2JZVA

Solution structure of s. aureus prsa-ppiase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
GPLGSDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Foldase protein prsA
publication title Solution structure of the parvulin-type PPIase domain of Staphylococcus aureus PrsA - Implications for the catalytic mechanism of parvulins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
total genus 28
structure length 111
sequence length 111
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2jzvA00
5GPGA 1FKRA 4DRKA 1FKJA 2M08A 5I98A 3WH0A 4QT3A 2XP5A 1Q6IA 2XP6A 3MDYB 4TNSA 5HKGA 1JVWA 1Q6UA 1BL4A 3CGMA 4ODNA 5HT1A 1FKKA 1D7JA 1ZK6A 5HW7A 4W9QA 1D7IA 3KACA 4LAVA 4DRJA 4TW7A 5HTGA 2F2DA 1FKSA 1FJDA 2RUCA 1QZ2A 3KAGA 4ODOA 3EY6A 1F8AB 1NMWA 2RUQA 1A7XA 1FKLA 1BKFA 2DG4A 4ITZA 1Q1CA 4MSPA 4BF8A 1L1PA 2Q5AA 1FKHA 2VN1A 2PV3A 2ITKA 3GPKA 1TCOC 5DIVA 2MLYA 2KI3A 3O5JA 1ZCNA 5D75A 1T11A 4LAYA 4N19A 2XP4A 3ODKA 2F4EA 3KAHA 2KR7A 2RUDA 2ZR4A 2OFNA 4GGQA 4JFMA 3IKGA 1FKTA 1M5YA 3FAPA 1YW5A 3PRBA 3NRKA 4NNRA 3UI4A 3UQBA 2FKEA 2KFWA 5DIUA 1J6YA 4J4NA 3CGNA 1FKGA 4QIBA 3KZ7A 3UF8A 2ZQSA 4GIVA 4LAXA 3RFWA 5HUAA 3UQAA 2Y78A 3KAIA 1NSGA 3JYMA 5HWCA 1P5QA 4W9OA 4DIPA 5BXJA 3O5KA 4G2PA 2ZR5A 3PA7A 1R9HA 4ODPA 4TW8A 2AWGA 4LAWA 1N1AA 2XP9A 4DRNA 2M2AA 3UI6A 4DRIA 1ROTA 3KCEA 4ODMA 1KT0A 2MLZA 2KGJA 2N87A 2ZQUA 2L2SA 2PPNA 1YATA 3LUOA 1KT1A 1FKBA 3O5QA 3PRDA 3UI5A 4JFIA 4JFLA 3KAFA 1FKFA 1HXVA 1PBKA 3UQIA 4MGVA 3TDBA 3IHZA 1JNTA 4U85A 2PPOA 4FAPA 1FAPA 2M1IA 4R0XA 4DROA 2DG3A 4FN2A 4TX0A 4U84A 3NTPA 3B7XA 1J4IA 2PBCA 2UZ5A 2XP3A 4IPXA 3IKDA 3JXVA 3O5LA 3H9RB 4J4OA 1FKDA 4JYSA 3O5OA 2ZR6A 2LGOA 2RURA 5HW8A 1J4RA 2JZVA 2FAPA 4JFJA 4ODRA 1C9HA 2LKNA 5J6EA 3VAWA 2XP7A 1FKIA 4IQCA 4TW6A 2DG9A 4U86A 4W9PA 2PPPA 2MPHA 1Q6HA 4JFKA 3O5RA 2VCDA 3O5FA 1D6OA 1EYMA 1Y0OA 1QPLA 3TC5A 5HW6A 4IQ2A 1JNSA 2RSEA 4O2TA 4DRHA 4DRMA 3O5PA 3O5IA 2IF4A 4DRPA 5HWBA 1F40A 1ROUA 1U79A 2MNTA 3KABA 4ODLA 2KE0A 4DRQA 3JYJA 3O5DA 4QT2A 3KADA 3NI6A 2LJ4A 2MLXA 2XP8A 2ZQVA 3O5GA 2ZQTA 2LPVA 2PV1A 2K8IA 3TCZA 4DH0A 4TYOA 1EQ3A 1W26A 2XPAA 1D7HA 4DZ2A 3I6CA 4G50A 4C02B 3OOBA 3IK8A 2D9FA 4DT4A 3RGCA 4ODKA 2F21A 1NMVA 2KO7A 2MF9A 1FD9A 3O5MA 2PV2A 3O5EA 5B8IC 2RQSA 2XPBA 1J4HA 4ODQA 4DZ3A 1QPFA 1PINA 1B6CA 5DITA
chains in the Genus database with same CATH superfamily
