2JZYA

Solution structure of c-terminal effector domain of putative two-component-system response regulator involved in copper resistance from klebsiella pneumoniae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
b'MAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIREE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein PcoR
publication title Solution structure of C-terminal effector domain of putative two-component-system response regulator involved in copper resistance from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2jzyA00
1GVJA 3NEUA 4ON0A 5LHIA 1T38A 2PFBA 5E8GA 4FX4A 4KN7X 3LAJA 1S3JA 4EGYA 4ZYDA 4LD5A 2P5LC 4OIRF 3P9CA 1KU3A 1ZHFA 1V3FA 2GXBA 3GFLA 2EFNA 5L3FA 4OMYA 2CSOA 3PQJA 2R7DA 4BHPA 1MJAA 4UXNA 3I0TA 3F22A 3LQQA 3VEPA 5CVVA 1ZARA 1R58A 3GUDA 2L01A 4AWXB 5L3DA 4KUMA 3J80K 2RV8A 5BOXA 1FPQA 4XSZF 5D6EA 4EVIA 1KQ0A 3EQLF 1ON1A 4KIFA 4WCGA 1I27A 1R22A 4MGRA 1KU7A 4XLNF 3RPQA 4HX4A 5DEQA 4EJVA 5FO5A 5HDKA 5D6FA 3GZ6A 3Q9VA 4EJOA 1SFUA 1TLHB 3HUGA 2VBYA 2NYXA 4EM1A 4U0YA 4R1HA 2EK5A 3BP8A 4I2OA 1X3UA 4O6JA 4RB1A 1R1UA 1QPMA 4HX7A 3QOPA 2P8TA 1BIAA 1UCRA 4KIBA 1DPRA 4P5OA 2FE3A 4Y17A 3L7WA 4G7ZF 3CLOA 3QRFF 1RZ4A 4IPAA 1O3RA 4HZFA 2XAJA 4FHTA 3I4PA 3IHUA 3KCCA 3H92A 1TNTA 3DP7A 2ETHA 1YO5C 1YS7A 5CYVA 4MHGA 4WWCA 3I54A 5JI6A 5FLXZ 3M8EA 3I64A 4EM0B 1RUOA 1SFEA 3ABUA 2QBYA 5DCMA 2OA4A 2W24A 4I0AA 4UVCA 2PN6A 5HLHA 3HTUA 1IXRC 5FD6A 3ELKA 5HOOA 4CYDA 3T8RA 1B9MA 3MQ0A 3VOEA 3J80Z 3VFZA 2VE8A 2KRFA 1XDSA 4ZYEA 1BOAA 4IJAA 1P4XA 1I1GA 3RJPA 4IVNA 2WTEA 3BZ6A 4G9YA 1TTYA 3F21A 4I01A 5K5RA 4UUVA 4BHCA 5E17F 2HR3A 4HF0A 2D1HA 3GXOA 2GZWA 4RAYA 1YS6A 1YLFA 1BI0A 2YPRA 1GXQA 3VB2A 4MTDA 3DEUA 3QP5A 2VC1A 3E6BA 4RGRA 1J7KA 2JT1A 2UWMA 1LQ1A 1Z7UA 1TNSA 1LJ9A 3KEOA 3ROUA 3L09A 3DPTA 1O3QA 5BPIA 2ESNA 1D8KA 1VTNC 1MZBA 4K2EA 4JQFA 5TJJA 2KIFA 2ACJA 3LA2A 1USTA 2RDPA 3F6VA 2VBXA 4L5JA 4GO1A 4AD9A 4ENNA 4KN4X 5JFRA 1W4MA 4I09A 2HDCA 1FLIA 2BYVE 1OYWA 3KP7A 2HS5A 2V9VA 4KA4A 5LBQA 1ONVA 3T1BA 2JRTA 5H20A 3GFMA 1O57A 2AXLA 3O3KA 4HV5A 2QLZA 3ERED 2BBYA 2IT0A 1E2XA 3KP5A 1Z1DA 2B0LA 1TQIA 4LGWA 4LJZF 3LSTA 1ODDA 3GX4X 2LSOA 4N0BA 5E8IA 4GGGA 1S29A 2P6SA 3TKYA 5D5XB 3QP6A 2PJPA 5CJ9A 2L3DA 2KIUA 2OAZA 5K1YA 3T0YA 3FMSA 1XDUA 3TOAA 3FXQA 1QZYA 3FM3A 1OYIA 4UVBA 3BDDA 5K5OA 1A04A 2W85A 3G3ZA 3KP2A 4BAYA 1HKTA 2P5VA 3DF8A 4HQEA 2GQQA 5E1ZB 2DW4A 2W25A 3C3WA 4NHJA 3P7NA 2H6CA 2YX4A 2ZBKA 5JHUA 1W7PB 4M9SA 3F23A 1T0FA 2PBIA 1BIBA 3M8FA 3WTWC 2O03A 1Z91A 1XGMA 3T8TA 4PCQA 2NRAC 2IA0A 3GFIA 2G9WA 1SMTA 2QQBA 2PMHA 1FBSA 3HRUA 2Q0OA 2FBKA 1QNTA 2M8EA 3WTTC 4G8XA 3F8FA 3M1EA 2Z9OA 2UXXA 3K9TA 2XAGA 1G4DA 1H9GA 1MDMB 2STWA 1Y0UA 3LA7A 1U78A 3WTVC 1ZG3A 5E1WA 1FP1D 2YX7A 5J6XA 2A6HF 5JVTA 4U88A 1XN7A 5CVIA 2D1VA 2IPQX 1STZA 3PQKA 2EJRA 1XMAA 4ZYHA 2XKPA 2HFHA 2D2WA 3K1PA 2QWWA 3LFKA 4N9IA 5ICEA 1JHHA 2G7HA 4OMZA 1U5TA 2DPUA 4L9TA 1K6OA 3QAHA 4A6EA 3SQNA 2A61A 1UFMA 3KE2A 1WSUA 2QM3A 4KIGA 4KFCA 4CO8A 1QQIA 1MGTA 2Y75A 1IAWA 3M7GA 4M72A 1ULYA 3NQOA 4G94A 2EFWA 3RKWA 2H09A 2DBBA 1YTYA 2NS0A 3FXUA 2G7UA 2E1NA 3C1DA 2IA1A 1HKSA 4M6YA 5DUKA 2OBPA 3GLXA 5DYMA 1B6AA 1B1BA 3RTRA 4CXFA 4ZZLA 4RGXA 3ISPA 3DPLC 1HBXG 2RC4A 4QLCU 3H3ZA 3HRTA 5J8FA 2Z3YA 2V1XA 1D5VA 2H6BA 2DQRA 4LK1F 3R0AA 2GIVA 4M6XA 3WGGA 3I59A 1IW7F 2IVMA 2QBYB 5DCMB 1U6GA 4LG0A 3MZYA 3CUQC 2VC0A 3GEZA 1SD5A 2CQKA 2P5KA 4HOBA 3N4MA 2IRFG 3PFIA 1Z6RA 2W84A 4CHUA 2RNJA 2ZMEA 1BC7C 3BJ6A 1WWXA 1JXSA 3C7JA 2W57A 4D0PA 3AAFA 2V1UA 4XRFA 2DFIA 5D8KB 3MWMA 5CLSA 2P7CB 3ABTA 5F64A 3EETA 4LFUA 2E1CA 3BJOA 2VODA 1MDMA 3U1DA 5BMZA 1ZN2A 4HAMA 4FT8A 3DKWA 1W5TA 4L0ZB 3OV8A 1HW5A 2EWNA 4LLNA 4YFNF 2M87A 3EUHA 4O5VA 3LQRA 5ICFA 1G3WA 1QO0D 4TV7A 2EFPA 4P96A 2DQLA 2LNBA 4MNUA 2XAFA 2HWVA 5FLXK 3I71A 1FSHA 5A2QK 4A0ZA 2FBHA 2ZNZA 1S7OA 5FFXA 3WTYC 3QU6A 1ZAOA 1D8JA 4RAZA 2K27A 1DPUA 1YW9A 4BNCA 4DQ2A 2V6CA 2IW5A 3BPVA 4Z2YA 3RPUA 2V79A 3TDZC 1J59A 1FC3A 1DDNA 1F1ZA 3FXRA 3KLNA 1FY7A 2GAUA 1O7FA 1R23A 1RUNA 3F8MA 2XAQA 5LRRA 2XASA 3L9FA 2FNAA 2KIMA 1XGOA 1ZGAA 3VODA 3V8LA 1L3LA 5E18F 3ZMSA 3R6SA 5KK1A 2ZO4A 1BN5A 5HLIA 1GXPA 2VBZA 4AIHA 4OIPF 3EYIA 3Q5FA 1G6NA 1AWCA 3TDUC 4ESBA 2LDUA 1QGPA 1P2FA 5A2QZ 3FX3A 4U7DA 4G6DA 2K86A 2FA5A 4L9VA 3U9GA 4KNYA 2P4WA 2M1BA 2JPCA 1SMYF 1GHCA 2BE5F 2IP2A 5LRSA 3OOPA 1BM9A 1BI1A 4KMFA 3E5QA 2EA2A 3O6BB 2XIGA 2BV6A 1ZRDA 4EQQA 1O3SA 3B02A 1HKQA 4RB0A 1W5SA 5LGNA 3SFZA 4ASNA 1D3YA 1YYVA 5ILVA 3IWZA 5LHGA 2HGCA 1IRFA 2QENA 3GF2A 2JPBA 2H27A 2NAZA 3GYHX 1FYKA 3HTSB 3BOQA 2FXAA 1K79A 2HKXA 2M45A 3HHGA 4RB3C 4RB2C 3KETA 1K78A 1PP7U 5K5QA 2ZXJA 3MFKA 5H6QA 2WC2A 2Y48A 2QVOA 1R7JA 3C18A 1FYMA 3HRSA 1MJ9A 4HF2A 4GCVA 6PAXA 1RNLA 1U5TB 3IKVA 4A5MA 2LF7A 3N97A 2VN2A 3WTUC 1XB4A 1ON2A 5D5WB 2PLYA 1BI2A 3K1MA 5DD8A 2OZUA 1Z6TA 4RGSA 3KP4A 2OD5A 4YFXF 3SXYA 1H9TA 4ESFA 2VT2A 4O3MA 1BI3A 3F72A 2MLKA 4BQAA 2J5PA 2X0LA 4ESJA 1MKMA 2CYYA 3V4GA 3KZYA 3ZMVA 2L02A 3BROA 4I0BA 3DXJF 1BC8C 1EV7A 3ZPLA 4IXAA 2VOOA 1H0MA 3IKTA 1B9NA 1EH8A 1HSTA 2ELHA 4IF4A 1G3YA 1P92A 2R3SA 1YW7A 3I59B 4GYGA 1Z05A 4XLPF 2DU9A 1SD7A 4BHBA 3CO6C 3E5UA 4LG0B 3H3UA 3I5UA 2H94A 4BYYA 3J81Z 2ZMEB 4UHTA 1JGSA 3QPTA 3RYPA 2DK8A 1JHFA 4OU0A 4UV9A 1WRJA 2P7VB 1F9NA 3RKYA 1CF7B 3KP6A 1WQ2A 1YW8A 5HS9A 3Q9SA 1IN6A 1U8RA 3ULQB 3GO5A 4M9ZA 4G6QA 2FU4A 3CUOA 5H6RA 2XVCA 3V8KA 2HYGD 1LDDA 2GXGA 4NB5A 5L3CA 4F7ZA 4HLXA 2ISZA 2O6GE 4YG2F 3ECHA 1XCVA 2K7LA 1YG2A 2KJCA 3E6DA 1CGPA 1R1TA 3F8CA 3MAJA 1C0WA 4PDKA 4Q5SF 4WXCA 2XROA 2R7FA 4UVAA 2FBIA 2A3SA 4Y13A 3GVAA 5HDGA 2O8XA 4HBLA 1F4KA 1R5GA 4S04A 2ZNYA 3ZN0A 4KYWA 1YQAA 3IRQA 3WE3A 1XSDA 3JSPA 5D5VB 3L2CA 4I98B 3TO9A 4A6DA 3M9AA 4OINF 2FMYA 1G3SA 5ILSA 1PDNC 2RN7A 2O0YA 2DK5A 1L0OC 3HOTA 4Q48A 4WX9A 2WV0A 4YIFA 2J5OA 1KQ8A 3WE2A 4FX0A 1ZLJA 2F5FA 2BGCA 2AS5F 4B09A 5ILUA 1DP7P 4MQVA 3ZN1A 3KFWX 1OKRA 4UNOA 2A68F 1IRGA 2JSCA 2EV0A 1PUEE 1ZH5A 3WTSC 1U3EM 3SHFA 2CFXA 1FBUA 3W6JB 3ZQ7A 3IL2A 3RKXA 3TOBA 1LNWA 1SAXA 1LDJA 2CG4A 1FYLA 1HW2A 5BPDA 3WGIA 1FX7A 4HDVA 1T2KA 1PP8F 5D4RA 2MA3A 1KYWA 5DCFA 3IRRA 2PI0A 2OQGA 2ZJ2A 4KICA 2L4MA 4P9UA 4S05A 4PGGA 2QYOA 3CUQA 3COAC 5TRDA 4R79A 1R36A 4L0YB 1J75A 2DO7A 1KA8A 2FEZA 1REPC 2PEXA 2FNPA 5EEHA 1UHMA 3D0SA 2FRHA 2DPDA 2LF8A 2UXNA 4Y15A 3GZ5A 2GWRA 2RGVA 5IT3A 2XUBA 1CF7A 3QU3A 5D4SA 2PQ8A 4WXDA 1IN7A 2YU3A 2EV6A 3BY6A 4ENMA 3ZP5A 4A0XA 5BQTA 1I1SA 5LGTA 5ED4A 4BH9A 1YIOA 2VE9A 3KLOA 3TQNA 5J8CA 4HDUA 1U2WA 5FD5A 2HOEA 2VXZA 2ADUA 2O3FA 1T39A 3FMRA 3GFJA 4A12A 3DQVC 2DT5A 2TDXA 3CO7C 3MZHA 1K78B 4A2UA 3I58A 3JSOA 5HS7A 2K4BA 3JW4A 4CZZA 4ZYGA 2GA1A 2HTSA 1XCBA 3BPXA 1ZRFA 5L3GA 4M9XA 2D45A 4OIOF 2XGXA 3IWFA 2OU2A 2MH2A 5DV5A 4HYEA 1SFXA 5FB2A 1MJBA 2IJLA 3LA3A 3F6OA 3P9KA 2UZKA 4EJWA 3CTAA 1B4AA 1ZYRF 5DUIA 3FMQA 1IXCA 3RDIA 3WTZA 1XD7A 2HZTA 2DI3A 1KU9A 2VT3A 1W7PD 3ZMDA 3K2ZA 2WWYA 4L9JA 2F5CA 4YIIA 3TGNA 5HVQC 4MEYF 2EFQA 1FSEA 4ZH4F 4P55A 3ZMUA 3RYRA 2PG4A 5IT9Z 2EV5A 3QPHA 3HYIA 2YR2A 1P4WA 3P9IA 2HQRA 3ML6A 2C6YA 1OR7A 4P9FA 1HW1A 4N9HA 2CGPA 2NNNA 4EGZA 4IHSA 2VOPA 2FQ3A 4CDGA 4HX8A 3KZZA 2HQNA 4RS8A 2Y0MA 3K0LA 3WU0A 4G7HF 2QQ9A 1V4RA 3E3VA 5LEKA 4LK0F 1KQ9A 3FF5A 1T6SA 1LVAA 2FOKA 4PZJA 1XGSA 5HDNA 2JZYA 2MLGA 3BWGA 2EFOA 5F6FA 5HS8A 1LEBA 5LLQA 3F8BA 2BEOA 4OOIA 2A5YB 1KGSA 2RKHA 3E6CC 4IHTA 5HLGA 1AOYA 4LB6B 3L00A 4RGUA 1USSA 1J9IA 3F8NA 1OPCA 1ZG1A 1LDKB 3I53A 3ZMTA 4NQWA 3HSEA 4I02A 4LLLA 1B59A 2L54A 5E1XA 5JR3A 5AONA 3SZPA 2KJBA 3DV8A 5L3BA 5ICGA 3LWFA 1WKMA 4M74A 1J2XA 2Z99A 4MEXF 2L4AA 1EH6A 2COMA 4BXUA 3HHHA 2XKOA 1RIOH 5LEJA 1JE8A 4AIJA 4OIQF 3J7AO 2Q2EA 5E20A 4EV0A 3WODF 4IRIA 4MQ9F 1WI9A 2DLLA 4M71A 3J81K 4GXOA 3R0JA 4E70A 1ZLKA 1TQPA 4EJUA 5BS6A 3JTGA 1TBXA 1IF1A 4KMUX 3WTXC 4U0VA 2MBFA 4CGZA 4U0WA 1IXSB 2F5EA 2NNYA 4L9NA 3WU1B 1UHWA 2XAHA 3FHZA 3WG9A 2V1DA 2ZFWA 2XV4S 3B73A 1EH7A 3ZMZA 2OQRA 1T98A 2DAOA 3LAPA 2K4JA 1IN8A 1K7AA 2LKPA 4ENKA 1KYZA 2FF4A 5D8LB 4A0YA 1HXDA 3K1NA 3CJNA 4M73A 4PGHA 1HQCA 1S7AA 4UV8A 1FWZA 4H0EA 1BJAA 1FBQA 1IN4A 3RIRA 1I5ZA 5CVJA 3ECOA 5F1RA 1MD0A 4GYIA 4DNCA 2RVCA 3REOA 3CUQB 5D5UB 2E7WA 3FWEA 5AIPA 1XMKA 1FP2A 3V7RA 2A07F 4JBAA 4L18B 4EM2A 2E7XA 2YSRA 4IRHA 3EYYA 3T5XA 1FOKA 2F2EA 3TO7A 3KP3A 2HEOA 2A69F 2Q8KA 1LEAA 2K02A 3GW2A 1BBYA 2O61A 1IUYA 1O7LA 1KU2A 2DTRA 4MTEA 2Z5UA 2JTVA 2STTA 4XSXF 3IC7A 1TQMA 1ZREA 3HRMA 1J0RA 3TO6A 1R5HA 2QUFA 3KEQA 2EA4A 2HKOA 4YFKF 3WGHA 1NHAA 1UB9A 2ESHA 1Z9CA 1FT9A 1ZG5A 2VBWA 2QQAA 1O3TA 1XGNA 3NRVA 5FGMA 1S8NA 3F3XA 1XSXA 1XSVA 5CVRA 3HSFA 4XBFA 3RI4A 3E6MA 4IRGA 2MH9A 2VONA 3JAMK 4HLYA 1TW3A 2F5DA 3V7CA 5FFZA 3GWZA 1DUXC 3G73A 5ICCA 4LLGF 4A5NA 4EMSA 4U7BA 1J5YA 3FZVA 1E17A 2ISYA 4HQMA 2MC3A 3MEXA 4Q47A 3D5LA 1LB2A 3JTHA 3HOSA 1U5TC 2MD5A 4ENJA 1R00A 2M30A 5DD4A 2CO5A 4EJTA 2XHKA 3DFGA 2IA2A 3R60A 2M5WA 3HSRA 4AIKA 1G3TA 3SZTA 1QBJA 2A6EF 3E5XA 5AIQA 1RI7A 4HA8A 1SD6A 1R1VA 4Q4ZF 2PMUA 4L5IA 2ZCWA 3BJAA 2FSWA 4I7HA 4LB5A 4B8XA 2GA2A 5DDGA 3U2RA 4AVPA 1P6RA 3W6KB 1SD4A 4WK8F 1HSJA 2CW0F 5CVUA 5KVRA 3JAMZ 1F5TA 4HF1A 4ZZDA 5L3EA 4WXHA 4KT5C 4R8HA 4HV6A 1I6XA 1IZ1A 3EDPA 1Q1HA 2Z33A 3S2WA 1S6LA 4HW0A 3MCZA 1ZRCA 4JK1X 2OZ6A 3K69A 3R4KA 1W7PA 3CDHA 4WF2A 1TW2A 1FZPB 3V8JA 1ZGJA 2HYFA 2P6TA 1OYYA 2CWEA 5ERIA 5IT9K 2KKOA 2QZ8A 4CICA 2RQPA 3FM5A 2EB7A 3HIFA 2X4HA 4QWQA 4KDPA 2FMLA 1QZZA 2XRNA 5LHHA 2ZKZA 3E97A 4ETSA 2HTJA 5EEGA 4G7OF 1P4AA 3O2PE 1IN5A 1FNNA 1YFHA 1OMIA 3R61A 5LGUA 3V7SA 4LMYA
chains in the Genus database with same CATH superfamily
5TISC 1GVJA 3NEUA 4ON0A 5LHIA 1T38A 2FJ1A 2WA0A 2PFBA 5E8GA 4FX4A 4KN7X 3LAJA 1S3JA 2DA6A 3BTIA 3OR1C 2Q2EB 4EGYA 4QPQA 4ZYDA 4LD5A 2P5LC 4OIRF 3P9CA 1KU3A 1ZHFA 1V3FA 2GXBA 3GFLA 2EFNA 5L3FA 4OMYA 2GOMA 3JR9A 1LVKA 2CSOA 1V5GA 3PQJA 2R7DA 4BHPA 1MJAA 4UXNA 3I0TA 2M7BA 2JA7J 4Y33A 3SDGA 2I8DA 2DODA 3F22A 3LQQA 3VEPA 5CVVA 1ZARA 1W36C 1S72I 1RKTA 2M9HA 3LSIA 3S1MJ 4I76A 1R58A 3GUDA 2L01A 3PL8A 4AWXB 3OIOA 4RLFA 3VYSB 2RAEA 1AKHB 5L3DA 4IKFA 4KUMA 3J80K 2RV8A 5BOXA 3J7AY 1FPQA 5M3MJ 2DMUA 4XSZF 5D6EA 2NVUB 4EVIA 1KQ0A 3EQLF 1ON1A 2JWTA 4KIFA 2X9DA 1I27A 4WCGA 3HOYJ 1R22A 2ZFUA 4MGRA 1KU7A 4XLNF 3RPQA 2IGMA 4HX4A 5DEQA 2JRMA 4EJVA 2L5QA 5FO5A 1MBFA 5HDKA 5D6FA 3GZ6A 2HNHA 3Q9VA 4EJOA 3TEDA 1SFUA 1RKWA 1TLHB 1XC5A 3HUGA 2VBYA 2NYXA 4EM1A 2E2IJ 4U0YA 4R1HA 2EK5A 2X6XA 3BP8A 2X6YA 4I2OA 1X3UA 4O6JA 4RB1A 2P0WA 1R1UA 3A0BC 3IP4B 4H4KC 1QPMA 1K4TA 1IJWC 1YJNI 3PO2J 4A3FJ 5FLVA 2DOFA 4HX7A 4ITVA 2EINH 3QOPA 2X1CA 2P8TA 1BIAA 1UCRA 3OS0A 4KIBA 1DPRA 1HLVA 4P5OA 2FE3A 4C9YA 2OTJI 4Y17A 3L7WA 3CCVI 3CLOA 4G7ZF 3QRFF 1RZ4A 4IPAA 4D7MA 4HZFA 1O3RA 3GTQJ 2WY7Q 2XAJA 4FHTA 2EZKA 3I4PA 3IHUA 4PSWA 4AU7A 3KCCA 3H92A 1TNTA 2CQ7A 5KAIC 2BZTA 3DP7A 2ETHA 1YO5C 1YS7A 3W2WA 4N4OB 5CYVA 2DFHA 2BW3B 4BS9A 4RLQA 3SEZA 1X2MA 2X1EA 1W36D 3V42A 1MH4A 4MHGA 2IS4A 4WWCA 3I54A 1U9OA 5JI6A 5FLXZ 3M8EA 3I64A 4EM0B 1OR7C 1RUOA 1SFEA 3ABUA 2QBYA 2R7XA 2BVLA 3DBHB 5DCMA 2OA4A 2W24A 5J1YA 4BBSJ 3DBLB 4XLHA 3SDBA 2LP0A 2W82A 3SJMA 2WAFA 1VNDA 4RM3A 2M7AA 4I0AA 3KPHA 4UVCA 4BL0B 2PN6A 4DBRA 4F52A 2CUJA 2NVTJ 3FK7A 5HLHA 3N05A 4XRSG 3HTUA 1S7EA 1IXRC 5FD6A 3ELKA 5HOOA 4CYDA 3T8RA 1B9MA 2E5ZA 1EKEA 1K83J 4P1WA 3MQ0A 3VOEA 2PJRA 3J80Z 3VFZA 2VE8A 1VQ8I 2KRFA 3HOWJ 1XDSA 3X2QH 3I9V2 3K4NA 4CA0A 4JP0A 4ZYEA 1BOAA 4IJAA 1P4XA 1I1GA 3RPUD 3JRFA 3H5AA 2HOSA 1JGGA 4L5EA 3RJPA 4IVNA 2WTEA 3BZ6A 4G9YA 2JVGA 1TTYA 3PSIA 3F21A 4FTHA 4I01A 3OYAA 5K5RA 1MIJA 3PNVA 4UUVA 4ZDLA 4BHCA 5E17F 2HR3A 4HF0A 4CH7A 3KZIC 4RA2A 1QRYA 5GAEJ 2D1HA 3L1PA 3GXOA 5IP7J 2GZWA 4RAYA 1YS6A 1YLFA 3CZ6A 1BI0A 2YPRA 3CJRB 4UB8C 1GXQA 