2JZVA

Solution structure of s. aureus prsa-ppiase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
GPLGSDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the parvulin-type PPIase domain of Staphylococcus aureus PrsA - Implications for the catalytic mechanism of parvulins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
molecule keywords Foldase protein prsA
total genus 28
structure length 111
sequence length 111
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2jzvA00
2XPBA 4JFLA 1D7HA 4DH0A 4ODPA 4GGQA 1D6OA 1FKJA 4QIBA 5DIVA 2M2AA 1R9HA 1PINA 4TNSA 3UF8A 3UQAA 4TX0A 4ITZA 2XP7A 4MGVA 3O5QA 2PV1A 3ODKA 4LAYA 4G50A 3KAHA 1J4HA 2XP5A 2OFNA 2FAPA 2ITKA 3CGMA 3WH0A 4FAPA 3O5OA 2XP4A 1EQ3A 2M08A 2D9FA 3KZ7A 3O5JA 2AWGA 2ZQSA 3O5LA 3TDBA 1FJDA 1FKDA 2XP8A 4W9PA 2XPAA 1QPLA 3KABA 4DRNA 3IKDA 2MLXA 2PV3A 5HW6A 3O5IA 1Y0OA 4TYOA 1NSGA 5DITA 3B7XA 5HWBA 4ODMA 1Q6UA 2KGJA 1F8AB 4ODQA 2MLZA 2RUQA 1F40A 1KT0A 1FKFA 3O5FA 3UI5A 5HT1A 4DRHA 1QZ2A 3LUOA 2ZQVA 4O2TA 1ROTA 1C9HA 3TC5A 4LAWA 2JZVA 5BXJA 1P5QA 2LPVA 1JVWA 4TW7A 4DRIA 5HW8A 3H9RB 1U79A 2M1IA 4N19A 3UI4A 1L1PA 1Q6HA 3JYMA 4TW6A 2N87A 2F2DA 3O5MA 4IQCA 1YATA 1T11A 3JXVA 3O5EA 4ODLA 3NTPA 2MPHA 2PV2A 3O5PA 4GIVA 1NMWA 4R0XA 2PPPA 5HWCA 4IQ2A 2PPNA 2F21A 3O5DA 1KT1A 3FAPA 4U84A 4BF8A 3IHZA 1FKTA 4JFKA 1ROUA 2FKEA 4DRMA 2UZ5A 2Q5AA 3CGNA 4DRKA 4TW8A 3OOBA 1BL4A 1EYMA 4JFMA 1D7JA 5HTGA 4J4NA 2RUDA 4DROA 3KAIA 3UQIA 1FKGA 1J4IA 4DRPA 5I98A 2ZQTA 4ODNA 1J6YA 3TCZA 3MDYB 2ZR6A 4G2PA 4LAXA 2RURA 2RQSA 2LGOA 2K8IA 3NI6A 2KFWA 4MSPA 1FKSA 5DIUA 3IKGA 5B8IC 1HXVA 2KO7A 1M5YA 4LAVA 5GPGA 2ZQUA 5HW7A 1A7XA 4JFJA 5HKGA 4ODRA 2LJ4A 2MNTA 3RFWA 2IF4A 1J4RA 3KAGA 2XP9A 2PBCA 1FKKA 4W9QA 2MF9A 4IPXA 4DZ2A 3IK8A 3KCEA 5HUAA 3KADA 4DT4A 1YW5A 3PRBA 4FN2A 4ODKA 4J4OA 1D7IA 1TCOC 2ZR4A 2RUCA 1ZCNA 1JNSA 4C02B 1QPFA 3O5RA 1FKIA 4U86A 2F4EA 3UI6A 4DRQA 3I6CA 2MLYA 2VN1A 1FKRA 4ODOA 2DG4A 4JYSA 5J6EA 4QT3A 3UQBA 1Q1CA 2XP3A 3JYJA 1NMVA 1FKLA 1FKHA 3KAFA 2KI3A 3O5KA 3RGCA 1N1AA 1Q6IA 2LKNA 4U85A 2RSEA 2Y78A 2XP6A 1ZK6A 3O5GA 3VAWA 1B6CA 3PRDA 1FKBA 3EY6A 5D75A 4DIPA 4DZ3A 2DG9A 2VCDA 3KACA 1FAPA 3PA7A 2L2SA 1FD9A 1JNTA 3GPKA 4W9OA 3NRKA 1PBKA 2KE0A 2PPOA 2ZR5A 1BKFA 1W26A 2KR7A 4JFIA 4QT2A 4NNRA 4DRJA 2DG3A
chains in the Genus database with same CATH superfamily
