2JZYA

Solution structure of c-terminal effector domain of putative two-component-system response regulator involved in copper resistance from klebsiella pneumoniae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
104
structure length
104
Chain Sequence
MAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of C-terminal effector domain of putative two-component-system response regulator involved in copper resistance from Klebsiella pneumoniae
rcsb
source organism Klebsiella pneumoniae
molecule tags Transcription
molecule keywords Transcriptional regulatory protein PcoR
total genus 16
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2jzyA00
3E6DA 1G6NA 5F1RA 1QO0D 3WODF 2K86A 3B73A 1U5TC 1HW2A 4LD5A 2NRAC 1FT9A 2RNJA 2HYFA 3LFKA 2CGPA 3DP7A 3GO5A 4KN4X 4AIJA 3V7RA 3KZZA 2FF4A 2CYYA 1I5ZA 4M71A 3K1MA 3M1EA 4A5MA 4N9HA 1SD6A 3FM3A 4RB1A 5LEKA 3E3VA 2DI3A 3GFLA 1V3FA 2FQ3A 4G94A 1MDMB 1QZZA 3E6CC 2Z99A 2ACJA 2O6GE 2STWA 2MLKA 2WV0A 3WTZA 1LEAA 1OKRA 1S8NA 4AVPA 2CSOA 2DT5A 3SFZA 1P4AA 4O3MA 5HS8A 2Y48A 2Q2EA 2B0LA 4Z2YA 2FEZA 5JI6A 4KT5C 4P55A 1I1SA 4EM0B 1O3QA 2HFHA 4G8XA 2YR2A 5E1WA 2GA1A 2DAOA 3JAMZ 3BJOA 1FLIA 1D5VA 1ZG1A 1HSJA 4UXNA 3T0YA 1BI3A 1KU2A 1YLFA 2EFWA 1IRFA 3SXYA 5ILVA 4U7BA 1P2FA 4LK1F 3WTTC 1P6RA 3JAMK 1J7KA 2O0YA 3V4GA 3RKXA 4S04A 3IHUA 2HOEA 2CFXA 3ZP5A 1STZA 2F5CA 4L18B 1UHMA 4OINF 3PQJA 2A61A 2WWYA 1LEBA 3PFIA 3O3KA 3FMRA 3MCZA 2VBWA 4WX9A 3HSRA 3H92A 2H6CA 4Y17A 4IXAA 2A6HF 4KMFA 5K5RA 4IF4A 3P9KA 4HDUA 2PMUA 2FA5A 3MWMA 3ML6A 5FFXA 4A5NA 4UV8A 4U88A 5DUKA 1B59A 3Q9VA 2HTJA 1R5GA 4UVBA 5E20A 2NYXA 4WXDA 4LG0A 3TDZC 2KRFA 4ZYGA 1YG2A 1K78B 5D6EA 3WGIA 1SD7A 4F7ZA 5FLXZ 3O6BB 4KUMA 4O5VA 1R1TA 4ZH4F 3K1NA 3EDPA 3DF8A 3EQLF 1XMKA 4YIFA 1H9TA 1HW5A 5FGMA 3QAHA 2A5YB 3HTUA 2ZKZA 2COMA 2HEOA 4E70A 4KA4A 3ZMSA 2NS0A 5CVIA 3VB2A 2VC0A 3R61A 2HTSA 1ZRCA 5LEJA 2XAHA 4LLGF 3HRMA 2GAUA 3I53A 2EA4A 3GZ6A 4FHTA 2ESHA 5E1XA 2VE8A 4LFUA 3MFKA 5E17F 3TO9A 2A69F 4WF2A 1F9NA 5FD5A 4CZZA 2MH2A 5AONA 3BPXA 1IF1A 3F8CA 3KCCA 3FWEA 1GVJA 2Z3YA 2HDCA 4HAMA 2VOPA 3S2WA 4BYYA 5LHGA 1R1VA 1LDJA 3J81Z 2AS5F 4MGRA 1TQPA 4G7OF 5H6RA 1W4MA 5DUIA 2M30A 2JTVA 4KFCA 4EM1A 2DW4A 3K1PA 3DQVC 1ZH5A 4KNYA 5LLQA 3JTHA 1G3SA 1O3RA 3BJ6A 2P4WA 2QUFA 4GGGA 5F6FA 2OQGA 4B09A 4LMYA 2MH9A 2FXAA 2QYOA 4KN7X 1GXQA 1WQ2A 2WTEA 2ZNYA 1W5SA 2XAQA 4ZYDA 2EWNA 2RQPA 2XGXA 4LB6B 5CJ9A 1LQ1A 2M45A 1FBUA 4PGGA 2X0LA 2Y75A 3MEXA 2P5VA 2KJCA 1DDNA 4QWQA 2FMYA 2V6CA 5L3DA 4XRFA 3J80K 2JPBA 1Q1HA 1SAXA 4R79A 1Z05A 4I09A 2QLZA 4ZZDA 3GEZA 4UNOA 1R23A 2XAGA 3L7WA 3I0TA 4CICA 1AOYA 3ABTA 2L4AA 4RAZA 5L3GA 4RB3C 5E18F 5E1ZB 2KIMA 2XV4S 3KEOA 3BROA 1R36A 1YW7A 3L9FA 1BI1A 4MQ9F 3CUQC 1SMTA 3O2PE 2M1BA 1HXDA 3I58A 3DPLC 3GLXA 3I59A 2DTRA 2K4JA 2M5WA 3KP5A 1JGSA 3V8JA 5DYMA 5JHUA 1FZPB 3RIRA 2P7VB 4OIPF 1UHWA 3F3XA 4HF0A 2C6YA 2E7WA 3EYYA 2XIGA 3BWGA 3V8LA 5ICEA 1MD0A 2OQRA 4P9FA 2M87A 1UFMA 5FD6A 4BQAA 2G7UA 1FSEA 1R00A 3U9GA 1ONVA 4HX8A 1SFXA 1KU9A 4PDKA 1HKTA 3PQKA 1A04A 5LRRA 4KDPA 3SHFA 4I98B 3HRUA 2P7CB 3FXRA 2VONA 4WCGA 4A2UA 3QP5A 4HYEA 3KLOA 4ZYEA 4PGHA 2A6EF 3GVAA 5KK1A 1X3UA 3DEUA 4HOBA 4JK1X 2R7FA 2PI0A 3KFWX 5D6FA 2ZMEA 1OYYA 2HS5A 3FXUA 2PEXA 1Z1DA 2FSWA 5TRDA 2IA0A 4U7DA 5DCMB 2ZMEB 1P4XA 3I71A 3L00A 4WXCA 3R4KA 5DD8A 4CXFA 2MBFA 3NQOA 4KYWA 2E1CA 1FX7A 2FBHA 1R22A 4LGWA 3KP7A 4WK8F 3D0SA 1H9GA 4RB2C 3DFGA 2DPDA 4YG2F 4ZZLA 1F4KA 3HIFA 4TV7A 1S3JA 3KZYA 2KJBA 5D8KB 1J9IA 1RIOH 1BM9A 3F8MA 3RJPA 2NNYA 1K79A 2PFBA 3RPUA 1USSA 3MZYA 1D3YA 1ON1A 2PBIA 1FYLA 2ZXJA 2JPCA 5HS9A 1KQ9A 4HX7A 2MD5A 1SMYF 4Q4ZF 3L2CA 4EM2A 5CYVA 4MEYF 1J2XA 1G3TA 3RTRA 3IWFA 2CW0F 2DQLA 2W24A 5ED4A 3E97A 3QRFF 5LHHA 3M8EA 4LK0F 4ON0A 1OPCA 5K5QA 1ZLKA 5BPIA 2DK5A 3F8FA 1Y0UA 2DBBA 4RGRA 2VT3A 3ROUA 2OAZA 4HQEA 5L3CA 4LB5A 5E8GA 1FYMA 1MKMA 1VTNC 1UB9A 5H20A 3ZQ7A 2O8XA 4OIQF 3FZVA 1SD4A 1XGNA 1LNWA 3H3ZA 4ENKA 2EV0A 4EJVA 2OU2A 1ZAOA 1IN7A 4G6DA 1G3YA 3E6MA 3F72A 1U5TB 2QQBA 1D8JA 1QNTA 4MTDA 3R0JA 1FSHA 3KETA 2D1HA 1ZN2A 1B9MA 2F2EA 2R7DA 2V9VA 1O3TA 6PAXA 3WTSC 1B9NA 4CO8A 3VOEA 3RDIA 2PLYA 5J8FA 1DPUA 1HSTA 2MC3A 5D5VB 3I59B 1ODDA 3P7NA 1ZG5A 4XBFA 3ZMVA 4IVNA 4PCQA 2GA2A 1XN7A 2DK8A 4OMZA 2RV8A 1TQMA 5ILSA 3BOQA 2P6TA 1XMAA 3T1BA 3DPTA 2IPQX 4S05A 1FYKA 1S7OA 2L3DA 1J0RA 1FP2A 4CDGA 3JSPA 3C18A 3LSTA 1K6OA 2FMLA 3NEUA 3HRTA 4GCVA 2QM3A 5HS7A 4HBLA 4EV0A 4IHSA 5LHIA 4IRHA 3JSOA 3ZPLA 1T98A 1WI9A 2GWRA 2JRTA 1IN6A 2F5FA 3SZPA 1TW3A 1E2XA 1IN8A 2DLLA 4U0VA 3F23A 1YW9A 4GXOA 3MAJA 2LF8A 1OR7A 3WE2A 1P92A 3FHZA 1XSDA 5BS6A 5DEQA 4Q5SF 2W25A 2ZFWA 3ELKA 5D4RA 2YSRA 3ULQB 4Q47A 2HGCA 5LGNA 3IL2A 2HKXA 3CJNA 2ZO4A 3MZHA 4Y15A 1IN5A 1ZG3A 2FNPA 4I0AA 2GQQA 2GIVA 2ESNA 3LAJA 3I4PA 1XGSA 4G7ZF 3LAPA 4L9VA 5JR3A 3BPVA 1CF7B 4BAYA 3HSFA 1LDDA 1KA8A 4P96A 3JW4A 4HF1A 5L3BA 3GF2A 1LB2A 4XLNF 4OOIA 3K2ZA 2E7XA 4A0YA 5HLGA 1XSVA 4GYGA 4LG0B 1ZRFA 1IN4A 4Y13A 1IXCA 3WTXC 1KYZA 1PP7U 5D5WB 1BI0A 2HQRA 4PZJA 1ZHFA 3VFZA 2UZKA 1WWXA 1K7AA 2H6BA 3CLOA 3F6OA 5A2QK 2IA2A 3WG9A 1GHCA 1XB4A 3GZ5A 3TKYA 4G9YA 2FRHA 4FT8A 2TDXA 2P6SA 3F8BA 1ZLJA 2XROA 1JE8A 3L09A 2GXBA 1L0OC 2Z9OA 2Q0OA 2W85A 4JQFA 4M74A 1J75A 2RGVA 1MJ9A 3CTAA 5HDGA 3GW2A 4AIKA 1W7PA 1QZYA 1T39A 1FY7A 5LGUA 3F22A 1IZ1A 2EV6A 4KICA 1KQ0A 1BIAA 2QENA 1QPMA 2A68F 1YTYA 2IRFG 4MNUA 1W5TA 4A6EA 1MJBA 4L0YB 3DV8A 3R0AA 3P9IA 1RUNA 4M9SA 5IT9Z 1JHHA 1G3WA 1XD7A 3ECHA 2IP2A 1BOAA 3HHHA 1YS6A 4IJAA 1XSXA 2V1DA 1RNLA 3ZMDA 1CF7A 5AIQA 4BHPA 4NQWA 3WTYC 2NNNA 4L0ZB 2WC2A 2MA3A 1U2WA 4HA8A 5JFRA 3TO6A 3REOA 2LF7A 4GO1A 4NB5A 5FB2A 2F5EA 5IT9K 2BEOA 4IRGA 2VBYA 1YQAA 5L3EA 3KE2A 2VC1A 3W6KB 1FP1D 4HW0A 4HQMA 2X4HA 5TJJA 1FBSA 1F1ZA 1ZGAA 5FO5A 2Z33A 3C7JA 2LSOA 5D4SA 2O3FA 4A0XA 3LA3A 4R8HA 3M8FA 3QU3A 2M8EA 3T8RA 3CUQB 1U6GA 1O3SA 1W7PB 2YPRA 4YFNF 3V7CA 5HLHA 3ZN0A 4EVIA 2HKOA 1D8KA 1NHAA 3DXJF 3J7AO 4OIRF 2LKPA 3WE3A 5L3FA 1G4DA 4MQVA 5D5UB 5ERIA 3OOPA 3ZMTA 1LDKB 3IC7A 1B1BA 2EFPA 5CVRA 3BP8A 3KLNA 3FM5A 4RS8A 4U0WA 4XLPF 2CQKA 2EFNA 1CGPA 1IW7F 2PG4A 3IKVA 1S6LA 1XGMA 4IRIA 2H27A 2IJLA 2K4BA 3T8TA 4DNCA 3FMQA 2HYGD 1YFHA 1T0FA 3R60A 4G6QA 3WGHA 2EJRA 3SZTA 1OMIA 2OZUA 3GYHX 3QU6A 2FOKA 2STTA 4K2EA 1BBYA 3EUHA 4Q48A 1B4AA 2VODA 4I01A 1FBQA 4FX4A 4ESBA 1UCRA 1T38A 4WXHA 4EJUA 1LVAA 4BH9A 5LBQA 2FU4A 1F5TA 4A0ZA 1DPRA 1RZ4A 1KYWA 3HHGA 4N0BA 3D5LA 2GZWA 2DFIA 3MQ0A 4KMUX 3WU0A 1GXPA 4FX0A 2PQ8A 2Z5UA 3G3ZA 4ESJA 1I1GA 1RI7A 4ENMA 4N9IA 4M72A 2VE9A 1YS7A 3U2RA 4EGZA 1EH7A 5ICFA 3V8KA 2A07F 4ENNA 5EEHA 2JT1A 4A6DA 1XCVA 4RGXA 4IPAA 3M9AA 2P5LC 1EV7A 2UWMA 4HLXA 