3VB2A 3S93A 4MTDA 3DEUA 4DYRA 3QP5A 5F1JA 4IHVA 4Y52J 2VC1A 2VPRA 2MG4A 3E6BA 2WAQA 2VI6A 1OLTA 3BR0A 3SEQA 3K4CA 4RGRA 1R71A 1J7KA 2JT1A 1NK2P 2R7ZJ 2UWMA 1LQ1A 3BQZA 1Z7UA 1TNSA 2R7WA 4UY8I 1LJ9A 4A3JJ 1VQOI 3KEOA 3ROUA 3L09A 3CCQI 1I3AA 2A5WA 3DPTA 3F0CA 1O3QA 2K3FA 5BPIA 2ESNA 1D8KA 1VTNC 1VFCA 1E3PA 2JUCA 3EUKL 3BG7A 1YRNB 1MZBA 4YIRX 4K2EA 5IYCJ 4JQFA 4RM2A 5TJJA 2COBA 2EZLA 2KIFA 2ACJA 3LA2A 2R7QA 1USTA 2RDPA 3F6VA 2VBXA 4L5JA 4GO1A 2KFDA 4AD9A 4ENNA 4KN4X 5JFRA 1W4MA 2Q1ZB 4I09A 2L9SA 3BG3A 2HDCA 1FLIA 2BYVE 4BQNA 1OYWA 3CESA 1FOWA 2JA2A 3KP7A 3J7ZI 2HS5A 2R92J 1OCTC 2V9VA 4KA4A 5LBQA 1FIAA 1ONVA 3T1BA 2JRTA 2L7MP 4HSRA 5H20A 2DOEA 3DU5A 3TBIA 3GFMA 1IV8A 1JTXA 1O57A 2AXLA 3O3KA 4HV5A 3HXLA 1TWGJ 2QLZA 4PFPA 5GTIC 3LSRA 1HDDC 3ERED 1Z21A 5JVGF 2BBYA 1ORKA 2IT0A 1E2XA 3KP5A 4C2TA 1Z1DA 1FMWA 4XL9A 2B0LA 3AFHA 1NK3P 1ACIA 5FRNA 1TQIA 2R7OA 4LGWA 3S32A 4LJZF 2GM4A 3VYRB 2V9KA 3LSTA 5C4JJ 4RAFA 3AG1H 1DP3A 1ODDA 1E3HA 3I55I 3FBIB 3GX4X 2LSOA 1VQPI 4N0BA 4A3CJ 5E8IA 5K7HA 3H5NA 4GGGA 1UMQA 1S29A 2P6SA 3K7AJ 3TKYA 5D5XB 4DGWB 2A05A 3HEFA 3QP6A 2PJPA 4E7LA 5CJ9A 2L3DA 5IOYA 2KIUA 2OAZA 1LUJB 1B72B 1YX5A 1TWFJ 5K1YA 3T0YA 3FMSA 4OAZA 3GTPJ 1XDUA 3TOAA 1W1WE 3FXQA 1QZYA 3FM3A 3CCYA 1OYIA 2ID6A 4UVBA 3BDDA 4B1RA 1VI0A 5K5OA 2KDZA 4PUSA 1FTTA 1A04A 3H1CA 4AUXA 1OCPA 2W85A 3G3ZA 3KP2A 3I4MJ 1MBGA 4BAYA 1UZCA 1JTYA 3KIOA 1HKTA 2P5VA 3GTKJ 3DF8A 2WB1A 4HQEA 2GQQA 5E1ZB 3OL4A 1D5YA 2DW4A 2W25A 3C3WA 4NHJA 1WJCA 3P7NA 2JUGA 3L2QA 1X1BA 3UR3C 3S16J 1SEUA 2H6CA 2YX4A 2ZBKA 2VQLA 5JHUA 1D1BA 1W7PB 4M9SA 2HXOA 5KNLA 5FROA 3F23A 1T0FA 3BQYA 2PBIA 1BIBA 3M8FA 1MMGA 3IH4A 3WTWC 4J19A 1YHQI 2O03A 1Z91A 1XGMA 3T8TA 4IEJA 4CYCA 1R49A 4PCQA 5KCMA 2NRAC 2IA0A 3FHNA 3GFIA 2OF7A 2G9WA 2DFEA 1SMTA 2QQBA 2PMHA 5IP6A 4XMYA 1FBSA 3HRUA 2Q0OA 3NWSA 2FBKA 5F08A 1E0EA 3CF2A 5IPAA 3BR3A 3ESWB 3HBLA 1QNTA 3OIPA 1YX3A 2K9SA 4BXFA 2M8EA 3WTTC 4G8XA 3LSPA 3F8FA 3M1EA 2Z9OA 2UXXA 3K9TA 2XAGA 1G4DA 1H9GA 1MDMB 2STWA 1Y0UA 3CCUI 3LA7A 3UNGC 1U78A 1X58A 4A3IJ 3WTVC 1CQTA 1XTAA 2DA2A 1ITYA 3OS2A 1ZG3A 2NOGA 5E1WA 3GTOJ 1FP1D 4EATA 2Y31A 4RDUA 2MYSA 2YX7A 5J6XA 3OY9A 1MNDA 2A6HF 3BTJA 4NC7A 4AVZA 1GVDA 5JVTA 4U88A 1VQKI 1XN7A 1TT5B 2E36A 1NG6A 5CVIA 2D1VA 3OYEA 2IPQX 2H8WA 1STZA 5J1RA 5E3NA 4JX4A 3PQKA 4GRIA 3WG7H 3LNQA 2EJRA 1XMAA 4ZYHA 4CCKA 1JUPA 3JRIA 2O9LA 3FBNB 2XKPA 2HFHA 2D2WA 2LYCA 3K1PA 1LKXA 2QWWA 3LFKA 4N9IA 1D1CA 4S0HB 5ICEA 2W7NA 3S3NA 3KYLA 1JHHA 2L0KA 2G7HA 2KRHA 3Q0UA 2JSPA 4OMZA 2VKEA 4M6VA 1U5TA 2DPUA 4B47A 3U21A 4L9TA 1K6OA 3QAHA 1WCMJ 4A6EA 3SQNA 2OCCH 1RC9A 2A61A 1UFMA 3KE2A 1WSUA 3I3LA 1PUFA 2QM3A 1JI8A 3QODA 2KP6A 1D0ZA 4Z6YA 4KIGA 4KFCA 4CO8A 1NTCA 1QQIA 1MGTA 2Y75A 3QYBA 4A3GJ 3HOVJ 3PIOF 3C2BA 1IAWA 3BTCA 3M7GA 2M0MA 4M72A 4IHYA 3GTMJ 1ULYA 4HNVA 3NQOA 4G94A 3OYBA 2EFWA 2EILH 3PUBA 3BTLA 3HUGB 2AQEA 3RKWA 3RQIA 3AL0B 3M3YJ 1GV2A 3HGYA 2H09A 1XX5A 2ZSIB 3OIQA 1ZGWA 2DBBA 1YTYA 2NS0A 2XC7A 1UHSA 3FXUA 2G7UA 2E1NA 3C1DA 5C4XJ 1D0XA 1ETYA 2IA1A 1HKSA 4M6YA 4XKWA 5DUKA 2OBPA 3GLXA 5DYMA 3JRBA 1JKPC 1APLC 1Y6IA 1IV6A 4IZZA 3KX2A 3DBRB 1ETOA 2IGOA 2VUMJ 1B6AA 1B1BA 3RTRA 3ERMA 4CXFA 4ZZLA 4RGXA 3ISPA 2AQFA 2OCEA 3DPLC 1HBXG 2RC4A 3LSMA 2QEXI 4QLCU 3H3ZA 3A01A 3HRTA 5J8FA 2Z3YA 2V1XA 1D5VA 2H6BA 2DQRA 2XPWA 1S5LC 4KJZA 4LK1F 3R0AA 1D1AA 1ZTRA 2GIVA 2TCTA 4EEFG 2DMPA 1MMDA 4M6XA 3WGGA 5M5WJ 3WHBA 1BW6A 3OYCA 2IEKA 3I59A 3DU6A 1QVTA 1IW7F 4MFDA 2IVMA 2QBYB 1E3OC 5DCMB 1U6GA 3HC7A 4HPQA 4LG0A 1OCOH 3MZYA 2NS7A 3M4OJ 3CUQC 4HG2A 2VC0A 3GEZA 1SD5A 2CQKA 4I99C 2KL4A 2P5KA 4HOBA 3N4MA 2IRFG 2E71A 3PFIA 4XLAA 1Z6RA 2W84A 4CHUA 1JUSA 2RNJA 2ZMEA 1BC7C 3BJ6A 5EGOA 1R6RA 3L2RA 2EIKH 1WWXA 4ZDOA 1JXSA 3C7JA 1WZ2A 2RQQA 2W57A 3SYTA 1GUUA 4D0PA 3AAFA 3O8HA 4G12A 4V2GA 2V1UA 4XRFA 1U9NA 2DFIA 4D5FA 1I6HJ 1VQ7I 1TT0A 5D8KB 3MWMA 5CLSA 2P7CB 1G8XA 1SVLA 2FUG2 4A3EJ 4ZTFA 2R7RA 3ABTA 5F64A 3EETA 4LFUA 2E1CA 5HODA 2LOOA 2X6OA 4AC0A 3BJOA 2Z2SB 2VODA 1MDMA 3U1DA 5BMZA 1ZN2A 2F6CA 4HAMA 4FT8A 5TGTA 3DKWA 3DKYA 5DS9A 1W5TA 4L0ZB 3OV8A 1HW5A 2EWNA 4LLNA 3ZQQA 4YFNF 2M87A 3EUHA 4O5VA 2O7OA 3LQRA 5ICFA 1G3WA 1YOVB 1XPXA 1BR4A 1QO0D 4XKCA 4TV7A 5B66C 1DQUA 2EFPA 4P96A 2DQLA 2LNBA 2K9LA 4MNUA 2DJNA 4PJNA 2XAFA 2HWVA 3QOEA 1VQLI 3D5SC 4XK4A 5J47A 5FLXK 3I71A 3WU2C 4AYBA 3BZKA 1QHHD 2V6EA 4IHXA 1MBHA 3QPLA 1FSHA 3K2AA 3O8GA 5A2QK 2ME6A 4XRMA 3OYGA 2YUSA 1UJ8A 4A0ZA 2FBHA 3HKZA 2DT6A 3CJTB 3VYUB 2ZNZA 1S7OA 1VQMI 2VKDA 5FFXA 3WTYC 3QU6A 3BC8A 1ZAOA 2PX9A 1D8JA 4ZYAA 4RAZA 3ZRGA 2K27A 3JRDA 3LFUA 4JYKA 4AM3A 2H1LA 1DPUA 1YW9A 2DTZA 4BNCA 2BOLA 4DQ2A 4DW6A 2V6CA 2IW5A 3BPVA 4F91B 5K7ZA 3C2HA 5FKLA 2LLKA 1MMAA 4Z2YA 2Y2ZA 3RPUA 2V79A 2JMWA 3TDZC 1ETVA 3DWLE 1QPIA 2GIZA 2M0CA 1J59A 2Y30A 1FC3A 5J3LA 4BY7J 2UV1A 4Y7NJ 2CMPA 3DCFA 1DDNA 1F1ZA 3FXRA 2WB1N 3KLNA 2IS1A 1FY7A 2GAUA 1O7FA 2PMZN 1FMVA 1R23A 4PJMA 1K61A 1RUNA 3F8MA 2XAQA 5LRRA 2XASA 1AU7A 3L9FA 4M3GA 1WHUA 2R4GA 2FNAA 4JX6A 2OC6A 2KIMA 1XGOA 4QSHA 1ZGAA 3VODA 1P7IA 3VPRA 4W1UA 3V8LA 1L3LA 5E18F 3ZMSA 3I56I 3JREA 2CV2A 3R6SA 5KK1A 2DYSH 2VASA 3A1YA 2LD5A 1GV5A 3FISA 2OUMA 3H5RA 2ZO4A 2P81A 1BN5A 1YITI 3AL0C 2HVSA 5HLIA 5KAFC 5F0FA 1GXPA 2FD5A 2NS8A 2VBZA 5JLWA 4AIHA 4D9JA 2CUEA 2DMQA 4OIPF 2AXTC 3EYIA 3Q5FA 2ECBA 2EIMH 1G6NA 1AWCA 4V2FA 3TDUC 4ESBA 4XRSA 3OYKA 2LDUA 1QGPA 1P2FA 1X1AA 4MFEA 5A2QZ 2M4KA 3FX3A 4U7DA 4G6DA 4XOPA 2K86A 2LH9A 4IOCF 2FA5A 4L9VA 4X1EA 3U9GA 3OYMA 4CSWA 1H89C 2Z1DA 3PM1A 2R7TA 3PSFA 5EDNA 4KNYA 1YIJI 3GLLA 3FXJA 2P4WA 1YJWI 2M2EA 2L9RA 4KITB 2M1BA 2CU7A 3ZXSA 2JPCA 3S2HJ 3MVPA 1T08B 1SMYF 2WADA 3P5JA 1GHCA 2BE5F 2LKXA 2IP2A 5J4YA 5LRSA 3OOPA 1BM9A 2V26A 2ZXHA 1BI1A 4KMFA 3E5QA 2MGQA 4CYCB 4BE0A 1HF0A 2EA2A 3O6BB 1G2HA 2XIGA 4B44A 3JRCA 2BV6A 1ZRDA 3KYDB 4D5CA 2H8RA 2V4JC 1T8IA 4EQQA 1O3SA 3B02A 1HKQA 4RB0A 1W5SA 2X48A 2ZXWH 2VB6A 3SFZA 5LGNA 1JKQC 4ASNA 2DA5A 1D3YA 1YYVA 1A5JA 2VJJA 3IWZA 5LHGA 2HGCA 1IRFA 5ILVA 2QENA 3AG4H 3GF2A 4J01A 4FASD 3S1NJ 3CMMA 1BJZA 1ZK8A 4PSXA 3OYJA 2MABA 2EZIA 2JPBA 4E7SA 5FKOA 5KHDA 5IY5H 2H27A 2NAZA 3MKLA 2H1KA 3IV5A 1OJLA 3GYHX 5FLMJ 3E0JB 3ZQFA 5H2FC 1FYKA 3HTSB 3BOQA 2W48A 2FXAA 1K79A 2HKXA 2M45A 3NAUA 3HHGA 4RB3C 4NBQA 4MIMA 3EUAA 2LY1A 2VJ5A 4RB2C 5CPRB 4QPOA 3KETA 1K78A 5DM7F 2R5ZA 1PP7U 5K5QA 2ZXJA 2VIXA 5K7FA 1XS9A 3BCBA 3MFKA 3B6CA 1F43A 3WHCA 5H6QA 2WC2A 2Y48A 1DU6A 2QVOA 1T95A 1R7JA 4CCJA 3C18A 1FYMA 4MO7A 3HRSA 1MW7A 1MJ9A 1PYVA 3F9KA 2HOTA 1WI3A 4HF2A 3BG9A 4Y3OA 4GCVA 3DTKA 3PNTA 2NXNB 5GTHC 2HI3A 2CW7A 2HU9A 3K6GA 6PAXA 3IH2A 1RNLA 4ZTJA 1ZR4A 1U5TB 3IKVA 1VQNI 4XLEA 4A5MA 2IGKA 1TL8A 2EZHA 4XLFA 2LF7A 3N97A 1VF9A 4C2UA 3VYTB 2VN2A 2K9QA 3WTUC 2IS2A 4XR6A 4B3AA 2KMUA 1UAAA 1PUFB 3FXOA 1XB4A 1ON2A 5BNGA 2CQQA 4DYQA 4F92B 1SAUA 5D5WB 2PLYA 4KT6A 1BI2A 4HSTA 5EG0A 1Z0XA 3K1MA 5DD8A 2HDWA 5FJ8J 2OZUA 1Z6TA 2R5YA 4FISA 4RGSA 5DM6F 3KP4A 1WJDA 2N8GA 1IRXA 5M5XJ 2HVRA 4C3HJ 4E4HA 3ABMH 3TP3A 4XN0A 2OD5A 4YFXF 3SXYA 5E79C 1H9TA 3DLAA 4ESFA 2CH0A 1V5EA 2VT2A 4DYCA 4BJ5C 4F93B 4O3MA 4BEHA 2VLAA 2VKHA 4BGDA 1BI3A 3F72A 4IHWA 2MLKA 4BQAA 3L2UA 1A31A 2J5PA 4RMNA 4BDZA 2X0LA 3G1LA 2WAEA 2QA4I 2OTLI 4ESJA 3DTEA 1MKMA 2CYYA 3V4GA 3CQZJ 2DYRH 3KZYA 3ZMVA 2L02A 2VQGA 3BROA 1ZKGA 2HQAA 3G1OA 4I0BA 4XKBA 3DXJF 3A01B 3G6EI 1BC8C 1EV7A 3ZPLA 2BHYA 4IXAA 2VOOA 3B6AA 3BR5A 4ZDPA 1PJRA 2LREA 3IKTA 1B9NA 1H0MA 1EH8A 1HSTA 1X1PA 2ELHA 2ZC2A 4IF4A 1G3YA 1P92A 5CQGA 3OYLA 1ETQA 2HOAA 2R3SA 1YW7A 2E60A 1ENHA 1HOMA 3I59B 4GYGA 1Z05A 1MBEA 4XLPF 2AO9A 2DU9A 1SD7A 4BHBA 3S17J 3CO6C 3W2AA 4YELA 3E5UA 1LPQA 4LG0B 2DMNA 3H3UA 4UB6C 4C2MJ 3H0DA 3ZQIA 3I5UA 1X4PA 2CQNA 2H94A 4BYYA 1IDYA 3LSKA 2LKSA 3J81Z 1J09A 2ZMEB 4UHTA 2L7FP 1JGSA 3QPTA 2BVMA 3RYPA 2DK8A 3A0HC 1JHFA 5EGOB 4A3MJ 4OU0A 1N25A 3CJQB 4UV9A 1WRJA 2DN0A 1EA3A 2P7VB 1F9NA 3G2BA 2QSGX 3RKYA 2DCEA 1CF7B 3KP6A 1WQ2A 4GDFA 1YW8A 1B8IA 5HS9A 3Q9SA 1IN6A 4A93J 1U8RA 3H3VK 3ULQB 2OV7A 2F4OB 3GO5A 2BXYA 4M9ZA 4G6QA 2FU4A 1MSFC 4I6ZA 3CUOA 3D5RC 3JRGA 5H6RA 3S1RJ 2XVCA 3V8KA 2HYGD 4PFOA 1LDDA 4CCLA 1T0FC 2IGNA 2GXGA 2X85A 5E3MA 1KONA 4NB5A 2WV1A 4M3EA 3G71I 2MSYA 4E7HA 5L3CA 1MMSA 4LIVA 4NUBA 1A6QA 4F7ZA 4HLXA 1AHDP 2K5CA 2QGUA 4YG2F 2ISZA 3ECHA 2O6GE 1XCVA 2K7LA 1YG2A 3MKYB 2KJCA 2EQRA 3E6DA 3TW7A 1CGPA 1R1TA 3FIWA 3BCAA 3S3MA 4X6AJ 2OPTA 3F8CA 3MAJA 1C0WA 5C44J 4ZC3A 1WH7A 4PDKA 4UUSA 4Q5SF 4WXCA 3G1MA 2XROA 2R7FA 4UVAA 4YRVA 2G0EA 4KISA 2BHZA 4FCYA 2IBDA 3LL7A 2FBIA 4MLOA 2A3SA 4Y13A 2CUZA 3GVAA 5HDGA 2O8XA 4HBLA 5GP9A 1F4KA 1R5GA 4DOZA 2LR8A 4S04A 2ZNYA 3ZN0A 4KYWA 1YQAA 3IRQA 3RSNA 3MKZA 5GPCA 2W00A 3WE3A 2CW8A 4DJAA 1XSDA 3JSPA 2XF5A 3RCOA 5D5VB 5E3OA 3VWBA 2QSHX 4RBOA 3L2CA 4I98B 3TO9A 1QU3A 4A6DA 3M9AA 1JKRC 2KZVA 4OINF 2FMYA 1G3SA 5ILSA 1PDNC 2RN7A 3K70C 2O0YA 1BA5A 2DK5A 5F0HA 1L0OC 3HOTA 1NG7A 4Q48A 4WX9A 1QZEA 2VPLA 2WV0A 4YIFA 3H9JA 2J5OA 1KQ8A 2DJIA 3WE2A 4FX0A 4FE4A 3K4KA 3CMAI 1X3ZB 1ZLJA 2F5FA 2BGCA 2AS5F 3OWTA 4B09A 3BLYA 1WJFA 3DPUA 5ILUA 1U0JA 1DP7P 4MQVA 1RESA 1W5CC 2XPVA 3ZN1A 3KFWX 3PJRA 1OKRA 1V54H 4UNOA 2A68F 1IRGA 2JSCA 1BR1A 1DGRM 2EV0A 4XKVA 4JOMA 1PUEE 1ZH5A 3WTSC 1U3EM 2HQ5A 3CCSI 2RREA 3SHFA 2KDOA 3W6VA 3A02A 3S2DJ 3KEYA 2CFXA 1FBUA 3H9QA 2E35A 4FETA 3W6JB 2VQHA 3ZQ7A 3IL2A 3RKXA 3TOBA 5J40A 1JJ6C 1LNWA 1SAXA 1LDJA 2CG4A 2JK3A 3Q3SA 1FYLA 4CCOA 2LRDA 5BPDA 1HW2A 4A69C 3WGIA 1FX7A 4HDVA 3CCMI 1T2KA 1PP8F 3H9GA 1R5ID 2V1NA 1RR8C 5D4RA 1HA8A 2MA3A 2CQXA 1KYWA 2KRCA 5LD2C 5DCFA 3IRRA 1DGWY 4HEA2 3EPZA 2PI0A 3RKQA 2OQGA 1Y8QB 3GTJJ 2ZJ2A 4KICA 2L4MA 4P9UA 4S05A 4PGGA 1F36A 2QYOA 3CUQA 3COAC 1SVOA 3E7LA 3IAS2 4B43A 5TRDA 4R79A 1R36A 4L0YB 1KZHA 4IL6C 1J75A 3HGGA 2K40A 5EJCA 1ZQ3P 2DO7A 2CJJA 2F5VA 1QA6A 3CC4I 4GFBA 2WAQN 4IQ4A 1KA8A 1I50J 1MMNA 1Z3XA 2FEZA 2KIQA 1S9HA 2PEXA 2QQ8A 4LOCA 2FNPA 2LC2A 1REPC 5EEHA 3OYHA 1UHMA 3D0SA 2XPUA 1SFOJ 2FRHA 1G59A 2DPDA 2LF8A 4XORA 3CDLA 2UXNA 2BY0A 4LIUA 1H8AC 2FOWA 4PJJA 3LMMA 4Y15A 3GZ5A 2BY2A 2BY1A 2GWRA 2RGVA 5IT3A 3CCLI 2XUBA 1CF7A 3QU3A 5J1UA 3CLQA 5D4SA 2PQ8A 1XMXA 4WXDA 1IN7A 2YU3A 2KZGA 3GTGJ 2EV6A 2Y0SA 3BY6A 4ENMA 1RRJA 4D7NA 3ZP5A 1TZLA 4A0XA 5BQTA 1I1SA 3CD6I 5LGTA 5ED4A 4BH9A 1ETKA 1X19A 4C30A 1YIOA 1RETA 1HCRA 3RZDJ 2VE9A 3KLOA 4DIQA 1MBKA 4BY1J 2E1MB 4LG3A 4BJTA 3LSJA 3GMEA 2ELKA 3SZGA 3TQNA 2DXIA 5J8CA 4HDUA 2QKLB 1YI2I 4E7JA 1U2WA 2O8KA 5FD5A 4IO9F 2HOEA 5GAGJ 4JX5A 4D1QA 2VXZA 2ADUA 2CRGA 2O3FA 1T39A 2K3PA 1TWAJ 3FMRA 3GFJA 4A12A 3DQVC 5IYDJ 2DT5A 2TDXA 3CO7C 1IRZA 3MZHA 1K78B 2R5ZB 4A2UA 3I58A 4C3JJ 1EF4A 3JSOA 5HS7A 3FKJA 5EZGA 3MKWB 2K4BA 3JW4A 4CZZA 4ZYGA 2GA1A 3S8PA 2HTSA 2XB0X 1XCBA 3BR2A 4BQOA 3BPXA 1ZRFA 5L3GA 4M9XA 4ZJZA 2GXAA 3OS1A 2D45A 4A3KJ 1VQ9I 2LFBA 3Q0VA 4OIOF 2XGXA 3IWFA 3HOXJ 4NNJA 3ZQCA 2OU2A 4BJ6C 2MH2A 3AKZA 5DV5A 3FXKA 4HYEA 3CC7I 1SFXA 1MJBA 2F48A 3EUHC 2IJLA 5FB2A 2R7SA 2NVYJ 3LA3A 3F6OA 3P9KA 2UZKA 4EJWA 1JUMA 1WH5A 3OSGA 3HB9A 4Y4RA 2GLOA 3CTAA 1B4AA 1ZYRF 5DUIA 5EEAA 2A6TA 3FMQA 1IXCA 4M3FA 5HNFA 3RDIA 3WTZA 1XD7A 2HZTA 2DI3A 2HPMA 2DFFA 1KU9A 2VT3A 1UELB 1SC7A 1W7PD 3ZMDA 4G6TB 3K2ZA 3A4CA 4L9JA 2WWYA 4OWRB 2L9VA 5EG0B 1W0UA 2F5CA 1OCRH 4YIIA 1T56A 3TGNA 5HVQC 4MEYF 1MSEC 2EFQA 1FSEA 2ELJA 2R5YB 2F4IA 1WJ5A 4ZH4F 4P55A 3ZMUA 1UG0A 4E6KG 3CF5F 2LK2A 2AHQA 5B5EC 3CP8A 3AG3H 5B1AH 3RYRA 2PG4A 5B3SH 5IT9Z 2CV0A 3BT9A 3K4LA 1V5FA 3JCUC 2EV5A 2X1DA 4CZCA 3QPHA 5C3EJ 3OSFA 3HYIA 4BEHB 2YR2A 1ERDA 1P4WA 2HXIA 2L7ZA 3P9IA 3OOUA 4DBQA 1ZR2A 4XM3A 2E2HJ 2HQRA 3ML6A 1SVMA 3VSLA 1FIPA 2I10A 2C6YA 1OR7A 4B3XA 3ASOH 4P9FA 1R4NB 1HW1A 2HDDA 2KHMA 3G4SI 2DDBA 4N9HA 2CGPA 2JN6A 1XG1A 2NNNA 4EGZA 2JQ7A 4IHSA 