1D7HA 4DH0A 2M2AA 1R9HA 3UQAA 4ITZA 4MGVA 3WD0A 2ETNA 3KAHA 1J4HA 2XP5A 3WH0A 1W1TA 3ARSA 4MTVA 2D9FA 3TDBA 1XHGA 2ZQSA 1W1PA 4Q7NA 3CH9A 4AY1A 3KABA 3CHDA 4DRNA 4W5UA 3BMBA 4UDMA 2EULA 1F8AB 2KGJA 4WIWA 1W9UA 1F40A 1XRVA 4ZPTR 1E6PA 4DRHA 1NWUA 3QOKA 1C9HA 2O9OA 5BXJA 4DRIA 2YBUA 1U79A 2DT0A 3H9RB 1L1PA 1Q6HA 1HJVA 2F2DA 1YATA 1OWQA 1T11A 4ODLA 1D2KA 2MPHA 2PPPA 3RM9A 3O5DA 1KT1A 3FAPA 3IHZA 2FKEA 4TW8A 3OOBA 5HTGA 1D7JA 1KFWA 2F23A 1ZBKA 4DRPA 2ESCA 2ZR6A 3OA5A 3NI6A 4Z2HA 2KFWA 1FKSA 1UR9A 1VF8A 1HXVA 4WKAA 3RFWA 2MNTA 2DT1A 2IF4A 4MNMA 4IPXA 5GQBA 2WK2A 4WK9A 2A3BA 2RUCA 1ZCNA 3B8SA 3O5RA 1W9VA 4LGXA 4Z2IA 1E44A 2VN1A 2A3CA 1FKRA 4ODOA 2DG4A 2PN0A 4JYSA 5GPRA 3UQBA 2P4VA 1Q1CA 1ZBCA 1FKLA 1RD6A 2XP6A 3O5GA 1JCHB 2WLZA 1NWTA 4DZ3A 3CHFA 1WAWA 4XAKA 4MNKA 1JNTA 4MPKA 3RMEA 1BKFA 4QT2A 4NNRA 4GGQA 3AQUA 2G41A 2XPBA 2B31A 3ARUA 4JFLA 1FKJA 4P8UA 5DIVA 4DWSA 2PI6A 2FDMA 2XP7A 1JNEA 2PV1A 3ODKA 4G50A 4FAPA 1ITXA 4NZCA 3G6LA 1H0GA 2DT2A 3ARWA 3WD3A 1FKDA 2XP8A 3EIPA 2PV3A 3WIJA 3O5IA 3ARQA 4P8XA 5DITA 5HWBA 1X6LA 2MLZA 2RUQA 1GOIA 4ZS6A 3WD2A 4PTMA 3LUOA 1HJWA 4O2TA 3ARZA 1ROTA 3TC5A 2JZVA 5HW8A 2G8ZA 2M1IA 4TW6A 3B9AA 4C02B 3UI6A 4DWSB 3WKZA 3O5EA 3NTPA 3O5PA 4GIVA 4R0XA 1NMWA 5HWCA 4U84A 1EIBA 4DRMA 1SR0A 2UZ5A 2Q5AA 3CGNA 4KR0B 1FFRA 3AS3A 1EYMA 4KQZA 4J4NA 2RUDA 4ODNA 2O92A 4G2PA 2RURA 2LGOA 4MSPA 3IKGA 1M5YA 3G6MA 5GPGA 5HW7A 4ODRA 3KAGA 4R5EA 2XP9A 1FKKA 4HBEA 3IK8A 3GTYX 3ALFA 3KADA 1NWRA 2ZR4A 4Z2GA 1JNSA 1QPFA 1FKIA 1E9LA 1W9PA 4L72B 4DRQA 4P8WA 2AOSA 2WM0A 1W1VA 3WL1A 1NMVA 1OGGA 1E15A 2KI3A 3O5KA 2LKNA 2Y78A 1GUVA 2DG9A 3KACA 1WNOA 1FAPA 1FD9A 1PBKA 2KE0A 4ML4A 1JNDA 2KR7A 1FFQA 3UF8A 1PINA 4TNSA 4TX0A 1LQ0A 3O5QA 3B9DA 2OFNA 2FAPA 3CGMA 1UR8A 3GU0A 4S3JA 3O5OA 2XP4A 1OGBA 2M08A 5DEZA 3KZ7A 3O5JA 4WKHA 1ZB5A 3AS1A 1QPLA 4Z2KA 1LL7A 3ARYA 4Z2LA 2MLXA 3ARTA 5HW6A 1LG2A 1O6IA 1Y0OA 2DSVA 4ODMA 1E6NA 1Q6UA 3WQVA 4ODQA 1ZBVA 1EHNA 1LG1A 4WKFA 5HT1A 3CHEA 2OLHA 3WD1A 2LPVA 4TW7A 4N19A 3UI4A 5HBFA 2N87A 3O5MA 1E6RA 2PV2A 1HKJA 2PPNA 4DRKA 1NH6A 2A3AA 1ROUA 3BXWA 4QZVB 3WQWA 1BL4A 2QF8A 4DROA 2IUZA 3KAIA 5I98A 1FKGA 1J4IA 4Z2JA 2ZQTA 1J6YA 3ARXA 3MDYB 5DF0A 2K8IA 5DIUA 2KO7A 4LAVA 2ZQUA 3CZ8A 2DPEA 4ZPVR 3WL0A 2LJ4A 1HKKA 1J4RA 1X6NA 2PBCA 1TFVA 3RM4A 3AS0A 2DSUA 3PRBA 4ODKA 4J4OA 1D7IA 1TCOC 4ZPWR 4L3NA 1ZU8A 2F4EA 4MAVA 5DO2A 1E6ZA 2MLYA 2DT3A 3ALGA 3B9EA 5JH8A 1N1AA 1ZBWA 4U85A 1B6CA 3PRDA 1FKBA 3EY6A 3ARPA 4HARA 5D75A 2VCDA 3WD4A 1W1YA 3GPKA 4W9OA 3NRKA 4DWSD 4JFIA 1WB0A 4DRJA 2DG3A 1NWSA 4ODPA 1D6OA 2A3EA 4QIBA 4WJXA 3FY1A 3AROA 3ARVA 4LAYA 3CHCA 4URIA 2ITKA 1EQ3A 3AS2A 2AWGA 3O5LA 1CTNA 4NSBA 2WLYA 4S3KA 1FJDA 4W9PA 2B5UB 2XPAA 1IX5A 3IKDA 4TYOA 1NSGA 3B7XA 3PRAA 1KT0A 1FKFA 3O5FA 3UI5A 1HJXA 1LL6A 1QZ2A 2ZQVA 4LAWA 1P5QA 1JVWA 2YBTA 3JYMA 4IQCA 3JXVA 4DWSC 1EDQA 1SYTA 4IQ2A 4MNJA 2F21A 4BF8A 1FKTA 4JFKA 4MNLA 4JFMA 3UQIA 4P8VA 3ARRA 3TCZA 1LJYA 1ZL1A 4LAXA 2RQSA 3W4RA 5B8IC 1A7XA 4JFJA 5HKGA 4HBOA 4W9QA 4IT4A 2MF9A 4DZ2A 1GRJA 3KCEA 5HUAA 4DT4A 1YW5A 4FN2A 3PR9A 1HKIA 2DSWA 4U86A 3I6CA 1HKMA 5J6EA 4IT6A 4QT3A 2XP3A 3JYJA 1GPFA 3FXYA 1FKHA 1H0IA 3KAFA 2DSZA 3RGCA 1Q6IA 1K9TA 2RSEA 3VAWA 1ZK6A 4DIPA 1LL4A 4Q22A 3PA7A 2L2SA 3RM8A 2PPOA 2ZR5A 1W26A