3KP6A 1DUXC 2DU9A 2HQNA 3GFMA 2LNBA 1EH8A 1LJ9A 1OYIA 2QWWA 4MHGA 1ZARA 1L3LA 4RGUA 2XKOA 2BGCA 2OBPA 3GUDA 5DCMA 1FWZA 3ZMUA 3HSEA 1S29A 3HTSB 3IKTA 4M9ZA 5A2QZ 4HX4A 5HDNA 4CGZA 1Z7UA 3F21A 2XASA 1HW1A 5BPDA 1PDNC 2ADUA 1XDSA 2XAJA 2W57A 3M7GA 3RI4A 4ZYHA 2XUBA 5HVQC 3ERED 1BJAA 5IT3A 2EFOA 1U78A 5DDGA 3RKWA 1B6AA 1WKMA 2KIUA 2NAZA 3FX3A 1KU7A 2E1NA 4EMSA 4WWCA 5AIPA 2OZ6A 4O6JA 2ELHA 3V7SA 2F5DA 1W7PD 4L5IA 4A12A 3GXOA 3N97A 1R1UA 2FE3A 2JSCA 2RDPA 3QP6A 5FLXK 3TGNA 4R1HA 1TBXA 1QBJA 4UV9A 2RKHA 1BC8C 1YIOA 5D5XB 1O7FA 3KP3A 1USTA 4BHBA 1IXSB 4LLNA 2HR3A 1I27A 4UVAA 5KVRA 3LWFA 3I54A 1Z9CA 2YX4A 5BMZA 4P9UA 2H94A 3BY6A 3GWZA 2ISYA 3Q5FA 3E5UA 4ETSA 4HF2A 4BHCA 2G7HA 1E17A 1FNNA 4UVCA 5ICCA 4EJTA 2IW5A 4EQQA 4MTEA 1RUOA 2OA4A 1ON2A 4HDVA 2O61A 4HZFA 1MZBA 2VOOA 3DKWA 1IUYA 3K69A 2V1XA 1AWCA 3U1DA 3F6VA 2Y0MA 2EFQA 3RPQA 3P9CA 2DPUA 1XCBA 2QZ8A 1Z6RA 3C3WA 3CUQA 1MGTA 1IRGA 4EJWA 3C1DA 2IA1A 1T6SA 1MJAA 1MDMA 1XGOA 2PMHA 3TQNA 4KIGA 3QPHA 5FFZA 4DQ2A 4HLYA 2FBIA 3AAFA 2QVOA 1HBXG 1TQIA 1R5HA 3GFJA 3EYIA 1S7AA 3WGGA 2XVCA 2W84A 2L54A 2KIFA 2ZBKA 4YIIA 3CUOA 1TW2A 5E8IA 2ZNZA 2L01A 2VBZA 3R6SA 2VT2A 3RKYA 2VBXA 3TOBA 2FNAA 3J81K 1U5TA 5K5OA 4L9JA 3CO7C 4UHTA 1FPQA 3BZ6A 4MEXF 1BN5A 3LA7A 5HLIA 2BBYA 2K7LA 1BI2A 2QBYA 2QQ9A 4OIOF 4AWXB 4M9XA 1JXSA 5DV5A 1KGSA 4BXUA 2LDUA 5DCFA 1IXRC 1FOKA 3TOAA 1PUEE 5LRSA 2J5PA 5CVUA 2L4MA 2ZJ2A 2CG4A 2XAFA 4HV6A 5HOOA 5CLSA 3TDUC 1SFEA 2ETHA 2A3SA 3WU1B 4AD9A 3LQQA 3IWZA 4M6YA 1ZRDA 2G9WA 1FC3A 1KQ8A 2HZTA 3GX4X 4LLLA 1WSUA 1HKSA 1T2KA 2RVCA 2DQRA 2VN2A 1ZYRF 2O03A 1P4WA 3IRRA 2OD5A 4YFXF 1SFUA 2RN7A 3HYIA 3K9TA 5CVJA 4ASNA 2DO7A 3SQNA 3FF5A 1EH6A 4YFKF 2XRNA 2CO5A 1OYWA 4UUVA 4EGYA 1WRJA 2QQAA 2YX7A 2VXZA 4AIHA 2H09A 1JHFA 3WTWC 4CHUA 3LQRA 2MLGA 1R7JA 2KKOA 5F64A 3TO7A 3B02A 1BIBA 4I02A 2J5OA 4I7HA 2YU3A 5BQTA 3GFIA 1Z6TA 3WTVC 1O57A 1ZGJA 3KP2A 4L5JA 1I6XA 4L9NA 3BDDA 5J8CA 1HKQA 1TLHB 4G7HF 2FBKA 3ECOA 4HV5A 2PN6A 2EB7A 1C0WA 3HOTA 4NHJA 3FXQA 1U3EM 3COAC 3CO6C 2V1UA 1J5YA 3EETA 3Q9SA 3KEQA 3W6JB 2ZCWA 3J80Z 3IRQA 1QGPA 4L9TA 1SD5A 4OMYA 2AXLA 5JVTA 4QLCU 2IT0A 4RB0A 4JBAA 5LGTA 2L02A 2QBYB 3G73A 3N4MA 3FMSA 1ZREA 3K0LA 2IVMA 4XSXF 4U0YA 1H0MA 1HQCA 2EK5A 3ABUA 2P8TA 2D2WA 1YW8A 2V79A 2GXGA 1U8RA 2HWVA 1REPC 5BOXA 5ICGA 1K78A 1KU3A 4EJOA 4I0BA 3ZN1A 3VEPA 3HRSA 2K02A 4GYIA 1IAWA 3BJAA 3E5XA 1YO5C 1J59A 2RC4A 4KIBA 2K27A 3QPTA 4RGSA 3KP4A 3NRVA 1QQIA 5D8LB 4H0EA 5ILUA 3HOSA 3VODA 1TTYA 4KIFA 1TNTA 3E5QA 4OU0A 4CYDA 1XDUA 3T5XA 2EA2A 3WTUC 3HUGA 5J6XA 3JTGA 2JZYA 3ZMZA 1BC7C 2EV5A 4RAYA 3RYRA 4XSZF 5HDKA 1YYVA 3E6BA 4P5OA 4ENJA 2R3SA 1Z91A 3ISPA 5H6QA 4D0PA 2D1VA 3I5UA 4M6XA 2UXXA 2PJPA 3QOPA 5K1YA 5DD4A 3H3UA 2D45A 1V4RA 3CDHA 2XKPA 2BYVE 5CVVA 1ULYA 1TNSA 3LA2A 4LJZF 3F8NA 4BNCA 2ISZA 2Q8KA 5EEGA 4IHTA 3I64A 2XHKA 2BE5F 4I2OA 2BV6A 2P5KA 4B8XA 2CWEA 4ESFA 1PP8F 3OV8A 1R58A 1O7LA 1DP7P 3RYPA 4M73A 2UXNA
chains in the Genus database with same CATH superfamily
2Y30A 3E6DA 3H0GJ 1B72B 2DA2A 1LE8A 1A5JA 1G6NA 1VQOI 1V5FA 5F1RA 1QO0D 1X3WB 1G2HA 3WODF 3H5AA 2OTLI 2K86A 3B73A 4IO9F 4HPQA 5FKMA 5F0FA 3HBLA 1U5TC 1HW2A 2VQGA 4LD5A 2NRAC 1FT9A 2RNJA 2HYFA 3CC7I 2DTZA 1OQYA 3LFKA 2CGPA 3CCYA 3DP7A 3GO5A 3Q0VA 1TL8A 1E3HA 4KN4X 4AIJA 3V7RA 1GV5A 4AVZA 3KZZA 1U0JA 1A35A 2FF4A 2CYYA 1I5ZA 4M71A 2DMTA 3K1MA 2VQLA 3M1EA 4A5MA 3K4LA 3P5JA 4N9HA 1SD6A 3FM3A 4RB1A 3S8PA 4BDYA 5LEKA 5B66C 3E3VA 2HOSA 1BR1A 1T56A 5EJCA 2DI3A 3GFLA 4BXXJ 1V3FA 2FQ3A 4G94A 4B43A 1JTYA 1QZZA 3E6CC 1MDMB 2Z99A 3JRCA 2ACJA 1WJFA 4A3IJ 2O6GE 2STWA 1DQUA 2MLKA 2WV0A 2R7WA 3UNGC 1VF9A 3DU5A 5HNFA 2BY1A 2X6OA 2LH9A 1YJ9I 3WTZA 1LEAA 1OKRA 1S8NA 4AVPA 3OSGA 2CSOA 3VSLA 3AL0B 2DT5A 3SFZA 1P4AA 2L0KA 3PSFA 4O3MA 5HS8A 2Y48A 3HPHA 2Q2EA 2B0LA 2MD0A 4Z2YA 2FEZA 5JI6A 4KT5C 2K9QA 4P55A 4XKVA 4FTHA 1I1SA 1TWFJ 4EM0B 1NTCA 1O3QA 4A3MJ 2HFHA 4A69C 3KPHA 3E0JB 4LOCA 4G8XA 2YR2A 5E1WA 2P81A 2GA1A 2DAOA 4II3A 3JAMZ 3BJOA 3NARA 1FLIA 1VI0A 1D5VA 1ZG1A 1HSJA 4UXNA 3KZIC 3T0YA 4CUGA 1BI3A 3IAM2 3AG1H 1KU2A 2KRCA 3G1OA 1YLFA 1YOVB 2EFWA 1IRFA 2JQ7A 1B8IB 3SXYA 5ILVA 3SEQA 4U7BA 1P2FA 2MSYA 4LK1F 4XLCA 4XLAA 2RAEA 5TGTA 3WTTC 4C3JJ 1P6RA 3JAMK 1WGXA 3H5NA 3QYFA 1BR2A 2R5YA 1J7KA 2I5UA 2O0YA 3V4GA 1G59A 1N25A 1BOBA 2MABA 5FRMA 4BJ5C 3SFIA 3BZCA 3RKXA 4S04A 3IHUA 2BOLA 4F55A 2HOEA 2CFXA 1E3PA 3TEDA 3ZP5A 1STZA 2F5CA 4L18B 1UHMA 2V7FA 4OINF 1KZHA 3PQJA 2NXNB 4BJ6C 2A61A 2WWYA 1LEBA 3PFIA 3LSPA 1LPQA 1ERDA 3O3KA 3OR2C 4M3BA 2CUJA 3FMRA 1HDDC 3MCZA 2VBWA 1UG2A 4WX9A 2ELKA 2JK3A 3HSRA 2Y0SA 3H92A 2H6CA 3PNVA 4Y17A 1PUFB 1APLC 4IXAA 2A6HF 4KMFA 5K5RA 4NC8A 4XMYA 4Y33A 2EILH 2HPMA 4IF4A 2MFZA 1D0ZA 3P9KA 3BG6A 4C2TA 4HDUA 2PMUA 2CV1A 2BZTA 2FA5A 3MWMA 3PJRA 3ML6A 2HQ5A 2CH0A 5FFXA 3TL4X 2JA8J 4A5NA 4UV8A 3G71I 1Y0NA 4U88A 5DUKA 3H0DA 4ANJA 4CA0A 2EIMH 2BY3A 5M3FJ 3Q3SA 4RM2A 3IP4B 4IHWA 1B59A 3Q9VA 3G2BA 2HTJA 1R5GA 4UVBA 1YIJI 3L2WA 2OUMA 5E20A 4ZTJA 1GVDA 2NYXA 4WXDA 4LG0A 3TDZC 2QF7A 2KRFA 4FQGA 3HEFA 3DBRB 4ZYGA 5J1RA 1SFKA 1YG2A 1K78B 5HNHA 5D6EA 5K7ZA 2BHYA 5F0HA 1YJWI 2PX9A 1QVTA 1SD7A 3WGIA 4BBRJ 3K70C 4F7ZA 5FLXZ 3F9KA 3LSRA 3O6BB 4KUMA 2X1CA 1R1TA 4O5VA 2QKMB 2EPFA 4ZH4F 1OCOH 2DA7A 3K1NA 4P1WA 3HZJA 3PM1A 3EDPA 3DF8A 3EQLF 2K85A 3LL7A 1MIJA 1XMKA 4YIFA 1H9TA 1HW5A 2YUSA 5FGMA 3QAHA 2R7UA 2DFFA 2A5YB 3PL8A 4XQFA 2M8GX 3HTUA 2ZKZA 1MNMC 2COMA 2HEOA 4E70A 2RQQA 4QIWN 4NDLA 3JR9A 4KA4A 3ZMSA 2NS0A 2VL8A 5CVIA 4MFEA 2XPUA 1WJ5A 3L2UA 3VB2A 2VC0A 3R61A 2HTSA 2X6XA 3A4CA 1W5CC 3CCVI 1ZRCA 5LEJA 2XAHA 4LLGF 4KITB 3HRMA 2L9NA 2GAUA 2XPWA 3I53A 5J47A 1EF4A 2EA4A 3GZ6A 4NBQA 4FHTA 3OYFA 2XF7A 2ESHA 4BU2A 1MSEC 5E1XA 3BR5A 3CF5F 3CCMI 2VE8A 2ZXHA 3CMYA 2EQRA 2K3PA 4LFUA 4Z6YA 2DT7B 3MFKA 4LIUA 5E17F 3TO9A 3HXLA 1IUFA 2A69F 4WF2A 1F9NA 2B63J 5M5XJ 2LYCA 2WAEA 5FD5A 4CZZA 3M4OJ 1ORKA 2MH2A 2XSDC 5AONA 2W1OA 3BPXA 1IF1A 3F8CA 4X1EA 2HOAA 3KCCA 3W6VA 2Z1DA 2LG4A 3FWEA 1GVJA 5GAEJ 2Z3YA 3CMAI 2A5WA 1JJ8C 4CCNA 1GT0C 1IV6A 4HAMA 2HDCA 2BXYA 2VOPA 1YJNI 3S2WA 1DU6A 3G1MA 4BYYA 5LHGA 1R1VA 2BXZA 4JX6A 1LDJA 3J81Z 2AS5F 3ASNH 4CYCA 4MGRA 1TQPA 4HG2A 4G7OF 5H6RA 1W4MA 5DUIA 2M30A 2JTVA 4KFCA 1FMVA 4EM1A 2DW4A 5FKNA 3K1PA 3DQVC 3PUBA 1Y1VJ 1ZH5A 2CV0A 2HYJA 4KNYA 2Y69H 2LC2A 1WVRA 1JUMA 3EUAA 5LLQA 3JTHA 1G3SA 1O3RA 3BJ6A 2P4WA 1MMSA 1YX3A 2QUFA 3CDIA 2HPIA 4D5FA 3HOZJ 2ZXIA 2DYRH 2DA3A 4E7KA 1G8XA 1T0FC 3MZ8A 4GGGA 2RNGA 1MMGA 3LNQA 3PFYA 5F6FA 3RZDJ 2OQGA 4BBSJ 1UELB 4B09A 4LMYA 2R7VA 2MH9A 2K9LA 2FXAA 2QYOA 4KN7X 1GXQA 1U8BA 1WQ2A 2WTEA 4AM3A 2ZNYA 1FOWA 1W5SA 1ETYA 2XAQA 2HQAA 3GZNB 