A 2PBCA 3I6CA 3KADA 3NI6A 5J6EA 4DRHA 1FKDA 2ZQVA 1F40A 1T11A 2RUQA 4LAXA 3UI4A 4ITZA 1Y0OA 3OOBA 3O5MA 3JXVA 4GIVA 1J4IA 3KAHA 4TW7A 4TW6A 1FKRA 2ZQSA 2Q5AA 3PRDA 1C9HA 5HT1A 1KT0A 2KGJA 4JFMA 4LAVA 3KACA 5HKGA 1ROTA 1D7HA 3O5GA 3IKDA 3O5FA 4QIBA 5I98A 2XPBA 3O5KA 1Q6IA 3CGNA 3KAIA 4ODRA 3IKGA 1F8AB 1YW5A 2M2AA 2XPAA 2DG9A 4LAWA
chains in the Genus database with same CATH superfamily
4MTVA 3B7XA 2ZR5A 1FKKA 3TDBA 1NMWA 1FKTA 4MNMA 3G6MA 3O5DA 2OLHA 5B8IC 3AS0A 3CHFA 1ZL1A 2PI6A 4FAPA 2DSZA 2IF4A 1GOIA 3PR9A 1FJDA 3O5QA 3ARWA 4ODPA 3KCEA 1NSGA 4IQCA 4UDMA 5HW6A 2MPHA 3AS1A 2PV3A 3GU0A 3G6LA 4DRPA 4ZPVR 1H0GA 2XP4A 4MNKA 3O5IA 1NMVA 4U86A 1KFWA 3IHZA 1ZK6A 2RURA 2KO7A 3BXWA 1LL7A 1EYMA 3B9EA 4C02B 3B9AA 3QOKA 4JFJA 2MLXA 3CHEA 4Z2JA 4DRMA 1W26A 3UQAA 3NTPA 3CH9A 1TCOC 4ODKA 1EHNA 3CGMA 4DZ2A 2K8IA 2LJ4A 1HKIA 4ODOA 4KR0B 2A3CA 4ODNA 2MLYA 3TC5A 4DT4A 5HW7A 2MLZA 2KR7A 1ZBVA 1EIBA 1FKIA 1NWRA 3EY6A 1ZU8A 4TYOA 2AWGA 3ARRA 3W4RA 4DROA 4S3JA 2L2SA 2DPEA 2OFNA 4P8VA 4DRNA 3OA5A 1JNEA 3NI6A 1FKDA 1CTNA 2ZQVA 3AS3A 3OOBA 4TW7A 3KAHA 4TW6A 2ZQSA 2Q5AA 5HT1A 2KGJA 5HKGA 1TFVA 4ZPWR 3IKDA 3AROA 4QIBA 2XPBA 1Q6IA 3ARPA 3CGNA 4ODRA 2DG9A 4LAWA 1Q6UA 4AY1A 1P5QA 4JFIA 1JNSA 3AQUA 1ZCNA 1FKJA 1HJWA 1SYTA 4KQZA 1BL4A 5HBFA 1H0IA 1HXVA 1J4HA 4JFKA 4W9QA 3PA7A 1J4RA 1W9VA 4BF8A 3O5EA 2YBUA 2ETNA 2F23A 1HKKA 2F21A 4ODLA 5GPRA 1SR0A 3WD4A 2ZR6A 4P8XA 1JNDA 3RM9A 1QPFA 4MPKA 4MNLA 4QZVB 4Z2KA 1HKMA 4DRJA 3ARSA 4S3KA 4DRIA 3WKZA 4DH0A 2XP7A 4L72B 1NWTA 1D7IA 4MNJA 3TCZA 3WIJA 3VAWA 2PV2A 2MNTA 3MDYB 1FKBA 3ARUA 2IUZA 4URIA 2O92A 4Q22A 1HJVA 4TW8A 3WD3A 5DIUA 1X6LA 3O5LA 1KT1A 2DT3A 2KFWA 4Z2HA 5HW8A 2KI3A 1WNOA 1E6ZA 1W1VA 2DG4A 2DSWA 2B5UB 1W9PA 2ZQTA 4TX0A 1E44A 1FKHA 1FKGA 1QPLA 4R0XA 4U84A 1D7JA 4JYSA 1PBKA 4DWSA 2O9OA 1LG2A 4Q7NA 3ARTA 3UI6A 5DO2A 1PINA 1E6NA 3CHCA 5J6EA 4DRHA 1T11A 4LAXA 3O5MA 1J4IA 1C9HA 4LAVA 3WQVA 2WM0A 5I98A 4WKHA 3IKGA 1YW5A 4WJXA 2XPAA 1OGBA 3O5OA 1LL6A 1LJYA 1XHGA 2ZR4A 5JH8A 3WD2A 4IPXA 1JNTA 3O5JA 1JVWA 4W9PA 2F2DA 2PPOA 4MGVA 1EQ3A 3O5RA 3UI5A 3ARYA 4DWSD 3ARVA 3ODKA 3KAGA 1IX5A 4QT2A 2Y78A 4HARA 1E9LA 1UR9A 2RUDA 3GTYX 5DIVA 2XP6A 2PN0A 3BMBA 4DRQA 2PV1A 1LQ0A 3GPKA 1U79A 3RM8A 4FN2A 2DT0A 1M5YA 1W1PA 4DWSC 4Z2GA 4Z2IA 1Q1CA 5DF0A 3KZ7A 1WAWA 2LKNA 4DWSB 3RM4A 4WIWA 2UZ5A 2RQSA 1B6CA 2WLYA 3WH0A 4HBEA 4WKFA 3WL0A 3O5PA 1VF8A 3AS2A 1NWUA 2JZVA 1FKLA 2YBTA 1FD9A 