chains in the Genus database with same CATH topology
1D7HA 4DH0A 2M2AA 1R9HA 3UQAA 4ITZA 4MGVA 3WD0A 3KAHA 1J4HA 2XP5A 3WH0A 1W1TA 3ARSA 4MTVA 2D9FA 3TDBA 1XHGA 2ZQSA 1W1PA 4Q7NA 3CH9A 4AY1A 3KABA 3CHDA 4DRNA 4W5UA 1F8AB 2KGJA 4WIWA 1W9UA 1F40A 1XRVA 4ZPTR 1E6PA 4DRHA 1NWUA 3QOKA 1C9HA 2O9OA 5BXJA 4DRIA 2YBUA 1U79A 2DT0A 3H9RB 1L1PA 1Q6HA 1HJVA 2F2DA 1YATA 1OWQA 1T11A 4ODLA 1D2KA 2MPHA 2PPPA 3RM9A 3O5DA 1KT1A 3FAPA 3IHZA 2FKEA 4TW8A 3OOBA 5HTGA 1D7JA 1KFWA 1ZBKA 4DRPA 2ESCA 2ZR6A 3OA5A 3NI6A 4Z2HA 2KFWA 1FKSA 1UR9A 1VF8A 1HXVA 4WKAA 3RFWA 2MNTA 2DT1A 2IF4A 4MNMA 4IPXA 5GQBA 2WK2A 4WK9A 2A3BA 2RUCA 1ZCNA 3B8SA 3O5RA 1W9VA 4LGXA 4Z2IA 2VN1A 2A3CA 1FKRA 4ODOA 2DG4A 4JYSA 5GPRA 3UQBA 1Q1CA 1ZBCA 1FKLA 1RD6A 2XP6A 3O5GA 2WLZA 1NWTA 4DZ3A 3CHFA 1WAWA 4XAKA 4MNKA 1JNTA 4MPKA 3RMEA 1BKFA 4QT2A 4NNRA 4GGQA 3AQUA 2G41A 2XPBA 2B31A 3ARUA 4JFLA 1FKJA 4P8UA 5DIVA 4DWSA 2PI6A 2FDMA 2XP7A 1JNEA 2PV1A 3ODKA 4G50A 4FAPA 1ITXA 4NZCA 3G6LA 1H0GA 2DT2A 3ARWA 3WD3A 1FKDA 2XP8A 2PV3A 3WIJA 3O5IA 3ARQA 4P8XA 5DITA 5HWBA 1X6LA 2MLZA 2RUQA 1GOIA 4ZS6A 3WD2A 4PTMA 3LUOA 1HJWA 4O2TA 3ARZA 1ROTA 3TC5A 2JZVA 5HW8A 2G8ZA 2M1IA 4TW6A 3B9AA 4C02B 3UI6A 4DWSB 3WKZA 3O5EA 3NTPA 3O5PA 4GIVA 4R0XA 1NMWA 5HWCA 4U84A 1EIBA 4DRMA 1SR0A 2UZ5A 2Q5AA 3CGNA 4KR0B 1FFRA 3AS3A 1EYMA 4KQZA 4J4NA 2RUDA 4ODNA 2O92A 4G2PA 2RURA 2LGOA 4MSPA 3IKGA 1M5YA 3G6MA 5GPGA 5HW7A 4ODRA 3KAGA 4R5EA 2XP9A 1FKKA 4HBEA 3IK8A 3ALFA 3KADA 1NWRA 2ZR4A 4Z2GA 1JNSA 1QPFA 1FKIA 1E9LA 1W9PA 4L72B 4DRQA 4P8WA 2AOSA 2WM0A 1W1VA 3WL1A 1NMVA 1OGGA 1E15A 2KI3A 3O5KA 2LKNA 2Y78A 1GUVA 2DG9A 3KACA 1WNOA 1FAPA 1FD9A 1PBKA 2KE0A 4ML4A 1JNDA 2KR7A 1FFQA 3UF8A 1PINA 4TNSA 4TX0A 1LQ0A 3O5QA 3B9DA 2OFNA 2FAPA 3CGMA 1UR8A 4S3JA 3O5OA 2XP4A 1OGBA 2M08A 5DEZA 3KZ7A 3O5JA 4WKHA 1ZB5A 3AS1A 1QPLA 4Z2KA 1LL7A 3ARYA 4Z2LA 2MLXA 3ARTA 5HW6A 1LG2A 1O6IA 1Y0OA 2DSVA 4ODMA 1E6NA 1Q6UA 3WQVA 4ODQA 1ZBVA 1EHNA 1LG1A 4WKFA 5HT1A 3CHEA 2OLHA 3WD1A 2LPVA 4TW7A 4N19A 3UI4A 5HBFA 2N87A 3O5MA 1E6RA 2PV2A 1HKJA 2PPNA 4DRKA 1NH6A 2A3AA 1ROUA 3BXWA 4QZVB 3WQWA 1BL4A 2QF8A 4DROA 2IUZA 3KAIA 5I98A 1FKGA 1J4IA 4Z2JA 2ZQTA 1J6YA 3ARXA 3MDYB 5DF0A 2K8IA 5DIUA 2KO7A 4LAVA 2ZQUA 3CZ8A 2DPEA 4ZPVR 3WL0A 2LJ4A 1HKKA 1J4RA 1X6NA 2PBCA 1TFVA 3RM4A 3AS0A 2DSUA 3PRBA 4ODKA 4J4OA 1D7IA 1TCOC 4ZPWR 4L3NA 1ZU8A 2F4EA 4MAVA 5DO2A 1E6ZA 2MLYA 2DT3A 3ALGA 3B9EA 5JH8A 1N1AA 