3C2HA 4ZYDA 2EWNA 2RQPA 2XGXA 4LB6B 1VZ0A 5CJ9A 3K70D 1LQ1A 2M45A 1FBUA 3K2AA 4PGGA 4XONA 2X0LA 2Y75A 3MEXA 1ETWA 2BW3B 2P5VA 1QRYA 2VJIA 2KJCA 1DDNA 4QWQA 2FMYA 2EZLA 2OCCH 2V6CA 3HL2A 3ZCOA 2KL4A 5L3DA 4XRFA 3DKYA 3J80K 3FKJA 2JPBA 3H9GA 1Q1HA 5EYRA 4R79A 2M9HA 1VQPI 1SAXA 5E3NA 1Z05A 4M3GA 3OYEA 3VDXA 1NH3A 4I09A 2QLZA 4ZZDA 3GEZA 4UNOA 1N77A 5KAIC 3UR3C 5F04A 1R23A 1MNEA 2XAGA 3L7WA 1X58A 3I0TA 5EGOB 4CICA 1AOYA 3ABTA 2L4AA 1MH3A 3QYEA 3GMEA 4RAZA 5L3GA 4RB3C 1E0EA 5HLTA 3K4CA 4ZDLA 3K4NA 5E18F 5E1ZB 4MLOA 3S93A 2KIMA 2XV4S 3KEOA 1JKQC 1QHGA 4YIRX 3PSIA 3BROA 3BTJA 4ITVA 1GDTA 2ZJQF 1R36A 1YW7A 3L9FA 1BI1A 3K7AJ 4MQ9F 3DCFA 5EZGA 3CUQC 1SMTA 3O2PE 2M1BA 2WBMA 2R5YB 1HXDA 4FETA 3PO3J 3I58A 3VWBA 5IYDJ 2KPMA 2M4GA 2V4JC 3DPLC 3GLXA 3I59A 2DTRA 2K4JA 2M5WA 3KP5A 4B44A 1EKEA 1JGSA 3V8JA 4M3FA 5DYMA 5JHUA 1FZPB 4E7SA 3RIRA 2P7VB 4OIPF 4LITA 3KIOA 5EG0A 1UHWA 3F3XA 5J1YA 4XM3A 4HF0A 4RBOA 2C6YA 3ZQCA 2IXSA 1X19A 4XR6A 4BACA 2E7WA 3EYYA 4JOMA 3AKZA 1Y56A 4A3DJ 2XIGA 3BWGA 1IV8A 3V8LA 3OYDA 5ICEA 3HM5A 1MD0A 2OQRA 4P9FA 2M87A 3MVPA 2GLOA 1UFMA 2Y2ZA 5FD6A 4XN0A 4DBQA 4B3AA 2O7OA 4E7IA 3QYBA 1Y1WJ 4BQAA 2G7UA 1FSEA 1A31A 1YRNA 1R00A 4B48A 3U9GA 1ONVA 3MMYB 2R4GA 4HX8A 4B47A 3OY9A 3Q0WA 1SFXA 1LE8B 3EPZA 1KU9A 3CDLA 4PDKA 3C2GA 1HKTA 2CQNA 3PQKA 1A04A 2AHQA 3S2HJ 2L5QA 4BKXA 5LRRA 1X1AA 2Q1ZB 3F0CA 3DLLF 4KDPA 2ZJPF 2F6CA 1MBEA 3CMMA 3SHFA 3HKZN 3ZOBA 4E6KG 1BA5A 3S2DJ 4I98B 4CCKA 4JX5A 5IY5H 3HRUA 2P7CB 3FXRA 2VONA 1Z67A 2BHZA 3CJTB 1V5EA 1XTAA 3I3LA 2VIXA 4D5CA 4WCGA 3S1NJ 4A2UA 3QP5A 4HYEA 2HI3A 3KLOA 3ONQA 4ZYEA 4PGHA 2A6EF 3GVAA 1LFPA 3BG5A 5KK1A 4HNTA 1X3UA 2E5NA 3CF2A 3DEUA 4XLFA 4HOBA 1FIAA 4H4KC 1MMDA 4E4HA 4JK1X 2DOEA 2LR8A 3SDGA 2R7FA 5K7FA 2L7FP 2PI0A 3KFWX 5D6FA 4IX7A 2ZMEA 2EH3A 4D7MA 1OYYA 2HS5A 3FXUA 2HU9A 2PEXA 3NWSA 1Z1DA 2FSWA 5TRDA 2IA0A 2DDAA 4U7DA 5DCMB 2ZMEB 1P4XA 3I71A 3L00A 4WXCA 1WH5A 3R4KA 4IOCF 5DD8A 4CXFA 1TT5B 2MBFA 4DGWB 3HOXJ 3NQOA 3VYSB 4KYWA 2E1CA 2IS6A 3UKGA 2V1NA 1FX7A 2FBHA 1R22A 3H3VK 4LGWA 1IDZA 1QVUA 4DYQA 5IP6A 3KP7A 1IC8A 2V9PA 1VQMI 2LBFB 3DBHB 4WK8F 5FRNA 5HODA 2X51A 3BC8A 3D0SA 1H9GA 2E2HJ 4RB2C 2W82A 3DFGA 2DPDA 4YG2F 4ZZLA 4XOPA 1F4KA 3HIFA 4TV7A 1U9NA 1S3JA 4RA2A 1D1BA 2H8RA 2PJRB 1P9QC 3KZYA 2KJBA 5F1JA 3PO2J 5D8KB 2IS4A 4B4CA 1NK3P 3I4NJ 1RIOH 1BM9A 1J9IA 5FJ8J 3F8MA 3RJPA 3U21A 4GDFA 2NNYA 2K9NA 5EDNA 2M3AA 1OCRH 1K79A 1FTZA 2PFBA 4W97A 1MMNA 3WHBA 3ZR8X 3RPUA 3HG9A 1USSA 1D1CA 3QWLA 1V55H 3MZYA 4I99C 2CW8A 1D3YA 1ETOA 1ON1A 3GTKJ 1UHSA 2PBIA 3FXOA 1FYLA 3LMMA 4MO7A 2ZXJA 2JPCA 1BJZA 1U9OA 4KJZA 4I76A 5HS9A 1RRJA 1KQ9A 4XOTA 4HX7A 2XRLA 4FE7A 3BQYA 2MD5A 1SMYF 4ZDOA 4FASD 2W4SA 4Q4ZF 3L2CA 1D5YA 2DOFA 4EM2A 4B3XA 5CYVA 3CD6I 4MEYF 1J2XA 1G3TA 1HOMA 4PJNA 3RTRA 3IWFA 2DMPA 2CW0F 2KFDA 2DQLA 2W24A 5ED4A 1JJ6C 1SFOJ 3E97A 3ZQGA 3H5RA 2V9KA 3QRFF 3ERMA 2FQ4A 3CP2A 2LD5A 4B1RA 5LHHA 1D0YA 2NOJB 1P7JA 2EZIA 1X1BA 3FK6A 1B72A 1ETXA 3S1MJ 2NS8A 2LKSA 1XS9A 3M8EA 3IUOA 2ECCA 4IQJA 4LK0F 1ITYA 4ON0A 1OPCA 5K5QA 4YRVA 1ZLKA 5E79C 5BPIA 1FIPA 2DK5A 4PSXA 2QSFX 3WHCA 1ZR4A 1I39A 2W00A 3F8FA 1Y0UA 2DBBA 4YELA 4RGRA 2VT3A 3OYJA 3ROUA 2OAZA 4HQEA 1RC9A 2LKXA 2KISA 5L3CA 1VQLI 5E8GA 3D5RC 4LB5A 2DA5A 1FYMA 1MKMA 3GTMJ 1VTNC 1UB9A 5H20A 3ZQHA 3BLYA 3W2VA 1FOYA 1DU0A 4CZCA 2V6EA 3H9QA 3ZQ7A 2O8XA 4PJMA 4OIQF 2LK2A 3FZVA 1VQ5I 1GLNA 2QSHX 3KX2A 1SD4A 1XGNA 1LNWA 3FXKA 3A01A 1XX5A 3H3ZA 3W3CA 9ANTA 4ENKA 2EV0A 4EJVA 2OU2A 1ZAOA 5IOZA 1BW5A 1IN7A 1RESA 1Z7LA 4G6DA 3HGYA 1G3YA 3E6MA 2D5VA 3F72A 2KHMA 3KYDB 1U5TB 2QQBA 1D8JA 4GRIA 1QNTA 2ID6A 3OR1C 4MTDA 3CP8A 3R0JA 3JRFA 4AIDA 4D9JA 2R7ZJ 1FSHA 3KETA 2K3FA 2ZJRF 2D1HA 1ZN2A 1B9MA 1Y6IA 2FX0A 1VQ7I 3FXJA 2F2EA 2R7DA 1QZEA 2V9VA 3M3YJ 2JVHA 2VPRA 4LIVA 3BG7A 1O3TA 3HOUJ 1I6HJ 4C3HJ 4BEHA 4QSHA 6PAXA 3BTCA 3WTSC 2JUCA 1B9NA 1TT0A 4CO8A 4CYCB 1LFUP 2OC6A 3VOEA 3RDIA 3OYNA 2CS3A 5IYBJ 3MKWB 2PLYA 2ICWG 3ABKH 5DTDA 5J8FA 4CSWA 1DPUA 1HSTA 2M0CA 3BR6A 2MC3A 5D5VB 2X48A 3DPUA 1V54H 3I59B 1ODDA 3P7NA 1R71A 1ZG5A 4XBFA 3ZMVA 4IVNA 4PCQA 2GA2A 1XN7A 2DK8A 4OMZA 2RV8A 1TQMA 5ILSA 2XGCA 5C44J 3BOQA 4NUBA 3SEZA 3CCLI 2P6TA 5EG0B 1XMAA 1VNDA 3T1BA 3DPTA 2IPQX 2M4KA 4S05A 3PIPF 1S7OA 2B7EA 3OIOA 1FYKA 5FLVA 2L3DA 3BG9A 1J0RA 1FP2A 4CDGA 3JSPA 3C18A 3LSTA 4OAZA 2R5ZA 1K6OA 1YX5A 2FMLA 3NEUA 3HRTA 4GCVA 2QM3A 5HS7A 3CJQB 4G12A 2CFOA 2VQHA 3MKZA 3OYMA 2GM4A 2R7XA 2VJ5A 4HBLA 4EV0A 4IHSA 2R0QC 1NG7A 2Y31A 4XKBA 5LHIA 3J7ZI 4ZYAA 3EUKL 4J19A 4IRHA 1MBGA 3JSOA 3ZPLA 1T98A 3BZKA 1WI9A 2GWRA 2JRTA 3K4JA 1IN6A 1OCZH 2KDZA 2F5FA 3SZPA 1TW3A 1E2XA 1IN8A 2DLLA 4U0VA 3F23A 2Y0SN 3OYKA 2MG4A 4C9YA 4BY7J 1YW9A 4GXOA 3MAJA 5GAHJ 2LF8A 1OR7A 2NVYJ 3WE2A 1P92A 3FHZA 3K4BA 3BTLA 1XSDA 4DYCA 5DEQA 5BS6A 2E60A 1OCTC 2JUGA 4Q5SF 2EIKH 2LRDA 3VPRA 2W25A 2ZFWA 3ELKA 5D4RA 5FKLA 3GBGA 3OYIA 2YSRA 1WI3A 3ULQB 4Q47A 2HGCA 5LGNA 3IL2A 2HKXA 3CJNA 1XC5A 3DBLB 2VXDA 1T33A 4A3GJ 5GAGJ 2ZO4A 5M5YJ 3MZHA 5GADJ 2LREA 2XF6A 2CQXA 4IHXA 2OTJI 4JYKA 4Y15A 1IN5A 3LSHA 2KZVA 4EEFG 3I56I 5B5EC 3AL0C 1ZG3A 2FNPA 3BR3A 4I0AA 2GQQA 2ZB9A 2JMWA 2IGNA 2GIVA 3FXMA 3HOVJ 4OWRB 2ESNA 3LAJA 3I4PA 1XGSA 2WA0A 4G7ZF 3LAPA 3OIQA 2B9SA 1TWHJ 4L9VA 3S17J 5JR3A 3BPVA 1CF7B 4Y52J 2ECBA 4BAYA 4PFOA 3PUFA 3HSFA 3DTKA 1O4XA 4QTRA 1LDDA 3HKZA 2AO9A 3KEYA 1KA8A 4KISA 1WZ2A 4P96A 1NK2P 1H89C 3JW4A 4HF1A 5EZHA 1EJ9A 4XKWA 2QEXI 4A3FJ 2OF7A 5L3BA 3GF2A 1LB2A 4XLNF 3OYAA 4PUSA 1UZCA 4OOIA 1DGRM 2YS9A 3K2ZA 3OS0A 2E7XA 1WFXA 3TMOA 4X0GA 4PJLA 2KMUA 2WADA 4A0YA 4BL0B 1H8AC 1VQ6I 5HLGA 4ZJZA 2NVXJ 1XSVA 4GYGA 3IAS2 3A02A 1TZLA 1DGWY 4XRSG 1ZRFA 4LG0B 1IN4A 2RREA 3PNYA 4Y13A 1IXCA 3NWTA 3WTXC 4IEJA 1KYZA 3CMEI 1PP7U 5D5WB 1BI0A 2HQRA 2JJ7A 3KYCB 4PZJA 1ZHFA 1SANA 2LY1A 1T08B 3VFZA 4E7LA 1ZR2A 2UZKA 4QPOA 1WWXA 4IOAF 3PIOF 1K7AA 2H6BA 2M2EA 3CLOA 4BE0A 5LD2C 3F6OA 2CQ7A 5A2QK 2IA2A 4D7NA 2WAQN 3WG9A 5J40A 1GHCA 2DODA 1JT6A 3S3MA 1OLTA 3VYUB 1XB4A 4C2UA 1QA6A 3L1PA 1GV2A 2CV2A 4BXFA 3GZ5A 3TKYA 4G9YA 2FRHA 1RR8C 4FT8A 2TDXA 4CCOA 2P6SA 3F8BA 1ZLJA 2XROA 3B6CA 1JE8A 3L09A 2GXBA 4BJTA 1IDYA 2QA4I 1L0OC 2Z9OA 1Z3XA 2Q0OA 2W85A 4JQFA 5C4XJ 2VKVA 4M74A 1X1DA 1J75A 2JWTA 2RGVA 1MJ9A 3CTAA 5HDGA 3GW2A 1WHUA 4DZPA 4AIKA 1W7PA 2I10A 1QZYA 1T39A 2BW3A 1FY7A 5LGUA 3E7LA 3F22A 1A36A 1IZ1A 2EV6A 2NVUB 4CCLA 1Z3YA 1QU3A 4KICA 1KQ0A 4N4NB 1BIAA 2M7BA 2QENA 5FKKA 2NVQJ 1QPMA 3U1KA 4OAYA 2A68F 3BG3A 2VI6A 1YTYA 2BVLA 3OMYA 2IRFG 4MNUA 1W5TA 4A6EA 1H88C 1M1EB 3DEEA 1MJBA 1K61A 4FCYA 4L0YB 1NG6A 3DV8A 1SVOA 2Y9ZA 3R0AA 3BCBA 1AKHA 4Y3OA 1VQKI 3MD2A 2BY0A 5KHDA 3P9IA 4BQQA 1RUNA 