3JYJA 2FDMA 4LGXA 1BKFA 2FKEA 5BXJA 2XP3A 1J6YA 1A7XA 2M1IA 2B31A 4IT4A 4QT3A 5DEZA 2DT1A 4ODQA 1JCHB 2KE0A 5GQBA 1O6IA 2MF9A 3UQIA 4U85A 1N1AA 4W5UA 3EIPA 2VN1A 2WK2A 3LUOA 2DG3A 3PRAA 1E6RA 1ZBCA 1FKSA 2PBCA 1FFQA 2G41A 1Y0OA 3JXVA 4GIVA 3WL1A 1FKRA 3B8SA 3PRDA 1KT0A 4NSBA 3KACA 1D7HA 3O5GA 4ZS6A 2DSUA 3O5KA 1WB0A 1RD6A 2EULA 4DRKA 3CZ8A 1UR8A 5HTGA 4ODMA 3RFWA 1E15A 4MSPA 2M08A 1FKFA 4O2TA 3H9RB 1OGGA 4IT6A 5GPGA 1HJXA 1ROUA 1W9UA 4MAVA 1QZ2A 4DIPA 1E6PA 1XRVA 2XP5A 2ESCA 1OWQA 2D9FA 3WQWA 4N19A 2QF8A 1EDQA 1NWSA 1L1PA 2ITKA 4TNSA 2FAPA 2ZQUA 2PPPA 3FXYA 2G8ZA 4IQ2A 1LG1A 4XAKA 2F4EA 1Q6HA 2DT2A 1FAPA 3WD1A 1YATA 3B9DA 3JYMA 5HUAA 1K9TA 3NRKA 5DITA 1GUVA 3FAPA 4ML4A 3KABA 3CHDA 3PRBA 4W9OA 2LGOA 2RUCA 4DZ3A 4NZCA 2PPNA 2RSEA 4G50A 2N87A 3ALFA 1ZBWA 1X6NA 2LPVA 3ALGA 4WK9A 1NH6A 2WLZA 4LAYA 4Z2LA 1D6OA 2A3BA 4P8UA 4R5EA 2VCDA 3WD0A 4ZPTR 5HWCA 3KAFA 2P4VA 4NNRA 3IK8A 4G2PA 4J4NA 1R9HA 3FY1A 4P8WA 1FFRA 5D75A 4L3NA 1W1TA 4JFLA 3UF8A 2XP8A 4GGQA 1GRJA 3ARZA 1D2KA 4HBOA 1HKJA 3UQBA 4J4OA 4WKAA 3RGCA 5HWBA 2A3EA 2XP9A 3I6CA 4PTMA 3ARXA 3KADA 1GPFA 2DSVA 3ARQA 1F40A 2RUQA 3UI4A 1LL4A 2AOSA 4ITZA 2A3AA 1ZB5A 1W1YA 4JFMA 1ROTA 3O5FA 1ITXA 3RMEA 3KAIA 1ZBKA 1F8AB 2M2AA
chains in the Genus database with same CATH topology
4MTVA 3B7XA 2ZR5A 1FKKA 3TDBA 1NMWA 1FKTA 4MNMA 3G6MA 3O5DA 2OLHA 5B8IC 3AS0A 3CHFA 1ZL1A 2PI6A 4FAPA 2DSZA 2IF4A 1GOIA 3PR9A 1FJDA 3O5QA 3ARWA 4ODPA 3KCEA 1NSGA 4IQCA 5HW6A 2MPHA 3AS1A 2PV3A 3G6LA 4DRPA 4ZPVR 1H0GA 2XP4A 4MNKA 3O5IA 1NMVA 4U86A 1KFWA 3IHZA 1ZK6A 2RURA 2KO7A 3BXWA 1LL7A 1EYMA 3B9EA 4C02B 3B9AA 3QOKA 4JFJA 2MLXA 3CHEA 4Z2JA 4DRMA 1W26A 3UQAA 3NTPA 3CH9A 1TCOC 4ODKA 1EHNA 3CGMA 4DZ2A 2K8IA 2LJ4A 1HKIA 4ODOA 4KR0B 2A3CA 4ODNA 2MLYA 3TC5A 4DT4A 5HW7A 2MLZA 2KR7A 1ZBVA 1EIBA 1FKIA 1NWRA 3EY6A 1ZU8A 4TYOA 2AWGA 3ARRA 3W4RA 4DROA 4S3JA 2L2SA 2DPEA 2OFNA 4P8VA 4DRNA 3OA5A 1JNEA 3NI6A 1FKDA 1CTNA 2ZQVA 3AS3A 3OOBA 4TW7A 3KAHA 4TW6A 2ZQSA 2Q5AA 5HT1A 2KGJA 5HKGA 1TFVA 4ZPWR 3IKDA 3AROA 4QIBA 2XPBA 1Q6IA 3ARPA 3CGNA 4ODRA 2DG9A 4LAWA 1Q6UA 4AY1A 1P5QA 4JFIA 1JNSA 3AQUA 1ZCNA 1FKJA 1HJWA 1SYTA 4KQZA 1BL4A 5HBFA 1H0IA 1HXVA 1J4HA 4JFKA 4W9QA 3PA7A 1J4RA 1W9VA 4BF8A 3O5EA 2YBUA 1HKKA 2F21A 4ODLA 5GPRA 1SR0A 3WD4A 2ZR6A 4P8XA 1JNDA 3RM9A 1QPFA 4MPKA 4MNLA 4QZVB 4Z2KA 1HKMA 4DRJA 3ARSA 4S3KA 4DRIA 3WKZA 4DH0A 2XP7A 4L72B 1NWTA 1D7IA 4MNJA 3TCZA 3WIJA 3VAWA 2PV2A 