5GPGA 4QT3A 2ETNA 1EDQA 5HKGA 1JVWA 4ODNA 1ZK6A 1D7IA 3KACA 5HTGA 3CZ8A 1NH6A 4HARA 2RUCA 1QZ2A 3ARPA 4KQZA 4S3KA 2VN1A 2Q5AA 1WB0A 3O5JA 1T11A 4LAYA 4N19A 4P8UA 2KR7A 1FKTA 1M5YA 2PI6A 3UI4A 3GTYX 2FKEA 4J4NA 2A3EA 4GIVA 4DWSB 1W9VA 2Y78A 4IT4A 1P5QA 4Z2KA 4DIPA 3PA7A 4P8XA 2WLZA 3UI6A 4DRIA 1W1PA 1CTNA 2N87A 2ZQUA 2L2SA 3FY1A 4ZPVR 1XRVA 1KT1A 3PRDA 4JFIA 3AS0A 3UQIA 2PPOA 4S3JA 2PN0A 3FXYA 4TX0A 3NTPA 1E6RA 1LG1A 2PBCA 4IPXA 3H9RB 4J4OA 1JCHB 4ZS6A 4HBEA 4PTMA 4KR0B 2LGOA 2RURA 1J4RA 2DSVA 3CHEA 1C9HA 1FKIA 3G6MA 2DG9A 3O5RA 1EYMA 3WD4A 1Y0OA 4QZVB 1LL6A 4DRHA 3O5PA 3B9AA 1H0IA 1F40A 2WLYA 1U79A 4ODLA 2KE0A 4DRQA 1OWQA 3O5DA 2DT2A 1HJXA 3RMEA 1EQ3A 1D2KA 3G6LA 2YBTA 3RM9A 3OA5A 4DZ2A 1RD6A 3IK8A 1SR0A 4DT4A 2KO7A 2MF9A 1FD9A 3O5MA 2O9OA 2DSUA 1J4HA 4ODQA 2DSWA 1FKJA 1W1YA 3AS2A 1Q6IA 3CHDA 3MDYB 3CGMA 4P8VA 1FKKA 1D7JA 4W9QA 4DRJA 1FKSA 4ML4A 3EY6A 4WJXA 1A7XA 1FKLA 3ARZA 4XAKA 2QF8A 1Q1CA 4MSPA 1L1PA 2DT0A 1FKHA 1HKJA 1TCOC 1ZBCA 3ALGA 2MLYA 2XP4A 2F4EA 2RUDA 2OFNA 4GGQA 3FAPA 3QOKA 4Q7NA 1E44A 4L72B 3CGNA 1FKGA 3UF8A 3RFWA 1NSGA 3ARRA 4W9OA 3O5KA 4G2PA 1R9HA 3ARYA 1VF8A 1N1AA 2XP9A 4WIWA 3AS1A 3WD2A 2A3AA 3KCEA 1SYTA 1E6PA 4JFLA 4IT6A 1PBKA 3TDBA 4FAPA 2M1IA 2EULA 2DT3A 1GUVA 4MNJA 2XP3A 3IKDA 4WKHA 1NWSA 1FKDA 4JYSA 3O5OA 2JZVA 3VAWA 5JH8A 5DEZA 1NWUA 1TFVA 4JFKA 1W1VA 4HBOA 5GPRA 1GRJA 4Z2HA 5HWBA 3B9DA 1ZBVA 2MNTA 3ARVA 3O5GA 2DT1A 2LPVA 3ARUA 3CH9A 4TYOA 1D7HA 1WAWA 4NZCA 3PRAA 3RGCA 1JNDA 2F21A 1NMVA 3EIPA 1FFRA 3O5EA 2RQSA 4R5EA 4MTVA 1QPFA 1PINA 1FKRA 4Z2JA 2M08A 1LJYA 3WH0A 2G8ZA 4TNSA 3BMBA 1W9UA 5HW7A 4Z2LA 4TW7A 1B6CA 1GOIA 2G41A 4ODOA 1NMWA 1BKFA 1EHNA 4ITZA 4URIA 2DPEA 3GPKA 4WK9A 3WQWA 5D75A 3WL0A 3B9EA 2ZR4A 4JFMA 3IKGA 4NSBA 3PRBA 3NRKA 3ARSA 4WKFA 5DIUA 1HKMA 2KFWA 4QIBA 3GU0A 2IUZA 2ZQSA 1LQ0A 3ALFA 1NWTA 4ZPTR 4MNKA 1ZBWA 4ODPA 4TW8A 4LAWA 1EIBA 1ROTA 3CHCA 4ODMA 1X6NA 2KGJA 2PPNA 1YATA 1GPFA 3O5QA 4L3NA 3KAFA 5GQBA 4Z2GA 1FKFA 1HXVA 3IHZA 1JNTA 3ARTA 4U85A 4P8WA 2B5UB 4DROA 2DG3A 4FN2A 5DF0A 3WD3A 3JXVA 3O5LA 2WK2A 1ITXA 2OLHA 1O6IA 3WD0A 2ZR6A 4ZPWR 1K9TA 5HW8A 2FAPA 4JFJA 3BXWA 1WNOA 2XP7A 4IQCA 2PPPA 1Q6HA 3RM8A 4DWSC 3O5FA 3TC5A 1UR9A 2RSEA 4O2TA 4DRMA 3CHFA 1ROUA 3KABA 3WIJA 1OGGA 3JYJA 3KADA 3NI6A 2MLXA 2XP8A 3RM4A 4DH0A 1ZU8A 1W26A 5HBFA 1HJVA 1LL7A 3OOBA 3WD1A 1KFWA 3ARWA 2D9FA 2WM0A 4ODKA 2FDMA 2XPBA 4DZ3A 1OGBA 3LUOA 4DRKA 5I98A 2XP5A 2XP6A 1Q6UA 1HKIA 5HT1A 1FJDA 4LAVA 2F2DA 2ESCA 3KAGA 1F8AB 4MPKA 1E6NA 1JNEA 2F23A 2RUQA 2DG4A 1ZB5A 4BF8A 1HJWA 1ZBKA 2PV3A 2ITKA 5DIVA 1ZL1A 2KI3A 1ZCNA 3ODKA 2A3BA 3KAHA 4MNMA 1YW5A 3WL1A 1LG2A 1NWRA 4NNRA 3W4RA 2DSZA 3UQBA 2YBUA 1J6YA 2A3CA 1HKKA 3KZ7A 4LAXA 3UQAA 3PR9A 2O92A 5HUAA 1H0GA 3KAIA 3JYMA 5HWCA 5BXJA 2ZR5A 2AWGA 1E15A 4DRNA 2M2AA 4Z2IA 1KT0A 2MLZA 4UDMA 1FKBA 4DWSD 3UI5A 1LL4A 3AS3A 4MGVA 1FAPA 4R0XA 4AY1A 4U84A 3B7XA 4MNLA 1J4IA 2UZ5A 4LGXA 4WKAA 3ARQA 3WQVA 1W9PA 4ODRA 4W5UA 1XHGA 2LKNA 5J6EA 4TW6A 4W9PA 4U86A 2MPHA 3ARXA 2VCDA 3WKZA 1D6OA 1W1TA 1IX5A 1QPLA 5HW6A 1JNSA 4IQ2A 3O5IA 2IF4A 4DRPA 2AOSA 2B31A 4Q22A 2P4VA 4QT2A 1E6ZA 2LJ4A 2ZQVA 2ZQTA 2PV1A 3B8SA 2K8IA 3TCZA 4MAVA 5DO2A 2XPAA 3I6CA 1X6LA 4G50A 4C02B 1FFQA 1UR8A 2PV2A 4DWSA 5B8IC 1E9LA 3AQUA 1BL4A 3AROA 5DITA