1ZBWA 4U85A 1B6CA 3PRDA 1FKBA 3EY6A 3ARPA 4HARA 5D75A 2VCDA 3WD4A 1W1YA 3GPKA 4W9OA 3NRKA 4DWSD 4JFIA 1WB0A 4DRJA 2DG3A 1NWSA 4ODPA 1D6OA 2A3EA 4QIBA 4WJXA 3FY1A 3AROA 3ARVA 4LAYA 3CHCA 4URIA 2ITKA 1EQ3A 3AS2A 2AWGA 3O5LA 1CTNA 4NSBA 2WLYA 4S3KA 1FJDA 4W9PA 2XPAA 1IX5A 3IKDA 4TYOA 1NSGA 3B7XA 3PRAA 1KT0A 1FKFA 3O5FA 3UI5A 1HJXA 1LL6A 1QZ2A 2ZQVA 4LAWA 1P5QA 1JVWA 2YBTA 3JYMA 4IQCA 3JXVA 4DWSC 1EDQA 1SYTA 4IQ2A 4MNJA 2F21A 4BF8A 1FKTA 4JFKA 4MNLA 4JFMA 3UQIA 4P8VA 3ARRA 3TCZA 1LJYA 1ZL1A 4LAXA 2RQSA 3W4RA 5B8IC 1A7XA 4JFJA 5HKGA 4HBOA 4W9QA 4IT4A 2MF9A 4DZ2A 3KCEA 5HUAA 4DT4A 1YW5A 4FN2A 3PR9A 1HKIA 2DSWA 4U86A 3I6CA 1HKMA 5J6EA 4IT6A 4QT3A 2XP3A 3JYJA 1GPFA 3FXYA 1FKHA 1H0IA 3KAFA 2DSZA 3RGCA 1Q6IA 1K9TA 2RSEA 3VAWA 1ZK6A 4DIPA 1LL4A 4Q22A 3PA7A 2L2SA 3RM8A 2PPOA 2ZR5A 1W26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPB A;  4JFL A;  1D7H A;  4DH0 A;  4ODP A;  4GGQ A;  1D6O A;  1FKJ A;  4QIB A;  5DIV A;  2M2A A;  1R9H A;  1PIN A;  4TNS A;  3UF8 A;  3UQA A;  4TX0 A;  4ITZ A;  2XP7 A;  4MGV A;  3O5Q A;  2PV1 A;  3ODK A;  4LAY A;  4G50 A;  3KAH A;  1J4H A;  2XP5 A;  2OFN A;  2FAP A;  2ITK A;  3CGM A;  3WH0 A;  4FAP A;  3O5O A;  2XP4 A;  1EQ3 A;  2M08 A;  2D9F A;  3KZ7 A;  3O5J A;  2AWG A;  2ZQS A;  3O5L A;  3TDB A;  1FJD A;  1FKD A;  2XP8 A;  4W9P A;  2XPA A;  1QPL A;  3KAB A;  4DRN A;  3IKD A;  2MLX A;  2PV3 A;  5HW6 A;  3O5I A;  1Y0O A;  4TYO A;  1NSG A;  5DIT A;  3B7X A;  5HWB A;  4ODM A;  1Q6U A;  2KGJ A;  1F8A B;  4ODQ A;  2MLZ A;  2RUQ A;  1F40 A;  1KT0 A;  1FKF A;  3O5F A;  3UI5 A;  5HT1 A;  4DRH A;  1QZ2 A;  3LUO A;  2ZQV A;  4O2T A;  1ROT A;  1C9H A;  3TC5 A;  4LAW A;  2JZV A;  5BXJ A;  1P5Q A;  2LPV A;  1JVW A;  4TW7 A;  4DRI A;  5HW8 A;  3H9R B;  1U79 A;  2M1I A;  4N19 A;  3UI4 A;  1L1P A;  1Q6H A;  3JYM A;  4TW6 A;  2N87 A;  2F2D A;  3O5M A;  4IQC A;  1YAT A;  1T11 A;  3JXV A;  3O5E A;  4ODL A;  3NTP A;  2MPH A;  2PV2 A;  3O5P A;  4GIV A;  1NMW A;  4R0X A;  2PPP A;  5HWC A;  4IQ2 A;  2PPN A;  2F21 A;  3O5D A;  1KT1 A;  3FAP A;  4U84 A;  4BF8 A;  3IHZ A;  1FKT A;  4JFK A;  1ROU A;  2FKE A;  4DRM A;  2UZ5 A;  2Q5A A;  3CGN A;  4DRK A;  4TW8 A;  3OOB A;  1BL4 A;  1EYM A;  4JFM A;  1D7J A;  5HTG A;  4J4N A;  2RUD A;  4DRO A;  3KAI A;  3UQI A;  1FKG A;  1J4I A;  4DRP A;  5I98 A;  2ZQT A;  4ODN A;  1J6Y A;  3TCZ A;  3MDY B;  2ZR6 A;  4G2P A;  4LAX A;  2RUR A;  2RQS A;  2LGO A;  2K8I A;  3NI6 A;  2KFW A;  4MSP A;  1FKS A;  5DIU A;  3IKG A;  5B8I C;  1HXV A;  2KO7 A;  1M5Y A;  4LAV A;  5GPG A;  2ZQU A;  5HW7 A;  1A7X A;  4JFJ A;  5HKG A;  4ODR A;  2LJ4 A;  2MNT A;  3RFW A;  2IF4 A;  1J4R A;  