2MNTA 3MDYB 1FKBA 3ARUA 2IUZA 4URIA 2O92A 4Q22A 1HJVA 4TW8A 3WD3A 5DIUA 1X6LA 3O5LA 1KT1A 2DT3A 2KFWA 4Z2HA 5HW8A 2KI3A 1WNOA 1E6ZA 1W1VA 2DG4A 2DSWA 1W9PA 2ZQTA 4TX0A 1FKHA 1FKGA 1QPLA 4R0XA 4U84A 1D7JA 4JYSA 1PBKA 4DWSA 2O9OA 1LG2A 4Q7NA 3ARTA 3UI6A 5DO2A 1PINA 1E6NA 3CHCA 5J6EA 4DRHA 1T11A 4LAXA 3O5MA 1J4IA 1C9HA 4LAVA 3WQVA 2WM0A 5I98A 4WKHA 3IKGA 1YW5A 4WJXA 2XPAA 1OGBA 3O5OA 1LL6A 1LJYA 1XHGA 2ZR4A 5JH8A 3WD2A 4IPXA 1JNTA 3O5JA 1JVWA 4W9PA 2F2DA 2PPOA 4MGVA 1EQ3A 3O5RA 3UI5A 3ARYA 4DWSD 3ARVA 3ODKA 3KAGA 1IX5A 4QT2A 2Y78A 4HARA 1E9LA 1UR9A 2RUDA 5DIVA 2XP6A 4DRQA 2PV1A 1LQ0A 3GPKA 1U79A 3RM8A 4FN2A 2DT0A 1M5YA 1W1PA 4DWSC 4Z2GA 4Z2IA 1Q1CA 5DF0A 3KZ7A 1WAWA 2LKNA 4DWSB 3RM4A 4WIWA 2UZ5A 2RQSA 1B6CA 2WLYA 3WH0A 4HBEA 4WKFA 3WL0A 3O5PA 1VF8A 3AS2A 1NWUA 2JZVA 1FKLA 2YBTA 1FD9A 3JYJA 2FDMA 4LGXA 1BKFA 2FKEA 5BXJA 2XP3A 1J6YA 1A7XA 2M1IA 2B31A 4IT4A 4QT3A 5DEZA 2DT1A 4ODQA 2KE0A 5GQBA 1O6IA 2MF9A 3UQIA 4U85A 1N1AA 4W5UA 2VN1A 2WK2A 3LUOA 2DG3A 3PRAA 1E6RA 1ZBCA 1FKSA 2PBCA 1FFQA 2G41A 1Y0OA 3JXVA 4GIVA 3WL1A 1FKRA 3B8SA 3PRDA 1KT0A 4NSBA 3KACA 1D7HA 3O5GA 4ZS6A 2DSUA 3O5KA 1WB0A 1RD6A 4DRKA 3CZ8A 1UR8A 5HTGA 4ODMA 3RFWA 1E15A 4MSPA 2M08A 1FKFA 4O2TA 3H9RB 1OGGA 4IT6A 5GPGA 1HJXA 1ROUA 1W9UA 4MAVA 1QZ2A 4DIPA 1E6PA 1XRVA 2XP5A 2ESCA 1OWQA 2D9FA 3WQWA 4N19A 2QF8A 1EDQA 1NWSA 1L1PA 2ITKA 4TNSA 2FAPA 2ZQUA 2PPPA 3FXYA 2G8ZA 4IQ2A 1LG1A 4XAKA 2F4EA 1Q6HA 2DT2A 1FAPA 3WD1A 1YATA 3B9DA 3JYMA 5HUAA 1K9TA 3NRKA 5DITA 1GUVA 3FAPA 4ML4A 3KABA 3CHDA 3PRBA 4W9OA 2LGOA 2RUCA 4DZ3A 4NZCA 2PPNA 2RSEA 4G50A 2N87A 3ALFA 1ZBWA 1X6NA 2LPVA 3ALGA 4WK9A 1NH6A 2WLZA 4LAYA 4Z2LA 1D6OA 2A3BA 4P8UA 4R5EA 2VCDA 3WD0A 4ZPTR 5HWCA 3KAFA 4NNRA 3IK8A 4G2PA 4J4NA 1R9HA 3FY1A 4P8WA 1FFRA 5D75A 4L3NA 1W1TA 4JFLA 3UF8A 2XP8A 4GGQA 3ARZA 1D2KA 4HBOA 1HKJA 3UQBA 4J4OA 4WKAA 3RGCA 5HWBA 2A3EA 2XP9A 3I6CA 4PTMA 3ARXA 3KADA 1GPFA 2DSVA 3ARQA 1F40A 2RUQA 3UI4A 1LL4A 2AOSA 4ITZA 2A3AA 1ZB5A 1W1YA 4JFMA 1ROTA 3O5FA 1ITXA 3RMEA 3KAIA 1ZBKA 1F8AB 2M2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q6U A;  4DRK A;  3O5O A;  3B7X A;  2ZR5 A;  1FKK A;  2ZR4 A;  1P5Q A;  3TDB A;  5HTG A;  4JFI A;  4ODM A;  1JNS A;  1NMW A;  1FKT A;  1ZCN A;  1FKJ A;  3RFW A;  1BL4 A;  2M08 A;  4IPX A;  1JNT A;  4MSP A;  3O5J A;  1JVW A;  1HXV A;  1FKF A;  4W9P A;  2F2D A;  2PPO A;  3O5D A;  4O2T A;  1J4H A;  5B8I C;  4JFK A;  4W9Q A;  