chains in the Genus database with same CATH topology
5GPGA 4QT3A 1EDQA 5HKGA 1JVWA 4ODNA 1ZK6A 1D7IA 3KACA 5HTGA 3CZ8A 1NH6A 4HARA 2RUCA 1QZ2A 3ARPA 4KQZA 4S3KA 2VN1A 2Q5AA 1WB0A 3O5JA 1T11A 4LAYA 4N19A 4P8UA 2KR7A 1FKTA 1M5YA 2PI6A 3UI4A 2FKEA 4J4NA 2A3EA 4GIVA 4DWSB 1W9VA 2Y78A 4IT4A 1P5QA 4Z2KA 4DIPA 3PA7A 4P8XA 2WLZA 3UI6A 4DRIA 1W1PA 1CTNA 2N87A 2ZQUA 2L2SA 3FY1A 4ZPVR 1XRVA 1KT1A 3PRDA 4JFIA 3AS0A 3UQIA 2PPOA 4S3JA 3FXYA 4TX0A 3NTPA 1E6RA 1LG1A 2PBCA 4IPXA 3H9RB 4J4OA 4ZS6A 4HBEA 4PTMA 4KR0B 2LGOA 2RURA 1J4RA 2DSVA 3CHEA 1C9HA 1FKIA 3G6MA 2DG9A 3O5RA 1EYMA 3WD4A 1Y0OA 4QZVB 1LL6A 4DRHA 3O5PA 3B9AA 1H0IA 1F40A 2WLYA 1U79A 4ODLA 2KE0A 4DRQA 1OWQA 3O5DA 2DT2A 1HJXA 3RMEA 1EQ3A 1D2KA 3G6LA 2YBTA 3RM9A 3OA5A 4DZ2A 1RD6A 3IK8A 1SR0A 4DT4A 2KO7A 2MF9A 1FD9A 3O5MA 2O9OA 2DSUA 1J4HA 4ODQA 2DSWA 1FKJA 1W1YA 3AS2A 1Q6IA 3CHDA 3MDYB 3CGMA 4P8VA 1FKKA 1D7JA 4W9QA 4DRJA 1FKSA 4ML4A 3EY6A 4WJXA 1A7XA 1FKLA 3ARZA 4XAKA 2QF8A 1Q1CA 4MSPA 1L1PA 2DT0A 1FKHA 1HKJA 1TCOC 1ZBCA 3ALGA 2MLYA 2XP4A 2F4EA 2RUDA 2OFNA 4GGQA 3FAPA 3QOKA 4Q7NA 4L72B 3CGNA 1FKGA 3UF8A 3RFWA 1NSGA 3ARRA 4W9OA 3O5KA 4G2PA 1R9HA 3ARYA 1VF8A 1N1AA 2XP9A 4WIWA 3AS1A 3WD2A 2A3AA 3KCEA 1SYTA 1E6PA 4JFLA 4IT6A 1PBKA 3TDBA 4FAPA 2M1IA 2DT3A 1GUVA 4MNJA 2XP3A 3IKDA 4WKHA 1NWSA 1FKDA 4JYSA 3O5OA 2JZVA 3VAWA 5JH8A 5DEZA 1NWUA 1TFVA 4JFKA 1W1VA 4HBOA 5GPRA 4Z2HA 5HWBA 3B9DA 1ZBVA 2MNTA 3ARVA 3O5GA 2DT1A 2LPVA 3ARUA 3CH9A 4TYOA 1D7HA 1WAWA 4NZCA 3PRAA 3RGCA 1JNDA 2F21A 1NMVA 1FFRA 3O5EA 2RQSA 4R5EA 4MTVA 1QPFA 1PINA 1FKRA 4Z2JA 2M08A 1LJYA 3WH0A 2G8ZA 4TNSA 1W9UA 5HW7A 4Z2LA 4TW7A 1B6CA 1GOIA 2G41A 4ODOA 1NMWA 1BKFA 1EHNA 4ITZA 4URIA 2DPEA 3GPKA 4WK9A 3WQWA 5D75A 3WL0A 3B9EA 2ZR4A 4JFMA 3IKGA 4NSBA 3PRBA 3NRKA 3ARSA 4WKFA 5DIUA 1HKMA 2KFWA 4QIBA 2IUZA 2ZQSA 1LQ0A 3ALFA 1NWTA 4ZPTR 4MNKA 1ZBWA 4ODPA 4TW8A 4LAWA 1EIBA 1ROTA 3CHCA 4ODMA 1X6NA 2KGJA 2PPNA 1YATA 1GPFA 3O5QA 4L3NA 3KAFA 5GQBA 4Z2GA 1FKFA 1HXVA 3IHZA 1JNTA 3ARTA 4U85A 4P8WA 4DROA 2DG3A 4FN2A 5DF0A 3WD3A 3JXVA 3O5LA 2WK2A 1ITXA 2OLHA 1O6IA 3WD0A 2ZR6A 4ZPWR 1K9TA 5HW8A 2FAPA 4JFJA 3BXWA 1WNOA 2XP7A 4IQCA 2PPPA 1Q6HA 3RM8A 4DWSC 3O5FA 3TC5A 1UR9A 2RSEA 4O2TA 4DRMA 3CHFA 1ROUA 3KABA 3WIJA 1OGGA 3JYJA 3KADA 3NI6A 2MLXA 2XP8A 3RM4A 4DH0A 1ZU8A 1W26A 5HBFA 1HJVA 1LL7A 3OOBA 3WD1A 1KFWA 3ARWA 2D9FA 2WM0A 4ODKA 2FDMA 2XPBA 4DZ3A 1OGBA 3LUOA 