2VOPA 4XN3A 2ZB9A 2FQ3A 4E7ZA 4CDGA 4HX8A 2XAUA 3HG9A 3KZZA 1I3QJ 2HQNA 4RS8A 1WJAA 2Y0MA 4W97A 2E2JJ 4CCNA 3K0LA 3WU0A 4G7HF 4FQGA 2QQ9A 3IAM2 1Y1VJ 4II3A 2M34A 1V4RA 3E3VA 5LEKA 4QIWN 3HM5A 4LK0F 4BBRJ 3J7YJ 1KQ9A 3FF5A 1T6SA 3MZ8A 1LVAA 2OJED 2FOKA 2MW8A 4PZJA 1XGSA 5HDNA 1VZ0A 2JZYA 2MLGA 3BWGA 2MFZA 1VQ4I 2X51A 3HPGA 2EFOA 2HZDA 3MMYB 5F6FA 5HS8A 1VQ5I 5LLQA 3GTLJ 1LEBA 2HVQA 2NVQJ 5M5YJ 3ZCOA 2JA6J 4BACA 3LSGA 3F8BA 2BEOA 2GBYA 4OOIA 1RPWA 2A5YB 1KGSA 2JVHA 2RKHA 3E6CC 3S14J 1V55H 4U87A 3FXMA 3ABKH 4BU2A 2LBFA 1Q1VA 4BDYA 4IHTA 2I5UA 2WBMA 2O5RA 5HLGA 3HPHA 1AOYA 1B8IB 3H0GJ 4LB6B 3L00A 4RGUA 1USSA 4YEJA 3ZQGA 3L2VA 4E7KA 3F8NA 3PUFA 3I4NJ 1J9IA 2VKVA 2UUZA 1OPCA 2E19A 2D5VA 1ZG1A 1LDKB 1YE9A 3I53A 3ZMTA 5CQEA 4NQWA 3DKXA 1LE8A 4OAYA 5F0CA 3HSEA 2E1OA 4I02A 2YS9A 4XIDA 4LLLA 1B59A 4A3BJ 3M8JA 2CFOA 2L54A 1JJ8C 2MD0A 2JA5J 1POGA 5E1XA 4DZJA 5JR3A 5AONA 1M1EB 3SZPA 2JA8J 2KJBA 3DV8A 5L3BA 5ICGA 3LWFA 1WKMA 1A35A 4M74A 2KPMA 1J2XA 3ZGKA 1Y0NA 2TRTA 1JT0A 2Z99A 1JKOC 4MEXF 2Y9ZA 2L4AA 3BG5A 3DLLF 2IXSA 1H88C 2BXZA 1EH6A 2COMA 3S3OA 4BXUA 3HHHA 4UUSB 2XKOA 2F4MB 1RIOH 3RZOJ 1RR7A 4AIDA 5LEJA 1JE8A 1IGNA 4CUGA 4AIJA 4PJLA 5EYRA 3TW6A 4OIQF 3J7AO 2Z16A 2E1MC 3H35A 2VL8A 2Q2EA 1Y1WJ 5E20A 9ANTA 4EV0A 3ZQHA 4M3BA 5HNHA 3WODF 4IRIA 3ONQA 4MQ9F 2DOAA 1WI9A 2DLLA 2CUFA 3K4BA 4M71A 2VXDA 3A03A 4LITA 4BE2A 3J81K 4GXOA 4QTRA 2L9NA 2IS6A 5HLTA 3R0JA 4E70A 1ZLKA 3JRHA 1TQPA 4X0GA 4EJUA 5BS6A 3JTGA 3HJEA 1TBXA 1IF1A 2DA4A 4KMUX 4U0VA 3WTXC 2ZJRF 4IOAF 2MBFA 4DZPA 4M3DA 1AKHA 1OISA 4CGZA 4U0WA 3VDXA 1IXSB 2F5EA 3IH3A 2NNYA 4L9NA 4F55A 2IAIA 3WU1B 1UHWA 2XAHA 2ECCA 3FHZA 3DEWA 3WG9A 1JT6A 2V1DA 1QHGA 2XV4S 2ZFWA 3B73A 1LFUP 1EH7A 3ZMZA 2OQRA 1Y56A 4IQJA 2M3AA 1T98A 2DAOA 2RNGA 3LAPA 2K4JA 1IN8A 1TWCJ 5LFAA 3OYDA 3HOUJ 1K7AA 3S15J 2LKPA 2ZXIA 4ENKA 1KYZA 1R4MB 2ZSHB 1I39A 3NARA 2LY2A 5EF6A 1WJEA 3S1QJ 2FF4A 4PJ0C 3CCJI 2FQ4A 1Z7LA 3A2KA 5D8LB 4A0YA 3BZCA 1HXDA 5IOZA 2QCOA 3C2GA 3K1NA 1QVUA 2EBIA 3CJNA 4M73A 4PGHA 1HQCA 1S7AA 4UV8A 1FWZA 1N75A 3OYFA 4H0EA 1BJAA 5IYBJ 1T33A 1FBQA 1IN4A 2XGEA 1I5ZA 5CVJA 3RIRA 2Y0SN 3RQ4A 1X2NA 2B9SA 3ECOA 5F1RA 2XB5A 4XOTA 5JHFA 1IO2A 1MD0A 4GYIA 5GPAA 4DNCA 2RVCA 2K9NA 1WPKA 2HPIA 5FKKA 3REOA 2ICWG 3CUQB 3W2VA 5D5UB 2E7WA 3PO3J 3FWEA 5FRMA 1SANA 2K85A 5F27A 5AIPA 2M4GA 1XMKA 1FP2A 2BW3A 3MD2A 3V7RA 1WJBA 2A07F 1WFXA 4JBAA 4L18B 3H36A 3FDYA 4CCMA 3JRAA 4EM2A 2E7XA 2W4SA 1IUFA 2YSRA 3BR1A 4IRHA 4BQQA 2XSDC 3EYYA 3T5XA 1BR2A 3PNYA 2ME0A 1FJLA 1FOKA 1EJ9A 1DU0A 1LFBA 2LVSA 2F2EA 3TO7A 3KP3A 1P9QC 2HEOA 2A69F 2Q8KA 2NVXJ 1LEAA 3IUOA 1K4SA 2R0QC 2K02A 3FK6A 3ZQLA 2PMZA 3MN2A 3GW2A 3CC2I 1BBYA 3TL4X 1MNEA 4AYBN 5EZHA 2O61A 4V19K 3LSHA 1IUYA 1IDZA 1O4XA 1O7LA 1KU2A 3HKZN 2ID3A 4II2A 2DTRA 4MTEA 1A6IA 2Z5UA 3BG6A 2JTVA 3UKGA 1FTZA 3M07A 4PK4A 2STTA 4XSXF 3CMYA 1U8BA 3IC7A 2ZJQF 1TQMA 2CS3A 1ZREA 3HRMA 1J0RA 3TO6A 4HNUA 1R5HA 2QUFA 3KEQA 2EA4A 3BR6A 4A3DJ 2HKOA 1A36A 1MNMC 2XF7A 2KLOA 4ABZA 4YFKF 3WGHA 2XGDA 1X4OA 1NHAA 1AA7A 1FEXA 1UB9A 3W3CA 2L7KA 3KYCB 3SFIA 4BE1A 3GZNB 2ESHA 3DEEA 1Z9CA 1Z67A 1FT9A 1ZG5A 2VBWA 2XGCA 3LOCA 2QQAA 1WGXA 5J4VA 1O3TA 1XGNA 2E34A 2LTPA 3HDDA 1Z77A 2WY8Q 3NRVA 5FGMA 1S8NA 3F3XA 1XSXA 2QSFX 1XSVA 3ASNH 5CVRA 1BL0A 4UUTA 3HOZJ 3HSFA 2KQRA 3CDIA 4XBFA 3RI4A 4C3IJ 3PIPF 2DA3A 1R9TJ 2K9MA 5FKMA 1YJ9I 4J00A 3E6MA 4IRGA 2MH9A 1YRNA 2VONA 3JAMK 3L2WA 4HLYA 1TW3A 2F5DA 3V7CA 5FFZA 1OCCH 3GWZA 1DUXC 2LY9A 3G73A 5ICCA 3CCEI 4LLGF 4A5NA 4EMSA 2E5NA 4U7BA 2DA1A 2QF7A 4F3QA 1J5YA 1GLNA 2Y9YA 3K4MA 4XONA 3ZOBA 3FZVA 1MH3A 2X6WA 3FXLA 1N78A 1E17A 3QWLA 1WVRA 3QYEA 2ISYA 2V9PA 4HQMA 2MC3A 3K10A 1OCZH 3NWTA 3MEXA 2EPFA 4Q47A 1K6YA 3D5LA 1IG7A 1NH3A 1LB2A 1UG2A 3JTHA 3HOSA 1U5TC 2L2OA 4A3LJ 2VJ4A 2MD5A 5JLXA 2V7FA 4ENJA 1R00A 2M30A 5DD4A 3K4JA 1ZELA 2CO5A 4EJTA 3D1NI 2XHKA 3DFGA 2IA2A 3R60A 1BW5A 1BOBA 2M5WA 2M8GX 1Y39A 3HSRA 4NC6A 1G3TA 5FKNA 3SZTA 4AIKA 2MC4A 4B48A 1QBJA 2A6EF 3E5XA 5AIQA 3QPSA 3HL2A 1RI7A 1HC8A 4HA8A 1OFCX 1Z3YA 1SD6A 3CP2A 1R1VA 2EIJH 5F04A 4HRIA 5DTDA 4Q4ZF 2PMUA 4L5IA 2DMTA 2XRLA 2BY3A 2ZCWA 3BJAA 1FOYA 2FSWA 1PVEA 1TC3C 2FX0A 1B72A 4I7HA 4LB5A 4B8XA 2GA2A 5DDGA 1X3WB 2XF6A 2W1OA 2XSJC 3U2RA 4AVPA 1P6RA 2YU9J 1ETWA 1W0TA 3Q0WA 5GAHJ 3W6KB 1SD4A 3TMOA 1LFPA 4WK8F 1HSJA 3K70D 3CCRI 5M3FJ 2CW0F 4XLCA 5CVUA 5KVRA 3JAMZ 1F5TA 4HF1A 4B4CA 3AG2H 4ZZDA 4IX7A 4RAGA 5L3EA 4FE7A 4WXHA 4KT5C 4NDLA 1X1DA 3OR2C 3M1CA 4R8HA 2NOJB 4HV6A 1I6XA 1IZ1A 5IP9J 3EDPA 1Q1HA 5CKTA 2Z33A 3HZJA 3S2WA 1S6LA 2ZJPF 4HW0A 3MCZA 1ZRCA 1Y8RB 4JK1X 2OZ6A 4N4NB 5GADJ 2DDAA 3K69A 3R4KA 1W7PA 1TP4A 3ABLH 1GT0C 1FOXA 1HDPA 3CDHA 1X1CA 1N77A 3OYIA 2CV1A 4WF2A 1TW2A 1FZPB 4BXXJ 1SFKA 3V8JA 3GCMA 1GDTA 3U1KA 2LBFB 1ZGJA 4ANJA 2DT7B 2HYFA 4XICA 2PJRB 1D0YA 2GOXB 2P6TA 5B1BH 3GBGA 1IC8A 2LG4A 1OQYA 2VJIA 1OYYA 3ZR8X 2CWEA 5ERIA 4BUPA 2ZMEC 1ETXA 3QQAA 4NQWB 5IT9K 3VSKA 2KKOA 2QZ8A 4CICA 1LE8B 4XQFA 2B7EA 2RQPA 4NC8A 4HNTA 3FM5A 2EB7A 3HIFA 2X4HA 4QWQA 2HYJA 4KDPA 2QKMB 3PFYA 2R7VA 2FMLA 1QZZA 3E1SA 2XRNA 3OMYA 3QYFA 1VQ6I 5LHHA 2ZKZA 3E97A 4ETSA 4E7IA 2XDVA 2R7UA 3OL3A 3CMEI 2Y69H 2HTJA 5EEGA 4G7OF 1MBJA 4XNFA 3OYNA 2KISA 3FKIJ 2JJ7A 4BKXA 2EH3A 1P4AA 5E3LA 2R93J 1TWHJ 2B63J 3O2PE 1IN5A 2KT0A 1FNNA 3DTIA 1YFHA 2DA7A 1OMIA 3R61A 3TP0A 2LMDA 5LGUA 2VQCA 3V7SA 1P7JA 4LMYA
chains in the Genus database with same CATH topology
1GVJA 3NEUA 4ON0A 5LHIA 1T38A 2PFBA 5E8GA 4FX4A 4KN7X 3LAJA 1S3JA 4EGYA 4ZYDA 4LD5A 2P5LC 4OIRF 3P9CA 1KU3A 1ZHFA 1V3FA 2GXBA 3GFLA 2EFNA 5L3FA 4OMYA 2CSOA 3PQJA 2R7DA 4BHPA 1MJAA 4UXNA 3I0TA 3F22A 3LQQA 3VEPA 5CVVA 1ZARA 1R58A 3GUDA 2L01A 4AWXB 5L3DA 4KUMA 3J80K 2RV8A 5BOXA 1FPQA 4XSZF 5D6EA 4EVIA 1KQ0A 3EQLF 1ON1A 4KIFA 4WCGA 1I27A 1R22A 4MGRA 1KU7A 4XLNF 3RPQA 4HX4A 5DEQA 4EJVA 5FO5A 5HDKA 5D6FA 3GZ6A 3Q9VA 4EJOA 1SFUA 1TLHB 3HUGA 2VBYA 2NYXA 4EM1A 4U0YA 4R1HA 2EK5A 3BP8A 4I2OA 1X3UA 4O6JA 4RB1A 1R1UA 1QPMA 4HX7A 3QOPA 2P8TA 1BIAA 1UCRA 4KIBA 1DPRA 4P5OA 2FE3A 4Y17A 3L7WA 4G7ZF 3CLOA 3QRFF 1RZ4A 4IPAA 1O3RA 4HZFA 2XAJA 4FHTA 3I4PA 3IHUA 3KCCA 3H92A 1TNTA 3DP7A 2ETHA 1YO5C 1YS7A 5CYVA 4MHGA 4WWCA 3I54A 5JI6A 5FLXZ 3M8EA 3I64A 4EM0B 1RUOA 1SFEA 3ABUA 2QBYA 5DCMA 2OA4A 2W24A 4I0AA 4UVCA 2PN6A 5HLHA 3HTUA 1IXRC 5FD6A 3ELKA 5HOOA 4CYDA 3T8RA 1B9MA 3MQ0A 3VOEA 3J80Z 3VFZA 2VE8A 2KRFA 1XDSA 4ZYEA 1BOAA 4IJAA 1P4XA 1I1GA 3RJPA 4IVNA 2WTEA 3BZ6A 4G9YA 1TTYA 3F21A 4I01A 5K5RA 4UUVA 4BHCA 5E17F 2HR3A 4HF0A 2D1HA 3GXOA 2GZWA 4RAYA 1YS6A 1YLFA 1BI0A 2YPRA 1GXQA 3VB2A 4MTDA 3DEUA 3QP5A 2VC1A 3E6BA 4RGRA 1J7KA 2JT1A 2UWMA 1LQ1A 1Z7UA 1TNSA 1LJ9A 3KEOA 3ROUA 3L09A 3DPTA 1O3QA 5BPIA 2ESNA 1D8KA 1VTNC 1MZBA 4K2EA 4JQFA 5TJJA 2KIFA 2ACJA 3LA2A 1USTA 2RDPA 3F6VA 2VBXA 4L5JA 4GO1A 4AD9A 4ENNA 4KN4X 5JFRA 1W4MA 4I09A 2HDCA 1FLIA 2BYVE 1OYWA 3KP7A 2HS5A 2V9VA 4KA4A 5LBQA 1ONVA 3T1BA 2JRTA 5H20A 3GFMA 1O57A 2AXLA 3O3KA 4HV5A 2QLZA 3ERED 2BBYA 2IT0A 1E2XA 3KP5A 1Z1DA 2B0LA 1TQIA 4LGWA 4LJZF 3LSTA 1ODDA 3GX4X 2LSOA 4N0BA 5E8IA 4GGGA 1S29A 2P6SA 3TKYA 5D5XB 3QP6A 2PJPA 5CJ9A 2L3DA 2KIUA 2OAZA 5K1YA 3T0YA 3FMSA 1XDUA 3TOAA 3FXQA 1QZYA 3FM3A 1OYIA 4UVBA 3BDDA 5K5OA 1A04A 2W85A 3G3ZA 3KP2A 4BAYA 1HKTA 2P5VA 3DF8A 4HQEA 2GQQA 5E1ZB 2DW4A 2W25A 3C3WA 4NHJA 3P7NA 2H6CA 2YX4A 2ZBKA 5JHUA 1W7PB 4M9SA 3F23A 1T0FA 2PBIA 1BIBA 3M8FA 3WTWC 2O03A 1Z91A 1XGMA 3T8TA 4PCQA 2NRAC 2IA0A 3GFIA 2G9WA 1SMTA 2QQBA 2PMHA 1FBSA 3HRUA 2Q0OA 2FBKA 1QNTA 2M8EA 3WTTC 4G8XA 3F8FA 3M1EA 2Z9OA 2UXXA 3K9TA 2XAGA 1G4DA 1H9GA 1MDMB 2STWA 1Y0UA 3LA7A 1U78A 3WTVC 1ZG3A 5E1WA 1FP1D 2YX7A 5J6XA 2A6HF 5JVTA 4U88A 1XN7A 5CVIA 2D1VA 2IPQX 1STZA 3PQKA 2EJRA 1XMAA 4ZYHA 2XKPA 2HFHA 2D2WA 3K1PA 2QWWA 3LFKA 4N9IA 5ICEA 1JHHA 2G7HA 4OMZA 1U5TA 2DPUA 4L9TA 1K6OA 3QAHA 4A6EA 3SQNA 2A61A 1UFMA 3KE2A 1WSUA 2QM3A 4KIGA 4KFCA 4CO8A 1QQIA 1MGTA 2Y75A 1IAWA 3M7GA 4M72A 1ULYA 3NQOA 4G94A 2EFWA 3RKWA 2H09A 2DBBA 1YTYA 2NS0A 3FXUA 2G7UA 2E1NA 3C1DA 2IA1A 1HKSA 4M6YA 5DUKA 2OBPA 3GLXA 5DYMA 1B6AA 1B1BA 3RTRA 4CXFA 4ZZLA 4RGXA 3ISPA 3DPLC 1HBXG 2RC4A 4QLCU 3H3ZA 3HRTA 5J8FA 2Z3YA 2V1XA 1D5VA 2H6BA 2DQRA 4LK1F 3R0AA 2GIVA 4M6XA 3WGGA 3I59A 1IW7F 2IVMA 2QBYB 5DCMB 1U6GA 4LG0A 3MZYA 3CUQC 2VC0A 3GEZA 1SD5A 2CQKA 2P5KA 4HOBA 3N4MA 2IRFG 3PFIA 1Z6RA 2W84A 4CHUA 2RNJA 2ZMEA 1BC7C 3BJ6A 1WWXA 1JXSA 3C7JA 2W57A 4D0PA 3AAFA 2V1UA 4XRFA 2DFIA 5D8KB 3MWMA 5CLSA 2P7CB 3ABTA 5F64A 3EETA 4LFUA 2E1CA 3BJOA 2VODA 1MDMA 3U1DA 5BMZA 1ZN2A 4HAMA 4FT8A 3DKWA 1W5TA 4L0ZB 3OV8A 1HW5A 2EWNA 4LLNA 4YFNF 2M87A 3EUHA 4O5VA 3LQRA 5ICFA 1G3WA 1QO0D 4TV7A 2EFPA 4P96A 2DQLA 2LNBA 4MNUA 2XAFA 2HWVA 5FLXK 3I71A 1FSHA 5A2QK 4A0ZA 2FBHA 2ZNZA 1S7OA 5FFXA 3WTYC 3QU6A 1ZAOA 1D8JA 4RAZA 2K27A 1DPUA 1YW9A 4BNCA 4DQ2A 2V6CA 2IW5A 3BPVA 4Z2YA 3RPUA 2V79A 3TDZC 1J59A 1FC3A 1DDNA 1F1ZA 3FXRA 3KLNA 1FY7A 2GAUA 1O7FA 1R23A 1RUNA 3F8MA 2XAQA 5LRRA 2XASA 3L9FA 2FNAA 2KIMA 1XGOA 1ZGAA 3VODA 3V8LA 1L3LA 5E18F 3ZMSA 3R6SA 5KK1A 2ZO4A 1BN5A 5HLIA 1GXPA 2VBZA 4AIHA 4OIPF 3EYIA 3Q5FA 1G6NA 1AWCA 3TDUC 4ESBA 2LDUA 1QGPA 1P2FA 5A2QZ 3FX3A 4U7DA 4G6DA 2K86A 2FA5A 4L9VA 3U9GA 4KNYA 2P4WA 2M1BA 2JPCA 1SMYF 1GHCA 2BE5F 2IP2A 5LRSA 3OOPA 1BM9A 1BI1A 4KMFA 3E5QA 2EA2A 3O6BB 2XIGA 2BV6A 1ZRDA 4EQQA 1O3SA 3B02A 1HKQA 4RB0A 1W5SA 5LGNA 3SFZA 4ASNA 1D3YA 1YYVA 5ILVA 3IWZA 5LHGA 2HGCA 1IRFA 2QENA 3GF2A 2JPBA 2H27A 2NAZA 3GYHX 1FYKA 3HTSB 3BOQA 2FXAA 1K79A 2HKXA 2M45A 3HHGA 4RB3C 4RB2C 3KETA 1K78A 1PP7U 5K5QA 2ZXJA 3MFKA 5H6QA 2WC2A 2Y48A 2QVOA 1R7JA 3C18A 1FYMA 3HRSA 1MJ9A 4HF2A 4GCVA 6PAXA 1RNLA 1U5TB 3IKVA 4A5MA 2LF7A 3N97A 2VN2A 3WTUC 1XB4A 1ON2A 5D5WB 2PLYA 1BI2A 3K1MA 5DD8A 2OZUA 1Z6TA 4RGSA 3KP4A 2OD5A 4YFXF 3SXYA 1H9TA 4ESFA 2VT2A 4O3MA 1BI3A 3F72A 2MLKA 4BQAA 2J5PA 2X0LA 4ESJA 1MKMA 2CYYA 3V4GA 3KZYA 3ZMVA 2L02A 3BROA 4I0BA 3DXJF 1BC8C 1EV7A 3ZPLA 4IXAA 2VOOA 1H0MA 3IKTA 1B9NA 1EH8A 1HSTA 2ELHA 4IF4A 1G3YA 1P92A 2R3SA 1YW7A 3I59B 4GYGA 1Z05A 4XLPF 2DU9A 1SD7A 4BHBA 3CO6C 3E5UA 4LG0B 3H3UA 3I5UA 2H94A 4BYYA 3J81Z 2ZMEB 4UHTA 1JGSA 3QPTA 3RYPA 2DK8A 1JHFA 4OU0A 4UV9A 1WRJA 2P7VB 1F9NA 3RKYA 1CF7B 3KP6A 1WQ2A 1YW8A 5HS9A 3Q9SA 1IN6A 1U8RA 3ULQB 3GO5A 4M9ZA 4G6QA 2FU4A 3CUOA 5H6RA 2XVCA 3V8KA 2HYGD 1LDDA 2GXGA 4NB5A 5L3CA 4F7ZA 4HLXA 2ISZA 2O6GE 4YG2F 3ECHA 1XCVA 2K7LA 1YG2A 2KJCA 3E6DA 1CGPA 1R1TA 3F8CA 3MAJA 1C0WA 4PDKA 4Q5SF 4WXCA 2XROA 2R7FA 4UVAA 2FBIA 2A3SA 4Y13A 3GVAA 5HDGA 2O8XA 4HBLA 1F4KA 1R5GA 4S04A 2ZNYA 3ZN0A 4KYWA 1YQAA 3IRQA 3WE3A 1XSDA 3JSPA 5D5VB 3L2CA 4I98B 3TO9A 4A6DA 3M9AA 4OINF 2FMYA 1G3SA 5ILSA 1PDNC 2RN7A 2O0YA 2DK5A 1L0OC 3HOTA 4Q48A 4WX9A 2WV0A 4YIFA 2J5OA 1KQ8A 3WE2A 4FX0A 1ZLJA 2F5FA 2BGCA 2AS5F 4B09A 5ILUA 1DP7P 4MQVA 3ZN1A 3KFWX 1OKRA 4UNOA 2A68F 1IRGA 2JSCA 2EV0A 1PUEE 1ZH5A 3WTSC 1U3EM 3SHFA 2CFXA 1FBUA 3W6JB 3ZQ7A 3IL2A 3RKXA 3TOBA 1LNWA 1SAXA 1LDJA 2CG4A 1FYLA 1HW2A 5BPDA 3WGIA 1FX7A 4HDVA 1T2KA 1PP8F 5D4RA 2MA3A 1KYWA 5DCFA 3IRRA 2PI0A 2OQGA 2ZJ2A 4KICA 2L4MA 4P9UA 4S05A 4PGGA 2QYOA 3CUQA 3COAC 5TRDA 4R79A 1R36A 4L0YB 1J75A 2DO7A 1KA8A 2FEZA 1REPC 2PEXA 2FNPA 5EEHA 1UHMA 3D0SA 2FRHA 2DPDA 2LF8A 2UXNA 4Y15A 3GZ5A 2GWRA 2RGVA 5IT3A 2XUBA 1CF7A 3QU3A 5D4SA 2PQ8A 4WXDA 1IN7A 2YU3A 2EV6A 3BY6A 4ENMA 3ZP5A 4A0XA 5BQTA 1I1SA 5LGTA 5ED4A 4BH9A 1YIOA 2VE9A 3KLOA 3TQNA 5J8CA 4HDUA 1U2WA 5FD5A 2HOEA 2VXZA 2ADUA 2O3FA 1T39A 3FMRA 3GFJA 4A12A 3DQVC 2DT5A 2TDXA 3CO7C 3MZHA 1K78B 4A2UA 3I58A 3JSOA 5HS7A 2K4BA 3JW4A 4CZZA 4ZYGA 2GA1A 2HTSA 1XCBA 3BPXA 1ZRFA 5L3GA 4M9XA 2D45A 4OIOF 2XGXA 3IWFA 2OU2A 2MH2A 5DV5A 4HYEA 1SFXA 5FB2A 1MJBA 2IJLA 3LA3A 3F6OA 3P9KA 2UZKA 4EJWA 3CTAA 1B4AA 1ZYRF 5DUIA 