4MGV A;  3H9R B;  1EQ3 A;  3O5R A;  3PA7 A;  4FAP A;  2IF4 A;  3UI5 A;  1J4R A;  5GPG A;  1ROU A;  4BF8 A;  3ODK A;  1FJD A;  3KAG A;  3O5E A;  3O5Q A;  4QT2 A;  2Y78 A;  1QZ2 A;  3UQI A;  4DIP A;  2XP5 A;  2RUD A;  4ODP A;  5DIV A;  2D9F A;  2XP6 A;  4DRQ A;  4ODL A;  2F21 A;  2PV1 A;  4N19 A;  3KCE A;  1NSG A;  2ZR6 A;  3GPK A;  4IQC A;  1U79 A;  5HW6 A;  1L1P A;  1QPF A;  2MPH A;  2ITK A;  4TNS A;  4FN2 A;  2FAP A;  2PV3 A;  2ZQU A;  2PPP A;  1M5Y A;  4DRJ A;  4IQ2 A;  4DRP A;  4DRI A;  1Q1C A;  2F4E A;  2XP4 A;  3O5I A;  4DH0 A;  1Q6H A;  2XP7 A;  1NMV A;  3KZ7 A;  4U86 A;  1FAP A;  2LKN A;  1D7I A;  1YAT A;  1ZK6 A;  3IHZ A;  3JYM A;  3TCZ A;  2UZ5 A;  2RUR A;  5HUA A;  2KO7 A;  2RQS A;  2PV2 A;  1B6C A;  2MNT A;  3NRK A;  5DIT A;  3MDY B;  3VAW A;  3WH0 A;  1FKB A;  3FAP A;  1EYM A;  3KAB A;  3PRB A;  4W9O A;  2LGO A;  2RUC A;  4DZ3 A;  3O5P A;  2PPN A;  2RSE A;  4G50 A;  2N87 A;  4TW8 A;  4C02 B;  4JFJ A;  5DIU A;  2MLX A;  2LPV A;  2JZV A;  1FKL A;  4LAY A;  3O5L A;  4DT4 A;  1KT1 A;  4DRM A;  1D6O A;  2KFW A;  1FD9 A;  5HW8 A;  1W26 A;  3JYJ A;  3UQA A;  1BKF A;  2FKE A;  2KI3 A;  2VCD A;  1TCO C;  3NTP A;  4ODK A;  2XP3 A;  5BXJ A;  3CGM A;  1A7X A;  4DZ2 A;  2M1I A;  5HWC A;  1J6Y A;  2DG4 A;  2K8I A;  2LJ4 A;  4ODO A;  3KAF A;  4ODN A;  4QT3 A;  2MLY A;  3TC5 A;  4NNR A;  5HW7 A;  3IK8 A;  4G2P A;  4ODQ A;  2MLZ A;  2KR7 A;  2ZQT A;  4TX0 A;  2KE0 A;  4J4N A;  1R9H A;  1FKH A;  1FKG A;  1FKI A;  1QPL A;  4R0X A;  4U84 A;  5D75 A;  3EY6 A;  2MF9 A;  1D7J A;  4JYS A;  4TYO A;  1PBK A;  2AWG A;  4JFL A;  1N1A A;  4U85 A;  2XP8 A;  3UF8 A;  4GGQ A;  4DRO A;  2VN1 A;  3UQB A;  2L2S A;  3LUO A;  2DG3 A;  3UI6 A;  2OFN A;  4J4O A;  3RGC A;  4DRN A;  5HWB A;  1FKS A;  1PIN A;  2XP9 A;  2PBC A;  3I6C A;  3KAD A;  3NI6 A;  5J6E A;  4DRH A;  1FKD A;  2ZQV A;  1F40 A;  1T11 A;  2RUQ A;  4LAX A;  3UI4 A;  4ITZ A;  1Y0O A;  3OOB A;  3O5M A;  3JXV A;  4GIV A;  1J4I A;  3KAH A;  4TW7 A;  4TW6 A;  1FKR A;  2ZQS A;  2Q5A A;  3PRD A;  1C9H A;  5HT1 A;  1KT0 A;  2KGJ A;  4JFM A;  4LAV A;  3KAC A;  5HKG A;  1ROT A;  1D7H A;  3O5G A;  3IKD A;  3O5F A;  4QIB A;  5I98 A;  2XPB A;  3O5K A;  1Q6I A;  3CGN A;  3KAI A;  4ODR A;  3IKG A;  1F8A B;  1YW5 A;  2M2A A;  2XPA A;  2DG9 A;  4LAW A; 
#chains in the Genus database with same CATH topology