3KAG A;  2XP9 A;  2PBC A;  1FKK A;  4W9Q A;  2MF9 A;  4IPX A;  4DZ2 A;  3IK8 A;  3KCE A;  5HUA A;  3KAD A;  4DT4 A;  1YW5 A;  3PRB A;  4FN2 A;  4ODK A;  4J4O A;  1D7I A;  1TCO C;  2ZR4 A;  2RUC A;  1ZCN A;  1JNS A;  4C02 B;  1QPF A;  3O5R A;  1FKI A;  4U86 A;  2F4E A;  3UI6 A;  4DRQ A;  3I6C A;  2MLY A;  2VN1 A;  1FKR A;  4ODO A;  2DG4 A;  4JYS A;  5J6E A;  4QT3 A;  3UQB A;  1Q1C A;  2XP3 A;  3JYJ A;  1NMV A;  1FKL A;  1FKH A;  3KAF A;  2KI3 A;  3O5K A;  3RGC A;  1N1A A;  1Q6I A;  2LKN A;  4U85 A;  2RSE A;  2Y78 A;  2XP6 A;  1ZK6 A;  3O5G A;  3VAW A;  1B6C A;  3PRD A;  1FKB A;  3EY6 A;  5D75 A;  4DIP A;  4DZ3 A;  2DG9 A;  2VCD A;  3KAC A;  1FAP A;  3PA7 A;  2L2S A;  1FD9 A;  1JNT A;  3GPK A;  4W9O A;  3NRK A;  1PBK A;  2KE0 A;  2PPO A;  2ZR5 A;  1BKF A;  1W26 A;  2KR7 A;  4JFI A;  4QT2 A;  4NNR A;  4DRJ A;  2DG3 A; 
#chains in the Genus database with same CATH topology
 1D7H A;  4DH0 A;  2M2A A;  1R9H A;  3UQA A;  4ITZ A;  4MGV A;  3WD0 A;  2ETN A;  3KAH A;  1J4H A;  2XP5 A;  3WH0 A;  1W1T A;  3ARS A;  4MTV A;  2D9F A;  3TDB A;  1XHG A;  2ZQS A;  1W1P A;  4Q7N A;  3CH9 A;  4AY1 A;  3KAB A;  3CHD A;  4DRN A;  4W5U A;  3BMB A;  4UDM A;  2EUL A;  1F8A B;  2KGJ A;  4WIW A;  1W9U A;  1F40 A;  1XRV A;  4ZPT R;  1E6P A;  4DRH A;  1NWU A;  3QOK A;  1C9H A;  2O9O A;  5BXJ A;  4DRI A;  2YBU A;  1U79 A;  2DT0 A;  3H9R B;  1L1P A;  1Q6H A;  1HJV A;  2F2D A;  1YAT A;  1OWQ A;  1T11 A;  4ODL A;  1D2K A;  2MPH A;  2PPP A;  3RM9 A;  3O5D A;  1KT1 A;  3FAP A;  3IHZ A;  2FKE A;  4TW8 A;  3OOB A;  5HTG A;  1D7J A;  1KFW A;  2F23 A;  1ZBK A;  4DRP A;  2ESC A;  2ZR6 A;  3OA5 A;  3NI6 A;  4Z2H A;  2KFW A;  1FKS A;  1UR9 A;  1VF8 A;  1HXV A;  4WKA A;  3RFW A;  2MNT A;  2DT1 A;  2IF4 A;  4MNM A;  4IPX A;  5GQB A;  2WK2 A;  4WK9 A;  2A3B A;  2RUC A;  1ZCN A;  3B8S A;  3O5R A;  1W9V A;  4LGX A;  4Z2I A;  1E44 A;  2VN1 A;  2A3C A;  1FKR A;  4ODO A;  2DG4 A;  2PN0 A;  4JYS A;  5GPR A;  3UQB A;  2P4V A;  1Q1C A;  1ZBC A;  1FKL A;  1RD6 A;  2XP6 A;  3O5G A;  1JCH B;  2WLZ A;  1NWT A;  4DZ3 A;  3CHF A;  1WAW A;  4XAK A;  4MNK A;  1JNT A;  4MPK A;  3RME A;  1BKF A;  4QT2 A;  4NNR A;  4GGQ A;  3AQU A;  2G41 A;  2XPB A;  2B31 A;  3ARU A;  4JFL A;  1FKJ A;  4P8U A;  5DIV A;  4DWS A;  2PI6 A;  2FDM A;  2XP7 A;  1JNE A;  2PV1 A;  3ODK A;  4G50 A;  4FAP A;  1ITX A;  4NZC A;  3G6L A;  1H0G A;  2DT2 A;  3ARW A;  3WD3 A;  1FKD A;  2XP8 A;  3EIP A;  2PV3 A;  3WIJ A;  3O5I A;  3ARQ A;  4P8X A;  5DIT A;  5HWB A;  1X6L A;  2MLZ A;  2RUQ A;  1GOI A;  4ZS6 A;  3WD2 A;  4PTM A;  3LUO A;  1HJW A;  4O2T A;  3ARZ A;  1ROT A;  3TC5 A;  2JZV A;  5HW8 A;  