3FMQA 1IXCA 3RDIA 3WTZA 1XD7A 2HZTA 2DI3A 1KU9A 2VT3A 1W7PD 3ZMDA 3K2ZA 2WWYA 4L9JA 2F5CA 4YIIA 3TGNA 5HVQC 4MEYF 2EFQA 1FSEA 4ZH4F 4P55A 3ZMUA 3RYRA 2PG4A 5IT9Z 2EV5A 3QPHA 3HYIA 2YR2A 1P4WA 3P9IA 2HQRA 3ML6A 2C6YA 1OR7A 4P9FA 1HW1A 4N9HA 2CGPA 2NNNA 4EGZA 4IHSA 2VOPA 2FQ3A 4CDGA 4HX8A 3KZZA 2HQNA 4RS8A 2Y0MA 3K0LA 3WU0A 4G7HF 2QQ9A 1V4RA 3E3VA 5LEKA 4LK0F 1KQ9A 3FF5A 1T6SA 1LVAA 2FOKA 4PZJA 1XGSA 5HDNA 2JZYA 2MLGA 3BWGA 2EFOA 5F6FA 5HS8A 1LEBA 5LLQA 3F8BA 2BEOA 4OOIA 2A5YB 1KGSA 2RKHA 3E6CC 4IHTA 5HLGA 1AOYA 4LB6B 3L00A 4RGUA 1USSA 1J9IA 3F8NA 1OPCA 1ZG1A 1LDKB 3I53A 3ZMTA 4NQWA 3HSEA 4I02A 4LLLA 1B59A 2L54A 5E1XA 5JR3A 5AONA 3SZPA 2KJBA 3DV8A 5L3BA 5ICGA 3LWFA 1WKMA 4M74A 1J2XA 2Z99A 4MEXF 2L4AA 1EH6A 2COMA 4BXUA 3HHHA 2XKOA 1RIOH 5LEJA 1JE8A 4AIJA 4OIQF 3J7AO 2Q2EA 5E20A 4EV0A 3WODF 4IRIA 4MQ9F 1WI9A 2DLLA 4M71A 3J81K 4GXOA 3R0JA 4E70A 1ZLKA 1TQPA 4EJUA 5BS6A 3JTGA 1TBXA 1IF1A 4KMUX 3WTXC 4U0VA 2MBFA 4CGZA 4U0WA 1IXSB 2F5EA 2NNYA 4L9NA 3WU1B 1UHWA 2XAHA 3FHZA 3WG9A 2V1DA 2ZFWA 2XV4S 3B73A 1EH7A 3ZMZA 2OQRA 1T98A 2DAOA 3LAPA 2K4JA 1IN8A 1K7AA 2LKPA 4ENKA 1KYZA 2FF4A 5D8LB 4A0YA 1HXDA 3K1NA 3CJNA 4M73A 4PGHA 1HQCA 1S7AA 4UV8A 1FWZA 4H0EA 1BJAA 1FBQA 1IN4A 3RIRA 1I5ZA 5CVJA 3ECOA 5F1RA 1MD0A 4GYIA 4DNCA 2RVCA 3REOA 3CUQB 5D5UB 2E7WA 3FWEA 5AIPA 1XMKA 1FP2A 3V7RA 2A07F 4JBAA 4L18B 4EM2A 2E7XA 2YSRA 4IRHA 3EYYA 3T5XA 1FOKA 2F2EA 3TO7A 3KP3A 2HEOA 2A69F 2Q8KA 1LEAA 2K02A 3GW2A 1BBYA 2O61A 1IUYA 1O7LA 1KU2A 2DTRA 4MTEA 2Z5UA 2JTVA 2STTA 4XSXF 3IC7A 1TQMA 1ZREA 3HRMA 1J0RA 3TO6A 1R5HA 2QUFA 3KEQA 2EA4A 2HKOA 4YFKF 3WGHA 1NHAA 1UB9A 2ESHA 1Z9CA 1FT9A 1ZG5A 2VBWA 2QQAA 1O3TA 1XGNA 3NRVA 5FGMA 1S8NA 3F3XA 1XSXA 1XSVA 5CVRA 3HSFA 4XBFA 3RI4A 3E6MA 4IRGA 2MH9A 2VONA 3JAMK 4HLYA 1TW3A 2F5DA 3V7CA 5FFZA 3GWZA 1DUXC 3G73A 5ICCA 4LLGF 4A5NA 4EMSA 4U7BA 1J5YA 3FZVA 1E17A 2ISYA 4HQMA 2MC3A 3MEXA 4Q47A 3D5LA 1LB2A 3JTHA 3HOSA 1U5TC 2MD5A 4ENJA 1R00A 2M30A 5DD4A 2CO5A 4EJTA 2XHKA 3DFGA 2IA2A 3R60A 2M5WA 3HSRA 4AIKA 1G3TA 3SZTA 1QBJA 2A6EF 3E5XA 5AIQA 1RI7A 4HA8A 1SD6A 1R1VA 4Q4ZF 2PMUA 4L5IA 2ZCWA 3BJAA 2FSWA 4I7HA 4LB5A 4B8XA 2GA2A 5DDGA 3U2RA 4AVPA 1P6RA 3W6KB 1SD4A 4WK8F 1HSJA 2CW0F 5CVUA 5KVRA 3JAMZ 1F5TA 4HF1A 4ZZDA 5L3EA 4WXHA 4KT5C 4R8HA 4HV6A 1I6XA 1IZ1A 3EDPA 1Q1HA 2Z33A 3S2WA 1S6LA 4HW0A 3MCZA 1ZRCA 4JK1X 2OZ6A 3K69A 3R4KA 1W7PA 3CDHA 4WF2A 1TW2A 1FZPB 3V8JA 1ZGJA 2HYFA 2P6TA 1OYYA 2CWEA 5ERIA 5IT9K 2KKOA 2QZ8A 4CICA 2RQPA 3FM5A 2EB7A 3HIFA 2X4HA 4QWQA 4KDPA 2FMLA 1QZZA 2XRNA 5LHHA 2ZKZA 3E97A 4ETSA 2HTJA 5EEGA 4G7OF 1P4AA 3O2PE 1IN5A 1FNNA 1YFHA 1OMIA 3R61A 5LGUA 3V7SA 4LMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GVJ A;  3NEU A;  4ON0 A;  5LHI A;  1T38 A;  2PFB A;  5E8G A;  4FX4 A;  4KN7 X;  3LAJ A;  1S3J A;  4EGY A;  4ZYD A;  4LD5 A;  2P5L C;  4OIR F;  3P9C A;  1KU3 A;  1ZHF A;  1V3F A;  2GXB A;  3GFL A;  2EFN A;  5L3F A;  4OMY A;  2CSO A;  3PQJ A;  2R7D A;  4BHP A;  1MJA A;  4UXN A;  3I0T A;  3F22 A;  3LQQ A;  3VEP A;  5CVV A;  1ZAR A;  1R58 A;  3GUD A;  2L01 A;  4AWX B;  5L3D A;  4KUM A;  3J80 K;  2RV8 A;  5BOX A;  1FPQ A;  4XSZ F;  5D6E A;  4EVI A;  1KQ0 A;  3EQL F;  1ON1 A;  4KIF A;  4WCG A;  1I27 A;  1R22 A;  4MGR A;  1KU7 A;  4XLN F;  3RPQ A;  4HX4 A;  5DEQ A;  4EJV A;  5FO5 A;  5HDK A;  5D6F A;  3GZ6 A;  3Q9V A;  4EJO A;  1SFU A;  1TLH B;  3HUG A;  2VBY A;  2NYX A;  4EM1 A;  4U0Y A;  4R1H A;  2EK5 A;  3BP8 A;  4I2O A;  1X3U A;  4O6J A;  4RB1 A;  1R1U A;  1QPM A;  4HX7 A;  3QOP A;  2P8T A;  1BIA A;  1UCR A;  4KIB A;  1DPR A;  4P5O A;  2FE3 A;  4Y17 A;  3L7W A;  4G7Z F;  3CLO A;  3QRF F;  1RZ4 A;  4IPA A;  1O3R A;  4HZF A;  2XAJ A;  4FHT A;  3I4P A;  3IHU A;  3KCC A;  3H92 A;  1TNT A;  3DP7 A;  2ETH A;  1YO5 C;  1YS7 A;  5CYV A;  4MHG A;  4WWC A;  3I54 A;  5JI6 A;  5FLX Z;  3M8E A;  3I64 A;  4EM0 B;  1RUO A;  1SFE A;  3ABU A;  2QBY A;  5DCM A;  2OA4 A;  2W24 A;  4I0A A;  4UVC A;  2PN6 A;  5HLH A;  3HTU A;  1IXR C;  5FD6 A;  3ELK A;  5HOO A;  4CYD A;  3T8R A;  1B9M A;  3MQ0 A;  3VOE A;  3J80 Z;  3VFZ A;  2VE8 A;  2KRF A;  1XDS A;  4ZYE A;  1BOA A;  4IJA A;  1P4X A;  1I1G A;  3RJP A;  4IVN A;  2WTE A;  3BZ6 A;  4G9Y A;  1TTY A;  3F21 A;  4I01 A;  5K5R A;  4UUV A;  4BHC A;  5E17 F;  2HR3 A;  4HF0 A;  2D1H A;  3GXO A;  2GZW A;  4RAY A;  1YS6 A;  1YLF A;  1BI0 A;  2YPR A;  1GXQ A;  3VB2 A;  4MTD A;  3DEU A;  3QP5 A;  2VC1 A;  3E6B A;  4RGR A;  1J7K A;  2JT1 A;  2UWM A;  1LQ1 A;  1Z7U A;  1TNS A;  1LJ9 A;  3KEO A;  3ROU A;  3L09 A;  3DPT A;  1O3Q A;  5BPI A;  2ESN A;  1D8K A;  1VTN C;  1MZB A;  4K2E A;  4JQF A;  5TJJ A;  2KIF A;  2ACJ A;  3LA2 A;  1UST A;  2RDP A;  3F6V A;  2VBX A;  4L5J A;  4GO1 A;  4AD9 A;  4ENN A;  4KN4 X;  5JFR A;  1W4M A;  4I09 A;  2HDC A;  1FLI A;  2BYV E;  1OYW A;  3KP7 A;  2HS5 A;  2V9V A;  4KA4 A;  5LBQ A;  1ONV A;  3T1B A;  2JRT A;  5H20 A;  3GFM A;  1O57 A;  2AXL A;  3O3K A;  4HV5 A;  2QLZ A;  3ERE D;  2BBY A;  2IT0 A;  1E2X A;  3KP5 A;  1Z1D A;  2B0L A;  1TQI A;  4LGW A;  4LJZ F;  3LST A;  1ODD A;  3GX4 X;  2LSO A;  4N0B A;  5E8I A;  4GGG A;  1S29 A;  2P6S A;  3TKY A;  5D5X B;  3QP6 A;  2PJP A;  5CJ9 A;  2L3D A;  2KIU A;  2OAZ A;  5K1Y A;  3T0Y A;  3FMS A;  1XDU A;  3TOA A;  3FXQ A;  1QZY A;  3FM3 A;  1OYI A;  4UVB A;  3BDD A;  5K5O A;  1A04 A;  2W85 A;  3G3Z A;  3KP2 A;  4BAY A;  1HKT A;  2P5V A;  3DF8 A;  4HQE A;  2GQQ A;  5E1Z B;  2DW4 A;  2W25 A;  3C3W A;  4NHJ A;  3P7N A;  2H6C A;  2YX4 A;  2ZBK A;  5JHU A;  1W7P B;  4M9S A;  3F23 A;  1T0F A;  2PBI A;  1BIB A;  3M8F A;  3WTW C;  2O03 A;  1Z91 A;  1XGM A;  3T8T A;  4PCQ A;  2NRA C;  2IA0 A;  3GFI A;  2G9W A;  1SMT A;  2QQB A;  2PMH A;  1FBS A;  3HRU A;  2Q0O A;  2FBK A;  1QNT A;  2M8E A;  3WTT C;  4G8X A;  3F8F A;  3M1E A;  2Z9O A;  2UXX A;  3K9T A;  2XAG A;  1G4D A;  1H9G A;  1MDM B;  2STW A;  1Y0U A;  3LA7 A;  1U78 A;  3WTV C;  1ZG3 A;  5E1W A;  1FP1 D;  2YX7 A;  5J6X A;  2A6H F;  5JVT A;  4U88 A;  1XN7 A;  5CVI A;  2D1V A;  2IPQ X;  1STZ A;  3PQK A;  2EJR A;  1XMA A;  4ZYH A;  2XKP A;  2HFH A;  2D2W A;  3K1P A;  2QWW A;  3LFK A;  4N9I A;  5ICE A;  1JHH A;  2G7H A;  4OMZ A;  1U5T A;  2DPU A;  4L9T A;  1K6O A;  3QAH A;  4A6E A;  3SQN A;  2A61 A;  1UFM A;  3KE2 A;  1WSU A;  2QM3 A;  4KIG A;  4KFC A;  4CO8 A;  1QQI A;  1MGT A;  2Y75 A;  1IAW A;  3M7G A;  4M72 A;  1ULY A;  3NQO A;  4G94 A;  2EFW A;  3RKW A;  2H09 A;  2DBB A;  1YTY A;  2NS0 A;  3FXU A;  2G7U A;  2E1N A;  3C1D A;  2IA1 A;  1HKS A;  4M6Y A;  5DUK A;  2OBP A;  3GLX A;  5DYM A;  1B6A A;  1B1B A;  3RTR A;  4CXF A;  4ZZL A;  4RGX A;  3ISP A;  3DPL C;  1HBX G;  2RC4 A;  4QLC U;  3H3Z A;  3HRT A;  5J8F A;  2Z3Y A;  2V1X A;  1D5V A;  2H6B A;  2DQR A;  4LK1 F;  3R0A A;  2GIV A;  4M6X A;  3WGG A;  3I59 A;  1IW7 F;  2IVM A;  2QBY B;  5DCM B;  1U6G A;  4LG0 A;  3MZY A;  3CUQ C;  2VC0 A;  3GEZ A;  1SD5 A;  2CQK A;  2P5K A;  4HOB A;  3N4M A;  2IRF G;  3PFI A;  1Z6R A;  2W84 A;  4CHU A;  2RNJ A;  2ZME A;  1BC7 C;  3BJ6 A;  1WWX A;  1JXS A;  3C7J A;  2W57 A;  4D0P A;  3AAF A;  2V1U A;  4XRF A;  2DFI A;  5D8K B;  3MWM A;  5CLS A;  2P7C B;  3ABT A;  5F64 A;  3EET A;  4LFU A;  2E1C A;  3BJO A;  2VOD A;  1MDM A;  3U1D A;  5BMZ A;  1ZN2 A;  4HAM A;  4FT8 A;  3DKW A;  1W5T A;  4L0Z B;  3OV8 A;  1HW5 A;  2EWN A;  4LLN A;  4YFN F;  2M87 A;  3EUH A;  4O5V A;  3LQR A;  5ICF A;  1G3W A;  1QO0 D;  4TV7 A;  2EFP A;  4P96 A;  2DQL A;  2LNB A;  4MNU A;  2XAF A;  2HWV A;  5FLX K;  3I71 A;  1FSH A;  5A2Q K;  4A0Z A;  2FBH A;  2ZNZ A;  1S7O A;  5FFX A;  3WTY C;  3QU6 A;  1ZAO A;  1D8J A;  4RAZ A;  2K27 A;  1DPU A;  1YW9 A;  4BNC A;  4DQ2 A;  2V6C A;  2IW5 A;  3BPV A;  4Z2Y A;  3RPU A;  2V79 A;  3TDZ C;  1J59 A;  1FC3 A;  1DDN A;  1F1Z A;  3FXR A;  3KLN A;  1FY7 A;  2GAU A;  1O7F A;  1R23 A;  1RUN A;  3F8M A;  2XAQ A;  5LRR A;  2XAS A;  3L9F A;  2FNA A;  2KIM A;  1XGO A;  1ZGA A;  3VOD A;  3V8L A;  1L3L A;  5E18 F;  3ZMS A;  3R6S A;  5KK1 A;  2ZO4 A;  1BN5 A;  5HLI A;  1GXP A;  2VBZ A;  4AIH A;  4OIP F;  3EYI A;  3Q5F A;  1G6N A;  1AWC A;  3TDU C;  4ESB A;  2LDU A;  1QGP A;  1P2F A;  5A2Q Z;  3FX3 A;  4U7D A;  4G6D A;  2K86 A;  2FA5 A;  4L9V A;  3U9G A;  4KNY A;  2P4W A;  2M1B A;  2JPC A;  1SMY F;  1GHC A;  2BE5 F;  2IP2 A;  5LRS A;  3OOP A;  1BM9 A;  1BI1 A;  4KMF A;  3E5Q A;  2EA2 A;  3O6B B;  2XIG A;  2BV6 A;  1ZRD A;  4EQQ A;  1O3S A;  3B02 A;  1HKQ A;  4RB0 A;  1W5S A;  5LGN A;  3SFZ A;  4ASN A;  1D3Y A;  1YYV A;  5ILV A;  3IWZ A;  5LHG A;  2HGC A;  1IRF A;  2QEN A;  3GF2 A;  2JPB A;  2H27 A;  2NAZ A;  3GYH X;  1FYK A;  3HTS B;  3BOQ A;  2FXA A;  1K79 A;  2HKX A;  2M45 A;  3HHG A;  4RB3 C;  4RB2 C;  3KET A;  1K78 A;  1PP7 U;  5K5Q A;  2ZXJ A;  3MFK A;  5H6Q A;  2WC2 A;  2Y48 A;  2QVO A;  1R7J A;  3C18 A;  1FYM A;  3HRS A;  1MJ9 A;  4HF2 A;  4GCV A;  6PAX A;  1RNL A;  1U5T B;  3IKV A;  4A5M A;  2LF7 A;  3N97 A;  2VN2 A;  3WTU C;  1XB4 A;  1ON2 A;  5D5W B;  2PLY A;  1BI2 A;  3K1M A;  5DD8 A;  2OZU A;  1Z6T A;  4RGS A;  3KP4 A;  2OD5 A;  4YFX F;  3SXY A;  1H9T A;  4ESF A;  2VT2 A;  4O3M A;  1BI3 A;  3F72 A;  2MLK A;  4BQA A;  2J5P A;  2X0L A;  4ESJ A;  1MKM A;  2CYY A;  3V4G A;  3KZY A;  3ZMV A;  2L02 A;  3BRO A;  4I0B A;  3DXJ F;  1BC8 C;  1EV7 A;  3ZPL A;  4IXA A;  2VOO A;  1H0M A;  3IKT A;  1B9N A;  1EH8 A;  1HST A;  2ELH A;  4IF4 A;  1G3Y A;  1P92 A;  2R3S A;  1YW7 A;  3I59 B;  4GYG A;  1Z05 A;  4XLP F;  2DU9 A;  1SD7 A;  4BHB A;  3CO6 C;  3E5U A;  4LG0 B;  3H3U A;  3I5U A;  2H94 A;  4BYY A;  3J81 Z;  2ZME B;  4UHT A;  1JGS A;  3QPT A;  3RYP A;  2DK8 A;  1JHF A;  4OU0 A;  4UV9 A;  1WRJ A;  2P7V B;  1F9N A;  3RKY A;  1CF7 B;  3KP6 A;  1WQ2 A;  1YW8 A;  5HS9 A;  3Q9S A;  1IN6 A;  1U8R A;  3ULQ B;  3GO5 A;  4M9Z A;  4G6Q A;  2FU4 A;  3CUO A;  5H6R A;  2XVC A;  3V8K A;  2HYG D;  1LDD A;  2GXG A;  4NB5 A;  5L3C A;  4F7Z A;  4HLX A;  2ISZ A;  2O6G E;  4YG2 F;  3ECH A;  1XCV A;  2K7L A;  1YG2 A;  2KJC A;  3E6D A;  1CGP A;  1R1T A;  3F8C A;  3MAJ A;  1C0W A;  4PDK A;  4Q5S F;  4WXC A;  2XRO A;  2R7F A;  4UVA A;  2FBI A;  2A3S A;  4Y13 A;  3GVA A;  5HDG A;  2O8X A;  4HBL A;  1F4K A;  1R5G A;  4S04 A;  2ZNY A;  3ZN0 A;  4KYW A;  1YQA A;  3IRQ A;  3WE3 A;  1XSD A;  3JSP A;  5D5V B;  3L2C A;  4I98 B;  3TO9 A;  4A6D A;  3M9A A;  4OIN F;  2FMY A;  1G3S A;  5ILS A;  1PDN C;  2RN7 A;  2O0Y A;  2DK5 A;  1L0O C;  3HOT A;  4Q48 A;  4WX9 A;  2WV0 A;  4YIF A;  2J5O A;  1KQ8 A;  3WE2 A;  4FX0 A;  1ZLJ A;  2F5F A;  2BGC A;  2AS5 F;  4B09 A;  5ILU A;  1DP7 P;  4MQV A;  3ZN1 A;  3KFW X;  1OKR A;  4UNO A;  2A68 F;  1IRG A;  2JSC A;  2EV0 A;  1PUE E;  1ZH5 A;  3WTS C;  1U3E M;  3SHF A;  2CFX A;  1FBU A;  3W6J B;  3ZQ7 A;  3IL2 A;  3RKX A;  3TOB A;  1LNW A;  1SAX A;  1LDJ A;  2CG4 A;  1FYL A;  1HW2 A;  5BPD A;  3WGI A;  1FX7 A;  4HDV A;  1T2K A;  1PP8 F;  5D4R A;  2MA3 A;  1KYW A;  5DCF A;  3IRR A;  2PI0 A;  2OQG A;  2ZJ2 A;  4KIC A;  2L4M A;  4P9U A;  4S05 A;  4PGG A;  2QYO A;  3CUQ A;  3COA C;  5TRD A;  4R79 A;  1R36 A;  4L0Y B;  1J75 A;  2DO7 A;  1KA8 A;  2FEZ A;  1REP C;  2PEX A;  2FNP A;  5EEH A;  1UHM A;  3D0S A;  2FRH A;  2DPD A;  2LF8 A;  2UXN A;  4Y15 A;  3GZ5 A;  2GWR A;  2RGV A;  5IT3 A;  2XUB A;  1CF7 A;  3QU3 A;  5D4S A;  2PQ8 A;  4WXD A;  1IN7 A;  2YU3 A;  2EV6 A;  3BY6 A;  4ENM A;  3ZP5 A;  4A0X A;  5BQT A;  1I1S A;  5LGT A;  5ED4 A;  4BH9 A;  1YIO A;  2VE9 A;  3KLO A;  3TQN A;  5J8C A;  4HDU A;  1U2W A;  5FD5 A;  2HOE A;  2VXZ A;  2ADU A;  2O3F A;  1T39 A;  3FMR A;  3GFJ A;  