 4MTV A;  3B7X A;  2ZR5 A;  1FKK A;  3TDB A;  1NMW A;  1FKT A;  4MNM A;  3G6M A;  3O5D A;  2OLH A;  5B8I C;  3AS0 A;  3CHF A;  1ZL1 A;  2PI6 A;  4FAP A;  2DSZ A;  2IF4 A;  1GOI A;  3PR9 A;  1FJD A;  3O5Q A;  3ARW A;  4ODP A;  3KCE A;  1NSG A;  4IQC A;  4UDM A;  5HW6 A;  2MPH A;  3AS1 A;  2PV3 A;  3GU0 A;  3G6L A;  4DRP A;  4ZPV R;  1H0G A;  2XP4 A;  4MNK A;  3O5I A;  1NMV A;  4U86 A;  1KFW A;  3IHZ A;  1ZK6 A;  2RUR A;  2KO7 A;  3BXW A;  1LL7 A;  1EYM A;  3B9E A;  4C02 B;  3B9A A;  3QOK A;  4JFJ A;  2MLX A;  3CHE A;  4Z2J A;  4DRM A;  1W26 A;  3UQA A;  3NTP A;  3CH9 A;  1TCO C;  4ODK A;  1EHN A;  3CGM A;  4DZ2 A;  2K8I A;  2LJ4 A;  1HKI A;  4ODO A;  4KR0 B;  2A3C A;  4ODN A;  2MLY A;  3TC5 A;  4DT4 A;  5HW7 A;  2MLZ A;  2KR7 A;  1ZBV A;  1EIB A;  1FKI A;  1NWR A;  3EY6 A;  1ZU8 A;  4TYO A;  2AWG A;  3ARR A;  3W4R A;  4DRO A;  4S3J A;  2L2S A;  2DPE A;  2OFN A;  4P8V A;  4DRN A;  3OA5 A;  1JNE A;  3NI6 A;  1FKD A;  1CTN A;  2ZQV A;  3AS3 A;  3OOB A;  4TW7 A;  3KAH A;  4TW6 A;  2ZQS A;  2Q5A A;  5HT1 A;  2KGJ A;  5HKG A;  1TFV A;  4ZPW R;  3IKD A;  3ARO A;  4QIB A;  2XPB A;  1Q6I A;  3ARP A;  3CGN A;  4ODR A;  2DG9 A;  4LAW A;  1Q6U A;  4AY1 A;  1P5Q A;  4JFI A;  1JNS A;  3AQU A;  1ZCN A;  1FKJ A;  1HJW A;  1SYT A;  4KQZ A;  1BL4 A;  5HBF A;  1H0I A;  1HXV A;  1J4H A;  4JFK A;  4W9Q A;  3PA7 A;  1J4R A;  1W9V A;  4BF8 A;  3O5E A;  2YBU A;  2ETN A;  2F23 A;  1HKK A;  2F21 A;  4ODL A;  5GPR A;  1SR0 A;  3WD4 A;  2ZR6 A;  4P8X A;  1JND A;  3RM9 A;  1QPF A;  4MPK A;  4MNL A;  4QZV B;  4Z2K A;  1HKM A;  4DRJ A;  3ARS A;  4S3K A;  4DRI A;  3WKZ A;  4DH0 A;  2XP7 A;  4L72 B;  1NWT A;  1D7I A;  4MNJ A;  3TCZ A;  3WIJ A;  3VAW A;  2PV2 A;  2MNT A;  3MDY B;  1FKB A;  3ARU A;  2IUZ A;  4URI A;  2O92 A;  4Q22 A;  1HJV A;  4TW8 A;  3WD3 A;  5DIU A;  1X6L A;  3O5L A;  1KT1 A;  2DT3 A;  2KFW A;  4Z2H A;  5HW8 A;  2KI3 A;  1WNO A;  1E6Z A;  1W1V A;  2DG4 A;  2DSW A;  2B5U B;  1W9P A;  2ZQT A;  4TX0 A;  1E44 A;  1FKH A;  1FKG A;  1QPL A;  4R0X A;  4U84 A;  1D7J A;  4JYS A;  1PBK A;  4DWS A;  2O9O A;  1LG2 A;  4Q7N A;  3ART A;  3UI6 A;  5DO2 A;  1PIN A;  1E6N A;  3CHC A;  5J6E A;  4DRH A;  1T11 A;  4LAX A;  3O5M A;  1J4I A;  1C9H A;  4LAV A;  3WQV A;  2WM0 A;  5I98 A;  4WKH A;  3IKG A;  1YW5 A;  4WJX A;  2XPA A;  1OGB A;  3O5O A;  1LL6 A;  1LJY A;  1XHG A;  2ZR4 A;  5JH8 A;  3WD2 A;  4IPX A;  1JNT A;  3O5J A;  1JVW A;  4W9P A;  2F2D A;  