4M9SA 3D1NI 5EGOA 5IT9Z 1JHHA 1G3WA 1XD7A 4XRSA 2JVGA 1Y8RB 2HDWA 2XC7A 3ECHA 2IP2A 1BOAA 1UJ8A 3HHHA 1YS6A 2FOWA 2X1EA 4IJAA 2IBDA 4PSWA 1ACIA 3CCQI 1JKOC 3L2VA 1XSXA 2OPTA 2V1DA 1RNLA 2KT0A 2LTPA 1R49A 2I8DA 2E71A 3BR1A 3ZMDA 1F36A 1CF7A 2E2JJ 3HOWJ 2XF5A 5AIQA 4BHPA 1ENHA 4DIQA 1MNDA 3C2BA 3HJEA 4NQWA 3WTYC 4XK4A 1DP3A 2BVMA 1A6QA 2KLOA 2NNNA 4L0ZB 4DZJA 2WC2A 4A3BJ 4IHVA 2MA3A 2XGEA 4C3IJ 3BTIA 4KT6A 1K4TA 1U2WA 3N05A 4HA8A 5JFRA 3TO6A 3REOA 2JA6J 2KIQA 1LFBA 2LF7A 1WCMJ 1WJEA 4GO1A 4NB5A 5FB2A 4F93B 4MFDA 4PJ0C 2F5EA 5IT9K 2BEOA 3RKQA 4IRGA 2VBYA 2JA7J 1YQAA 5L3EA 5CKTA 1AHDP 3KE2A 2VQCA 2VC1A 3FISA 3W6KB 2IGOA 2M34A 1FP1D 4HW0A 2HVSA 4HQMA 2X4HA 3I9V2 5KCMA 5TJJA 2WY8Q 2EZKA 5GTIC 1FBSA 1F1ZA 1ZGAA 2CUFA 3AG2H 5FO5A 3S32A 5J4YA 5EEAA 3OYGA 2HVQA 3JRIA 2Z33A 2DA4A 1FEXA 4UUSB 3C7JA 4BE1A 2LSOA 4A3CJ 5D4SA 4M3EA 2O3FA 4A0XA 3LA3A 2DFHA 1HLVA 4R8HA 3M8FA 4PFPA 4AC0A 3QU3A 3RCOA 4NC6A 2M8EA 3T8RA 3CUQB 3JRAA 4AYBA 3ASOH 1U6GA 1O3SA 1XMXA 1OR7C 5E3MA 1W7PB 2YPRA 4HSTA 3S3NA 2LVSA 4YFNF 5GPCA 3V7CA 2E1MB 5HLHA 5M5WJ 3S1RJ 3K4MA 3ZN0A 4EVIA 2HKOA 4E7ZA 2ID3A 1D8KA 1NHAA 5IPAA 3I4MJ 3DXJF 2F4OB 2R5ZB 3CQZJ 1IGNA 3J7AO 2PMZA 2WB1N 4OIRF 1W0UA 2LKPA 4GFBA 2QKLB 3WE3A 5L3FA 1G4DA 4MQVA 5D5UB 5ERIA 3OOPA 3ZQLA 3E1SA 3ZMTA 4HSRA 1LDKB 3IC7A 3IH4A 2E34A 1B1BA 1X4OA 3JCUC 2E5ZA 2EFPA 5CVRA 1IG7A 2L9SA 3BP8A 3KLNA 3S15J 3FM5A 4RS8A 3HOYJ 2ELJA 4U0WA 4XLPF 2CQKA 2EFNA 3S3OA 2K9MA 3VYRB 1CGPA 1IW7F 2GBYA 2PG4A 3JRGA 2OJED 3IKVA 1N75A 1S6LA 1B8IA 1XGMA 2H27A 4IRIA 2IJLA 2K4BA 3QOEA 3T8TA 4DNCA 1S5LC 2O9LA 3GLLA 3FMQA 2HYGD 4IZZA 1VQ9I 4FE4A 3ABMH 1ZGWA 1K83J 1YFHA 1T0FA 3R60A 4G6QA 2ZSHB 3WGHA 1JKPC 1TWAJ 2JRMA 1J09A 2EJRA 4RLQA 3O8GA 3SZTA 1T8IA 1OMIA 2OZUA 1QHHD 3DLAA 2R7TA 2XDVA 3GYHX 3QU6A 1HC8A 2FOKA 3TP3A 2STTA 5LFAA 1OISA 4K2EA 4NQWB 5DM7F 4BEHB 3D5SC 1BBYA 1POGA 3EUHA 1BL0A 4Q48A 1B4AA 2VODA 4I01A 2EINH 1YRNB 1FBQA 4E7HA 4FX4A 4RMNA 1T95A 4ESBA 1UCRA 2HZDA 1T38A 4WXHA 4EJUA 1LVAA 2R7OA 4BH9A 1OJLA 4BQOA 5LBQA 4HNVA 2VKDA 1SVMA 2FU4A 1F5TA 4A0ZA 1FJLA 1DPRA 1RZ4A 1KYWA 3HHGA 3CJRB 4N0BA 4YEJA 3D5LA 2GZWA 3G1LA 2DFIA 3MQ0A 4KMUX 3WU0A 3GTOJ 1GXPA 4FX0A 2PQ8A 1WJBA 2Z5UA 3G3ZA 2H1LA 1R4MB 4ESJA 2VLAA 1I1GA 1Z0XA 1PUFA 1RI7A 1WJAA 2G0EA 4N9IA 4ENMA 1HF0A 2QGUA 2VJ4A 4M72A 3IV5A 2AQFA 2VE9A 1YS7A 3U2RA 4EGZA 3ZRGA 2DN0A 4DYRA 1EH7A 3H35A 5ICFA 3V8KA 2A07F 5F27A 1LUJB 2GIZA 3HPGA 5EEHA 4ENNA 3H36A 2JT1A 3VSKA 1ETVA 2HXIA 1GUUA 1OCPA 3CCUI 2Z16A 4A6DA 1XCVA 4RGXA 3LOCA 4IPAA 3M9AA 3JRHA 1Z77A 2P5LC 2VKHA 3L2RA 1EV7A 1HCRA 2UWMA 4BQNA 1OFCX 4HLXA 3KP6A 1DUXC 2DU9A 2HQNA 3GFMA 1ZELA 4DBRA 2LNBA 4XL9A 1EH8A 5B3SH 2W48A 1LJ9A 1OYIA 1TP4A 2QWWA 1WJDA 4I6ZA 4MHGA 1ZARA 3H9JA 1L3LA 4RGUA 1MW7A 3LSGA 2XKOA 4A3LJ 2BGCA 4UUSA 2OBPA 2DYSH 3WG7H 3GUDA 3MKLA 5DCMA 1FWZA 3ZMUA 1AU7A 3JRDA 4DOZA 3HSEA 1S29A 3HTSB 3W2AA 3IKTA 1YI2I 3VYTB 2IGMA 4M9ZA 5A2QZ 1UAAA 4HX4A 5HDNA 4CGZA 5K7HA 3Q0UA 1Z7UA 5CQGA 2E19A 2L7KA 3A0HC 3F21A 2XASA 3A01B 1HW1A 5BPDA 3KYLA 1KONA 4S0HB 1PDNC 2ADUA 1ZKGA 1XDSA 2DA6A 3CLQA 3ESWB 5F0CA 2XAJA 4RAFA 2W57A 4V2FA 3M7GA 1JUSA 3RI4A 4RM3A 4ZYHA 2XUBA 5HVQC 3ZGKA 3ERED 1BJAA 2DOAA 5IT3A 3CESA 1WH7A 2EFOA 1U78A 5DDGA 3DTIA 3DWLE 2VB6A 3RKWA 2VUMJ 1B6AA 2CUEA 2CJJA 5B1BH 1WKMA 2KIUA 1D0XA 2NAZA 3FX3A 3SZGA 5IYCJ 2FJ1A 3CZ6A 1KU7A 2E1NA 3HUGB 4EMSA 4WWCA 5AIPA 3JRBA 2L9RA 3FDYA 4HRIA 2OZ6A 5GTHC 4II2A 2Q2EB 2MW8A 4O6JA 4DW6A 4A3KJ 2ELHA 3V7SA 1Q1VA 2F5DA 1W7PD 2LP0A 1MMAA 3GTPJ 4L5IA 4LG3A 2EIJH 4A12A 5IP9J 5C4JJ 2L7MP 1SC7A 2K40A 1TC3C 1S9HA 3GXOA 1W36C 1X2MA 1XG1A 2DMUA 3N97A 1R1UA 5B1AH 4XLHA 3OYBA 2FE3A 1X1CA 2JSCA 2RDPA 3QP6A 5FLXK 3TGNA 4R1HA 2KDOA 1TBXA 1QBJA 3L2QA 2MGQA 1ZK8A 4UV9A 3HC7A 4BGDA 2RKHA 5DM6F 1BC8C 1YIOA 1RPWA 2OCEA 5D5XB 1O7FA 2JN6A 2KP6A 1F43A 2XSJC 1Y8QB 3KP3A 1USTA 2A6TA 3NAUA 1IXSB 4BHBA 4XLEA 2AXTC 4LLNA 2F4IA 4RAGA 2HR3A 1I27A 3OL3A 2NVTJ 1TWCJ 4UVAA 5KVRA 5JLWA 1PJRA 2X9DA 2KZGA 5E3OA 3BCAA 3LWFA 1IRXA 1AA7A 1JI8A 3I54A 1Z9CA 4XIDA 2YX4A 2K9SA 5BMZA 4P9UA 2H94A 3BY6A 3GWZA 2ISYA 1VQ4I 3Q5FA 5CPRB 3E5UA 4ETSA 4HF2A 4D1QA 1JTXA 3OOUA 2IS2A 4BHCA 2G7HA 2CRGA 2E2IJ 1E17A 1FNNA 4UVCA 5ICCA 4EJTA 4FISA 2IW5A 2L2OA 2DT6A 4EQQA 1FTTA 1UMQA 1EA3A 4MTEA 1RUOA 2OA4A 4ZC3A 1ON2A 4HDVA 2HDDA 2O61A 3TP0A 1VQ8I 5JHFA 4X6AJ 4HZFA 3J7AY 4QPQA 4M6VA 1MZBA 2QCOA 2VOOA 3DKWA 1IUYA 1PYVA 2XB0X 3HGGA 3K69A 4XICA 3MN2A 2V1XA 1AWCA 2X1DA 2HNHA 3F6VA 2Y0MA 3U1DA 4F3QA 2EFQA 2CUZA 3RPQA 3P9CA 2DPUA 1XCBA 5BNGA 2QZ8A 1Z6RA 3C3WA 3CUQA 1MGTA 3WU2C 1IRGA 4EJWA 2X6WA 1ETQA 1SAUA 3C1DA 2Z2SB 2IA1A 3FBIB 2LY9A 3LFUA 1T6SA 2IS1A 1MJAA 1MDMA 3CCEI 1XGOA 2PMHA 2JA5J 3TQNA 4KIGA 4PK4A 3QPHA 2COBA 4RLFA 5FFZA 4DQ2A 4HLYA 1K4SA 1JGGA 2FBIA 3HDDA 3AAFA 1SVLA 2W7NA 2QVOA 1HBXG 1HA8A 2L7ZA 4A3EJ 1TQIA 1R5HA 3O8HA 3GFJA 3EYIA 3ABLH 1S7AA 3OSFA 5GPAA 2DMNA 1RKWA 3WGGA 2XVCA 3GTGJ 1D1AA 2W84A 2L54A 4W1UA 2KIFA 2ZBKA 4YIIA 2DJIA 1LVKA 3CUOA 4V2GA 5FROA 1TW2A 2CW7A 5E8IA 2ZNZA 2L01A 2VBZA 2R7SA 4F92B 2NOGA 3R6SA 2VT2A 4MIMA 4UUTA 4U87A 2VBXA 3RKYA 3TOBA 3OL4A 2FNAA 4C30A 1X1PA 3J81K 1U5TA 2R7RA 2X85A 5K5OA 1IRZA 2BY2A 4L9JA 3CO7C 4UHTA 1PVEA 1FPQA 3BZ6A 4XNFA 4MEXF 2EZHA 3EUHC 1BN5A 3LA7A 1X2NA 5HLIA 4F91B 3OWTA 3TW6A 2E35A 2BBYA 2K7LA 1BI2A 2QBYA 1N78A 2QQ9A 3ZQIA 2UUZA 2XB5A 2ZXWH 4OIOF 3G6EI 2E36A 3K4KA 4AWXB 4M9XA 1JXSA 3M1CA 5DV5A 4XORA 1KGSA 1VFCA 4BXUA 1MBKA 2MYSA 2LDUA 5DCFA 1FMWA 1IXRC 1FOKA 3TOAA 1UG0A 3FXLA 3X2QH 1PUEE 5LRSA 4EATA 3IH2A 1V5GA 2J5PA 4HNUA 5CVUA 3TBIA 4N4OB 1JT0A 1I3AA 3CCSI 2L4MA 3H1CA 4M3DA 4Y4RA 2ZJ2A 2CG4A 2XAFA 4HV6A 4DJAA 3OYHA 4NC7A 1RKTA 5HOOA 4PJJA 5CLSA 2DXIA 3A0BC 3TDUC 2VPLA 1MBFA 1Z21A 2R93J 4CCJA 2LMDA 1SFEA 4RDUA 2ETHA 4F52A 2A3SA 2XPVA 3OIPA 1MBHA 2HXOA 5DS9A 3WU1B 4AD9A 2LY2A 3LQQA 3IWZA 1ZQ3P 4M6YA 5JVGF 1ZRDA 3OS2A 3S16J 2EBIA 2G9WA 3CC4I 1FC3A 1KQ8A 2HZTA 3GX4X 4LLLA 2H1KA 3J7YJ 1Y39A 1S72I 1WSUA 4IQ4A 1HKSA 4BUPA 2LOOA 1T2KA 2RVCA 2A05A 4J01A 4HEA2 5C3EJ 2DQRA 3QPSA 3FK7A 2VN2A 3M07A 2Y9YA 1ZYRF 2WV1A 3LSJA 2O03A 1R5ID 5F08A 1P4WA 2KQRA 3IRRA 3OS1A 1ZTRA 3DKXA 5KNLA 1AKHB 1XPXA 2OD5A 4YFXF 1W0TA 1SFUA 2RN7A 3HYIA 3OYCA 3V42A 2UV1A 3K9TA 2DJNA 5CVJA 3DTEA 4ASNA 2DO7A 3SQNA 3FF5A 1EH6A 4YFKF 5M3MJ 4J00A 1A6IA 4ABZA 2XRNA 2CQQA 2CO5A 1OYWA 4UUVA 3G4SI 2WAQA 4EGYA 1WRJA 2CMPA 1X4PA 2NS7A 2M0MA 2QQAA 1X3ZB 4BDZA 3M8JA 2YX7A 3K10A 2VXZA 4AIHA 3LSKA 1R4NB 2H09A 1JHFA 1RETA 3CCRI 2X6YA 3WTWC 2ZFUA 3LSIA 3LQRA 4CHUA 2MLGA 2GOMA 1R7JA 2KKOA 5F64A 3TO7A 1WPKA 2LLKA 3B02A 1JUPA 1BIBA 4I02A 2J5OA 3I55I 4I7HA 1TWGJ 2YU3A 2IEKA 3ZQQA 5BQTA 