4DRKA 5I98A 2XP5A 2XP6A 1Q6UA 1HKIA 5HT1A 1FJDA 4LAVA 2F2DA 2ESCA 3KAGA 1F8AB 4MPKA 1E6NA 1JNEA 2RUQA 2DG4A 1ZB5A 4BF8A 1HJWA 1ZBKA 2PV3A 2ITKA 5DIVA 1ZL1A 2KI3A 1ZCNA 3ODKA 2A3BA 3KAHA 4MNMA 1YW5A 3WL1A 1LG2A 1NWRA 4NNRA 3W4RA 2DSZA 3UQBA 2YBUA 1J6YA 2A3CA 1HKKA 3KZ7A 4LAXA 3UQAA 3PR9A 2O92A 5HUAA 1H0GA 3KAIA 3JYMA 5HWCA 5BXJA 2ZR5A 2AWGA 1E15A 4DRNA 2M2AA 4Z2IA 1KT0A 2MLZA 1FKBA 4DWSD 3UI5A 1LL4A 3AS3A 4MGVA 1FAPA 4R0XA 4AY1A 4U84A 3B7XA 4MNLA 1J4IA 2UZ5A 4LGXA 4WKAA 3ARQA 3WQVA 1W9PA 4ODRA 4W5UA 1XHGA 2LKNA 5J6EA 4TW6A 4W9PA 4U86A 2MPHA 3ARXA 2VCDA 3WKZA 1D6OA 1W1TA 1IX5A 1QPLA 5HW6A 1JNSA 4IQ2A 3O5IA 2IF4A 4DRPA 2AOSA 2B31A 4Q22A 4QT2A 1E6ZA 2LJ4A 2ZQVA 2ZQTA 2PV1A 3B8SA 2K8IA 3TCZA 4MAVA 5DO2A 2XPAA 3I6CA 1X6LA 4G50A 4C02B 1FFQA 1UR8A 2PV2A 4DWSA 5B8IC 1E9LA 3AQUA 1BL4A 3AROA 5DITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPG A;  1FKR A;  4DRK A;  1FKJ A;  2M08 A;  5I98 A;  3WH0 A;  4QT3 A;  2XP5 A;  1Q6I A;  2XP6 A;  3MDY B;  4TNS A;  5HKG A;  1JVW A;  1Q6U A;  1BL4 A;  3CGM A;  4ODN A;  5HT1 A;  1FKK A;  1D7J A;  1ZK6 A;  5HW7 A;  4W9Q A;  1D7I A;  3KAC A;  4LAV A;  4DRJ A;  4TW7 A;  5HTG A;  2F2D A;  1FKS A;  1FJD A;  2RUC A;  1QZ2 A;  3KAG A;  4ODO A;  3EY6 A;  1F8A B;  1NMW A;  2RUQ A;  1A7X A;  1FKL A;  1BKF A;  2DG4 A;  4ITZ A;  1Q1C A;  4MSP A;  4BF8 A;  1L1P A;  2Q5A A;  1FKH A;  2VN1 A;  2PV3 A;  2ITK A;  3GPK A;  1TCO C;  5DIV A;  2MLY A;  2KI3 A;  3O5J A;  1ZCN A;  5D75 A;  1T11 A;  4LAY A;  4N19 A;  2XP4 A;  3ODK A;  2F4E A;  3KAH A;  2KR7 A;  2RUD A;  2ZR4 A;  2OFN A;  4GGQ A;  4JFM A;  3IKG A;  1FKT A;  1M5Y A;  3FAP A;  1YW5 A;  3PRB A;  3NRK A;  4NNR A;  3UI4 A;  3UQB A;  2FKE A;  2KFW A;  5DIU A;  1J6Y A;  4J4N A;  3CGN A;  1FKG A;  4QIB A;  3KZ7 A;  3UF8 A;  2ZQS A;  4GIV A;  4LAX A;  3RFW A;  5HUA A;  3UQA A;  2Y78 A;  3KAI A;  1NSG A;  3JYM A;  5HWC A;  1P5Q A;  4W9O A;  4DIP A;  5BXJ A;  3O5K A;  4G2P A;  2ZR5 A;  3PA7 A;  1R9H A;  4ODP A;  4TW8 A;  2AWG A;  4LAW A;  1N1A A;  2XP9 A;  4DRN A;  2M2A A;  3UI6 A;  4DRI A;  1ROT A;  3KCE A;  4ODM A;  1KT0 A;  2MLZ A;  2KGJ A;  2N87 A;  2ZQU A;  2L2S A;  2PPN A;  1YAT A;  3LUO A;  1KT1 A;  1FKB A;  3O5Q A;  3PRD A;  3UI5 A;  4JFI A;  4JFL A;  3KAF A;  1FKF A;  1HXV A;  1PBK A;  3UQI A;  4MGV A;  3TDB A;  3IHZ A;  1JNT A;  4U85 A;  2PPO A;  4FAP A;  1FAP A;  2M1I A;  4R0X A;  4DRO A;  2DG3 A;  4FN2 A;  4TX0 A;  4U84 A;  3NTP A;  3B7X A;  1J4I A;  2PBC A;  2UZ5 A;  2XP3 A;  4IPX A;  3IKD A;  3JXV A;  3O5L A;  3H9R B;  4J4O A;  1FKD A;  4JYS A;  3O5O A;  2ZR6 A;  2LGO A;  2RUR A;  5HW8 A;  1J4R A;  2JZV A;  2FAP A;  4JFJ A;  