2PPO A;  4MGV A;  1EQ3 A;  3O5R A;  3UI5 A;  3ARY A;  4DWS D;  3ARV A;  3ODK A;  3KAG A;  1IX5 A;  4QT2 A;  2Y78 A;  4HAR A;  1E9L A;  1UR9 A;  2RUD A;  3GTY X;  5DIV A;  2XP6 A;  2PN0 A;  3BMB A;  4DRQ A;  2PV1 A;  1LQ0 A;  3GPK A;  1U79 A;  3RM8 A;  4FN2 A;  2DT0 A;  1M5Y A;  1W1P A;  4DWS C;  4Z2G A;  4Z2I A;  1Q1C A;  5DF0 A;  3KZ7 A;  1WAW A;  2LKN A;  4DWS B;  3RM4 A;  4WIW A;  2UZ5 A;  2RQS A;  1B6C A;  2WLY A;  3WH0 A;  4HBE A;  4WKF A;  3WL0 A;  3O5P A;  1VF8 A;  3AS2 A;  1NWU A;  2JZV A;  1FKL A;  2YBT A;  1FD9 A;  3JYJ A;  2FDM A;  4LGX A;  1BKF A;  2FKE A;  5BXJ A;  2XP3 A;  1J6Y A;  1A7X A;  2M1I A;  2B31 A;  4IT4 A;  4QT3 A;  5DEZ A;  2DT1 A;  4ODQ A;  1JCH B;  2KE0 A;  5GQB A;  1O6I A;  2MF9 A;  3UQI A;  4U85 A;  1N1A A;  4W5U A;  3EIP A;  2VN1 A;  2WK2 A;  3LUO A;  2DG3 A;  3PRA A;  1E6R A;  1ZBC A;  1FKS A;  2PBC A;  1FFQ A;  2G41 A;  1Y0O A;  3JXV A;  4GIV A;  3WL1 A;  1FKR A;  3B8S A;  3PRD A;  1KT0 A;  4NSB A;  3KAC A;  1D7H A;  3O5G A;  4ZS6 A;  2DSU A;  3O5K A;  1WB0 A;  1RD6 A;  2EUL A;  4DRK A;  3CZ8 A;  1UR8 A;  5HTG A;  4ODM A;  3RFW A;  1E15 A;  4MSP A;  2M08 A;  1FKF A;  4O2T A;  3H9R B;  1OGG A;  4IT6 A;  5GPG A;  1HJX A;  1ROU A;  1W9U A;  4MAV A;  1QZ2 A;  4DIP A;  1E6P A;  1XRV A;  2XP5 A;  2ESC A;  1OWQ A;  2D9F A;  3WQW A;  4N19 A;  2QF8 A;  1EDQ A;  1NWS A;  1L1P A;  2ITK A;  4TNS A;  2FAP A;  2ZQU A;  2PPP A;  3FXY A;  2G8Z A;  4IQ2 A;  1LG1 A;  4XAK A;  2F4E A;  1Q6H A;  2DT2 A;  1FAP A;  3WD1 A;  1YAT A;  3B9D A;  3JYM A;  5HUA A;  1K9T A;  3NRK A;  5DIT A;  1GUV A;  3FAP A;  4ML4 A;  3KAB A;  3CHD A;  3PRB A;  4W9O A;  2LGO A;  2RUC A;  4DZ3 A;  4NZC A;  2PPN A;  2RSE A;  4G50 A;  2N87 A;  3ALF A;  1ZBW A;  1X6N A;  2LPV A;  3ALG A;  4WK9 A;  1NH6 A;  2WLZ A;  4LAY A;  4Z2L A;  1D6O A;  2A3B A;  4P8U A;  4R5E A;  2VCD A;  3WD0 A;  4ZPT R;  5HWC A;  3KAF A;  2P4V A;  4NNR A;  3IK8 A;  4G2P A;  4J4N A;  1R9H A;  3FY1 A;  4P8W A;  1FFR A;  5D75 A;  4L3N A;  1W1T A;  4JFL A;  3UF8 A;  2XP8 A;  4GGQ A;  1GRJ A;  3ARZ A;  1D2K A;  4HBO A;  1HKJ A;  3UQB A;  4J4O A;  4WKA A;  3RGC A;  5HWB A;  2A3E A;  2XP9 A;  3I6C A;  4PTM A;  3ARX A;  3KAD A;  1GPF A;  2DSV A;  3ARQ A;  1F40 A;  2RUQ A;  3UI4 A;  1LL4 A;  2AOS A;  4ITZ A;  2A3A A;  1ZB5 A;  1W1Y A;  4JFM A;  1ROT A;  3O5F A;  1ITX A;  3RME A;  3KAI A;  1ZBK A;  1F8A B;  2M2A A; 