3AFHA 3GFIA 1Z6TA 3WTVC 1O57A 1ZGJA 3KP2A 3SJMA 1IO2A 4UB8C 4L5JA 1P7IA 1WJCA 1MH4A 1I6XA 2HOTA 2E1OA 2R92J 4L9NA 3BDDA 5IOYA 2QSGX 3CC2I 5J8CA 2JA2A 1HKQA 3BQZA 3ZQFA 1TLHB 2ME6A 3TW7A 4G7HF 2FBKA 2O8KA 3ECOA 1R9TJ 4HV5A 2PN6A 2EB7A 1C0WA 4ZDPA 3HOTA 4AU7A 2VASA 4NHJA 3FXQA 4JP0A 1U3EM 3COAC 4E7JA 3CO6C 3AG4H 2V1UA 2P0WA 1J5YA 2XAUA 3EETA 3Q9SA 3KEQA 3W6JB 2TRTA 3PNTA 3BT9A 2ZCWA 3J80Z 3IRQA 1QGPA 4L9TA 2DA1A 5E3LA 1YE9A 2AQEA 3BR0A 1SD5A 4UB6C 4OMYA 3A1YA 2AXLA 5H2FC 5JVTA 3CCJI 4QLCU 2F5VA 2HVRA 1R6RA 4RB0A 2IT0A 4JBAA 2LFBA 5LGTA 2CU7A 2F4MB 2L02A 4XRMA 2QBYB 2DMQA 3FBNB 3FIWA 3RQ4A 3DU6A 5J4VA 3G73A 4A3JJ 1I50J 3N4MA 3FMSA 1W36D 1MSFC 1LKXA 1VQNI 1ZREA 4UY8I 3K0LA 3RPUD 4BY1J 2IVMA 4A93J 1OCCH 4XSXF 4U0YA 1H0MA 3AG3H 2DDBA 1HQCA 2ZMEC 2EK5A 2ZSIB 3ABUA 2P8TA 2D2WA 3HB9A 3FHNA 1YW8A 2V79A 2IAIA 2GXGA 3DEWA 2F48A 1U8RA 2HWVA 4BE2A 1REPC 5BOXA 1YHQI 2QQ8A 1RR7A 5J3LA 2DFEA 3QODA 5ICGA 4ZTFA 1K78A 3W2WA 1KU3A 4EJOA 4I0BA 1SEUA 3ZN1A 3VEPA 3HRSA 2K02A 4GYIA 4Y7NJ 3BJAA 1IAWA 3E5XA 3GCMA 2XGDA 2VJJA 1YO5C 4AUXA 1J59A 3LSMA 2RC4A 2ME0A 4KIBA 1YITI 1JKRC 2K27A 2TCTA 3QPTA 5FKOA 4RGSA 4XN3A 1QPIA 5EF6A 3QQAA 1ETKA 3GTJJ 3KP4A 3GTLJ 2WY7Q 2O5RA 3NRVA 3B6AA 1QQIA 5D8LB 3FKIJ 3RQIA 3A2KA 1E3OC 2GOXB 4H0EA 5ILUA 3HOSA 2YU9J 3VODA 2GXAA 5KAFC 1TTYA 4KIFA 1TNTA 3E5QA 1BW6A 4OU0A 4CYDA 1W1WE 1XDUA 3S1QJ 3T5XA 2EA2A 3WTUC 2L9VA 2KRHA 3HUGA 3RZOJ 5J6XA 3JTGA 2N8GA 1S7EA 2FD5A 2JZYA 3ZMZA 2MC4A 2K5CA 1BC7C 2EV5A 2PJRA 1CQTA 4RAYA 3RYRA 4XSZF 5HDKA 1YYVA 2WAFA 5FLMJ 3E6BA 4JX4A 4P5OA 4ENJA 2R3SA 2FUG2 1Z91A 3SYTA 3ISPA 2E1MC 5H6QA 4D0PA 1FOXA 2D1VA 4BS9A 1IJWC 3I5UA 4M6XA 2UXXA 2R7QA 4C2MJ 2PMZN 2WB1A 1MBJA 3JREA 2PJPA 3OYLA 3QOPA 5K1YA 5DD4A 3H3UA 4NNJA 1V4RA 3CDHA 4CCMA 3MKYB 2D45A 4L5EA 2XKPA 3ZXSA 2BYVE 2JSPA 2LBFA 2M7AA 4IL6C 5CVVA 3BR2A 1ULYA 1TNSA 3LA2A 4LJZF 5CQEA 1BR4A 3F8NA 4BNCA 2ISZA 2H8WA 2ZC2A 3A03A 4XKCA 2Q8KA 5EEGA 4IHTA 2DCEA 5J1UA 5TISC 3S14J 3I64A 3K6GA 2XHKA 2BE5F 4I2OA 2BV6A 5GP9A 5JLXA 2P5KA 3SDBA 4B8XA 2OV7A 2CWEA 4ESFA 1PP8F 3OV8A 1R58A 2IGKA 5IP7J 1O7LA 3QPLA 4V19K 4IKFA 1I3QJ 3GTQJ 1HDPA 3IH3A 3RSNA 2VKEA 4AYBN 1DP7P 4IHYA 3RYPA 2V26A 4M73A 1K6YA 4G6TB 2UXNA 4CH7A
chains in the Genus database with same CATH topology
3E6DA 1G6NA 5F1RA 1QO0D 3WODF 2K86A 3B73A 1U5TC 1HW2A 4LD5A 2NRAC 1FT9A 2RNJA 2HYFA 3LFKA 2CGPA 3DP7A 3GO5A 4KN4X 4AIJA 3V7RA 3KZZA 2FF4A 2CYYA 1I5ZA 4M71A 3K1MA 3M1EA 4A5MA 4N9HA 1SD6A 3FM3A 4RB1A 5LEKA 3E3VA 2DI3A 3GFLA 1V3FA 2FQ3A 4G94A 1MDMB 1QZZA 3E6CC 2Z99A 2ACJA 2O6GE 2STWA 2MLKA 2WV0A 3WTZA 1LEAA 1OKRA 1S8NA 4AVPA 2CSOA 2DT5A 3SFZA 1P4AA 4O3MA 5HS8A 2Y48A 2Q2EA 2B0LA 4Z2YA 2FEZA 5JI6A 4KT5C 4P55A 1I1SA 4EM0B 1O3QA 2HFHA 4G8XA 2YR2A 5E1WA 2GA1A 2DAOA 3JAMZ 3BJOA 1FLIA 1D5VA 1ZG1A 1HSJA 4UXNA 3T0YA 1BI3A 1KU2A 1YLFA 2EFWA 1IRFA 3SXYA 5ILVA 4U7BA 1P2FA 4LK1F 3WTTC 1P6RA 3JAMK 1J7KA 2O0YA 3V4GA 3RKXA 4S04A 3IHUA 2HOEA 2CFXA 3ZP5A 1STZA 2F5CA 4L18B 1UHMA 4OINF 3PQJA 2A61A 2WWYA 1LEBA 3PFIA 3O3KA 3FMRA 3MCZA 2VBWA 4WX9A 3HSRA 3H92A 2H6CA 4Y17A 4IXAA 2A6HF 4KMFA 5K5RA 4IF4A 3P9KA 4HDUA 2PMUA 2FA5A 3MWMA 3ML6A 5FFXA 4A5NA 4UV8A 4U88A 5DUKA 1B59A 3Q9VA 2HTJA 1R5GA 4UVBA 5E20A 2NYXA 4WXDA 4LG0A 3TDZC 2KRFA 4ZYGA 1YG2A 1K78B 5D6EA 3WGIA 1SD7A 4F7ZA 5FLXZ 3O6BB 4KUMA 4O5VA 1R1TA 4ZH4F 3K1NA 3EDPA 3DF8A 3EQLF 1XMKA 4YIFA 1H9TA 1HW5A 5FGMA 3QAHA 2A5YB 3HTUA 2ZKZA 2COMA 2HEOA 4E70A 4KA4A 3ZMSA 2NS0A 5CVIA 3VB2A 2VC0A 3R61A 2HTSA 1ZRCA 5LEJA 2XAHA 4LLGF 3HRMA 2GAUA 3I53A 2EA4A 3GZ6A 4FHTA 2ESHA 5E1XA 2VE8A 4LFUA 3MFKA 5E17F 3TO9A 2A69F 4WF2A 1F9NA 5FD5A 4CZZA 2MH2A 5AONA 3BPXA 1IF1A 3F8CA 3KCCA 3FWEA 1GVJA 2Z3YA 2HDCA 4HAMA 2VOPA 3S2WA 4BYYA 5LHGA 1R1VA 1LDJA 3J81Z 2AS5F 4MGRA 1TQPA 4G7OF 5H6RA 1W4MA 5DUIA 2M30A 2JTVA 4KFCA 4EM1A 2DW4A 3K1PA 3DQVC 1ZH5A 4KNYA 5LLQA 3JTHA 1G3SA 1O3RA 3BJ6A 2P4WA 2QUFA 4GGGA 5F6FA 2OQGA 4B09A 4LMYA 2MH9A 2FXAA 2QYOA 4KN7X 1GXQA 1WQ2A 2WTEA 2ZNYA 1W5SA 2XAQA 4ZYDA 2EWNA 2RQPA 2XGXA 4LB6B 5CJ9A 1LQ1A 2M45A 1FBUA 4PGGA 2X0LA 2Y75A 3MEXA 2P5VA 2KJCA 1DDNA 4QWQA 2FMYA 2V6CA 5L3DA 4XRFA 3J80K 2JPBA 1Q1HA 1SAXA 4R79A 1Z05A 4I09A 2QLZA 4ZZDA 3GEZA 4UNOA 1R23A 2XAGA 3L7WA 3I0TA 4CICA 1AOYA 3ABTA 2L4AA 4RAZA 5L3GA 4RB3C 5E18F 5E1ZB 2KIMA 2XV4S 3KEOA 3BROA 1R36A 1YW7A 3L9FA 1BI1A 4MQ9F 3CUQC 1SMTA 3O2PE 2M1BA 1HXDA 3I58A 3DPLC 3GLXA 3I59A 2DTRA 2K4JA 2M5WA 3KP5A 1JGSA 3V8JA 5DYMA 5JHUA 1FZPB 3RIRA 2P7VB 4OIPF 1UHWA 3F3XA 4HF0A 2C6YA 2E7WA 3EYYA 2XIGA 3BWGA 3V8LA 5ICEA 1MD0A 2OQRA 4P9FA 2M87A 1UFMA 5FD6A 4BQAA 2G7UA 1FSEA 1R00A 3U9GA 1ONVA 4HX8A 1SFXA 1KU9A 4PDKA 1HKTA 3PQKA 1A04A 5LRRA 4KDPA 3SHFA 4I98B 3HRUA 2P7CB 3FXRA 2VONA 4WCGA 4A2UA 3QP5A 4HYEA 3KLOA 4ZYEA 4PGHA 2A6EF 3GVAA 5KK1A 1X3UA 3DEUA 4HOBA 4JK1X 2R7FA 2PI0A 3KFWX 5D6FA 2ZMEA 1OYYA 2HS5A 3FXUA 2PEXA 1Z1DA 2FSWA 5TRDA 2IA0A 4U7DA 5DCMB 2ZMEB 1P4XA 3I71A 3L00A 4WXCA 3R4KA 5DD8A 4CXFA 2MBFA 3NQOA 4KYWA 2E1CA 1FX7A 2FBHA 1R22A 4LGWA 3KP7A 4WK8F 3D0SA 1H9GA 4RB2C 3DFGA 2DPDA 4YG2F 4ZZLA 1F4KA 3HIFA 4TV7A 1S3JA 3KZYA 2KJBA 5D8KB 1J9IA 1RIOH 1BM9A 3F8MA 3RJPA 2NNYA 1K79A 2PFBA 3RPUA 1USSA 3MZYA 1D3YA 1ON1A 2PBIA 1FYLA 2ZXJA 2JPCA 5HS9A 1KQ9A 4HX7A 2MD5A 1SMYF 4Q4ZF 3L2CA 4EM2A 5CYVA 4MEYF 1J2XA 1G3TA 3RTRA 3IWFA 2CW0F 2DQLA 2W24A 5ED4A 3E97A 3QRFF 5LHHA 3M8EA 4LK0F 4ON0A 1OPCA 5K5QA 1ZLKA 5BPIA 2DK5A 3F8FA 1Y0UA 2DBBA 4RGRA 2VT3A 3ROUA 2OAZA 4HQEA 5L3CA 4LB5A 5E8GA 1FYMA 1MKMA 1VTNC 1UB9A 5H20A 3ZQ7A 2O8XA 4OIQF 3FZVA 1SD4A 1XGNA 1LNWA 3H3ZA 4ENKA 2EV0A 4EJVA 2OU2A 1ZAOA 1IN7A 4G6DA 1G3YA 3E6MA 3F72A 1U5TB 2QQBA 1D8JA 1QNTA 4MTDA 3R0JA 1FSHA 3KETA 2D1HA 1ZN2A 1B9MA 2F2EA 2R7DA 2V9VA 1O3TA 6PAXA 3WTSC 1B9NA 4CO8A 3VOEA 3RDIA 2PLYA 5J8FA 1DPUA 1HSTA 2MC3A 5D5VB 3I59B 1ODDA 3P7NA 1ZG5A 4XBFA 3ZMVA 4IVNA 4PCQA 2GA2A 1XN7A 2DK8A 4OMZA 2RV8A 1TQMA 5ILSA 3BOQA 2P6TA 1XMAA 3T1BA 3DPTA 2IPQX 4S05A 1FYKA 1S7OA 2L3DA 1J0RA 1FP2A 4CDGA 3JSPA 3C18A 3LSTA 1K6OA 2FMLA 3NEUA 3HRTA 4GCVA 2QM3A 5HS7A 4HBLA 4EV0A 4IHSA 5LHIA 4IRHA 3JSOA 3ZPLA 1T98A 1WI9A 2GWRA 2JRTA 1IN6A 2F5FA 3SZPA 1TW3A 1E2XA 1IN8A 2DLLA 4U0VA 3F23A 1YW9A 4GXOA 3MAJA 2LF8A 1OR7A 3WE2A 1P92A 3FHZA 1XSDA 5BS6A 5DEQA 4Q5SF 2W25A 2ZFWA 3ELKA 5D4RA 2YSRA 3ULQB 4Q47A 2HGCA 5LGNA 3IL2A 2HKXA 3CJNA 2ZO4A 3MZHA 4Y15A 1IN5A 1ZG3A 2FNPA 4I0AA 2GQQA 2GIVA 2ESNA 3LAJA 3I4PA 1XGSA 4G7ZF 3LAPA 4L9VA 5JR3A 3BPVA 1CF7B 4BAYA 3HSFA 1LDDA 1KA8A 4P96A 3JW4A 4HF1A 5L3BA 3GF2A 1LB2A 4XLNF 4OOIA 3K2ZA 2E7XA 4A0YA 5HLGA 1XSVA 4GYGA 4LG0B 1ZRFA 1IN4A 4Y13A 1IXCA 3WTXC 1KYZA 1PP7U 5D5WB 1BI0A 2HQRA 4PZJA 1ZHFA 3VFZA 2UZKA 