4ODR A;  1C9H A;  2LKN A;  5J6E A;  3VAW A;  2XP7 A;  1FKI A;  4IQC A;  4TW6 A;  2DG9 A;  4U86 A;  4W9P A;  2PPP A;  2MPH A;  1Q6H A;  4JFK A;  3O5R A;  2VCD A;  3O5F A;  1D6O A;  1EYM A;  1Y0O A;  1QPL A;  3TC5 A;  5HW6 A;  4IQ2 A;  1JNS A;  2RSE A;  4O2T A;  4DRH A;  4DRM A;  3O5P A;  3O5I A;  2IF4 A;  4DRP A;  5HWB A;  1F40 A;  1ROU A;  1U79 A;  2MNT A;  3KAB A;  4ODL A;  2KE0 A;  4DRQ A;  3JYJ A;  3O5D A;  4QT2 A;  3KAD A;  3NI6 A;  2LJ4 A;  2MLX A;  2XP8 A;  2ZQV A;  3O5G A;  2ZQT A;  2LPV A;  2PV1 A;  2K8I A;  3TCZ A;  4DH0 A;  4TYO A;  1EQ3 A;  1W26 A;  2XPA A;  1D7H A;  4DZ2 A;  3I6C A;  4G50 A;  4C02 B;  3OOB A;  3IK8 A;  2D9F A;  4DT4 A;  3RGC A;  4ODK A;  2F21 A;  1NMV A;  2KO7 A;  2MF9 A;  1FD9 A;  3O5M A;  2PV2 A;  3O5E A;  5B8I C;  2RQS A;  2XPB A;  1J4H A;  4ODQ A;  4DZ3 A;  1QPF A;  1PIN A;  1B6C A;  5DIT A; 
#chains in the Genus database with same CATH topology
 5GPG A;  4QT3 A;  2ETN A;  1EDQ A;  5HKG A;  1JVW A;  4ODN A;  1ZK6 A;  1D7I A;  3KAC A;  5HTG A;  3CZ8 A;  1NH6 A;  4HAR A;  2RUC A;  1QZ2 A;  3ARP A;  4KQZ A;  4S3K A;  2VN1 A;  2Q5A A;  1WB0 A;  3O5J A;  1T11 A;  4LAY A;  4N19 A;  4P8U A;  2KR7 A;  1FKT A;  1M5Y A;  2PI6 A;  3UI4 A;  3GTY X;  2FKE A;  4J4N A;  2A3E A;  4GIV A;  4DWS B;  1W9V A;  2Y78 A;  4IT4 A;  1P5Q A;  4Z2K A;  4DIP A;  3PA7 A;  4P8X A;  2WLZ A;  3UI6 A;  4DRI A;  1W1P A;  1CTN A;  2N87 A;  2ZQU A;  2L2S A;  3FY1 A;  4ZPV R;  1XRV A;  1KT1 A;  3PRD A;  4JFI A;  3AS0 A;  3UQI A;  2PPO A;  4S3J A;  2PN0 A;  3FXY A;  4TX0 A;  3NTP A;  1E6R A;  1LG1 A;  2PBC A;  4IPX A;  3H9R B;  4J4O A;  1JCH B;  4ZS6 A;  4HBE A;  4PTM A;  4KR0 B;  2LGO A;  2RUR A;  1J4R A;  2DSV A;  3CHE A;  1C9H A;  1FKI A;  3G6M A;  2DG9 A;  3O5R A;  1EYM A;  3WD4 A;  1Y0O A;  4QZV B;  1LL6 A;  4DRH A;  3O5P A;  3B9A A;  1H0I A;  1F40 A;  2WLY A;  1U79 A;  4ODL A;  2KE0 A;  4DRQ A;  1OWQ A;  3O5D A;  2DT2 A;  1HJX A;  3RME A;  1EQ3 A;  1D2K A;  3G6L A;  2YBT A;  3RM9 A;  3OA5 A;  4DZ2 A;  1RD6 A;  3IK8 A;  1SR0 A;  4DT4 A;  2KO7 A;  2MF9 A;  1FD9 A;  3O5M A;  2O9O A;  2DSU A;  1J4H A;  4ODQ A;  2DSW A;  1FKJ A;  1W1Y A;  3AS2 A;  1Q6I A;  3CHD A;  3MDY B;  3CGM A;  4P8V A;  1FKK A;  1D7J A;  4W9Q A;  4DRJ A;  1FKS A;  4ML4 A;  3EY6 A;  4WJX A;  1A7X A;  1FKL A;  3ARZ A;  4XAK A;  2QF8 A;  1Q1C A;  4MSP A;  1L1P A;  2DT0 A;  1FKH A;  1HKJ A;  1TCO C;  1ZBC A;  3ALG A;  2MLY A;  2XP4 A;  2F4E A;  2RUD A;  2OFN A;  4GGQ A;  3FAP A;  3QOK A;  4Q7N A;  1E44 A;  4L72 B;  3CGN A;  1FKG A;  3UF8 A;  3RFW A;  1NSG A;  3ARR A;  4W9O A;  3O5K A;  4G2P A;  1R9H A;  3ARY A;  1VF8 A;  1N1A A;  2XP9 A;  