4A12 A;  3DQV C;  2DT5 A;  2TDX A;  3CO7 C;  3MZH A;  1K78 B;  4A2U A;  3I58 A;  3JSO A;  5HS7 A;  2K4B A;  3JW4 A;  4CZZ A;  4ZYG A;  2GA1 A;  2HTS A;  1XCB A;  3BPX A;  1ZRF A;  5L3G A;  4M9X A;  2D45 A;  4OIO F;  2XGX A;  3IWF A;  2OU2 A;  2MH2 A;  5DV5 A;  4HYE A;  1SFX A;  5FB2 A;  1MJB A;  2IJL A;  3LA3 A;  3F6O A;  3P9K A;  2UZK A;  4EJW A;  3CTA A;  1B4A A;  1ZYR F;  5DUI A;  3FMQ A;  1IXC A;  3RDI A;  3WTZ A;  1XD7 A;  2HZT A;  2DI3 A;  1KU9 A;  2VT3 A;  1W7P D;  3ZMD A;  3K2Z A;  2WWY A;  4L9J A;  2F5C A;  4YII A;  3TGN A;  5HVQ C;  4MEY F;  2EFQ A;  1FSE A;  4ZH4 F;  4P55 A;  3ZMU A;  3RYR A;  2PG4 A;  5IT9 Z;  2EV5 A;  3QPH A;  3HYI A;  2YR2 A;  1P4W A;  3P9I A;  2HQR A;  3ML6 A;  2C6Y A;  1OR7 A;  4P9F A;  1HW1 A;  4N9H A;  2CGP A;  2NNN A;  4EGZ A;  4IHS A;  2VOP A;  2FQ3 A;  4CDG A;  4HX8 A;  3KZZ A;  2HQN A;  4RS8 A;  2Y0M A;  3K0L A;  3WU0 A;  4G7H F;  2QQ9 A;  1V4R A;  3E3V A;  5LEK A;  4LK0 F;  1KQ9 A;  3FF5 A;  1T6S A;  1LVA A;  2FOK A;  4PZJ A;  1XGS A;  5HDN A;  2JZY A;  2MLG A;  3BWG A;  2EFO A;  5F6F A;  5HS8 A;  1LEB A;  5LLQ A;  3F8B A;  2BEO A;  4OOI A;  2A5Y B;  1KGS A;  2RKH A;  3E6C C;  4IHT A;  5HLG A;  1AOY A;  4LB6 B;  3L00 A;  4RGU A;  1USS A;  1J9I A;  3F8N A;  1OPC A;  1ZG1 A;  1LDK B;  3I53 A;  3ZMT A;  4NQW A;  3HSE A;  4I02 A;  4LLL A;  1B59 A;  2L54 A;  5E1X A;  5JR3 A;  5AON A;  3SZP A;  2KJB A;  3DV8 A;  5L3B A;  5ICG A;  3LWF A;  1WKM A;  4M74 A;  1J2X A;  2Z99 A;  4MEX F;  2L4A A;  1EH6 A;  2COM A;  4BXU A;  3HHH A;  2XKO A;  1RIO H;  5LEJ A;  1JE8 A;  4AIJ A;  4OIQ F;  3J7A O;  2Q2E A;  5E20 A;  4EV0 A;  3WOD F;  4IRI A;  4MQ9 F;  1WI9 A;  2DLL A;  4M71 A;  3J81 K;  4GXO A;  3R0J A;  4E70 A;  1ZLK A;  1TQP A;  4EJU A;  5BS6 A;  3JTG A;  1TBX A;  1IF1 A;  4KMU X;  3WTX C;  4U0V A;  2MBF A;  4CGZ A;  4U0W A;  1IXS B;  2F5E A;  2NNY A;  4L9N A;  3WU1 B;  1UHW A;  2XAH A;  3FHZ A;  3WG9 A;  2V1D A;  2ZFW A;  2XV4 S;  3B73 A;  1EH7 A;  3ZMZ A;  2OQR A;  1T98 A;  2DAO A;  3LAP A;  2K4J A;  1IN8 A;  1K7A A;  2LKP A;  4ENK A;  1KYZ A;  2FF4 A;  5D8L B;  4A0Y A;  1HXD A;  3K1N A;  3CJN A;  4M73 A;  4PGH A;  1HQC A;  1S7A A;  4UV8 A;  1FWZ A;  4H0E A;  1BJA A;  1FBQ A;  1IN4 A;  3RIR A;  1I5Z A;  5CVJ A;  3ECO A;  5F1R A;  1MD0 A;  4GYI A;  4DNC A;  2RVC A;  3REO A;  3CUQ B;  5D5U B;  2E7W A;  3FWE A;  5AIP A;  1XMK A;  1FP2 A;  3V7R A;  2A07 F;  4JBA A;  4L18 B;  4EM2 A;  2E7X A;  2YSR A;  4IRH A;  3EYY A;  3T5X A;  1FOK A;  2F2E A;  3TO7 A;  3KP3 A;  2HEO A;  2A69 F;  2Q8K A;  1LEA A;  2K02 A;  3GW2 A;  1BBY A;  2O61 A;  1IUY A;  1O7L A;  1KU2 A;  2DTR A;  4MTE A;  2Z5U A;  2JTV A;  2STT A;  4XSX F;  3IC7 A;  1TQM A;  1ZRE A;  3HRM A;  1J0R A;  3TO6 A;  1R5H A;  2QUF A;  3KEQ A;  2EA4 A;  2HKO A;  4YFK F;  3WGH A;  1NHA A;  1UB9 A;  2ESH A;  1Z9C A;  1FT9 A;  1ZG5 A;  2VBW A;  2QQA A;  1O3T A;  1XGN A;  3NRV A;  5FGM A;  1S8N A;  3F3X A;  1XSX A;  1XSV A;  5CVR A;  3HSF A;  4XBF A;  3RI4 A;  3E6M A;  4IRG A;  2MH9 A;  2VON A;  3JAM K;  4HLY A;  1TW3 A;  2F5D A;  3V7C A;  5FFZ A;  3GWZ A;  1DUX C;  3G73 A;  5ICC A;  4LLG F;  4A5N A;  4EMS A;  4U7B A;  1J5Y A;  3FZV A;  1E17 A;  2ISY A;  4HQM A;  2MC3 A;  3MEX A;  4Q47 A;  3D5L A;  1LB2 A;  3JTH A;  3HOS A;  1U5T C;  2MD5 A;  4ENJ A;  1R00 A;  2M30 A;  5DD4 A;  2CO5 A;  4EJT A;  2XHK A;  3DFG A;  2IA2 A;  3R60 A;  2M5W A;  3HSR A;  4AIK A;  1G3T A;  3SZT A;  1QBJ A;  2A6E F;  3E5X A;  5AIQ A;  1RI7 A;  4HA8 A;  1SD6 A;  1R1V A;  4Q4Z F;  2PMU A;  4L5I A;  2ZCW A;  3BJA A;  2FSW A;  4I7H A;  4LB5 A;  4B8X A;  2GA2 A;  5DDG A;  3U2R A;  4AVP A;  1P6R A;  3W6K B;  1SD4 A;  4WK8 F;  1HSJ A;  2CW0 F;  5CVU A;  5KVR A;  3JAM Z;  1F5T A;  4HF1 A;  4ZZD A;  5L3E A;  4WXH A;  4KT5 C;  4R8H A;  4HV6 A;  1I6X A;  1IZ1 A;  3EDP A;  1Q1H A;  2Z33 A;  3S2W A;  1S6L A;  4HW0 A;  3MCZ A;  1ZRC A;  4JK1 X;  2OZ6 A;  3K69 A;  3R4K A;  1W7P A;  3CDH A;  4WF2 A;  1TW2 A;  1FZP B;  3V8J A;  1ZGJ A;  2HYF A;  2P6T A;  1OYY A;  2CWE A;  5ERI A;  5IT9 K;  2KKO A;  2QZ8 A;  4CIC A;  2RQP A;  3FM5 A;  2EB7 A;  3HIF A;  2X4H A;  4QWQ A;  4KDP A;  2FML A;  1QZZ A;  2XRN A;  5LHH A;  2ZKZ A;  3E97 A;  4ETS A;  2HTJ A;  5EEG A;  4G7O F;  1P4A A;  3O2P E;  1IN5 A;  1FNN A;  1YFH A;  1OMI A;  3R61 A;  5LGU A;  3V7S A;  4LMY A; 
#chains in the Genus database with same CATH topology
 5TIS C;  1GVJ A;  3NEU A;  4ON0 A;  5LHI A;  1T38 A;  2FJ1 A;  2WA0 A;  2PFB A;  5E8G A;  4FX4 A;  4KN7 X;  3LAJ A;  1S3J A;  2DA6 A;  3BTI A;  3OR1 C;  2Q2E B;  4EGY A;  4QPQ A;  4ZYD A;  4LD5 A;  2P5L C;  4OIR F;  3P9C A;  1KU3 A;  1ZHF A;  1V3F A;  2GXB A;  3GFL A;  2EFN A;  5L3F A;  4OMY A;  2GOM A;  3JR9 A;  1LVK A;  2CSO A;  1V5G A;  3PQJ A;  2R7D A;  4BHP A;  1MJA A;  4UXN A;  3I0T A;  2M7B A;  2JA7 J;  4Y33 A;  3SDG A;  2I8D A;  2DOD A;  3F22 A;  3LQQ A;  3VEP A;  5CVV A;  1ZAR A;  1W36 C;  1S72 I;  1RKT A;  2M9H A;  3LSI A;  3S1M J;  4I76 A;  1R58 A;  3GUD A;  2L01 A;  3PL8 A;  4AWX B;  3OIO A;  4RLF A;  3VYS B;  2RAE A;  1AKH B;  5L3D A;  4IKF A;  4KUM A;  3J80 K;  2RV8 A;  5BOX A;  3J7A Y;  1FPQ A;  5M3M J;  2DMU A;  4XSZ F;  5D6E A;  2NVU B;  4EVI A;  1KQ0 A;  3EQL F;  1ON1 A;  2JWT A;  4KIF A;  2X9D A;  1I27 A;  4WCG A;  3HOY J;  1R22 A;  2ZFU A;  4MGR A;  1KU7 A;  4XLN F;  3RPQ A;  2IGM A;  4HX4 A;  5DEQ A;  2JRM A;  4EJV A;  2L5Q A;  5FO5 A;  1MBF A;  5HDK A;  5D6F A;  3GZ6 A;  2HNH A;  3Q9V A;  4EJO A;  3TED A;  1SFU A;  1RKW A;  1TLH B;  1XC5 A;  3HUG A;  2VBY A;  2NYX A;  4EM1 A;  2E2I J;  4U0Y A;  4R1H A;  2EK5 A;  2X6X A;  3BP8 A;  2X6Y A;  4I2O A;  1X3U A;  4O6J A;  4RB1 A;  2P0W A;  1R1U A;  3A0B C;  3IP4 B;  4H4K C;  1QPM A;  1K4T A;  1IJW C;  1YJN I;  3PO2 J;  4A3F J;  5FLV A;  2DOF A;  4HX7 A;  4ITV A;  2EIN H;  3QOP A;  2X1C A;  2P8T A;  1BIA A;  1UCR A;  3OS0 A;  4KIB A;  1DPR A;  1HLV A;  4P5O A;  2FE3 A;  4C9Y A;  2OTJ I;  4Y17 A;  3L7W A;  3CCV I;  3CLO A;  4G7Z F;  3QRF F;  1RZ4 A;  4IPA A;  4D7M A;  4HZF A;  1O3R A;  3GTQ J;  2WY7 Q;  2XAJ A;  4FHT A;  2EZK A;  3I4P A;  3IHU A;  4PSW A;  4AU7 A;  3KCC A;  3H92 A;  1TNT A;  2CQ7 A;  5KAI C;  2BZT A;  3DP7 A;  2ETH A;  1YO5 C;  1YS7 A;  3W2W A;  4N4O B;  5CYV A;  2DFH A;  2BW3 B;  4BS9 A;  4RLQ A;  3SEZ A;  1X2M A;  2X1E A;  1W36 D;  3V42 A;  1MH4 A;  4MHG A;  2IS4 A;  4WWC A;  3I54 A;  1U9O A;  5JI6 A;  5FLX Z;  3M8E A;  3I64 A;  4EM0 B;  1OR7 C;  1RUO A;  1SFE A;  3ABU A;  2QBY A;  2R7X A;  2BVL A;  3DBH B;  5DCM A;  2OA4 A;  2W24 A;  5J1Y A;  4BBS J;  3DBL B;  4XLH A;  3SDB A;  2LP0 A;  2W82 A;  3SJM A;  2WAF A;  1VND A;  4RM3 A;  2M7A A;  4I0A A;  3KPH A;  4UVC A;  4BL0 B;  2PN6 A;  4DBR A;  4F52 A;  2CUJ A;  2NVT J;  3FK7 A;  5HLH A;  3N05 A;  4XRS G;  3HTU A;  1S7E A;  1IXR C;  5FD6 A;  3ELK A;  5HOO A;  4CYD A;  3T8R A;  1B9M A;  2E5Z A;  1EKE A;  1K83 J;  4P1W A;  3MQ0 A;  3VOE A;  2PJR A;  3J80 Z;  3VFZ A;  2VE8 A;  1VQ8 I;  2KRF A;  3HOW J;  1XDS A;  3X2Q H;  3I9V 2;  3K4N A;  4CA0 A;  4JP0 A;  4ZYE A;  1BOA A;  4IJA A;  1P4X A;  1I1G A;  3RPU D;  3JRF A;  3H5A A;  2HOS A;  1JGG A;  4L5E A;  3RJP A;  4IVN A;  2WTE A;  3BZ6 A;  4G9Y A;  2JVG A;  1TTY A;  3PSI A;  3F21 A;  4FTH A;  4I01 A;  3OYA A;  5K5R A;  1MIJ A;  3PNV A;  4UUV A;  4ZDL A;  4BHC A;  5E17 F;  2HR3 A;  4HF0 A;  4CH7 A;  3KZI C;  4RA2 A;  1QRY A;  5GAE J;  2D1H A;  3L1P A;  3GXO A;  5IP7 J;  2GZW A;  4RAY A;  1YS6 A;  1YLF A;  3CZ6 A;  1BI0 A;  2YPR A;  3CJR B;  4UB8 C;  1GXQ A;  3VB2 A;  3S93 A;  4MTD A;  3DEU A;  4DYR A;  3QP5 A;  5F1J A;  4IHV A;  4Y52 J;  2VC1 A;  2VPR A;  2MG4 A;  3E6B A;  2WAQ A;  2VI6 A;  1OLT A;  3BR0 A;  3SEQ A;  3K4C A;  4RGR A;  1R71 A;  1J7K A;  2JT1 A;  1NK2 P;  2R7Z J;  2UWM A;  1LQ1 A;  3BQZ A;  1Z7U A;  1TNS A;  2R7W A;  4UY8 I;  1LJ9 A;  4A3J J;  1VQO I;  3KEO A;  3ROU A;  3L09 A;  3CCQ I;  1I3A A;  2A5W A;  3DPT A;  3F0C A;  1O3Q A;  2K3F A;  5BPI A;  2ESN A;  1D8K A;  1VTN C;  1VFC A;  1E3P A;  2JUC A;  3EUK L;  3BG7 A;  1YRN B;  1MZB A;  4YIR X;  4K2E A;  5IYC J;  4JQF A;  4RM2 A;  5TJJ A;  2COB A;  2EZL A;  2KIF A;  2ACJ A;  3LA2 A;  2R7Q A;  1UST A;  2RDP A;  3F6V A;  2VBX A;  4L5J A;  4GO1 A;  2KFD A;  4AD9 A;  4ENN A;  4KN4 X;  5JFR A;  1W4M A;  2Q1Z B;  4I09 A;  2L9S A;  3BG3 A;  2HDC A;  1FLI A;  2BYV E;  4BQN A;  1OYW A;  3CES A;  1FOW A;  2JA2 A;  3KP7 A;  3J7Z I;  2HS5 A;  2R92 J;  1OCT C;  2V9V A;  4KA4 A;  5LBQ A;  1FIA A;  1ONV A;  3T1B A;  2JRT A;  2L7M P;  4HSR A;  5H20 A;  2DOE A;  3DU5 A;  3TBI A;  3GFM A;  1IV8 A;  1JTX A;  1O57 A;  2AXL A;  3O3K A;  4HV5 A;  3HXL A;  1TWG J;  2QLZ A;  4PFP A;  5GTI C;  3LSR A;  1HDD C;  3ERE D;  1Z21 A;  5JVG F;  2BBY A;  1ORK A;  2IT0 A;  1E2X A;  3KP5 A;  4C2T A;  1Z1D A;  1FMW A;  4XL9 A;  2B0L A;  3AFH A;  1NK3 P;  1ACI A;  5FRN A;  1TQI A;  2R7O A;  4LGW A;  3S32 A;  4LJZ F;  2GM4 A;  3VYR B;  2V9K A;  3LST A;  5C4J J;  4RAF A;  3AG1 H;  1DP3 A;  1ODD A;  1E3H A;  3I55 I;  3FBI B;  3GX4 X;  2LSO A;  1VQP I;  4N0B A;  4A3C J;  5E8I A;  5K7H A;  3H5N A;  4GGG A;  1UMQ A;  1S29 A;  2P6S A;  3K7A J;  3TKY A;  5D5X B;  4DGW B;  2A05 A;  3HEF A;  3QP6 A;  2PJP A;  4E7L A;  5CJ9 A;  2L3D A;  5IOY A;  2KIU A;  2OAZ A;  1LUJ B;  1B72 B;  1YX5 A;  1TWF J;  5K1Y A;  3T0Y A;  3FMS A;  4OAZ A;  3GTP J;  1XDU A;  3TOA A;  1W1W E;  3FXQ A;  1QZY A;  3FM3 A;  3CCY A;  1OYI A;  2ID6 A;  4UVB A;  3BDD A;  4B1R A;  1VI0 A;  5K5O A;  2KDZ A;  4PUS A;  1FTT A;  1A04 A;  3H1C A;  4AUX A;  1OCP A;  2W85 A;  3G3Z A;  3KP2 A;  3I4M J;  1MBG A;  4BAY A;  1UZC A;  1JTY A;  3KIO A;  1HKT A;  2P5V A;  3GTK J;  3DF8 A;  2WB1 A;  4HQE A;  2GQQ A;  5E1Z B;  3OL4 A;  1D5Y A;  2DW4 A;  2W25 A;  3C3W A;  4NHJ A;  1WJC A;  3P7N A;  2JUG A;  3L2Q A;  1X1B A;  3UR3 C;  3S16 J;  1SEU A;  2H6C A;  2YX4 A;  2ZBK A;  2VQL A;  5JHU A;  1D1B A;  1W7P B;  4M9S A;  2HXO A;  5KNL A;  5FRO A;  3F23 A;  1T0F A;  3BQY A;  2PBI A;  1BIB A;  3M8F A;  1MMG A;  3IH4 A;  3WTW C;  4J19 A;  1YHQ I;  2O03 A;  1Z91 A;  1XGM A;  3T8T A;  4IEJ A;  4CYC A;  1R49 A;  4PCQ A;  5KCM A;  2NRA C;  2IA0 A;  3FHN A;  3GFI A;  2OF7 A;  2G9W A;  2DFE A;  1SMT A;  2QQB A;  2PMH A;  5IP6 A;  4XMY A;  1FBS A;  3HRU A;  2Q0O A;  3NWS A;  2FBK A;  5F08 A;  1E0E A;  3CF2 A;  5IPA A;  3BR3 A;  3ESW B;  3HBL A;  1QNT A;  3OIP A;  1YX3 A;  2K9S A;  4BXF A;  2M8E A;  3WTT C;  4G8X A;  3LSP A;  3F8F A;  3M1E A;  2Z9O A;  2UXX A;  3K9T A;  2XAG A;  1G4D A;  1H9G A;  1MDM B;  2STW A;  1Y0U A;  3CCU I;  3LA7 A;  3UNG C;  1U78 A;  1X58 A;  4A3I J;  3WTV C;  1CQT A;  1XTA A;  2DA2 A;  1ITY A;  3OS2 A;  1ZG3 A;  2NOG A;  5E1W A;  3GTO J;  1FP1 D;  4EAT A;  2Y31 A;  4RDU A;  2MYS A;  2YX7 A;  5J6X A;  3OY9 A;  1MND A;  2A6H F;  3BTJ A;  4NC7 A;  4AVZ A;  1GVD A;  5JVT A;  4U88 A;  1VQK I;  1XN7 A;  1TT5 B;  2E36 A;  1NG6 A;  5CVI A;  2D1V A;  3OYE A;  2IPQ X;  2H8W A;  1STZ A;  5J1R A;  5E3N A;  4JX4 A;  3PQK A;  4GRI A;  3WG7 H;  3LNQ A;  2EJR A;  1XMA A;  4ZYH A;  4CCK A;  1JUP A;  3JRI A;  2O9L A;  3FBN B;  2XKP A;  2HFH A;  2D2W A;  2LYC A;  3K1P A;  1LKX A;  2QWW A;  3LFK A;  4N9I A;  1D1C A;  4S0H B;  5ICE A;  2W7N A;  3S3N A;  3KYL A;  1JHH A;  2L0K A;  2G7H A;  2KRH A;  3Q0U A;  2JSP A;  4OMZ A;  2VKE A;  4M6V A;  1U5T A;  2DPU A;  4B47 A;  3U21 A;  4L9T A;  1K6O A;  3QAH A;  1WCM J;  4A6E A;  3SQN A;  2OCC H;  1RC9 A;  2A61 A;  1UFM A;  3KE2 A;  1WSU A;  3I3L A;  1PUF A;  2QM3 A;  1JI8 A;  