1WWXA 1K7AA 2H6BA 3CLOA 3F6OA 5A2QK 2IA2A 3WG9A 1GHCA 1XB4A 3GZ5A 3TKYA 4G9YA 2FRHA 4FT8A 2TDXA 2P6SA 3F8BA 1ZLJA 2XROA 1JE8A 3L09A 2GXBA 1L0OC 2Z9OA 2Q0OA 2W85A 4JQFA 4M74A 1J75A 2RGVA 1MJ9A 3CTAA 5HDGA 3GW2A 4AIKA 1W7PA 1QZYA 1T39A 1FY7A 5LGUA 3F22A 1IZ1A 2EV6A 4KICA 1KQ0A 1BIAA 2QENA 1QPMA 2A68F 1YTYA 2IRFG 4MNUA 1W5TA 4A6EA 1MJBA 4L0YB 3DV8A 3R0AA 3P9IA 1RUNA 4M9SA 5IT9Z 1JHHA 1G3WA 1XD7A 3ECHA 2IP2A 1BOAA 3HHHA 1YS6A 4IJAA 1XSXA 2V1DA 1RNLA 3ZMDA 1CF7A 5AIQA 4BHPA 4NQWA 3WTYC 2NNNA 4L0ZB 2WC2A 2MA3A 1U2WA 4HA8A 5JFRA 3TO6A 3REOA 2LF7A 4GO1A 4NB5A 5FB2A 2F5EA 5IT9K 2BEOA 4IRGA 2VBYA 1YQAA 5L3EA 3KE2A 2VC1A 3W6KB 1FP1D 4HW0A 4HQMA 2X4HA 5TJJA 1FBSA 1F1ZA 1ZGAA 5FO5A 2Z33A 3C7JA 2LSOA 5D4SA 2O3FA 4A0XA 3LA3A 4R8HA 3M8FA 3QU3A 2M8EA 3T8RA 3CUQB 1U6GA 1O3SA 1W7PB 2YPRA 4YFNF 3V7CA 5HLHA 3ZN0A 4EVIA 2HKOA 1D8KA 1NHAA 3DXJF 3J7AO 4OIRF 2LKPA 3WE3A 5L3FA 1G4DA 4MQVA 5D5UB 5ERIA 3OOPA 3ZMTA 1LDKB 3IC7A 1B1BA 2EFPA 5CVRA 3BP8A 3KLNA 3FM5A 4RS8A 4U0WA 4XLPF 2CQKA 2EFNA 1CGPA 1IW7F 2PG4A 3IKVA 1S6LA 1XGMA 4IRIA 2H27A 2IJLA 2K4BA 3T8TA 4DNCA 3FMQA 2HYGD 1YFHA 1T0FA 3R60A 4G6QA 3WGHA 2EJRA 3SZTA 1OMIA 2OZUA 3GYHX 3QU6A 2FOKA 2STTA 4K2EA 1BBYA 3EUHA 4Q48A 1B4AA 2VODA 4I01A 1FBQA 4FX4A 4ESBA 1UCRA 1T38A 4WXHA 4EJUA 1LVAA 4BH9A 5LBQA 2FU4A 1F5TA 4A0ZA 1DPRA 1RZ4A 1KYWA 3HHGA 4N0BA 3D5LA 2GZWA 2DFIA 3MQ0A 4KMUX 3WU0A 1GXPA 4FX0A 2PQ8A 2Z5UA 3G3ZA 4ESJA 1I1GA 1RI7A 4ENMA 4N9IA 4M72A 2VE9A 1YS7A 3U2RA 4EGZA 1EH7A 5ICFA 3V8KA 2A07F 4ENNA 5EEHA 2JT1A 4A6DA 1XCVA 4RGXA 4IPAA 3M9AA 2P5LC 1EV7A 2UWMA 4HLXA 3KP6A 1DUXC 2DU9A 2HQNA 3GFMA 2LNBA 1EH8A 1LJ9A 1OYIA 2QWWA 4MHGA 1ZARA 1L3LA 4RGUA 2XKOA 2BGCA 2OBPA 3GUDA 5DCMA 1FWZA 3ZMUA 3HSEA 1S29A 3HTSB 3IKTA 4M9ZA 5A2QZ 4HX4A 5HDNA 4CGZA 1Z7UA 3F21A 2XASA 1HW1A 5BPDA 1PDNC 2ADUA 1XDSA 2XAJA 2W57A 3M7GA 3RI4A 4ZYHA 2XUBA 5HVQC 3ERED 1BJAA 5IT3A 2EFOA 1U78A 5DDGA 3RKWA 1B6AA 1WKMA 2KIUA 2NAZA 3FX3A 1KU7A 2E1NA 4EMSA 4WWCA 5AIPA 2OZ6A 4O6JA 2ELHA 3V7SA 2F5DA 1W7PD 4L5IA 4A12A 3GXOA 3N97A 1R1UA 2FE3A 2JSCA 2RDPA 3QP6A 5FLXK 3TGNA 4R1HA 1TBXA 1QBJA 4UV9A 2RKHA 1BC8C 1YIOA 5D5XB 1O7FA 3KP3A 1USTA 4BHBA 1IXSB 4LLNA 2HR3A 1I27A 4UVAA 5KVRA 3LWFA 3I54A 1Z9CA 2YX4A 5BMZA 4P9UA 2H94A 3BY6A 3GWZA 2ISYA 3Q5FA 3E5UA 4ETSA 4HF2A 4BHCA 2G7HA 1E17A 1FNNA 4UVCA 5ICCA 4EJTA 2IW5A 4EQQA 4MTEA 1RUOA 2OA4A 1ON2A 4HDVA 2O61A 4HZFA 1MZBA 2VOOA 3DKWA 1IUYA 3K69A 2V1XA 1AWCA 3U1DA 3F6VA 2Y0MA 2EFQA 3RPQA 3P9CA 2DPUA 1XCBA 2QZ8A 1Z6RA 3C3WA 3CUQA 1MGTA 1IRGA 4EJWA 3C1DA 2IA1A 1T6SA 1MJAA 1MDMA 1XGOA 2PMHA 3TQNA 4KIGA 3QPHA 5FFZA 4DQ2A 4HLYA 2FBIA 3AAFA 2QVOA 1HBXG 1TQIA 1R5HA 3GFJA 3EYIA 1S7AA 3WGGA 2XVCA 2W84A 2L54A 2KIFA 2ZBKA 4YIIA 3CUOA 1TW2A 5E8IA 2ZNZA 2L01A 2VBZA 3R6SA 2VT2A 3RKYA 2VBXA 3TOBA 2FNAA 3J81K 1U5TA 5K5OA 4L9JA 3CO7C 4UHTA 1FPQA 3BZ6A 4MEXF 1BN5A 3LA7A 5HLIA 2BBYA 2K7LA 1BI2A 2QBYA 2QQ9A 4OIOF 4AWXB 4M9XA 1JXSA 5DV5A 1KGSA 4BXUA 2LDUA 5DCFA 1IXRC 1FOKA 3TOAA 1PUEE 5LRSA 2J5PA 5CVUA 2L4MA 2ZJ2A 2CG4A 2XAFA 4HV6A 5HOOA 5CLSA 3TDUC 1SFEA 2ETHA 2A3SA 3WU1B 4AD9A 3LQQA 3IWZA 4M6YA 1ZRDA 2G9WA 1FC3A 1KQ8A 2HZTA 3GX4X 4LLLA 1WSUA 1HKSA 1T2KA 2RVCA 2DQRA 2VN2A 1ZYRF 2O03A 1P4WA 3IRRA 2OD5A 4YFXF 1SFUA 2RN7A 3HYIA 3K9TA 5CVJA 4ASNA 2DO7A 3SQNA 3FF5A 1EH6A 4YFKF 2XRNA 2CO5A 1OYWA 4UUVA 4EGYA 1WRJA 2QQAA 2YX7A 2VXZA 4AIHA 2H09A 1JHFA 3WTWC 4CHUA 3LQRA 2MLGA 1R7JA 2KKOA 5F64A 3TO7A 3B02A 1BIBA 4I02A 2J5OA 4I7HA 2YU3A 5BQTA 3GFIA 1Z6TA 3WTVC 1O57A 1ZGJA 3KP2A 4L5JA 1I6XA 4L9NA 3BDDA 5J8CA 1HKQA 1TLHB 4G7HF 2FBKA 3ECOA 4HV5A 2PN6A 2EB7A 1C0WA 3HOTA 4NHJA 3FXQA 1U3EM 3COAC 3CO6C 2V1UA 1J5YA 3EETA 3Q9SA 3KEQA 3W6JB 2ZCWA 3J80Z 3IRQA 1QGPA 4L9TA 1SD5A 4OMYA 2AXLA 5JVTA 4QLCU 2IT0A 4RB0A 4JBAA 5LGTA 2L02A 2QBYB 3G73A 3N4MA 3FMSA 1ZREA 3K0LA 2IVMA 4XSXF 4U0YA 1H0MA 1HQCA 2EK5A 3ABUA 2P8TA 2D2WA 1YW8A 2V79A 2GXGA 1U8RA 2HWVA 1REPC 5BOXA 5ICGA 1K78A 1KU3A 4EJOA 4I0BA 3ZN1A 3VEPA 3HRSA 2K02A 4GYIA 1IAWA 3BJAA 3E5XA 1YO5C 1J59A 2RC4A 4KIBA 2K27A 3QPTA 4RGSA 3KP4A 3NRVA 1QQIA 5D8LB 4H0EA 5ILUA 3HOSA 3VODA 1TTYA 4KIFA 1TNTA 3E5QA 4OU0A 4CYDA 1XDUA 3T5XA 2EA2A 3WTUC 3HUGA 5J6XA 3JTGA 2JZYA 3ZMZA 1BC7C 2EV5A 4RAYA 3RYRA 4XSZF 5HDKA 1YYVA 3E6BA 4P5OA 4ENJA 2R3SA 1Z91A 3ISPA 5H6QA 4D0PA 2D1VA 3I5UA 4M6XA 2UXXA 2PJPA 3QOPA 5K1YA 5DD4A 3H3UA 2D45A 1V4RA 3CDHA 2XKPA 2BYVE 5CVVA 1ULYA 1TNSA 3LA2A 4LJZF 3F8NA 4BNCA 2ISZA 2Q8KA 5EEGA 4IHTA 3I64A 2XHKA 2BE5F 4I2OA 2BV6A 2P5KA 4B8XA 2CWEA 4ESFA 1PP8F 3OV8A 1R58A 1O7LA 1DP7P 3RYPA 4M73A 2UXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6D A;  1G6N A;  5F1R A;  1QO0 D;  3WOD F;  2K86 A;  3B73 A;  1U5T C;  1HW2 A;  4LD5 A;  2NRA C;  1FT9 A;  2RNJ A;  2HYF A;  3LFK A;  2CGP A;  3DP7 A;  3GO5 A;  4KN4 X;  4AIJ A;  3V7R A;  3KZZ A;  2FF4 A;  2CYY A;  1I5Z A;  4M71 A;  3K1M A;  3M1E A;  4A5M A;  4N9H A;  1SD6 A;  3FM3 A;  4RB1 A;  5LEK A;  3E3V A;  2DI3 A;  3GFL A;  1V3F A;  2FQ3 A;  4G94 A;  1MDM B;  1QZZ A;  3E6C C;  2Z99 A;  2ACJ A;  2O6G E;  2STW A;  2MLK A;  2WV0 A;  3WTZ A;  1LEA A;  1OKR A;  1S8N A;  4AVP A;  2CSO A;  2DT5 A;  3SFZ A;  1P4A A;  4O3M A;  5HS8 A;  2Y48 A;  2Q2E A;  2B0L A;  4Z2Y A;  2FEZ A;  5JI6 A;  4KT5 C;  4P55 A;  1I1S A;  4EM0 B;  1O3Q A;  2HFH A;  4G8X A;  2YR2 A;  5E1W A;  2GA1 A;  2DAO A;  3JAM Z;  3BJO A;  1FLI A;  1D5V A;  1ZG1 A;  1HSJ A;  4UXN A;  3T0Y A;  1BI3 A;  1KU2 A;  1YLF A;  2EFW A;  1IRF A;  3SXY A;  5ILV A;  4U7B A;  1P2F A;  4LK1 F;  3WTT C;  1P6R A;  3JAM K;  1J7K A;  2O0Y A;  3V4G A;  3RKX A;  4S04 A;  3IHU A;  2HOE A;  2CFX A;  3ZP5 A;  1STZ A;  2F5C A;  4L18 B;  1UHM A;  4OIN F;  3PQJ A;  2A61 A;  2WWY A;  1LEB A;  3PFI A;  3O3K A;  3FMR A;  3MCZ A;  2VBW A;  4WX9 A;  3HSR A;  3H92 A;  2H6C A;  4Y17 A;  4IXA A;  2A6H F;  4KMF A;  5K5R A;  4IF4 A;  3P9K A;  4HDU A;  2PMU A;  2FA5 A;  3MWM A;  3ML6 A;  5FFX A;  4A5N A;  4UV8 A;  4U88 A;  5DUK A;  1B59 A;  3Q9V A;  2HTJ A;  1R5G A;  4UVB A;  5E20 A;  2NYX A;  4WXD A;  4LG0 A;  3TDZ C;  2KRF A;  4ZYG A;  1YG2 A;  1K78 B;  5D6E A;  3WGI A;  1SD7 A;  4F7Z A;  5FLX Z;  3O6B B;  4KUM A;  4O5V A;  1R1T A;  4ZH4 F;  3K1N A;  3EDP A;  3DF8 A;  3EQL F;  1XMK A;  4YIF A;  1H9T A;  1HW5 A;  5FGM A;  3QAH A;  2A5Y B;  3HTU A;  2ZKZ A;  2COM A;  2HEO A;  4E70 A;  4KA4 A;  3ZMS A;  2NS0 A;  5CVI A;  3VB2 A;  2VC0 A;  3R61 A;  2HTS A;  1ZRC A;  5LEJ A;  2XAH A;  4LLG F;  3HRM A;  2GAU A;  3I53 A;  2EA4 A;  3GZ6 A;  4FHT A;  2ESH A;  5E1X A;  2VE8 A;  4LFU A;  3MFK A;  5E17 F;  3TO9 A;  2A69 F;  4WF2 A;  1F9N A;  5FD5 A;  4CZZ A;  2MH2 