4WIW A;  3AS1 A;  3WD2 A;  2A3A A;  3KCE A;  1SYT A;  1E6P A;  4JFL A;  4IT6 A;  1PBK A;  3TDB A;  4FAP A;  2M1I A;  2EUL A;  2DT3 A;  1GUV A;  4MNJ A;  2XP3 A;  3IKD A;  4WKH A;  1NWS A;  1FKD A;  4JYS A;  3O5O A;  2JZV A;  3VAW A;  5JH8 A;  5DEZ A;  1NWU A;  1TFV A;  4JFK A;  1W1V A;  4HBO A;  5GPR A;  1GRJ A;  4Z2H A;  5HWB A;  3B9D A;  1ZBV A;  2MNT A;  3ARV A;  3O5G A;  2DT1 A;  2LPV A;  3ARU A;  3CH9 A;  4TYO A;  1D7H A;  1WAW A;  4NZC A;  3PRA A;  3RGC A;  1JND A;  2F21 A;  1NMV A;  3EIP A;  1FFR A;  3O5E A;  2RQS A;  4R5E A;  4MTV A;  1QPF A;  1PIN A;  1FKR A;  4Z2J A;  2M08 A;  1LJY A;  3WH0 A;  2G8Z A;  4TNS A;  3BMB A;  1W9U A;  5HW7 A;  4Z2L A;  4TW7 A;  1B6C A;  1GOI A;  2G41 A;  4ODO A;  1NMW A;  1BKF A;  1EHN A;  4ITZ A;  4URI A;  2DPE A;  3GPK A;  4WK9 A;  3WQW A;  5D75 A;  3WL0 A;  3B9E A;  2ZR4 A;  4JFM A;  3IKG A;  4NSB A;  3PRB A;  3NRK A;  3ARS A;  4WKF A;  5DIU A;  1HKM A;  2KFW A;  4QIB A;  3GU0 A;  2IUZ A;  2ZQS A;  1LQ0 A;  3ALF A;  1NWT A;  4ZPT R;  4MNK A;  1ZBW A;  4ODP A;  4TW8 A;  4LAW A;  1EIB A;  1ROT A;  3CHC A;  4ODM A;  1X6N A;  2KGJ A;  2PPN A;  1YAT A;  1GPF A;  3O5Q A;  4L3N A;  3KAF A;  5GQB A;  4Z2G A;  1FKF A;  1HXV A;  3IHZ A;  1JNT A;  3ART A;  4U85 A;  4P8W A;  2B5U B;  4DRO A;  2DG3 A;  4FN2 A;  5DF0 A;  3WD3 A;  3JXV A;  3O5L A;  2WK2 A;  1ITX A;  2OLH A;  1O6I A;  3WD0 A;  2ZR6 A;  4ZPW R;  1K9T A;  5HW8 A;  2FAP A;  4JFJ A;  3BXW A;  1WNO A;  2XP7 A;  4IQC A;  2PPP A;  1Q6H A;  3RM8 A;  4DWS C;  3O5F A;  3TC5 A;  1UR9 A;  2RSE A;  4O2T A;  4DRM A;  3CHF A;  1ROU A;  3KAB A;  3WIJ A;  1OGG A;  3JYJ A;  3KAD A;  3NI6 A;  2MLX A;  2XP8 A;  3RM4 A;  4DH0 A;  1ZU8 A;  1W26 A;  5HBF A;  1HJV A;  1LL7 A;  3OOB A;  3WD1 A;  1KFW A;  3ARW A;  2D9F A;  2WM0 A;  4ODK A;  2FDM A;  2XPB A;  4DZ3 A;  1OGB A;  3LUO A;  4DRK A;  5I98 A;  2XP5 A;  2XP6 A;  1Q6U A;  1HKI A;  5HT1 A;  1FJD A;  4LAV A;  2F2D A;  2ESC A;  3KAG A;  1F8A B;  4MPK A;  1E6N A;  1JNE A;  2F23 A;  2RUQ A;  2DG4 A;  1ZB5 A;  4BF8 A;  1HJW A;  1ZBK A;  2PV3 A;  2ITK A;  5DIV A;  1ZL1 A;  2KI3 A;  1ZCN A;  3ODK A;  2A3B A;  3KAH A;  4MNM A;  1YW5 A;  3WL1 A;  1LG2 A;  1NWR A;  4NNR A;  3W4R A;  2DSZ A;  3UQB A;  2YBU A;  1J6Y A;  2A3C A;  1HKK A;  3KZ7 A;  4LAX A;  3UQA A;  3PR9 A;  2O92 A;  5HUA A;  1H0G A;  3KAI A;  3JYM A;  5HWC A;  5BXJ A;  2ZR5 A;  2AWG A;  1E15 A;  4DRN A;  2M2A A;  4Z2I A;  1KT0 A;  2MLZ A;  4UDM A;  1FKB A;  4DWS D;  3UI5 A;  1LL4 A;  3AS3 A;  4MGV A;  1FAP A;  4R0X A;  4AY1 A;  4U84 A;  3B7X A;  4MNL A;  1J4I A;  2UZ5 A;  4LGX A;  4WKA A;  3ARQ A;  3WQV A;  1W9P A;  4ODR A;  4W5U A;  1XHG A;  2LKN A;  5J6E A;  4TW6 A;  4W9P A;  4U86 A;  2MPH A;  3ARX A;  2VCD A;  3WKZ A;  1D6O A;  1W1T A;  1IX5 A;  1QPL A;  5HW6 A;  1JNS A;  4IQ2 A;  3O5I A;  2IF4 A;  4DRP A;  2AOS A;  2B31 A;  4Q22 A;  2P4V A;  4QT2 A;  1E6Z A;  2LJ4 A;  2ZQV A;  2ZQT A;  2PV1 A;  3B8S A;  2K8I A;  3TCZ A;  4MAV A;  5DO2 A;  2XPA A;  3I6C A;  1X6L A;  4G50 A;  4C02 B;  1FFQ A;  1UR8 A;  2PV2 A;  4DWS A;  5B8I C;  1E9L A;  3AQU A;  1BL4 A;  3ARO A;  5DIT A; 
#chains in the Genus database with same CATH homology
 5GPG A;  4QT3 A;  1EDQ A;  5HKG A;  1JVW A;  4ODN A;  1ZK6 A;  1D7I A;  3KAC A;  5HTG A;  3CZ8 A;  1NH6 A;  4HAR A;  2RUC A;  1QZ2 A;  3ARP A;  4KQZ A;  4S3K A;  2VN1 A;  2Q5A A;  1WB0 A;  3O5J A;  1T11 A;  4LAY A;  4N19 A;  4P8U A;  2KR7 A;  1FKT A;  1M5Y A;  2PI6 A;  3UI4 A;  2FKE A;  4J4N A;  2A3E A;  4GIV A;  4DWS B;  1W9V A;  2Y78 A;  4IT4 A;  1P5Q A;  4Z2K A;  4DIP A;  3PA7 A;  4P8X A;  2WLZ A;  3UI6 A;  4DRI A;  1W1P A;  1CTN A;  2N87 A;  2ZQU A;  2L2S A;  3FY1 A;  4ZPV R;  1XRV A;  1KT1 A;  3PRD A;  4JFI A;  3AS0 A;  3UQI A;  2PPO A;  4S3J A;  3FXY A;  4TX0 A;  3NTP A;  1E6R A;  1LG1 A;  2PBC A;  4IPX A;  3H9R B;  4J4O A;  4ZS6 A;  4HBE A;  4PTM A;  4KR0 B;  2LGO A;  2RUR A;  1J4R A;  2DSV A;  3CHE A;  1C9H A;  1FKI A;  3G6M A;  2DG9 A;  3O5R A;  1EYM A;  3WD4 A;  1Y0O A;  4QZV B;  1LL6 A;  4DRH A;  3O5P A;  3B9A A;  1H0I A;  1F40 A;  2WLY A;  1U79 A;  4ODL A;  2KE0 A;  4DRQ A;  1OWQ A;  3O5D A;  2DT2 A;  1HJX A;  3RME A;  1EQ3 A;  1D2K A;  3G6L A;  2YBT A;  3RM9 A;  3OA5 A;  4DZ2 A;  1RD6 A;  3IK8 A;  1SR0 A;  4DT4 A;  2KO7 A;  2MF9 A;  1FD9 A;  3O5M A;  2O9O A;  2DSU A;  1J4H A;  4ODQ A;  2DSW A;  1FKJ A;  1W1Y A;  3AS2 A;  1Q6I A;  3CHD A;  3MDY B;  3CGM A;  4P8V A;  1FKK A;  1D7J A;  4W9Q A;  4DRJ A;  1FKS A;  4ML4 A;  3EY6 A;  4WJX A;  1A7X A;  1FKL A;  3ARZ A;  4XAK A;  2QF8 A;  1Q1C A;  4MSP A;  1L1P A;  2DT0 A;  1FKH A;  1HKJ A;  1TCO C;  1ZBC A;  3ALG A;  2MLY A;  2XP4 A;  2F4E A;  2RUD A;  2OFN A;  4GGQ A;  3FAP A;  3QOK A;  4Q7N A;  4L72 B;  3CGN A;  1FKG A;  3UF8 A;  3RFW A;  1NSG A;  3ARR A;  4W9O A;  3O5K A;  4G2P A;  1R9H A;  3ARY A;  1VF8 A;  1N1A A;  2XP9 A;  4WIW A;  3AS1 A;  3WD2 A;  2A3A A;  3KCE A;  1SYT A;  1E6P A;  4JFL A;  4IT6 A;  1PBK A;  3TDB A;  4FAP A;  2M1I A;  2DT3 A;  1GUV A;  4MNJ A;  2XP3 A;  3IKD A;  4WKH A;  1NWS A;  1FKD A;  4JYS A;  3O5O A;  2JZV A;  3VAW A;  5JH8 A;  5DEZ A;  1NWU A;  1TFV A;  4JFK A;  1W1V A;  4HBO A;  5GPR A;  4Z2H A;  5HWB A;  3B9D A;  1ZBV A;  2MNT A;  3ARV A;  3O5G A;  2DT1 A;  2LPV A;  3ARU A;  3CH9 A;  4TYO A;  1D7H A;  1WAW A;  4NZC