2G8Z A;  2M1I A;  4TW6 A;  3B9A A;  4C02 B;  3UI6 A;  4DWS B;  3WKZ A;  3O5E A;  3NTP A;  3O5P A;  4GIV A;  4R0X A;  1NMW A;  5HWC A;  4U84 A;  1EIB A;  4DRM A;  1SR0 A;  2UZ5 A;  2Q5A A;  3CGN A;  4KR0 B;  1FFR A;  3AS3 A;  1EYM A;  4KQZ A;  4J4N A;  2RUD A;  4ODN A;  2O92 A;  4G2P A;  2RUR A;  2LGO A;  4MSP A;  3IKG A;  1M5Y A;  3G6M A;  5GPG A;  5HW7 A;  4ODR A;  3KAG A;  4R5E A;  2XP9 A;  1FKK A;  4HBE A;  3IK8 A;  3GTY X;  3ALF A;  3KAD A;  1NWR A;  2ZR4 A;  4Z2G A;  1JNS A;  1QPF A;  1FKI A;  1E9L A;  1W9P A;  4L72 B;  4DRQ A;  4P8W A;  2AOS A;  2WM0 A;  1W1V A;  3WL1 A;  1NMV A;  1OGG A;  1E15 A;  2KI3 A;  3O5K A;  2LKN A;  2Y78 A;  1GUV A;  2DG9 A;  3KAC A;  1WNO A;  1FAP A;  1FD9 A;  1PBK A;  2KE0 A;  4ML4 A;  1JND A;  2KR7 A;  1FFQ A;  3UF8 A;  1PIN A;  4TNS A;  4TX0 A;  1LQ0 A;  3O5Q A;  3B9D A;  2OFN A;  2FAP A;  3CGM A;  1UR8 A;  3GU0 A;  4S3J A;  3O5O A;  2XP4 A;  1OGB A;  2M08 A;  5DEZ A;  3KZ7 A;  3O5J A;  4WKH A;  1ZB5 A;  3AS1 A;  1QPL A;  4Z2K A;  1LL7 A;  3ARY A;  4Z2L A;  2MLX A;  3ART A;  5HW6 A;  1LG2 A;  1O6I A;  1Y0O A;  2DSV A;  4ODM A;  1E6N A;  1Q6U A;  3WQV A;  4ODQ A;  1ZBV A;  1EHN A;  1LG1 A;  4WKF A;  5HT1 A;  3CHE A;  2OLH A;  3WD1 A;  2LPV A;  4TW7 A;  4N19 A;  3UI4 A;  5HBF A;  2N87 A;  3O5M A;  1E6R A;  2PV2 A;  1HKJ A;  2PPN A;  4DRK A;  1NH6 A;  2A3A A;  1ROU A;  3BXW A;  4QZV B;  3WQW A;  1BL4 A;  2QF8 A;  4DRO A;  2IUZ A;  3KAI A;  5I98 A;  1FKG A;  1J4I A;  4Z2J A;  2ZQT A;  1J6Y A;  3ARX A;  3MDY B;  5DF0 A;  2K8I A;  5DIU A;  2KO7 A;  4LAV A;  2ZQU A;  3CZ8 A;  2DPE A;  4ZPV R;  3WL0 A;  2LJ4 A;  1HKK A;  1J4R A;  1X6N A;  2PBC A;  1TFV A;  3RM4 A;  3AS0 A;  2DSU A;  3PRB A;  4ODK A;  4J4O A;  1D7I A;  1TCO C;  4ZPW R;  4L3N A;  1ZU8 A;  2F4E A;  4MAV A;  5DO2 A;  1E6Z A;  2MLY A;  2DT3 A;  3ALG A;  3B9E A;  5JH8 A;  1N1A A;  1ZBW A;  4U85 A;  1B6C A;  3PRD A;  1FKB A;  3EY6 A;  3ARP A;  4HAR A;  5D75 A;  2VCD A;  3WD4 A;  1W1Y A;  3GPK A;  4W9O A;  3NRK A;  4DWS D;  4JFI A;  1WB0 A;  4DRJ A;  2DG3 A;  1NWS A;  4ODP A;  1D6O A;  2A3E A;  4QIB A;  4WJX A;  3FY1 A;  3ARO A;  3ARV A;  4LAY A;  3CHC A;  4URI A;  2ITK A;  1EQ3 A;  3AS2 A;  2AWG A;  3O5L A;  1CTN A;  4NSB A;  2WLY A;  4S3K A;  1FJD A;  4W9P A;  2B5U B;  2XPA A;  1IX5 A;  3IKD A;  4TYO A;  1NSG A;  3B7X A;  3PRA A;  1KT0 A;  1FKF A;  3O5F A;  3UI5 A;  1HJX A;  1LL6 A;  1QZ2 A;  2ZQV A;  4LAW A;  1P5Q A;  1JVW A;  2YBT A;  3JYM A;  4IQC A;  3JXV A;  4DWS C;  1EDQ A;  1SYT A;  4IQ2 A;  4MNJ A;  2F21 A;  4BF8 A;  1FKT A;  4JFK A;  4MNL A;  4JFM A;  3UQI A;  4P8V A;  3ARR A;  3TCZ A;  1LJY A;  1ZL1 A;  