3QOD A;  2KP6 A;  1D0Z A;  4Z6Y A;  4KIG A;  4KFC A;  4CO8 A;  1NTC A;  1QQI A;  1MGT A;  2Y75 A;  3QYB A;  4A3G J;  3HOV J;  3PIO F;  3C2B A;  1IAW A;  3BTC A;  3M7G A;  2M0M A;  4M72 A;  4IHY A;  3GTM J;  1ULY A;  4HNV A;  3NQO A;  4G94 A;  3OYB A;  2EFW A;  2EIL H;  3PUB A;  3BTL A;  3HUG B;  2AQE A;  3RKW A;  3RQI A;  3AL0 B;  3M3Y J;  1GV2 A;  3HGY A;  2H09 A;  1XX5 A;  2ZSI B;  3OIQ A;  1ZGW A;  2DBB A;  1YTY A;  2NS0 A;  2XC7 A;  1UHS A;  3FXU A;  2G7U A;  2E1N A;  3C1D A;  5C4X J;  1D0X A;  1ETY A;  2IA1 A;  1HKS A;  4M6Y A;  4XKW A;  5DUK A;  2OBP A;  3GLX A;  5DYM A;  3JRB A;  1JKP C;  1APL C;  1Y6I A;  1IV6 A;  4IZZ A;  3KX2 A;  3DBR B;  1ETO A;  2IGO A;  2VUM J;  1B6A A;  1B1B A;  3RTR A;  3ERM A;  4CXF A;  4ZZL A;  4RGX A;  3ISP A;  2AQF A;  2OCE A;  3DPL C;  1HBX G;  2RC4 A;  3LSM A;  2QEX I;  4QLC U;  3H3Z A;  3A01 A;  3HRT A;  5J8F A;  2Z3Y A;  2V1X A;  1D5V A;  2H6B A;  2DQR A;  2XPW A;  1S5L C;  4KJZ A;  4LK1 F;  3R0A A;  1D1A A;  1ZTR A;  2GIV A;  2TCT A;  4EEF G;  2DMP A;  1MMD A;  4M6X A;  3WGG A;  5M5W J;  3WHB A;  1BW6 A;  3OYC A;  2IEK A;  3I59 A;  3DU6 A;  1QVT A;  1IW7 F;  4MFD A;  2IVM A;  2QBY B;  1E3O C;  5DCM B;  1U6G A;  3HC7 A;  4HPQ A;  4LG0 A;  1OCO H;  3MZY A;  2NS7 A;  3M4O J;  3CUQ C;  4HG2 A;  2VC0 A;  3GEZ A;  1SD5 A;  2CQK A;  4I99 C;  2KL4 A;  2P5K A;  4HOB A;  3N4M A;  2IRF G;  2E71 A;  3PFI A;  4XLA A;  1Z6R A;  2W84 A;  4CHU A;  1JUS A;  2RNJ A;  2ZME A;  1BC7 C;  3BJ6 A;  5EGO A;  1R6R A;  3L2R A;  2EIK H;  1WWX A;  4ZDO A;  1JXS A;  3C7J A;  1WZ2 A;  2RQQ A;  2W57 A;  3SYT A;  1GUU A;  4D0P A;  3AAF A;  3O8H A;  4G12 A;  4V2G A;  2V1U A;  4XRF A;  1U9N A;  2DFI A;  4D5F A;  1I6H J;  1VQ7 I;  1TT0 A;  5D8K B;  3MWM A;  5CLS A;  2P7C B;  1G8X A;  1SVL A;  2FUG 2;  4A3E J;  4ZTF A;  2R7R A;  3ABT A;  5F64 A;  3EET A;  4LFU A;  2E1C A;  5HOD A;  2LOO A;  2X6O A;  4AC0 A;  3BJO A;  2Z2S B;  2VOD A;  1MDM A;  3U1D A;  5BMZ A;  1ZN2 A;  2F6C A;  4HAM A;  4FT8 A;  5TGT A;  3DKW A;  3DKY A;  5DS9 A;  1W5T A;  4L0Z B;  3OV8 A;  1HW5 A;  2EWN A;  4LLN A;  3ZQQ A;  4YFN F;  2M87 A;  3EUH A;  4O5V A;  2O7O A;  3LQR A;  5ICF A;  1G3W A;  1YOV B;  1XPX A;  1BR4 A;  1QO0 D;  4XKC A;  4TV7 A;  5B66 C;  1DQU A;  2EFP A;  4P96 A;  2DQL A;  2LNB A;  2K9L A;  4MNU A;  2DJN A;  4PJN A;  2XAF A;  2HWV A;  3QOE A;  1VQL I;  3D5S C;  4XK4 A;  5J47 A;  5FLX K;  3I71 A;  3WU2 C;  4AYB A;  3BZK A;  1QHH D;  2V6E A;  4IHX A;  1MBH A;  3QPL A;  1FSH A;  3K2A A;  3O8G A;  5A2Q K;  2ME6 A;  4XRM A;  3OYG A;  2YUS A;  1UJ8 A;  4A0Z A;  2FBH A;  3HKZ A;  2DT6 A;  3CJT B;  3VYU B;  2ZNZ A;  1S7O A;  1VQM I;  2VKD A;  5FFX A;  3WTY C;  3QU6 A;  3BC8 A;  1ZAO A;  2PX9 A;  1D8J A;  4ZYA A;  4RAZ A;  3ZRG A;  2K27 A;  3JRD A;  3LFU A;  4JYK A;  4AM3 A;  2H1L A;  1DPU A;  1YW9 A;  2DTZ A;  4BNC A;  2BOL A;  4DQ2 A;  4DW6 A;  2V6C A;  2IW5 A;  3BPV A;  4F91 B;  5K7Z A;  3C2H A;  5FKL A;  2LLK A;  1MMA A;  4Z2Y A;  2Y2Z A;  3RPU A;  2V79 A;  2JMW A;  3TDZ C;  1ETV A;  3DWL E;  1QPI A;  2GIZ A;  2M0C A;  1J59 A;  2Y30 A;  1FC3 A;  5J3L A;  4BY7 J;  2UV1 A;  4Y7N J;  2CMP A;  3DCF A;  1DDN A;  1F1Z A;  3FXR A;  2WB1 N;  3KLN A;  2IS1 A;  1FY7 A;  2GAU A;  1O7F A;  2PMZ N;  1FMV A;  1R23 A;  4PJM A;  1K61 A;  1RUN A;  3F8M A;  2XAQ A;  5LRR A;  2XAS A;  1AU7 A;  3L9F A;  4M3G A;  1WHU A;  2R4G A;  2FNA A;  4JX6 A;  2OC6 A;  2KIM A;  1XGO A;  4QSH A;  1ZGA A;  3VOD A;  1P7I A;  3VPR A;  4W1U A;  3V8L A;  1L3L A;  5E18 F;  3ZMS A;  3I56 I;  3JRE A;  2CV2 A;  3R6S A;  5KK1 A;  2DYS H;  2VAS A;  3A1Y A;  2LD5 A;  1GV5 A;  3FIS A;  2OUM A;  3H5R A;  2ZO4 A;  2P81 A;  1BN5 A;  1YIT I;  3AL0 C;  2HVS A;  5HLI A;  5KAF C;  5F0F A;  1GXP A;  2FD5 A;  2NS8 A;  2VBZ A;  5JLW A;  4AIH A;  4D9J A;  2CUE A;  2DMQ A;  4OIP F;  2AXT C;  3EYI A;  3Q5F A;  2ECB A;  2EIM H;  1G6N A;  1AWC A;  4V2F A;  3TDU C;  4ESB A;  4XRS A;  3OYK A;  2LDU A;  1QGP A;  1P2F A;  1X1A A;  4MFE A;  5A2Q Z;  2M4K A;  3FX3 A;  4U7D A;  4G6D A;  4XOP A;  2K86 A;  2LH9 A;  4IOC F;  2FA5 A;  4L9V A;  4X1E A;  3U9G A;  3OYM A;  4CSW A;  1H89 C;  2Z1D A;  3PM1 A;  2R7T A;  3PSF A;  5EDN A;  4KNY A;  1YIJ I;  3GLL A;  3FXJ A;  2P4W A;  1YJW I;  2M2E A;  2L9R A;  4KIT B;  2M1B A;  2CU7 A;  3ZXS A;  2JPC A;  3S2H J;  3MVP A;  1T08 B;  1SMY F;  2WAD A;  3P5J A;  1GHC A;  2BE5 F;  2LKX A;  2IP2 A;  5J4Y A;  5LRS A;  3OOP A;  1BM9 A;  2V26 A;  2ZXH A;  1BI1 A;  4KMF A;  3E5Q A;  2MGQ A;  4CYC B;  4BE0 A;  1HF0 A;  2EA2 A;  3O6B B;  1G2H A;  2XIG A;  4B44 A;  3JRC A;  2BV6 A;  1ZRD A;  3KYD B;  4D5C A;  2H8R A;  2V4J C;  1T8I A;  4EQQ A;  1O3S A;  3B02 A;  1HKQ A;  4RB0 A;  1W5S A;  2X48 A;  2ZXW H;  2VB6 A;  3SFZ A;  5LGN A;  1JKQ C;  4ASN A;  2DA5 A;  1D3Y A;  1YYV A;  1A5J A;  2VJJ A;  3IWZ A;  5LHG A;  2HGC A;  1IRF A;  5ILV A;  2QEN A;  3AG4 H;  3GF2 A;  4J01 A;  4FAS D;  3S1N J;  3CMM A;  1BJZ A;  1ZK8 A;  4PSX A;  3OYJ A;  2MAB A;  2EZI A;  2JPB A;  4E7S A;  5FKO A;  5KHD A;  5IY5 H;  2H27 A;  2NAZ A;  3MKL A;  2H1K A;  3IV5 A;  1OJL A;  3GYH X;  5FLM J;  3E0J B;  3ZQF A;  5H2F C;  1FYK A;  3HTS B;  3BOQ A;  2W48 A;  2FXA A;  1K79 A;  2HKX A;  2M45 A;  3NAU A;  3HHG A;  4RB3 C;  4NBQ A;  4MIM A;  3EUA A;  2LY1 A;  2VJ5 A;  4RB2 C;  5CPR B;  4QPO A;  3KET A;  1K78 A;  5DM7 F;  2R5Z A;  1PP7 U;  5K5Q A;  2ZXJ A;  2VIX A;  5K7F A;  1XS9 A;  3BCB A;  3MFK A;  3B6C A;  1F43 A;  3WHC A;  5H6Q A;  2WC2 A;  2Y48 A;  1DU6 A;  2QVO A;  1T95 A;  1R7J A;  4CCJ A;  3C18 A;  1FYM A;  4MO7 A;  3HRS A;  1MW7 A;  1MJ9 A;  1PYV A;  3F9K A;  2HOT A;  1WI3 A;  4HF2 A;  3BG9 A;  4Y3O A;  4GCV A;  3DTK A;  3PNT A;  2NXN B;  5GTH C;  2HI3 A;  2CW7 A;  2HU9 A;  3K6G A;  6PAX A;  3IH2 A;  1RNL A;  4ZTJ A;  1ZR4 A;  1U5T B;  3IKV A;  1VQN I;  4XLE A;  4A5M A;  2IGK A;  1TL8 A;  2EZH A;  4XLF A;  2LF7 A;  3N97 A;  1VF9 A;  4C2U A;  3VYT B;  2VN2 A;  2K9Q A;  3WTU C;  2IS2 A;  4XR6 A;  4B3A A;  2KMU A;  1UAA A;  1PUF B;  3FXO A;  1XB4 A;  1ON2 A;  5BNG A;  2CQQ A;  4DYQ A;  4F92 B;  1SAU A;  5D5W B;  2PLY A;  4KT6 A;  1BI2 A;  4HST A;  5EG0 A;  1Z0X A;  3K1M A;  5DD8 A;  2HDW A;  5FJ8 J;  2OZU A;  1Z6T A;  2R5Y A;  4FIS A;  4RGS A;  5DM6 F;  3KP4 A;  1WJD A;  2N8G A;  1IRX A;  5M5X J;  2HVR A;  4C3H J;  4E4H A;  3ABM H;  3TP3 A;  4XN0 A;  2OD5 A;  4YFX F;  3SXY A;  5E79 C;  1H9T A;  3DLA A;  4ESF A;  2CH0 A;  1V5E A;  2VT2 A;  4DYC A;  4BJ5 C;  4F93 B;  4O3M A;  4BEH A;  2VLA A;  2VKH A;  4BGD A;  1BI3 A;  3F72 A;  4IHW A;  2MLK A;  4BQA A;  3L2U A;  1A31 A;  2J5P A;  4RMN A;  4BDZ A;  2X0L A;  3G1L A;  2WAE A;  2QA4 I;  2OTL I;  4ESJ A;  3DTE A;  1MKM A;  2CYY A;  3V4G A;  3CQZ J;  2DYR H;  3KZY A;  3ZMV A;  2L02 A;  2VQG A;  3BRO A;  1ZKG A;  2HQA A;  3G1O A;  4I0B A;  4XKB A;  3DXJ F;  3A01 B;  3G6E I;  1BC8 C;  1EV7 A;  3ZPL A;  2BHY A;  4IXA A;  2VOO A;  3B6A A;  3BR5 A;  4ZDP A;  1PJR A;  2LRE A;  3IKT A;  1B9N A;  1H0M A;  1EH8 A;  1HST A;  1X1P A;  2ELH A;  2ZC2 A;  4IF4 A;  1G3Y A;  1P92 A;  5CQG A;  3OYL A;  1ETQ A;  2HOA A;  2R3S A;  1YW7 A;  2E60 A;  1ENH A;  1HOM A;  3I59 B;  4GYG A;  1Z05 A;  1MBE A;  4XLP F;  2AO9 A;  2DU9 A;  1SD7 A;  4BHB A;  3S17 J;  3CO6 C;  3W2A A;  4YEL A;  3E5U A;  1LPQ A;  4LG0 B;  2DMN A;  3H3U A;  4UB6 C;  4C2M J;  3H0D A;  3ZQI A;  3I5U A;  1X4P A;  2CQN A;  2H94 A;  4BYY A;  1IDY A;  3LSK A;  2LKS A;  3J81 Z;  1J09 A;  2ZME B;  4UHT A;  2L7F P;  1JGS A;  3QPT A;  2BVM A;  3RYP A;  2DK8 A;  3A0H C;  1JHF A;  5EGO B;  4A3M J;  4OU0 A;  1N25 A;  3CJQ B;  4UV9 A;  1WRJ A;  2DN0 A;  1EA3 A;  2P7V B;  1F9N A;  3G2B A;  2QSG X;  3RKY A;  2DCE A;  1CF7 B;  3KP6 A;  1WQ2 A;  4GDF A;  1YW8 A;  1B8I A;  5HS9 A;  3Q9S A;  1IN6 A;  4A93 J;  1U8R A;  3H3V K;  3ULQ B;  2OV7 A;  2F4O B;  3GO5 A;  2BXY A;  4M9Z A;  4G6Q A;  2FU4 A;  1MSF C;  4I6Z A;  3CUO A;  3D5R C;  3JRG A;  5H6R A;  3S1R J;  2XVC A;  3V8K A;  2HYG D;  4PFO A;  1LDD A;  4CCL A;  1T0F C;  2IGN A;  2GXG A;  2X85 A;  5E3M A;  1KON A;  4NB5 A;  2WV1 A;  4M3E A;  3G71 I;  2MSY A;  4E7H A;  5L3C A;  1MMS A;  4LIV A;  4NUB A;  1A6Q A;  4F7Z A;  4HLX A;  1AHD P;  2K5C A;  2QGU A;  4YG2 F;  2ISZ A;  3ECH A;  2O6G E;  1XCV A;  2K7L A;  1YG2 A;  3MKY B;  2KJC A;  2EQR A;  3E6D A;  3TW7 A;  1CGP A;  1R1T A;  3FIW A;  3BCA A;  3S3M A;  4X6A J;  2OPT A;  3F8C A;  3MAJ A;  1C0W A;  5C44 J;  4ZC3 A;  1WH7 A;  4PDK A;  4UUS A;  4Q5S F;  4WXC A;  3G1M A;  2XRO A;  2R7F A;  4UVA A;  4YRV A;  2G0E A;  4KIS A;  2BHZ A;  4FCY A;  2IBD A;  3LL7 A;  2FBI A;  4MLO A;  2A3S A;  4Y13 A;  2CUZ A;  3GVA A;  5HDG A;  2O8X A;  4HBL A;  5GP9 A;  1F4K A;  1R5G A;  4DOZ A;  2LR8 A;  4S04 A;  2ZNY A;  3ZN0 A;  4KYW A;  1YQA A;  3IRQ A;  3RSN A;  3MKZ A;  5GPC A;  2W00 A;  3WE3 A;  2CW8 A;  4DJA A;  1XSD A;  3JSP A;  2XF5 A;  3RCO A;  5D5V B;  5E3O A;  3VWB A;  2QSH X;  4RBO A;  3L2C A;  4I98 B;  3TO9 A;  1QU3 A;  4A6D A;  3M9A A;  1JKR C;  2KZV A;  4OIN F;  2FMY A;  1G3S A;  5ILS A;  1PDN C;  2RN7 A;  3K70 C;  2O0Y A;  1BA5 A;  2DK5 A;  5F0H A;  1L0O C;  3HOT A;  1NG7 A;  4Q48 A;  4WX9 A;  1QZE A;  2VPL A;  2WV0 A;  4YIF A;  3H9J A;  2J5O A;  1KQ8 A;  2DJI A;  3WE2 A;  4FX0 A;  4FE4 A;  3K4K A;  3CMA I;  1X3Z B;  1ZLJ A;  2F5F A;  2BGC A;  2AS5 F;  3OWT A;  4B09 A;  3BLY A;  1WJF A;  3DPU A;  5ILU A;  1U0J A;  1DP7 P;  4MQV A;  1RES A;  1W5C C;  2XPV A;  3ZN1 A;  3KFW X;  3PJR A;  1OKR A;  1V54 H;  4UNO A;  2A68 F;  1IRG A;  2JSC A;  1BR1 A;  1DGR M;  2EV0 A;  4XKV A;  4JOM A;  1PUE E;  1ZH5 A;  3WTS C;  1U3E M;  2HQ5 A;  3CCS I;  2RRE A;  3SHF A;  2KDO A;  3W6V A;  3A02 A;  3S2D J;  3KEY A;  2CFX A;  1FBU A;  3H9Q A;  2E35 A;  4FET A;  3W6J B;  2VQH A;  3ZQ7 A;  3IL2 A;  3RKX A;  3TOB A;  5J40 A;  1JJ6 C;  1LNW A;  1SAX A;  1LDJ A;  2CG4 A;  2JK3 A;  3Q3S A;  1FYL A;  4CCO A;  2LRD A;  5BPD A;  1HW2 A;  4A69 C;  3WGI A;  1FX7 A;  4HDV A;  3CCM I;  1T2K A;  1PP8 F;  3H9G A;  1R5I D;  2V1N A;  1RR8 C;  5D4R A;  1HA8 A;  2MA3 A;  2CQX A;  1KYW A;  2KRC A;  5LD2 C;  5DCF A;  3IRR A;  1DGW Y;  4HEA 2;  3EPZ A;  2PI0 A;  3RKQ A;  2OQG A;  1Y8Q B;  3GTJ J;  2ZJ2 A;  4KIC A;  2L4M A;  4P9U A;  4S05 A;  4PGG A;  1F36 A;  2QYO A;  3CUQ A;  3COA C;  1SVO A;  3E7L A;  3IAS 2;  4B43 A;  5TRD A;  4R79 A;  1R36 A;  4L0Y B;  1KZH A;  4IL6 C;  1J75 A;  3HGG A;  2K40 A;  5EJC A;  1ZQ3 P;  2DO7 A;  2CJJ A;  2F5V A;  1QA6 A;  3CC4 I;  4GFB A;  2WAQ N;  4IQ4 A;  1KA8 A;  1I50 J;  1MMN A;  1Z3X A;  2FEZ A;  2KIQ A;  1S9H A;  2PEX A;  2QQ8 A;  4LOC A;  2FNP A;  2LC2 A;  1REP C;  5EEH A;  3OYH A;  1UHM A;  3D0S A;  2XPU A;  1SFO J;  2FRH A;  1G59 A;  2DPD A;  2LF8 A;  4XOR A;  3CDL A;  2UXN A;  2BY0 A;  4LIU A;  1H8A C;  2FOW A;  4PJJ A;  3LMM A;  4Y15 A;  3GZ5 A;  2BY2 A;  2BY1 A;  2GWR A;  2RGV A;  5IT3 A;  3CCL I;  2XUB A;  1CF7 A;  3QU3 A;  5J1U A;  3CLQ A;  5D4S A;  2PQ8 A;  1XMX A;  4WXD A;  1IN7 A;  2YU3 A;  2KZG A;  3GTG J;  2EV6 A;  2Y0S A;  3BY6 A;  4ENM A;  1RRJ A;  4D7N A;  3ZP5 A;  1TZL A;  4A0X A;  5BQT A;  1I1S A;  3CD6 I;  5LGT A;  5ED4 A;  4BH9 A;  1ETK A;  1X19 A;  4C30 A;  1YIO A;  1RET A;  1HCR A;  3RZD J;  2VE9 A;  3KLO A;  4DIQ A;  1MBK A;  4BY1 J;  2E1M B;  4LG3 A;  4BJT A;  3LSJ A;  3GME A;  2ELK A;  3SZG A;  3TQN A;  2DXI A;  5J8C A;  4HDU A;  2QKL B;  1YI2 I;  4E7J A;  1U2W A;  2O8K A;  5FD5 A;  4IO9 F;  2HOE A;  5GAG J;  4JX5 A;  4D1Q A;  2VXZ A;  2ADU A;  2CRG A;  2O3F A;  1T39 A;  2K3P A;  