#chains in the Genus database with same CATH homology
 4MTV A;  3B7X A;  2ZR5 A;  1FKK A;  3TDB A;  1NMW A;  1FKT A;  4MNM A;  3G6M A;  3O5D A;  2OLH A;  5B8I C;  3AS0 A;  3CHF A;  1ZL1 A;  2PI6 A;  4FAP A;  2DSZ A;  2IF4 A;  1GOI A;  3PR9 A;  1FJD A;  3O5Q A;  3ARW A;  4ODP A;  3KCE A;  1NSG A;  4IQC A;  5HW6 A;  2MPH A;  3AS1 A;  2PV3 A;  3G6L A;  4DRP A;  4ZPV R;  1H0G A;  2XP4 A;  4MNK A;  3O5I A;  1NMV A;  4U86 A;  1KFW A;  3IHZ A;  1ZK6 A;  2RUR A;  2KO7 A;  3BXW A;  1LL7 A;  1EYM A;  3B9E A;  4C02 B;  3B9A A;  3QOK A;  4JFJ A;  2MLX A;  3CHE A;  4Z2J A;  4DRM A;  1W26 A;  3UQA A;  3NTP A;  3CH9 A;  1TCO C;  4ODK A;  1EHN A;  3CGM A;  4DZ2 A;  2K8I A;  2LJ4 A;  1HKI A;  4ODO A;  4KR0 B;  2A3C A;  4ODN A;  2MLY A;  3TC5 A;  4DT4 A;  5HW7 A;  2MLZ A;  2KR7 A;  1ZBV A;  1EIB A;  1FKI A;  1NWR A;  3EY6 A;  1ZU8 A;  4TYO A;  2AWG A;  3ARR A;  3W4R A;  4DRO A;  4S3J A;  2L2S A;  2DPE A;  2OFN A;  4P8V A;  4DRN A;  3OA5 A;  1JNE A;  3NI6 A;  1FKD A;  1CTN A;  2ZQV A;  3AS3 A;  3OOB A;  4TW7 A;  3KAH A;  4TW6 A;  2ZQS A;  2Q5A A;  5HT1 A;  2KGJ A;  5HKG A;  1TFV A;  4ZPW R;  3IKD A;  3ARO A;  4QIB A;  2XPB A;  1Q6I A;  3ARP A;  3CGN A;  4ODR A;  2DG9 A;  4LAW A;  1Q6U A;  4AY1 A;  1P5Q A;  4JFI A;  1JNS A;  3AQU A;  1ZCN A;  1FKJ A;  1HJW A;  1SYT A;  4KQZ A;  1BL4 A;  5HBF A;  1H0I A;  1HXV A;  1J4H A;  4JFK A;  4W9Q A;  3PA7 A;  1J4R A;  1W9V A;  4BF8 A;  3O5E A;  2YBU A;  1HKK A;  2F21 A;  4ODL A;  5GPR A;  1SR0 A;  3WD4 A;  2ZR6 A;  4P8X A;  1JND A;  3RM9 A;  1QPF A;  4MPK A;  4MNL A;  4QZV B;  4Z2K A;  1HKM A;  4DRJ A;  3ARS A;  4S3K A;  4DRI A;  3WKZ A;  4DH0 A;  2XP7 A;  4L72 B;  1NWT A;  1D7I A;  4MNJ A;  3TCZ A;  3WIJ A;  3VAW A;  2PV2 A;  2MNT A;  3MDY B;  1FKB A;  3ARU A;  2IUZ A;  4URI A;  2O92 A;  4Q22 A;  1HJV A;  4TW8 A;  3WD3 A;  5DIU A;  1X6L A;  3O5L A;  1KT1 A;  2DT3 A;  2KFW A;  4Z2H A;  5HW8 A;  2KI3 A;  1WNO A;  1E6Z A;  1W1V A;  2DG4 A;  2DSW A;  1W9P A;  2ZQT A;  4TX0 A;  1FKH A;  1FKG A;  1QPL A;  4R0X A;  4U84 A;  1D7J A;  4JYS A;  1PBK A;  4DWS A;  2O9O A;  1LG2 A;  4Q7N A;  3ART A;  3UI6 A;  5DO2 A;  1PIN A;  1E6N A;  3CHC A;  5J6E A;  4DRH A;  1T11 A;  4LAX A;  3O5M A;  1J4I A;  1C9H A;  4LAV A;  3WQV A;  2WM0 A;  5I98 A;  4WKH A;  3IKG A;  1YW5 A;  4WJX A;  2XPA A;  1OGB A;  3O5O A;  1LL6 A;  1LJY A;  1XHG A;  2ZR4 A;  5JH8 A;  3WD2 A;  4IPX A;  1JNT A;  3O5J