4LAX A;  2RQS A;  3W4R A;  5B8I C;  1A7X A;  4JFJ A;  5HKG A;  4HBO A;  4W9Q A;  4IT4 A;  2MF9 A;  4DZ2 A;  1GRJ A;  3KCE A;  5HUA A;  4DT4 A;  1YW5 A;  4FN2 A;  3PR9 A;  1HKI A;  2DSW A;  4U86 A;  3I6C A;  1HKM A;  5J6E A;  4IT6 A;  4QT3 A;  2XP3 A;  3JYJ A;  1GPF A;  3FXY A;  1FKH A;  1H0I A;  3KAF A;  2DSZ A;  3RGC A;  1Q6I A;  1K9T A;  2RSE A;  3VAW A;  1ZK6 A;  4DIP A;  1LL4 A;  4Q22 A;  3PA7 A;  2L2S A;  3RM8 A;  2PPO A;  2ZR5 A;  1W26 A; 
#chains in the Genus database with same CATH homology
 1D7H A;  4DH0 A;  2M2A A;  1R9H A;  3UQA A;  4ITZ A;  4MGV A;  3WD0 A;  3KAH A;  1J4H A;  2XP5 A;  3WH0 A;  1W1T A;  3ARS A;  4MTV A;  2D9F A;  3TDB A;  1XHG A;  2ZQS A;  1W1P A;  4Q7N A;  3CH9 A;  4AY1 A;  3KAB A;  3CHD A;  4DRN A;  4W5U A;  1F8A B;  2KGJ A;  4WIW A;  1W9U A;  1F40 A;  1XRV A;  4ZPT R;  1E6P A;  4DRH A;  1NWU A;  3QOK A;  1C9H A;  2O9O A;  5BXJ A;  4DRI A;  2YBU A;  1U79 A;  2DT0 A;  3H9R B;  1L1P A;  1Q6H A;  1HJV A;  2F2D A;  1YAT A;  1OWQ A;  1T11 A;  4ODL A;  1D2K A;  2MPH A;  2PPP A;  3RM9 A;  3O5D A;  1KT1 A;  3FAP A;  3IHZ A;  2FKE A;  4TW8 A;  3OOB A;  5HTG A;  1D7J A;  1KFW A;  1ZBK A;  4DRP A;  2ESC A;  2ZR6 A;  3OA5 A;  3NI6 A;  4Z2H A;  2KFW A;  1FKS A;  1UR9 A;  1VF8 A;  1HXV A;  4WKA A;  3RFW A;  2MNT A;  2DT1 A;  2IF4 A;  4MNM A;  4IPX A;  5GQB A;  2WK2 A;  4WK9 A;  2A3B A;  2RUC A;  1ZCN A;  3B8S A;  3O5R A;  1W9V A;  4LGX A;  4Z2I A;  2VN1 A;  2A3C A;  1FKR A;  4ODO A;  2DG4 A;  4JYS A;  5GPR A;  3UQB A;  1Q1C A;  1ZBC A;  1FKL A;  1RD6 A;  2XP6 A;  3O5G A;  2WLZ A;  1NWT A;  4DZ3 A;  3CHF A;  1WAW A;  4XAK A;  4MNK A;  1JNT A;  4MPK A;  3RME A;  1BKF A;  4QT2 A;  4NNR A;  4GGQ A;  3AQU A;  2G41 A;  2XPB A;  2B31 A;  3ARU A;  4JFL A;  1FKJ A;  4P8U A;  5DIV A;  4DWS A;  2PI6 A;  2FDM A;  2XP7 A;  1JNE A;  2PV1 A;  3ODK A;  4G50 A;  4FAP A;  1ITX A;  4NZC A;  3G6L A;  1H0G A;  2DT2 A;  3ARW A;  3WD3 A;  1FKD A;  2XP8 A;  2PV3 A;  3WIJ A;  3O5I A;  3ARQ A;  4P8X A;  5DIT A;  5HWB A;  1X6L A;  2MLZ A;  2RUQ A;  1GOI A;  4ZS6 A;  3WD2 A;  4PTM A;  3LUO A;  1HJW A;  4O2T A;  3ARZ A;  1ROT A;  3TC5 A;  2JZV A;  5HW8 A;  2G8Z A;  2M1I A;  4TW6 A;  3B9A A;  4C02 B;  3UI6 A;  4DWS B;  3WKZ A;  3O5E A;  3NTP A;  3O5P A;  4GIV A;  4R0X A;  1NMW A;  5HWC A;  4U84 A;  1EIB A;  4DRM A;  1SR0 A;  2UZ5 A;  2Q5A A;  3CGN A;  4KR0 B;  1FFR A;  3AS3 A;  1EYM A;  4KQZ A;  4J4N A;  2RUD A;  4ODN A;  2O92 A;  4G2P A;  2RUR A;  2LGO A;  4MSP A;  3IKG A;  1M5Y A;  3G6M A;  5GPG A;  5HW7 A;  4ODR A;  3KAG A;  4R5E A;  2XP9 A;  1FKK A;  4HBE A;  3IK8 A;  3ALF A;  3KAD A;  1NWR A;  2ZR4 A;  4Z2G