1TWA J;  3FMR A;  3GFJ A;  4A12 A;  3DQV C;  5IYD J;  2DT5 A;  2TDX A;  3CO7 C;  1IRZ A;  3MZH A;  1K78 B;  2R5Z B;  4A2U A;  3I58 A;  4C3J J;  1EF4 A;  3JSO A;  5HS7 A;  3FKJ A;  5EZG A;  3MKW B;  2K4B A;  3JW4 A;  4CZZ A;  4ZYG A;  2GA1 A;  3S8P A;  2HTS A;  2XB0 X;  1XCB A;  3BR2 A;  4BQO A;  3BPX A;  1ZRF A;  5L3G A;  4M9X A;  4ZJZ A;  2GXA A;  3OS1 A;  2D45 A;  4A3K J;  1VQ9 I;  2LFB A;  3Q0V A;  4OIO F;  2XGX A;  3IWF A;  3HOX J;  4NNJ A;  3ZQC A;  2OU2 A;  4BJ6 C;  2MH2 A;  3AKZ A;  5DV5 A;  3FXK A;  4HYE A;  3CC7 I;  1SFX A;  1MJB A;  2F48 A;  3EUH C;  2IJL A;  5FB2 A;  2R7S A;  2NVY J;  3LA3 A;  3F6O A;  3P9K A;  2UZK A;  4EJW A;  1JUM A;  1WH5 A;  3OSG A;  3HB9 A;  4Y4R A;  2GLO A;  3CTA A;  1B4A A;  1ZYR F;  5DUI A;  5EEA A;  2A6T A;  3FMQ A;  1IXC A;  4M3F A;  5HNF A;  3RDI A;  3WTZ A;  1XD7 A;  2HZT A;  2DI3 A;  2HPM A;  2DFF A;  1KU9 A;  2VT3 A;  1UEL B;  1SC7 A;  1W7P D;  3ZMD A;  4G6T B;  3K2Z A;  3A4C A;  4L9J A;  2WWY A;  4OWR B;  2L9V A;  5EG0 B;  1W0U A;  2F5C A;  1OCR H;  4YII A;  1T56 A;  3TGN A;  5HVQ C;  4MEY F;  1MSE C;  2EFQ A;  1FSE A;  2ELJ A;  2R5Y B;  2F4I A;  1WJ5 A;  4ZH4 F;  4P55 A;  3ZMU A;  1UG0 A;  4E6K G;  3CF5 F;  2LK2 A;  2AHQ A;  5B5E C;  3CP8 A;  3AG3 H;  5B1A H;  3RYR A;  2PG4 A;  5B3S H;  5IT9 Z;  2CV0 A;  3BT9 A;  3K4L A;  1V5F A;  3JCU C;  2EV5 A;  2X1D A;  4CZC A;  3QPH A;  5C3E J;  3OSF A;  3HYI A;  4BEH B;  2YR2 A;  1ERD A;  1P4W A;  2HXI A;  2L7Z A;  3P9I A;  3OOU A;  4DBQ A;  1ZR2 A;  4XM3 A;  2E2H J;  2HQR A;  3ML6 A;  1SVM A;  3VSL A;  1FIP A;  2I10 A;  2C6Y A;  1OR7 A;  4B3X A;  3ASO H;  4P9F A;  1R4N B;  1HW1 A;  2HDD A;  2KHM A;  3G4S I;  2DDB A;  4N9H A;  2CGP A;  2JN6 A;  1XG1 A;  2NNN A;  4EGZ A;  2JQ7 A;  4IHS A;  2VOP A;  4XN3 A;  2ZB9 A;  2FQ3 A;  4E7Z A;  4CDG A;  4HX8 A;  2XAU A;  3HG9 A;  3KZZ A;  1I3Q J;  2HQN A;  4RS8 A;  1WJA A;  2Y0M A;  4W97 A;  2E2J J;  4CCN A;  3K0L A;  3WU0 A;  4G7H F;  4FQG A;  2QQ9 A;  3IAM 2;  1Y1V J;  4II3 A;  2M34 A;  1V4R A;  3E3V A;  5LEK A;  4QIW N;  3HM5 A;  4LK0 F;  4BBR J;  3J7Y J;  1KQ9 A;  3FF5 A;  1T6S A;  3MZ8 A;  1LVA A;  2OJE D;  2FOK A;  2MW8 A;  4PZJ A;  1XGS A;  5HDN A;  1VZ0 A;  2JZY A;  2MLG A;  3BWG A;  2MFZ A;  1VQ4 I;  2X51 A;  3HPG A;  2EFO A;  2HZD A;  3MMY B;  5F6F A;  5HS8 A;  1VQ5 I;  5LLQ A;  3GTL J;  1LEB A;  2HVQ A;  2NVQ J;  5M5Y J;  3ZCO A;  2JA6 J;  4BAC A;  3LSG A;  3F8B A;  2BEO A;  2GBY A;  4OOI A;  1RPW A;  2A5Y B;  1KGS A;  2JVH A;  2RKH A;  3E6C C;  3S14 J;  1V55 H;  4U87 A;  3FXM A;  3ABK H;  4BU2 A;  2LBF A;  1Q1V A;  4BDY A;  4IHT A;  2I5U A;  2WBM A;  2O5R A;  5HLG A;  3HPH A;  1AOY A;  1B8I B;  3H0G J;  4LB6 B;  3L00 A;  4RGU A;  1USS A;  4YEJ A;  3ZQG A;  3L2V A;  4E7K A;  3F8N A;  3PUF A;  3I4N J;  1J9I A;  2VKV A;  2UUZ A;  1OPC A;  2E19 A;  2D5V A;  1ZG1 A;  1LDK B;  1YE9 A;  3I53 A;  3ZMT A;  5CQE A;  4NQW A;  3DKX A;  1LE8 A;  4OAY A;  5F0C A;  3HSE A;  2E1O A;  4I02 A;  2YS9 A;  4XID A;  4LLL A;  1B59 A;  4A3B J;  3M8J A;  2CFO A;  2L54 A;  1JJ8 C;  2MD0 A;  2JA5 J;  1POG A;  5E1X A;  4DZJ A;  5JR3 A;  5AON A;  1M1E B;  3SZP A;  2JA8 J;  2KJB A;  3DV8 A;  5L3B A;  5ICG A;  3LWF A;  1WKM A;  1A35 A;  4M74 A;  2KPM A;  1J2X A;  3ZGK A;  1Y0N A;  2TRT A;  1JT0 A;  2Z99 A;  1JKO C;  4MEX F;  2Y9Z A;  2L4A A;  3BG5 A;  3DLL F;  2IXS A;  1H88 C;  2BXZ A;  1EH6 A;  2COM A;  3S3O A;  4BXU A;  3HHH A;  4UUS B;  2XKO A;  2F4M B;  1RIO H;  3RZO J;  1RR7 A;  4AID A;  5LEJ A;  1JE8 A;  1IGN A;  4CUG A;  4AIJ A;  4PJL A;  5EYR A;  3TW6 A;  4OIQ F;  3J7A O;  2Z16 A;  2E1M C;  3H35 A;  2VL8 A;  2Q2E A;  1Y1W J;  5E20 A;  9ANT A;  4EV0 A;  3ZQH A;  4M3B A;  5HNH A;  3WOD F;  4IRI A;  3ONQ A;  4MQ9 F;  2DOA A;  1WI9 A;  2DLL A;  2CUF A;  3K4B A;  4M71 A;  2VXD A;  3A03 A;  4LIT A;  4BE2 A;  3J81 K;  4GXO A;  4QTR A;  2L9N A;  2IS6 A;  5HLT A;  3R0J A;  4E70 A;  1ZLK A;  3JRH A;  1TQP A;  4X0G A;  4EJU A;  5BS6 A;  3JTG A;  3HJE A;  1TBX A;  1IF1 A;  2DA4 A;  4KMU X;  4U0V A;  3WTX C;  2ZJR F;  4IOA F;  2MBF A;  4DZP A;  4M3D A;  1AKH A;  1OIS A;  4CGZ A;  4U0W A;  3VDX A;  1IXS B;  2F5E A;  3IH3 A;  2NNY A;  4L9N A;  4F55 A;  2IAI A;  3WU1 B;  1UHW A;  2XAH A;  2ECC A;  3FHZ A;  3DEW A;  3WG9 A;  1JT6 A;  2V1D A;  1QHG A;  2XV4 S;  2ZFW A;  3B73 A;  1LFU P;  1EH7 A;  3ZMZ A;  2OQR A;  1Y56 A;  4IQJ A;  2M3A A;  1T98 A;  2DAO A;  2RNG A;  3LAP A;  2K4J A;  1IN8 A;  1TWC J;  5LFA A;  3OYD A;  3HOU J;  1K7A A;  3S15 J;  2LKP A;  2ZXI A;  4ENK A;  1KYZ A;  1R4M B;  2ZSH B;  1I39 A;  3NAR A;  2LY2 A;  5EF6 A;  1WJE A;  3S1Q J;  2FF4 A;  4PJ0 C;  3CCJ I;  2FQ4 A;  1Z7L A;  3A2K A;  5D8L B;  4A0Y A;  3BZC A;  1HXD A;  5IOZ A;  2QCO A;  3C2G A;  3K1N A;  1QVU A;  2EBI A;  3CJN A;  4M73 A;  4PGH A;  1HQC A;  1S7A A;  4UV8 A;  1FWZ A;  1N75 A;  3OYF A;  4H0E A;  1BJA A;  5IYB J;  1T33 A;  1FBQ A;  1IN4 A;  2XGE A;  1I5Z A;  5CVJ A;  3RIR A;  2Y0S N;  3RQ4 A;  1X2N A;  2B9S A;  3ECO A;  5F1R A;  2XB5 A;  4XOT A;  5JHF A;  1IO2 A;  1MD0 A;  4GYI A;  5GPA A;  4DNC A;  2RVC A;  2K9N A;  1WPK A;  2HPI A;  5FKK A;  3REO A;  2ICW G;  3CUQ B;  3W2V A;  5D5U B;  2E7W A;  3PO3 J;  3FWE A;  5FRM A;  1SAN A;  2K85 A;  5F27 A;  5AIP A;  2M4G A;  1XMK A;  1FP2 A;  2BW3 A;  3MD2 A;  3V7R A;  1WJB A;  2A07 F;  1WFX A;  4JBA A;  4L18 B;  3H36 A;  3FDY A;  4CCM A;  3JRA A;  4EM2 A;  2E7X A;  2W4S A;  1IUF A;  2YSR A;  3BR1 A;  4IRH A;  4BQQ A;  2XSD C;  3EYY A;  3T5X A;  1BR2 A;  3PNY A;  2ME0 A;  1FJL A;  1FOK A;  1EJ9 A;  1DU0 A;  1LFB A;  2LVS A;  2F2E A;  3TO7 A;  3KP3 A;  1P9Q C;  2HEO A;  2A69 F;  2Q8K A;  2NVX J;  1LEA A;  3IUO A;  1K4S A;  2R0Q C;  2K02 A;  3FK6 A;  3ZQL A;  2PMZ A;  3MN2 A;  3GW2 A;  3CC2 I;  1BBY A;  3TL4 X;  1MNE A;  4AYB N;  5EZH A;  2O61 A;  4V19 K;  3LSH A;  1IUY A;  1IDZ A;  1O4X A;  1O7L A;  1KU2 A;  3HKZ N;  2ID3 A;  4II2 A;  2DTR A;  4MTE A;  1A6I A;  2Z5U A;  3BG6 A;  2JTV A;  3UKG A;  1FTZ A;  3M07 A;  4PK4 A;  2STT A;  4XSX F;  3CMY A;  1U8B A;  3IC7 A;  2ZJQ F;  1TQM A;  2CS3 A;  1ZRE A;  3HRM A;  1J0R A;  3TO6 A;  4HNU A;  1R5H A;  2QUF A;  3KEQ A;  2EA4 A;  3BR6 A;  4A3D J;  2HKO A;  1A36 A;  1MNM C;  2XF7 A;  2KLO A;  4ABZ A;  4YFK F;  3WGH A;  2XGD A;  1X4O A;  1NHA A;  1AA7 A;  1FEX A;  1UB9 A;  3W3C A;  2L7K A;  3KYC B;  3SFI A;  4BE1 A;  3GZN B;  2ESH A;  3DEE A;  1Z9C A;  1Z67 A;  1FT9 A;  1ZG5 A;  2VBW A;  2XGC A;  3LOC A;  2QQA A;  1WGX A;  5J4V A;  1O3T A;  1XGN A;  2E34 A;  2LTP A;  3HDD A;  1Z77 A;  2WY8 Q;  3NRV A;  5FGM A;  1S8N A;  3F3X A;  1XSX A;  2QSF X;  1XSV A;  3ASN H;  5CVR A;  1BL0 A;  4UUT A;  3HOZ J;  3HSF A;  2KQR A;  3CDI A;  4XBF A;  3RI4 A;  4C3I J;  3PIP F;  2DA3 A;  1R9T J;  2K9M A;  5FKM A;  1YJ9 I;  4J00 A;  3E6M A;  4IRG A;  2MH9 A;  1YRN A;  2VON A;  3JAM K;  3L2W A;  4HLY A;  1TW3 A;  2F5D A;  3V7C A;  5FFZ A;  1OCC H;  3GWZ A;  1DUX C;  2LY9 A;  3G73 A;  5ICC A;  3CCE I;  4LLG F;  4A5N A;  4EMS A;  2E5N A;  4U7B A;  2DA1 A;  2QF7 A;  4F3Q A;  1J5Y A;  1GLN A;  2Y9Y A;  3K4M A;  4XON A;  3ZOB A;  3FZV A;  1MH3 A;  2X6W A;  3FXL A;  1N78 A;  1E17 A;  3QWL A;  1WVR A;  3QYE A;  2ISY A;  2V9P A;  4HQM A;  2MC3 A;  3K10 A;  1OCZ H;  3NWT A;  3MEX A;  2EPF A;  4Q47 A;  1K6Y A;  3D5L A;  1IG7 A;  1NH3 A;  1LB2 A;  1UG2 A;  3JTH A;  3HOS A;  1U5T C;  2L2O A;  4A3L J;  2VJ4 A;  2MD5 A;  5JLX A;  2V7F A;  4ENJ A;  1R00 A;  2M30 A;  5DD4 A;  3K4J A;  1ZEL A;  2CO5 A;  4EJT A;  3D1N I;  2XHK A;  3DFG A;  2IA2 A;  3R60 A;  1BW5 A;  1BOB A;  2M5W A;  2M8G X;  1Y39 A;  3HSR A;  4NC6 A;  1G3T A;  5FKN A;  3SZT A;  4AIK A;  2MC4 A;  4B48 A;  1QBJ A;  2A6E F;  3E5X A;  5AIQ A;  3QPS A;  3HL2 A;  1RI7 A;  1HC8 A;  4HA8 A;  1OFC X;  1Z3Y A;  1SD6 A;  3CP2 A;  1R1V A;  2EIJ H;  5F04 A;  4HRI A;  5DTD A;  4Q4Z F;  2PMU A;  4L5I A;  2DMT A;  2XRL A;  2BY3 A;  2ZCW A;  3BJA A;  1FOY A;  2FSW A;  1PVE A;  1TC3 C;  2FX0 A;  1B72 A;  4I7H A;  4LB5 A;  4B8X A;  2GA2 A;  5DDG A;  1X3W B;  2XF6 A;  2W1O A;  2XSJ C;  3U2R A;  4AVP A;  1P6R A;  2YU9 J;  1ETW A;  1W0T A;  3Q0W A;  5GAH J;  3W6K B;  1SD4 A;  3TMO A;  1LFP A;  4WK8 F;  1HSJ A;  3K70 D;  3CCR I;  5M3F J;  2CW0 F;  4XLC A;  5CVU A;  5KVR A;  3JAM Z;  1F5T A;  4HF1 A;  4B4C A;  3AG2 H;  4ZZD A;  4IX7 A;  4RAG A;  5L3E A;  4FE7 A;  4WXH A;  4KT5 C;  4NDL A;  1X1D A;  3OR2 C;  3M1C A;  4R8H A;  2NOJ B;  4HV6 A;  1I6X A;  1IZ1 A;  5IP9 J;  3EDP A;  1Q1H A;  5CKT A;  2Z33 A;  3HZJ A;  3S2W A;  1S6L A;  2ZJP F;  4HW0 A;  3MCZ A;  1ZRC A;  1Y8R B;  4JK1 X;  2OZ6 A;  4N4N B;  5GAD J;  2DDA A;  3K69 A;  3R4K A;  1W7P A;  1TP4 A;  3ABL H;  1GT0 C;  1FOX A;  1HDP A;  3CDH A;  1X1C A;  1N77 A;  3OYI A;  2CV1 A;  4WF2 A;  1TW2 A;  1FZP B;  4BXX J;  1SFK A;  3V8J A;  3GCM A;  1GDT A;  3U1K A;  2LBF B;  1ZGJ A;  4ANJ A;  2DT7 B;  2HYF A;  4XIC A;  2PJR B;  1D0Y A;  2GOX B;  2P6T A;  5B1B H;  3GBG A;  1IC8 A;  2LG4 A;  1OQY A;  2VJI A;  1OYY A;  3ZR8 X;  2CWE A;  5ERI A;  4BUP A;  2ZME C;  1ETX A;  3QQA A;  4NQW B;  5IT9 K;  3VSK A;  2KKO A;  2QZ8 A;  4CIC A;  1LE8 B;  4XQF A;  2B7E A;  2RQP A;  4NC8 A;  4HNT A;  3FM5 A;  2EB7 A;  3HIF A;  2X4H A;  4QWQ A;  2HYJ A;  4KDP A;  2QKM B;  3PFY A;  2R7V A;  2FML A;  1QZZ A;  3E1S A;  2XRN A;  3OMY A;  3QYF A;  1VQ6 I;  5LHH A;  2ZKZ A;  3E97 A;  4ETS A;  4E7I A;  2XDV A;  2R7U A;  3OL3 A;  3CME I;  2Y69 H;  2HTJ A;  5EEG A;  4G7O F;  1MBJ A;  4XNF A;  3OYN A;  2KIS A;  3FKI J;  2JJ7 A;  4BKX A;  2EH3 A;  1P4A A;  5E3L A;  2R93 J;  1TWH J;  2B63 J;  3O2P E;  1IN5 A;  2KT0 A;  1FNN A;  3DTI A;  1YFH A;  2DA7 A;  1OMI A;  3R61 A;  3TP0 A;  2LMD A;  5LGU A;  2VQC A;  3V7S A;  1P7J A;  4LMY A; 
#chains in the Genus database with same CATH homology