A;  3PRA A;  3RGC A;  1JND A;  2F21 A;  1NMV A;  1FFR A;  3O5E A;  2RQS A;  4R5E A;  4MTV A;  1QPF A;  1PIN A;  1FKR A;  4Z2J A;  2M08 A;  1LJY A;  3WH0 A;  2G8Z A;  4TNS A;  1W9U A;  5HW7 A;  4Z2L A;  4TW7 A;  1B6C A;  1GOI A;  2G41 A;  4ODO A;  1NMW A;  1BKF A;  1EHN A;  4ITZ A;  4URI A;  2DPE A;  3GPK A;  4WK9 A;  3WQW A;  5D75 A;  3WL0 A;  3B9E A;  2ZR4 A;  4JFM A;  3IKG A;  4NSB A;  3PRB A;  3NRK A;  3ARS A;  4WKF A;  5DIU A;  1HKM A;  2KFW A;  4QIB A;  2IUZ A;  2ZQS A;  1LQ0 A;  3ALF A;  1NWT A;  4ZPT R;  4MNK A;  1ZBW A;  4ODP A;  4TW8 A;  4LAW A;  1EIB A;  1ROT A;  3CHC A;  4ODM A;  1X6N A;  2KGJ A;  2PPN A;  1YAT A;  1GPF A;  3O5Q A;  4L3N A;  3KAF A;  5GQB A;  4Z2G A;  1FKF A;  1HXV A;  3IHZ A;  1JNT A;  3ART A;  4U85 A;  4P8W A;  4DRO A;  2DG3 A;  4FN2 A;  5DF0 A;  3WD3 A;  3JXV A;  3O5L A;  2WK2 A;  1ITX A;  2OLH A;  1O6I A;  3WD0 A;  2ZR6 A;  4ZPW R;  1K9T A;  5HW8 A;  2FAP A;  4JFJ A;  3BXW A;  1WNO A;  2XP7 A;  4IQC A;  2PPP A;  1Q6H A;  3RM8 A;  4DWS C;  3O5F A;  3TC5 A;  1UR9 A;  2RSE A;  4O2T A;  4DRM A;  3CHF A;  1ROU A;  3KAB A;  3WIJ A;  1OGG A;  3JYJ A;  3KAD A;  3NI6 A;  2MLX A;  2XP8 A;  3RM4 A;  4DH0 A;  1ZU8 A;  1W26 A;  5HBF A;  1HJV A;  1LL7 A;  3OOB A;  3WD1 A;  1KFW A;  3ARW A;  2D9F A;  2WM0 A;  4ODK A;  2FDM A;  2XPB A;  4DZ3 A;  1OGB A;  3LUO A;  4DRK A;  5I98 A;  2XP5 A;  2XP6 A;  1Q6U A;  1HKI A;  5HT1 A;  1FJD A;  4LAV A;  2F2D A;  2ESC A;  3KAG A;  1F8A B;  4MPK A;  1E6N A;  1JNE A;  2RUQ A;  2DG4 A;  1ZB5 A;  4BF8 A;  1HJW A;  1ZBK A;  2PV3 A;  2ITK A;  5DIV A;  1ZL1 A;  2KI3 A;  1ZCN A;  3ODK A;  2A3B A;  3KAH A;  4MNM A;  1YW5 A;  3WL1 A;  1LG2 A;  1NWR A;  4NNR A;  3W4R A;  2DSZ A;  3UQB A;  2YBU A;  1J6Y A;  2A3C A;  1HKK A;  3KZ7 A;  4LAX A;  3UQA A;  3PR9 A;  2O92 A;  5HUA A;  1H0G A;  3KAI A;  3JYM A;  5HWC A;  5BXJ A;  2ZR5 A;  2AWG A;  1E15 A;  4DRN A;  2M2A A;  4Z2I A;  1KT0 A;  2MLZ A;  1FKB A;  4DWS D;  3UI5 A;  1LL4 A;  3AS3 A;  4MGV A;  1FAP A;  4R0X A;  4AY1 A;  4U84 A;  3B7X A;  4MNL A;  1J4I A;  2UZ5 A;  4LGX A;  4WKA A;  3ARQ A;  3WQV A;  1W9P A;  4ODR A;  4W5U A;  1XHG A;  2LKN A;  5J6E A;  4TW6 A;  4W9P A;  4U86 A;  2MPH A;  3ARX A;  2VCD A;  3WKZ A;  1D6O A;  1W1T A;  1IX5 A;  1QPL A;  5HW6 A;  1JNS A;  4IQ2 A;  3O5I A;  2IF4 A;  4DRP A;  2AOS A;  2B31 A;  4Q22 A;  4QT2 A;  1E6Z A;  2LJ4 A;  2ZQV A;  2ZQT A;  2PV1 A;  3B8S A;  2K8I A;  3TCZ A;  4MAV A;  5DO2 A;  2XPA A;  3I6C A;  1X6L A;  4G50 A;  4C02 B;  1FFQ A;  1UR8 A;  2PV2 A;  4DWS A;  5B8I C;  1E9L A;  3AQU A;  1BL4 A;  3ARO A;  5DIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...