A;  1JNS A;  1QPF A;  1FKI A;  1E9L A;  1W9P A;  4L72 B;  4DRQ A;  4P8W A;  2AOS A;  2WM0 A;  1W1V A;  3WL1 A;  1NMV A;  1OGG A;  1E15 A;  2KI3 A;  3O5K A;  2LKN A;  2Y78 A;  1GUV A;  2DG9 A;  3KAC A;  1WNO A;  1FAP A;  1FD9 A;  1PBK A;  2KE0 A;  4ML4 A;  1JND A;  2KR7 A;  1FFQ A;  3UF8 A;  1PIN A;  4TNS A;  4TX0 A;  1LQ0 A;  3O5Q A;  3B9D A;  2OFN A;  2FAP A;  3CGM A;  1UR8 A;  4S3J A;  3O5O A;  2XP4 A;  1OGB A;  2M08 A;  5DEZ A;  3KZ7 A;  3O5J A;  4WKH A;  1ZB5 A;  3AS1 A;  1QPL A;  4Z2K A;  1LL7 A;  3ARY A;  4Z2L A;  2MLX A;  3ART A;  5HW6 A;  1LG2 A;  1O6I A;  1Y0O A;  2DSV A;  4ODM A;  1E6N A;  1Q6U A;  3WQV A;  4ODQ A;  1ZBV A;  1EHN A;  1LG1 A;  4WKF A;  5HT1 A;  3CHE A;  2OLH A;  3WD1 A;  2LPV A;  4TW7 A;  4N19 A;  3UI4 A;  5HBF A;  2N87 A;  3O5M A;  1E6R A;  2PV2 A;  1HKJ A;  2PPN A;  4DRK A;  1NH6 A;  2A3A A;  1ROU A;  3BXW A;  4QZV B;  3WQW A;  1BL4 A;  2QF8 A;  4DRO A;  2IUZ A;  3KAI A;  5I98 A;  1FKG A;  1J4I A;  4Z2J A;  2ZQT A;  1J6Y A;  3ARX A;  3MDY B;  5DF0 A;  2K8I A;  5DIU A;  2KO7 A;  4LAV A;  2ZQU A;  3CZ8 A;  2DPE A;  4ZPV R;  3WL0 A;  2LJ4 A;  1HKK A;  1J4R A;  1X6N A;  2PBC A;  1TFV A;  3RM4 A;  3AS0 A;  2DSU A;  3PRB A;  4ODK A;  4J4O A;  1D7I A;  1TCO C;  4ZPW R;  4L3N A;  1ZU8 A;  2F4E A;  4MAV A;  5DO2 A;  1E6Z A;  2MLY A;  2DT3 A;  3ALG A;  3B9E A;  5JH8 A;  1N1A A;  1ZBW A;  4U85 A;  1B6C A;  3PRD A;  1FKB A;  3EY6 A;  3ARP A;  4HAR A;  5D75 A;  2VCD A;  3WD4 A;  1W1Y A;  3GPK A;  4W9O A;  3NRK A;  4DWS D;  4JFI A;  1WB0 A;  4DRJ A;  2DG3 A;  1NWS A;  4ODP A;  1D6O A;  2A3E A;  4QIB A;  4WJX A;  3FY1 A;  3ARO A;  3ARV A;  4LAY A;  3CHC A;  4URI A;  2ITK A;  1EQ3 A;  3AS2 A;  2AWG A;  3O5L A;  1CTN A;  4NSB A;  2WLY A;  4S3K A;  1FJD A;  4W9P A;  2XPA A;  1IX5 A;  3IKD A;  4TYO A;  1NSG A;  3B7X A;  3PRA A;  1KT0 A;  1FKF A;  3O5F A;  3UI5 A;  1HJX A;  1LL6 A;  1QZ2 A;  2ZQV A;  4LAW A;  1P5Q A;  1JVW A;  2YBT A;  3JYM A;  4IQC A;  3JXV A;  4DWS C;  1EDQ A;  1SYT A;  4IQ2 A;  4MNJ A;  2F21 A;  4BF8 A;  1FKT A;  4JFK A;  4MNL A;  4JFM A;  3UQI A;  4P8V A;  3ARR A;  3TCZ A;  1LJY A;  1ZL1 A;  4LAX A;  2RQS A;  3W4R A;  5B8I C;  1A7X A;  4JFJ A;  5HKG A;  4HBO A;  4W9Q A;  4IT4 A;  2MF9 A;  4DZ2 A;  3KCE A;  5HUA A;  4DT4 A;  1YW5 A;  4FN2 A;  3PR9 A;  1HKI A;  2DSW A;  4U86 A;  3I6C A;  1HKM A;  5J6E A;  4IT6 A;  4QT3 A;  2XP3 A;  3JYJ A;  1GPF A;  3FXY A;  1FKH A;  1H0I A;  3KAF A;  2DSZ A;  3RGC A;  1Q6I A;  1K9T A;  2RSE A;  3VAW A;  1ZK6 A;  4DIP A;  1LL4 A;  4Q22 A;  3PA7 A;  2L2S A;  3RM8 A;  2PPO A;  2ZR5 A;  1W26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...