 1GVJ A;  3NEU A;  4ON0 A;  5LHI A;  1T38 A;  2PFB A;  5E8G A;  4FX4 A;  4KN7 X;  3LAJ A;  1S3J A;  4EGY A;  4ZYD A;  4LD5 A;  2P5L C;  4OIR F;  3P9C A;  1KU3 A;  1ZHF A;  1V3F A;  2GXB A;  3GFL A;  2EFN A;  5L3F A;  4OMY A;  2CSO A;  3PQJ A;  2R7D A;  4BHP A;  1MJA A;  4UXN A;  3I0T A;  3F22 A;  3LQQ A;  3VEP A;  5CVV A;  1ZAR A;  1R58 A;  3GUD A;  2L01 A;  4AWX B;  5L3D A;  4KUM A;  3J80 K;  2RV8 A;  5BOX A;  1FPQ A;  4XSZ F;  5D6E A;  4EVI A;  1KQ0 A;  3EQL F;  1ON1 A;  4KIF A;  4WCG A;  1I27 A;  1R22 A;  4MGR A;  1KU7 A;  4XLN F;  3RPQ A;  4HX4 A;  5DEQ A;  4EJV A;  5FO5 A;  5HDK A;  5D6F A;  3GZ6 A;  3Q9V A;  4EJO A;  1SFU A;  1TLH B;  3HUG A;  2VBY A;  2NYX A;  4EM1 A;  4U0Y A;  4R1H A;  2EK5 A;  3BP8 A;  4I2O A;  1X3U A;  4O6J A;  4RB1 A;  1R1U A;  1QPM A;  4HX7 A;  3QOP A;  2P8T A;  1BIA A;  1UCR A;  4KIB A;  1DPR A;  4P5O A;  2FE3 A;  4Y17 A;  3L7W A;  4G7Z F;  3CLO A;  3QRF F;  1RZ4 A;  4IPA A;  1O3R A;  4HZF A;  2XAJ A;  4FHT A;  3I4P A;  3IHU A;  3KCC A;  3H92 A;  1TNT A;  3DP7 A;  2ETH A;  1YO5 C;  1YS7 A;  5CYV A;  4MHG A;  4WWC A;  3I54 A;  5JI6 A;  5FLX Z;  3M8E A;  3I64 A;  4EM0 B;  1RUO A;  1SFE A;  3ABU A;  2QBY A;  5DCM A;  2OA4 A;  2W24 A;  4I0A A;  4UVC A;  2PN6 A;  5HLH A;  3HTU A;  1IXR C;  5FD6 A;  3ELK A;  5HOO A;  4CYD A;  3T8R A;  1B9M A;  3MQ0 A;  3VOE A;  3J80 Z;  3VFZ A;  2VE8 A;  2KRF A;  1XDS A;  4ZYE A;  1BOA A;  4IJA A;  1P4X A;  1I1G A;  3RJP A;  4IVN A;  2WTE A;  3BZ6 A;  4G9Y A;  1TTY A;  3F21 A;  4I01 A;  5K5R A;  4UUV A;  4BHC A;  5E17 F;  2HR3 A;  4HF0 A;  2D1H A;  3GXO A;  2GZW A;  4RAY A;  1YS6 A;  1YLF A;  1BI0 A;  2YPR A;  1GXQ A;  3VB2 A;  4MTD A;  3DEU A;  3QP5 A;  2VC1 A;  3E6B A;  4RGR A;  1J7K A;  2JT1 A;  2UWM A;  1LQ1 A;  1Z7U A;  1TNS A;  1LJ9 A;  3KEO A;  3ROU A;  3L09 A;  3DPT A;  1O3Q A;  5BPI A;  2ESN A;  1D8K A;  1VTN C;  1MZB A;  4K2E A;  4JQF A;  5TJJ A;  2KIF A;  2ACJ A;  3LA2 A;  1UST A;  2RDP A;  3F6V A;  2VBX A;  4L5J A;  4GO1 A;  4AD9 A;  4ENN A;  4KN4 X;  5JFR A;  1W4M A;  4I09 A;  2HDC A;  1FLI A;  2BYV E;  1OYW A;  3KP7 A;  2HS5 A;  2V9V A;  4KA4 A;  5LBQ A;  1ONV A;  3T1B A;  2JRT A;  5H20 A;  3GFM A;  1O57 A;  2AXL A;  3O3K A;  4HV5 A;  2QLZ A;  3ERE D;  2BBY A;  2IT0 A;  1E2X A;  3KP5 A;  1Z1D A;  2B0L A;  1TQI A;  4LGW A;  4LJZ F;  3LST A;  1ODD A;  3GX4 X;  2LSO A;  4N0B A;  5E8I A;  4GGG A;  1S29 A;  2P6S A;  3TKY A;  5D5X B;  3QP6 A;  2PJP A;  5CJ9 A;  2L3D A;  2KIU A;  2OAZ A;  5K1Y A;  3T0Y A;  3FMS A;  1XDU A;  3TOA A;  3FXQ A;  1QZY A;  3FM3 A;  1OYI A;  4UVB A;  3BDD A;  5K5O A;  1A04 A;  2W85 A;  3G3Z A;  3KP2 A;  4BAY A;  1HKT A;  2P5V A;  3DF8 A;  4HQE A;  2GQQ A;  5E1Z B;  2DW4 A;  2W25 A;  3C3W A;  4NHJ A;  3P7N A;  2H6C A;  2YX4 A;  2ZBK A;  5JHU A;  1W7P B;  4M9S A;  3F23 A;  1T0F A;  2PBI A;  1BIB A;  3M8F A;  3WTW C;  2O03 A;  1Z91 A;  1XGM A;  3T8T A;  4PCQ A;  2NRA C;  2IA0 A;  3GFI A;  2G9W A;  1SMT A;  2QQB A;  2PMH A;  1FBS A;  3HRU A;  2Q0O A;  2FBK A;  1QNT A;  2M8E A;  3WTT C;  4G8X A;  3F8F A;  3M1E A;  2Z9O A;  2UXX A;  3K9T A;  2XAG A;  1G4D A;  1H9G A;  1MDM B;  2STW A;  1Y0U A;  3LA7 A;  1U78 A;  3WTV C;  1ZG3 A;  5E1W A;  1FP1 D;  2YX7 A;  5J6X A;  2A6H F;  5JVT A;  4U88 A;  1XN7 A;  5CVI A;  2D1V A;  2IPQ X;  1STZ A;  3PQK A;  2EJR A;  1XMA A;  4ZYH A;  2XKP A;  2HFH A;  2D2W A;  3K1P A;  2QWW A;  3LFK A;  4N9I A;  5ICE A;  1JHH A;  2G7H A;  4OMZ A;  1U5T A;  2DPU A;  4L9T A;  1K6O A;  3QAH A;  4A6E A;  3SQN A;  2A61 A;  1UFM A;  3KE2 A;  1WSU A;  2QM3 A;  4KIG A;  4KFC A;  4CO8 A;  1QQI A;  1MGT A;  2Y75 A;  1IAW A;  3M7G A;  4M72 A;  1ULY A;  3NQO A;  4G94 A;  2EFW A;  3RKW A;  2H09 A;  2DBB A;  1YTY A;  2NS0 A;  3FXU A;  2G7U A;  2E1N A;  3C1D A;  2IA1 A;  1HKS A;  4M6Y A;  5DUK A;  2OBP A;  3GLX A;  5DYM A;  1B6A A;  1B1B A;  3RTR A;  4CXF A;  4ZZL A;  4RGX A;  3ISP A;  3DPL C;  1HBX G;  2RC4 A;  4QLC U;  3H3Z A;  3HRT A;  5J8F A;  2Z3Y A;  2V1X A;  1D5V A;  2H6B A;  2DQR A;  4LK1 F;  3R0A A;  2GIV A;  4M6X A;  3WGG A;  3I59 A;  1IW7 F;  2IVM A;  2QBY B;  5DCM B;  1U6G A;  4LG0 A;  3MZY A;  3CUQ C;  2VC0 A;  3GEZ A;  1SD5 A;  2CQK A;  2P5K A;  4HOB A;  3N4M A;  2IRF G;  3PFI A;  1Z6R A;  2W84 A;  4CHU A;  2RNJ A;  2ZME A;  1BC7 C;  3BJ6 A;  1WWX A;  1JXS A;  3C7J A;  2W57 A;  4D0P A;  3AAF A;  2V1U A;  4XRF A;  2DFI A;  5D8K B;  3MWM A;  5CLS A;  2P7C B;  3ABT A;  5F64 A;  3EET A;  4LFU A;  2E1C A;  3BJO A;  2VOD A;  1MDM A;  3U1D A;  5BMZ A;  1ZN2 A;  4HAM A;  4FT8 A;  3DKW A;  1W5T A;  4L0Z B;  3OV8 A;  1HW5 A;  2EWN A;  4LLN A;  4YFN F;  2M87 A;  3EUH A;  4O5V A;  3LQR A;  5ICF A;  1G3W A;  1QO0 D;  4TV7 A;  2EFP A;  4P96 A;  2DQL A;  2LNB A;  4MNU A;  2XAF A;  2HWV A;  5FLX K;  3I71 A;  1FSH A;  5A2Q K;  4A0Z A;  2FBH A;  2ZNZ A;  1S7O A;  5FFX A;  3WTY C;  3QU6 A;  1ZAO A;  1D8J A;  4RAZ A;  2K27 A;  1DPU A;  1YW9 A;  4BNC A;  4DQ2 A;  2V6C A;  2IW5 A;  3BPV A;  4Z2Y A;  3RPU A;  2V79 A;  3TDZ C;  1J59 A;  1FC3 A;  1DDN A;  1F1Z A;  3FXR A;  3KLN A;  1FY7 A;  2GAU A;  1O7F A;  1R23 A;  1RUN A;  3F8M A;  2XAQ A;  5LRR A;  2XAS A;  3L9F A;  2FNA A;  2KIM A;  1XGO A;  1ZGA A;  3VOD A;  3V8L A;  1L3L A;  5E18 F;  3ZMS A;  3R6S A;  5KK1 A;  2ZO4 A;  1BN5 A;  5HLI A;  1GXP A;  2VBZ A;  4AIH A;  4OIP F;  3EYI A;  3Q5F A;  1G6N A;  1AWC A;  3TDU C;  4ESB A;  2LDU A;  1QGP A;  1P2F A;  5A2Q Z;  3FX3 A;  4U7D A;  4G6D A;  2K86 A;  2FA5 A;  4L9V A;  3U9G A;  4KNY A;  2P4W A;  2M1B A;  2JPC A;  1SMY F;  1GHC A;  2BE5 F;  2IP2 A;  5LRS A;  3OOP A;  1BM9 A;  1BI1 A;  4KMF A;  3E5Q A;  2EA2 A;  3O6B B;  2XIG A;  2BV6 A;  1ZRD A;  4EQQ A;  1O3S A;  3B02 A;  1HKQ A;  4RB0 A;  1W5S A;  5LGN A;  3SFZ A;  4ASN A;  1D3Y A;  1YYV A;  5ILV A;  3IWZ A;  5LHG A;  2HGC A;  1IRF A;  2QEN A;  3GF2 A;  2JPB A;  2H27 A;  2NAZ A;  3GYH X;  1FYK A;  3HTS B;  3BOQ A;  2FXA A;  1K79 A;  2HKX A;  2M45 A;  3HHG A;  4RB3 C;  4RB2 C;  3KET A;  1K78 A;  1PP7 U;  5K5Q A;  2ZXJ A;  3MFK A;  5H6Q A;  2WC2 A;  2Y48 A;  2QVO A;  1R7J A;  3C18 A;  1FYM A;  3HRS A;  1MJ9 A;  4HF2 A;  4GCV A;  6PAX A;  1RNL A;  1U5T B;  3IKV A;  4A5M A;  2LF7 A;  3N97 A;  2VN2 A;  3WTU C;  1XB4 A;  1ON2 A;  5D5W B;  2PLY A;  1BI2 A;  3K1M A;  5DD8 A;  2OZU A;  1Z6T A;  4RGS A;  3KP4 A;  2OD5 A;  4YFX F;  3SXY A;  1H9T A;  4ESF A;  2VT2 A;  4O3M A;  1BI3 A;  3F72 A;  2MLK A;  4BQA A;  2J5P A;  2X0L A;  4ESJ A;  1MKM A;  2CYY A;  3V4G A;  3KZY A;  3ZMV A;  2L02 A;  3BRO A;  4I0B A;  3DXJ F;  1BC8 C;  1EV7 A;  3ZPL A;  4IXA A;  2VOO A;  1H0M A;  3IKT A;  1B9N A;  1EH8 A;  1HST A;  2ELH A;  4IF4 A;  1G3Y A;  1P92 A;  2R3S A;  1YW7 A;  3I59 B;  4GYG A;  1Z05 A;  4XLP F;  2DU9 A;  1SD7 A;  4BHB A;  3CO6 C;  3E5U A;  4LG0 B;  3H3U A;  3I5U A;  2H94 A;  4BYY A;  3J81 Z;  2ZME B;  4UHT A;  1JGS A;  3QPT A;  3RYP A;  2DK8 A;  1JHF A;  4OU0 A;  4UV9 A;  1WRJ A;  2P7V B;  1F9N A;  3RKY A;  1CF7 B;  3KP6 A;  1WQ2 A;  1YW8 A;  5HS9 A;  3Q9S A;  1IN6 A;  1U8R A;  3ULQ B;  3GO5 A;  4M9Z A;  4G6Q A;  2FU4 A;  3CUO A;  5H6R A;  2XVC A;  3V8K A;  2HYG D;  1LDD A;  2GXG A;  4NB5 A;  5L3C A;  4F7Z A;  4HLX A;  2ISZ A;  2O6G E;  4YG2 F;  3ECH A;  1XCV A;  2K7L A;  1YG2 A;  2KJC A;  3E6D A;  1CGP A;  1R1T A;  3F8C A;  3MAJ A;  1C0W A;  4PDK A;  4Q5S F;  4WXC A;  2XRO A;  2R7F A;  4UVA A;  2FBI A;  2A3S A;  4Y13 A;  3GVA A;  5HDG A;  2O8X A;  4HBL A;  1F4K A;  1R5G A;  4S04 A;  2ZNY A;  3ZN0 A;  4KYW A;  1YQA A;  3IRQ A;  3WE3 A;  1XSD A;  3JSP A;  5D5V B;  3L2C A;  4I98 B;  3TO9 A;  4A6D A;  3M9A A;  4OIN F;  2FMY A;  1G3S A;  5ILS A;  1PDN C;  2RN7 A;  2O0Y A;  2DK5 A;  1L0O C;  3HOT A;  4Q48 A;  4WX9 A;  2WV0 A;  4YIF A;  2J5O A;  1KQ8 A;  3WE2 A;  4FX0 A;  1ZLJ A;  2F5F A;  2BGC A;  2AS5 F;  4B09 A;  5ILU A;  1DP7 P;  4MQV A;  3ZN1 A;  3KFW X;  1OKR A;  4UNO A;  2A68 F;  1IRG A;  2JSC A;  2EV0 A;  1PUE E;  1ZH5 A;  3WTS C;  1U3E M;  3SHF A;  2CFX A;  1FBU A;  3W6J B;  3ZQ7 A;  3IL2 A;  3RKX A;  3TOB A;  1LNW A;  1SAX A;  1LDJ A;  2CG4 A;  1FYL A;  1HW2 A;  5BPD A;  3WGI A;  1FX7 A;  4HDV A;  1T2K A;  1PP8 F;  5D4R A;  2MA3 A;  1KYW A;  5DCF A;  3IRR A;  2PI0 A;  2OQG A;  2ZJ2 A;  4KIC A;  2L4M A;  4P9U A;  4S05 A;  4PGG A;  2QYO A;  3CUQ A;  3COA C;  5TRD A;  4R79 A;  1R36 A;  4L0Y B;  1J75 A;  2DO7 A;  1KA8 A;  2FEZ A;  1REP C;  2PEX A;  2FNP A;  5EEH A;  1UHM A;  3D0S A;  2FRH A;  2DPD A;  2LF8 A;  2UXN A;  4Y15 A;  3GZ5 A;  2GWR A;  2RGV A;  5IT3 A;  2XUB A;  1CF7 A;  3QU3 A;  5D4S A;  2PQ8 A;  4WXD A;  1IN7 A;  2YU3 A;  2EV6 A;  3BY6 A;  4ENM A;  3ZP5 A;  4A0X A;  5BQT A;  1I1S A;  5LGT A;  5ED4 A;  4BH9 A;  1YIO A;  2VE9 A;  3KLO A;  3TQN A;  5J8C A;  4HDU A;  1U2W A;  5FD5 A;  2HOE A;  2VXZ A;  2ADU A;  2O3F A;  1T39 A;  3FMR A;  3GFJ A;  4A12 A;  3DQV C;  2DT5 A;  2TDX A;  3CO7 C;  3MZH A;  1K78 B;  4A2U A;  3I58 A;  3JSO A;  5HS7 A;  2K4B A;  3JW4 A;  4CZZ A;  4ZYG A;  2GA1 A;  2HTS A;  1XCB A;  3BPX A;  1ZRF A;  5L3G A;  4M9X A;  2D45 A;  4OIO F;  2XGX A;  3IWF A;  2OU2 A;  2MH2 A;  5DV5 A;  4HYE A;  1SFX A;  5FB2 A;  1MJB A;  2IJL A;  3LA3 A;  3F6O A;  3P9K A;  2UZK A;  4EJW A;  3CTA A;  1B4A A;  1ZYR F;  5DUI A;  3FMQ A;  1IXC A;  3RDI A;  3WTZ A;  1XD7 A;  2HZT A;  2DI3 A;  1KU9 A;  2VT3 A;  1W7P D;  3ZMD A;  3K2Z A;  2WWY A;  4L9J A;  2F5C A;  4YII A;  3TGN A;  5HVQ C;  4MEY F;  2EFQ A;  1FSE A;  4ZH4 F;  4P55 A;  3ZMU A;  3RYR A;  2PG4 A;  5IT9 Z;  2EV5 A;  3QPH A;  3HYI A;  2YR2 A;  1P4W A;  3P9I A;  2HQR A;  3ML6 A;  2C6Y A;  1OR7 A;  4P9F A;  1HW1 A;  4N9H A;  2CGP A;  2NNN A;  4EGZ A;  4IHS A;  2VOP A;  2FQ3 A;  4CDG A;  4HX8 A;  3KZZ A;  2HQN A;  4RS8 A;  2Y0M A;  3K0L A;  3WU0 A;  4G7H F;  2QQ9 A;  1V4R A;  3E3V A;  5LEK A;  4LK0 F;  1KQ9 A;  3FF5 A;  1T6S A;  1LVA A;  2FOK A;  4PZJ A;  1XGS A;  5HDN A;  2JZY A;  2MLG A;  3BWG A;  2EFO A;  5F6F A;  5HS8 A;  1LEB A;  5LLQ A;  3F8B A;  2BEO A;  4OOI A;  2A5Y B;  1KGS A;  2RKH A;  3E6C C;  4IHT A;  5HLG A;  1AOY A;  4LB6 B;  3L00 A;  4RGU A;  1USS A;  1J9I A;  3F8N A;  1OPC A;  1ZG1 A;  1LDK B;  3I53 A;  3ZMT A;  4NQW A;  3HSE A;  4I02 A;  4LLL A;  1B59 A;  2L54 A;  5E1X A;  5JR3 A;  5AON A;  3SZP A;  2KJB A;  3DV8 A;  5L3B A;  5ICG A;  3LWF A;  1WKM A;  4M74 A;  1J2X A;  2Z99 A;  4MEX F;  2L4A A;  1EH6 A;  2COM A;  4BXU A;  3HHH A;  2XKO A;  1RIO H;  5LEJ A;  1JE8 A;  4AIJ A;  4OIQ F;  3J7A O;  2Q2E A;  5E20 A;  4EV0 A;  3WOD F;  4IRI A;  4MQ9 F;  1WI9 A;  2DLL A;  4M71 A;  3J81 K;  4GXO A;  3R0J A;  4E70 A;  1ZLK A;  1TQP A;  4EJU A;  5BS6 A;  3JTG A;  1TBX A;  1IF1 A;  4KMU X;  3WTX C;  4U0V A;  2MBF A;  4CGZ A;  4U0W A;  1IXS B;  2F5E A;  2NNY A;  4L9N A;  3WU1 B;  1UHW A;  2XAH A;  3FHZ A;  3WG9 A;  2V1D A;  2ZFW A;  2XV4 S;  3B73 A;  1EH7 A;  3ZMZ A;  2OQR A;  1T98 A;  2DAO A;  3LAP A;  2K4J A;  1IN8 A;  1K7A A;  2LKP A;  4ENK A;  1KYZ A;  2FF4 A;  5D8L B;  4A0Y A;  1HXD A;  3K1N A;  3CJN A;  4M73 A;  4PGH A;  1HQC A;  1S7A A;  4UV8 A;  1FWZ A;  4H0E A;  1BJA A;  1FBQ A;  1IN4 A;  3RIR A;  1I5Z A;  5CVJ A;  3ECO A;  5F1R A;  1MD0 A;  4GYI A;  4DNC A;  2RVC A;  3REO A;  3CUQ B;  5D5U B;  2E7W A;  3FWE A;  5AIP A;  1XMK A;  1FP2 A;  3V7R A;  2A07 F;  4JBA A;  4L18 B;  4EM2 A;  2E7X A;  2YSR A;  4IRH A;  3EYY A;  3T5X A;  1FOK A;  2F2E A;  3TO7 A;  3KP3 A;  2HEO A;  2A69 F;  2Q8K A;  1LEA A;  2K02 A;  3GW2 A;  1BBY A;  2O61 A;  1IUY A;  1O7L A;  1KU2 A;  2DTR A;  4MTE A;  2Z5U A;  2JTV A;  2STT A;  4XSX F;  3IC7 A;  1TQM A;  1ZRE A;  3HRM A;  1J0R A;  3TO6 A;  1R5H A;  2QUF A;  3KEQ A;  2EA4 A;  2HKO A;  4YFK F;  3WGH A;  1NHA A;  1UB9 A;  2ESH A;  1Z9C A;  1FT9 A;  1ZG5 A;  2VBW A;  2QQA A;  1O3T A;  1XGN A;  3NRV A;  5FGM A;  1S8N A;  3F3X A;  1XSX A;  1XSV A;  5CVR A;  3HSF A;  4XBF A;  3RI4 A;  3E6M A;  4IRG A;  2MH9 A;  2VON A;  3JAM K;  4HLY A;  1TW3 A;  2F5D A;  3V7C A;  5FFZ A;  3GWZ A;  1DUX C;  3G73 A;  5ICC A;  4LLG F;  4A5N A;  4EMS A;  4U7B A;  1J5Y A;  3FZV A;  1E17 A;  2ISY A;  4HQM A;  2MC3 A;  3MEX A;  4Q47 A;  3D5L A;  1LB2 A;  3JTH A;  3HOS A;  1U5T C;  2MD5 A;  4ENJ A;  1R00 A;  2M30 A;  5DD4 A;  2CO5 A;  4EJT A;  2XHK A;  3DFG A;  2IA2 A;  3R60 A;  2M5W A;  3HSR A;  4AIK A;  1G3T A;  3SZT A;  1QBJ A;  2A6E F;  3E5X A;  5AIQ A;  1RI7 A;  4HA8 A;  1SD6 A;  1R1V A;  4Q4Z F;  2PMU A;  4L5I A;  2ZCW A;  3BJA A;  2FSW A;  4I7H A;  4LB5 A;  4B8X A;  2GA2 A;  5DDG A;  3U2R A;  4AVP A;  1P6R A;  3W6K B;  1SD4 A;  4WK8 F;  1HSJ A;  2CW0 F;  5CVU A;  5KVR A;  3JAM Z;  1F5T A;  4HF1 A;  4ZZD A;  5L3E A;  4WXH A;  4KT5 C;  4R8H A;  4HV6 A;  1I6X A;  1IZ1 A;  3EDP A;  1Q1H A;  2Z33 A;  3S2W A;  1S6L A;  4HW0 A;  3MCZ A;  1ZRC A;  4JK1 X;  2OZ6 A;  3K69 A;  3R4K A;  1W7P A;  3CDH A;  4WF2 A;  1TW2 A;  1FZP B;  3V8J A;  1ZGJ A;  2HYF A;  2P6T A;  1OYY A;  2CWE A;  5ERI A;  5IT9 K;  2KKO A;  2QZ8 A;  4CIC A;  2RQP A;  3FM5 A;  2EB7 A;  3HIF A;  2X4H A;  4QWQ A;  4KDP A;  2FML A;  1QZZ A;  2XRN A;  5LHH A;  2ZKZ A;  3E97 A;  4ETS A;  2HTJ A;  5EEG A;  4G7O F;  1P4A A;  3O2P E;  1IN5 A;  1FNN A;  1YFH A;  1OMI A;  3R61 A;  5LGU A;  3V7S A;  4LMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...