A;  1JVW A;  4W9P A;  2F2D A;  2PPO A;  4MGV A;  1EQ3 A;  3O5R A;  3UI5 A;  3ARY A;  4DWS D;  3ARV A;  3ODK A;  3KAG A;  1IX5 A;  4QT2 A;  2Y78 A;  4HAR A;  1E9L A;  1UR9 A;  2RUD A;  5DIV A;  2XP6 A;  4DRQ A;  2PV1 A;  1LQ0 A;  3GPK A;  1U79 A;  3RM8 A;  4FN2 A;  2DT0 A;  1M5Y A;  1W1P A;  4DWS C;  4Z2G A;  4Z2I A;  1Q1C A;  5DF0 A;  3KZ7 A;  1WAW A;  2LKN A;  4DWS B;  3RM4 A;  4WIW A;  2UZ5 A;  2RQS A;  1B6C A;  2WLY A;  3WH0 A;  4HBE A;  4WKF A;  3WL0 A;  3O5P A;  1VF8 A;  3AS2 A;  1NWU A;  2JZV A;  1FKL A;  2YBT A;  1FD9 A;  3JYJ A;  2FDM A;  4LGX A;  1BKF A;  2FKE A;  5BXJ A;  2XP3 A;  1J6Y A;  1A7X A;  2M1I A;  2B31 A;  4IT4 A;  4QT3 A;  5DEZ A;  2DT1 A;  4ODQ A;  2KE0 A;  5GQB A;  1O6I A;  2MF9 A;  3UQI A;  4U85 A;  1N1A A;  4W5U A;  2VN1 A;  2WK2 A;  3LUO A;  2DG3 A;  3PRA A;  1E6R A;  1ZBC A;  1FKS A;  2PBC A;  1FFQ A;  2G41 A;  1Y0O A;  3JXV A;  4GIV A;  3WL1 A;  1FKR A;  3B8S A;  3PRD A;  1KT0 A;  4NSB A;  3KAC A;  1D7H A;  3O5G A;  4ZS6 A;  2DSU A;  3O5K A;  1WB0 A;  1RD6 A;  4DRK A;  3CZ8 A;  1UR8 A;  5HTG A;  4ODM A;  3RFW A;  1E15 A;  4MSP A;  2M08 A;  1FKF A;  4O2T A;  3H9R B;  1OGG A;  4IT6 A;  5GPG A;  1HJX A;  1ROU A;  1W9U A;  4MAV A;  1QZ2 A;  4DIP A;  1E6P A;  1XRV A;  2XP5 A;  2ESC A;  1OWQ A;  2D9F A;  3WQW A;  4N19 A;  2QF8 A;  1EDQ A;  1NWS A;  1L1P A;  2ITK A;  4TNS A;  2FAP A;  2ZQU A;  2PPP A;  3FXY A;  2G8Z A;  4IQ2 A;  1LG1 A;  4XAK A;  2F4E A;  1Q6H A;  2DT2 A;  1FAP A;  3WD1 A;  1YAT A;  3B9D A;  3JYM A;  5HUA A;  1K9T A;  3NRK A;  5DIT A;  1GUV A;  3FAP A;  4ML4 A;  3KAB A;  3CHD A;  3PRB A;  4W9O A;  2LGO A;  2RUC A;  4DZ3 A;  4NZC A;  2PPN A;  2RSE A;  4G50 A;  2N87 A;  3ALF A;  1ZBW A;  1X6N A;  2LPV A;  3ALG A;  4WK9 A;  1NH6 A;  2WLZ A;  4LAY A;  4Z2L A;  1D6O A;  2A3B A;  4P8U A;  4R5E A;  2VCD A;  3WD0 A;  4ZPT R;  5HWC A;  3KAF A;  4NNR A;  3IK8 A;  4G2P A;  4J4N A;  1R9H A;  3FY1 A;  4P8W A;  1FFR A;  5D75 A;  4L3N A;  1W1T A;  4JFL A;  3UF8 A;  2XP8 A;  4GGQ A;  3ARZ A;  1D2K A;  4HBO A;  1HKJ A;  3UQB A;  4J4O A;  4WKA A;  3RGC A;  5HWB A;  2A3E A;  2XP9 A;  3I6C A;  4PTM A;  3ARX A;  3KAD A;  1GPF A;  2DSV A;  3ARQ A;  1F40 A;  2RUQ A;  3UI4 A;  1LL4 A;  2AOS A;  4ITZ A;  2A3A A;  1ZB5 A;  1W1Y A;  4JFM A;  1ROT A;  3O5F A;  1ITX A;  3RME A;  3KAI A;  1ZBK A;  1F8A B;  2M2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...