A;  5AON A;  3BPX A;  1IF1 A;  3F8C A;  3KCC A;  3FWE A;  1GVJ A;  2Z3Y A;  2HDC A;  4HAM A;  2VOP A;  3S2W A;  4BYY A;  5LHG A;  1R1V A;  1LDJ A;  3J81 Z;  2AS5 F;  4MGR A;  1TQP A;  4G7O F;  5H6R A;  1W4M A;  5DUI A;  2M30 A;  2JTV A;  4KFC A;  4EM1 A;  2DW4 A;  3K1P A;  3DQV C;  1ZH5 A;  4KNY A;  5LLQ A;  3JTH A;  1G3S A;  1O3R A;  3BJ6 A;  2P4W A;  2QUF A;  4GGG A;  5F6F A;  2OQG A;  4B09 A;  4LMY A;  2MH9 A;  2FXA A;  2QYO A;  4KN7 X;  1GXQ A;  1WQ2 A;  2WTE A;  2ZNY A;  1W5S A;  2XAQ A;  4ZYD A;  2EWN A;  2RQP A;  2XGX A;  4LB6 B;  5CJ9 A;  1LQ1 A;  2M45 A;  1FBU A;  4PGG A;  2X0L A;  2Y75 A;  3MEX A;  2P5V A;  2KJC A;  1DDN A;  4QWQ A;  2FMY A;  2V6C A;  5L3D A;  4XRF A;  3J80 K;  2JPB A;  1Q1H A;  1SAX A;  4R79 A;  1Z05 A;  4I09 A;  2QLZ A;  4ZZD A;  3GEZ A;  4UNO A;  1R23 A;  2XAG A;  3L7W A;  3I0T A;  4CIC A;  1AOY A;  3ABT A;  2L4A A;  4RAZ A;  5L3G A;  4RB3 C;  5E18 F;  5E1Z B;  2KIM A;  2XV4 S;  3KEO A;  3BRO A;  1R36 A;  1YW7 A;  3L9F A;  1BI1 A;  4MQ9 F;  3CUQ C;  1SMT A;  3O2P E;  2M1B A;  1HXD A;  3I58 A;  3DPL C;  3GLX A;  3I59 A;  2DTR A;  2K4J A;  2M5W A;  3KP5 A;  1JGS A;  3V8J A;  5DYM A;  5JHU A;  1FZP B;  3RIR A;  2P7V B;  4OIP F;  1UHW A;  3F3X A;  4HF0 A;  2C6Y A;  2E7W A;  3EYY A;  2XIG A;  3BWG A;  3V8L A;  5ICE A;  1MD0 A;  2OQR A;  4P9F A;  2M87 A;  1UFM A;  5FD6 A;  4BQA A;  2G7U A;  1FSE A;  1R00 A;  3U9G A;  1ONV A;  4HX8 A;  1SFX A;  1KU9 A;  4PDK A;  1HKT A;  3PQK A;  1A04 A;  5LRR A;  4KDP A;  3SHF A;  4I98 B;  3HRU A;  2P7C B;  3FXR A;  2VON A;  4WCG A;  4A2U A;  3QP5 A;  4HYE A;  3KLO A;  4ZYE A;  4PGH A;  2A6E F;  3GVA A;  5KK1 A;  1X3U A;  3DEU A;  4HOB A;  4JK1 X;  2R7F A;  2PI0 A;  3KFW X;  5D6F A;  2ZME A;  1OYY A;  2HS5 A;  3FXU A;  2PEX A;  1Z1D A;  2FSW A;  5TRD A;  2IA0 A;  4U7D A;  5DCM B;  2ZME B;  1P4X A;  3I71 A;  3L00 A;  4WXC A;  3R4K A;  5DD8 A;  4CXF A;  2MBF A;  3NQO A;  4KYW A;  2E1C A;  1FX7 A;  2FBH A;  1R22 A;  4LGW A;  3KP7 A;  4WK8 F;  3D0S A;  1H9G A;  4RB2 C;  3DFG A;  2DPD A;  4YG2 F;  4ZZL A;  1F4K A;  3HIF A;  4TV7 A;  1S3J A;  3KZY A;  2KJB A;  5D8K B;  1J9I A;  1RIO H;  1BM9 A;  3F8M A;  3RJP A;  2NNY A;  1K79 A;  2PFB A;  3RPU A;  1USS A;  3MZY A;  1D3Y A;  1ON1 A;  2PBI A;  1FYL A;  2ZXJ A;  2JPC A;  5HS9 A;  1KQ9 A;  4HX7 A;  2MD5 A;  1SMY F;  4Q4Z F;  3L2C A;  4EM2 A;  5CYV A;  4MEY F;  1J2X A;  1G3T A;  3RTR A;  3IWF A;  2CW0 F;  2DQL A;  2W24 A;  5ED4 A;  3E97 A;  3QRF F;  5LHH A;  3M8E A;  4LK0 F;  4ON0 A;  1OPC A;  5K5Q A;  1ZLK A;  5BPI A;  2DK5 A;  3F8F A;  1Y0U A;  2DBB A;  4RGR A;  2VT3 A;  3ROU A;  2OAZ A;  4HQE A;  5L3C A;  4LB5 A;  5E8G A;  1FYM A;  1MKM A;  1VTN C;  1UB9 A;  5H20 A;  3ZQ7 A;  2O8X A;  4OIQ F;  3FZV A;  1SD4 A;  1XGN A;  1LNW A;  3H3Z A;  4ENK A;  2EV0 A;  4EJV A;  2OU2 A;  1ZAO A;  1IN7 A;  4G6D A;  1G3Y A;  3E6M A;  3F72 A;  1U5T B;  2QQB A;  1D8J A;  1QNT A;  4MTD A;  3R0J A;  1FSH A;  3KET A;  2D1H A;  1ZN2 A;  1B9M A;  2F2E A;  2R7D A;  2V9V A;  1O3T A;  6PAX A;  3WTS C;  1B9N A;  4CO8 A;  3VOE A;  3RDI A;  2PLY A;  5J8F A;  1DPU A;  1HST A;  2MC3 A;  5D5V B;  3I59 B;  1ODD A;  3P7N A;  1ZG5 A;  4XBF A;  3ZMV A;  4IVN A;  4PCQ A;  2GA2 A;  1XN7 A;  2DK8 A;  4OMZ A;  2RV8 A;  1TQM A;  5ILS A;  3BOQ A;  2P6T A;  1XMA A;  3T1B A;  3DPT A;  2IPQ X;  4S05 A;  1FYK A;  1S7O A;  2L3D A;  1J0R A;  1FP2 A;  4CDG A;  3JSP A;  3C18 A;  3LST A;  1K6O A;  2FML A;  3NEU A;  3HRT A;  4GCV A;  2QM3 A;  5HS7 A;  4HBL A;  4EV0 A;  4IHS A;  5LHI A;  4IRH A;  3JSO A;  3ZPL A;  1T98 A;  1WI9 A;  2GWR A;  2JRT A;  1IN6 A;  2F5F A;  3SZP A;  1TW3 A;  1E2X A;  1IN8 A;  2DLL A;  4U0V A;  3F23 A;  1YW9 A;  4GXO A;  3MAJ A;  2LF8 A;  1OR7 A;  3WE2 A;  1P92 A;  3FHZ A;  1XSD A;  5BS6 A;  5DEQ A;  4Q5S F;  2W25 A;  2ZFW A;  3ELK A;  5D4R A;  2YSR A;  3ULQ B;  4Q47 A;  2HGC A;  5LGN A;  3IL2 A;  2HKX A;  3CJN A;  2ZO4 A;  3MZH A;  4Y15 A;  1IN5 A;  1ZG3 A;  2FNP A;  4I0A A;  2GQQ A;  2GIV A;  2ESN A;  3LAJ A;  3I4P A;  1XGS A;  4G7Z F;  3LAP A;  4L9V A;  5JR3 A;  3BPV A;  1CF7 B;  4BAY A;  3HSF A;  1LDD A;  1KA8 A;  4P96 A;  3JW4 A;  4HF1 A;  5L3B A;  3GF2 A;  1LB2 A;  4XLN F;  4OOI A;  3K2Z A;  2E7X A;  4A0Y A;  5HLG A;  1XSV A;  4GYG A;  4LG0 B;  1ZRF A;  1IN4 A;  4Y13 A;  1IXC A;  3WTX C;  1KYZ A;  1PP7 U;  5D5W B;  1BI0 A;  2HQR A;  4PZJ A;  1ZHF A;  3VFZ A;  2UZK A;  1WWX A;  1K7A A;  2H6B A;  3CLO A;  3F6O A;  5A2Q K;  2IA2 A;  3WG9 A;  1GHC A;  1XB4 A;  3GZ5 A;  3TKY A;  4G9Y A;  2FRH A;  4FT8 A;  2TDX A;  2P6S A;  3F8B A;  1ZLJ A;  2XRO A;  1JE8 A;  3L09 A;  2GXB A;  1L0O C;  2Z9O A;  2Q0O A;  2W85 A;  4JQF A;  4M74 A;  1J75 A;  2RGV A;  1MJ9 A;  3CTA A;  5HDG A;  3GW2 A;  4AIK A;  1W7P A;  1QZY A;  1T39 A;  1FY7 A;  5LGU A;  3F22 A;  1IZ1 A;  2EV6 A;  4KIC A;  1KQ0 A;  1BIA A;  2QEN A;  1QPM A;  2A68 F;  1YTY A;  2IRF G;  4MNU A;  1W5T A;  4A6E A;  1MJB A;  4L0Y B;  3DV8 A;  3R0A A;  3P9I A;  1RUN A;  4M9S A;  5IT9 Z;  1JHH A;  1G3W A;  1XD7 A;  3ECH A;  2IP2 A;  1BOA A;  3HHH A;  1YS6 A;  4IJA A;  1XSX A;  2V1D A;  1RNL A;  3ZMD A;  1CF7 A;  5AIQ A;  4BHP A;  4NQW A;  3WTY C;  2NNN A;  4L0Z B;  2WC2 A;  2MA3 A;  1U2W A;  4HA8 A;  5JFR A;  3TO6 A;  3REO A;  2LF7 A;  4GO1 A;  4NB5 A;  5FB2 A;  2F5E A;  5IT9 K;  2BEO A;  4IRG A;  2VBY A;  1YQA A;  5L3E A;  3KE2 A;  2VC1 A;  3W6K B;  1FP1 D;  4HW0 A;  4HQM A;  2X4H A;  5TJJ A;  1FBS A;  1F1Z A;  1ZGA A;  5FO5 A;  2Z33 A;  3C7J A;  2LSO A;  5D4S A;  2O3F A;  4A0X A;  3LA3 A;  4R8H A;  3M8F A;  3QU3 A;  2M8E A;  3T8R A;  3CUQ B;  1U6G A;  1O3S A;  1W7P B;  2YPR A;  4YFN F;  3V7C A;  5HLH A;  3ZN0 A;  4EVI A;  2HKO A;  1D8K A;  1NHA A;  3DXJ F;  3J7A O;  4OIR F;  2LKP A;  3WE3 A;  5L3F A;  1G4D A;  4MQV A;  5D5U B;  5ERI A;  3OOP A;  3ZMT A;  1LDK B;  3IC7 A;  1B1B A;  2EFP A;  5CVR A;  3BP8 A;  3KLN A;  3FM5 A;  4RS8 A;  4U0W A;  4XLP F;  2CQK A;  2EFN A;  1CGP A;  1IW7 F;  2PG4 A;  3IKV A;  1S6L A;  1XGM A;  4IRI A;  2H27 A;  2IJL A;  2K4B A;  3T8T A;  4DNC A;  3FMQ A;  2HYG D;  1YFH A;  1T0F A;  3R60 A;  4G6Q A;  3WGH A;  2EJR A;  3SZT A;  1OMI A;  2OZU A;  3GYH X;  3QU6 A;  2FOK A;  2STT A;  4K2E A;  1BBY A;  3EUH A;  4Q48 A;  1B4A A;  2VOD A;  4I01 A;  1FBQ A;  4FX4 A;  4ESB A;  1UCR A;  1T38 A;  4WXH A;  4EJU A;  1LVA A;  4BH9 A;  5LBQ A;  2FU4 A;  1F5T A;  4A0Z A;  1DPR A;  1RZ4 A;  1KYW A;  3HHG A;  4N0B A;  3D5L A;  2GZW A;  2DFI A;  3MQ0 A;  4KMU X;  3WU0 A;  1GXP A;  4FX0 A;  2PQ8 A;  2Z5U A;  3G3Z A;  4ESJ A;  1I1G A;  1RI7 A;  4ENM A;  4N9I A;  4M72 A;  2VE9 A;  1YS7 A;  3U2R A;  4EGZ A;  1EH7 A;  5ICF A;  3V8K A;  2A07 F;  4ENN A;  5EEH A;  2JT1 A;  4A6D A;  1XCV A;  4RGX A;  4IPA A;  3M9A A;  2P5L C;  1EV7 A;  2UWM A;  4HLX A;  3KP6 A;  1DUX C;  2DU9 A;  2HQN A;  3GFM A;  2LNB A;  1EH8 A;  1LJ9 A;  1OYI A;  2QWW A;  4MHG A;  1ZAR A;  1L3L A;  4RGU A;  2XKO A;  2BGC A;  2OBP A;  3GUD A;  5DCM A;  1FWZ A;  3ZMU A;  3HSE A;  1S29 A;  3HTS B;  3IKT A;  4M9Z A;  5A2Q Z;  4HX4 A;  5HDN A;  4CGZ A;  1Z7U A;  3F21 A;  2XAS A;  1HW1 A;  5BPD A;  1PDN C;  2ADU A;  1XDS A;  2XAJ A;  2W57 A;  3M7G A;  3RI4 A;  4ZYH A;  2XUB A;  5HVQ C;  3ERE D;  1BJA A;  5IT3 A;  2EFO A;  1U78 A;  5DDG A;  3RKW A;  1B6A A;  1WKM A;  2KIU A;  2NAZ A;  3FX3 A;  1KU7 A;  2E1N A;  4EMS A;  4WWC A;  5AIP A;  2OZ6 A;  4O6J A;  2ELH A;  3V7S A;  2F5D A;  1W7P D;  4L5I A;  4A12 A;  3GXO A;  3N97 A;  1R1U A;  2FE3 A;  2JSC A;  2RDP A;  3QP6 A;  5FLX K;  3TGN A;  4R1H A;  1TBX A;  1QBJ A;  4UV9 A;  2RKH A;  1BC8 C;  1YIO A;  5D5X B;  1O7F A;  3KP3 A;  1UST A;  4BHB A;  1IXS B;  4LLN A;  2HR3 A;  1I27 A;  4UVA A;  5KVR A;  3LWF A;  3I54 A;  1Z9C A;  2YX4 A;  5BMZ A;  4P9U A;  2H94 A;  3BY6 A;  3GWZ A;  2ISY A;  3Q5F A;  3E5U A;  4ETS A;  4HF2 A;  4BHC A;  2G7H A;  1E17 A;  1FNN A;  4UVC A;  5ICC A;  4EJT A;  2IW5 A;  4EQQ A;  4MTE A;  1RUO A;  2OA4 A;  1ON2 A;  4HDV A;  2O61 A;  4HZF A;  1MZB A;  2VOO A;  3DKW A;  1IUY A;  3K69 A;  2V1X A;  1AWC A;  3U1D A;  3F6V A;  2Y0M A;  2EFQ A;  3RPQ A;  3P9C A;  2DPU A;  1XCB A;  2QZ8 A;  1Z6R A;  3C3W A;  3CUQ A;  1MGT A;  1IRG A;  4EJW A;  3C1D A;  2IA1 A;  1T6S A;  1MJA A;  1MDM A;  1XGO A;  2PMH A;  3TQN A;  4KIG A;  3QPH A;  5FFZ A;  4DQ2 A;  4HLY A;  2FBI A;  3AAF A;  2QVO A;  1HBX G;  1TQI A;  1R5H A;  3GFJ A;  3EYI A;  1S7A A;  3WGG A;  2XVC A;  2W84 A;  2L54 A;  2KIF A;  2ZBK A;  4YII A;  3CUO A;  1TW2 A;  5E8I A;  2ZNZ A;  2L01 A;  2VBZ A;  3R6S A;  2VT2 A;  3RKY A;  2VBX A;  3TOB A;  2FNA A;  3J81 K;  1U5T A;  5K5O A;  4L9J A;  3CO7 C;  4UHT A;  1FPQ A;  3BZ6 A;  4MEX F;  1BN5 A;  3LA7 A;  5HLI A;  2BBY A;  2K7L A;  1BI2 A;  2QBY A;  2QQ9 A;  4OIO F;  4AWX B;  4M9X A;  1JXS A;  5DV5 A;  1KGS A;  4BXU A;  2LDU A;  5DCF A;  1IXR C;  1FOK A;  3TOA A;  1PUE E;  5LRS A;  2J5P A;  5CVU A;  2L4M A;  2ZJ2 A;  2CG4 A;  2XAF A;  4HV6 A;  5HOO A;  5CLS A;  3TDU C;  1SFE A;  2ETH A;  2A3S A;  3WU1 B;  4AD9 A;  3LQQ A;  3IWZ A;  4M6Y A;  1ZRD A;  2G9W A;  1FC3 A;  1KQ8 A;  2HZT A;  3GX4 X;  4LLL A;  1WSU A;  1HKS A;  1T2K A;  2RVC A;  2DQR A;  2VN2 A;  1ZYR F;  2O03 A;  1P4W A;  3IRR A;  2OD5 A;  4YFX F;  1SFU A;  2RN7 A;  3HYI A;  3K9T A;  5CVJ A;  4ASN A;  2DO7 A;  3SQN A;  3FF5 A;  1EH6 A;  4YFK F;  2XRN A;  2CO5 A;  1OYW A;  4UUV A;  4EGY A;  1WRJ A;  2QQA A;  2YX7 A;  2VXZ A;  4AIH A;  2H09 A;  1JHF A;  3WTW C;  4CHU A;  3LQR A;  2MLG A;  1R7J A;  2KKO A;  5F64 A;  3TO7 A;  3B02 A;  1BIB A;  4I02 A;  2J5O A;  4I7H A;  2YU3 A;  5BQT A;  3GFI A;  1Z6T A;  3WTV C;  1O57 A;  1ZGJ A;  3KP2 A;  4L5J A;  1I6X A;  4L9N A;  3BDD A;  5J8C A;  1HKQ A;  1TLH B;  4G7H F;  2FBK A;  3ECO A;  4HV5 A;  2PN6 A;  2EB7 A;  1C0W A;  3HOT A;  4NHJ A;  3FXQ A;  1U3E M;  3COA C;  3CO6 C;  2V1U A;  1J5Y A;  3EET A;  3Q9S A;  3KEQ A;  3W6J B;  2ZCW A;  3J80 Z;  3IRQ A;  1QGP A;  4L9T A;  1SD5 A;  4OMY A;  2AXL A;  5JVT A;  4QLC U;  2IT0 A;  4RB0 A;  4JBA A;  5LGT A;  2L02 A;  2QBY B;  3G73 A;  3N4M A;  3FMS A;  1ZRE A;  3K0L A;  2IVM A;  4XSX F;  4U0Y A;  1H0M A;  1HQC A;  2EK5 A;  3ABU A;  2P8T A;  2D2W A;  1YW8 A;  2V79 A;  2GXG A;  1U8R A;  2HWV A;  1REP C;  5BOX A;  5ICG A;  1K78 A;  1KU3 A;  4EJO A;  4I0B A;  3ZN1 A;  3VEP A;  3HRS A;  2K02 A;  4GYI A;  1IAW A;  3BJA A;  3E5X A;  1YO5 C;  1J59 A;  2RC4 A;  4KIB A;  2K27 A;  3QPT A;  4RGS A;  3KP4 A;  3NRV A;  1QQI A;  5D8L B;  4H0E A;  5ILU A;  3HOS A;  3VOD A;  1TTY A;  4KIF A;  1TNT A;  3E5Q A;  4OU0 A;  4CYD A;  1XDU A;  3T5X A;  2EA2 A;  3WTU C;  3HUG A;  5J6X A;  3JTG A;  2JZY A;  3ZMZ A;  1BC7 C;  2EV5 A;  4RAY A;  3RYR A;  4XSZ F;  5HDK A;  1YYV A;  3E6B A;  4P5O A;  4ENJ A;  2R3S A;  1Z91 A;  3ISP A;  5H6Q A;  4D0P A;  2D1V A;  3I5U A;  4M6X A;  2UXX A;  2PJP A;  3QOP A;  5K1Y A;  5DD4 A;  3H3U A;  2D45 A;  1V4R A;  3CDH A;  2XKP A;  2BYV E;  5CVV A;  1ULY A;  1TNS A;  3LA2 A;  4LJZ F;  3F8N A;  4BNC A;  2ISZ A;  2Q8K A;  5EEG A;  4IHT A;  3I64 A;  2XHK A;  2BE5 F;  4I2O A;  2BV6 A;  2P5K A;  4B8X A;  2CWE A;  4ESF A;  1PP8 F;  3OV8 A;  1R58 A;  1O7L A;  1DP7 P;  3RYP A;  4M73 A;  2UXN A; 
#chains in the Genus database with same CATH topology
 2Y30 A;  3E6D A;  3H0G J;  1B72 B;  2DA2 A;  1LE8 A;  1A5J A;  1G6N A;  1VQO I;  1V5F A;  5F1R A;  1QO0 D;  1X3W B;  1G2H A;  3WOD F;  3H5A A;  2OTL I;  2K86 A;  3B73 A;  4IO9 F;  4HPQ A;  5FKM A;  5F0F A;  3HBL A;  1U5T C;  1HW2 A;  2VQG A;  4LD5 A;  2NRA C;  1FT9 A;  2RNJ A;  2HYF A;  3CC7 I;  2DTZ A;  1OQY A;  3LFK A;  2CGP A;  3CCY A;  3DP7 A;  3GO5 A;  3Q0V A;  1TL8 A;  1E3H A;  4KN4 X;  4AIJ A;  3V7R A;  1GV5 A;  4AVZ A;  3KZZ A;  1U0J A;  1A35 A;  2FF4 A;  2CYY A;  1I5Z A;  4M71 A;  2DMT A;  3K1M A;  2VQL A;  3M1E A;  4A5M A;  3K4L A;  3P5J A;  4N9H A;  1SD6 A;  3FM3 A;  4RB1 A;  3S8P A;  4BDY A;  5LEK A;  5B66 C;  3E3V A;  2HOS A;  1BR1 A;  1T56 A;  5EJC A;  2DI3 A;  3GFL A;  4BXX J;  1V3F A;  2FQ3 A;  4G94 A;  4B43 A;  1JTY A;  1QZZ A;  3E6C C;  1MDM B;  2Z99 A;  3JRC A;  2ACJ A;  1WJF A;  4A3I J;  2O6G E;  2STW A;  1DQU A;  2MLK A;  2WV0 A;  2R7W A;  3UNG C;  1VF9 A;  3DU5 A;  5HNF A;  2BY1 A;  2X6O A;  2LH9 A;  1YJ9 I;  3WTZ A;  1LEA A;  1OKR A;  1S8N A;  4AVP A;  3OSG A;  2CSO A;  3VSL A;  3AL0 B;  2DT5 A;  3SFZ A;  1P4A A;  2L0K A;  3PSF A;  4O3M A;  5HS8 A;  2Y48 A;  3HPH A;  2Q2E A;  2B0L A;  2MD0 A;  4Z2Y A;  2FEZ A;  5JI6 A;  4KT5 C;  2K9Q A;  4P55 A;  4XKV A;  4FTH A;  1I1S A;  1TWF J;  4EM0 B;  1NTC A;  1O3Q A;  4A3M J;  2HFH A;  4A69 C;  3KPH A;  3E0J B;  4LOC A;  4G8X A;  2YR2 A;  5E1W A;  2P81 A;  2GA1 A;  2DAO A;  4II3 A;  3JAM Z;  3BJO A;  3NAR A;  1FLI A;  1VI0 A;  1D5V A;  1ZG1 A;  1HSJ A;  4UXN A;  3KZI C;  3T0Y A;  4CUG A;  1BI3 A;  3IAM 2;  3AG1 H;  1KU2 A;  2KRC A;  3G1O A;  1YLF A;  1YOV B;  2EFW A;  1IRF A;  2JQ7 A;  1B8I B;  3SXY A;  5ILV A;  3SEQ A;  4U7B A;  1P2F A;  2MSY A;  4LK1 F;  4XLC A;  4XLA A;  2RAE A;  5TGT A;  3WTT C;  4C3J J;  1P6R A;  3JAM K;  1WGX A;  3H5N A;  3QYF A;  1BR2 A;  2R5Y A;  1J7K A;  2I5U A;  2O0Y A;  3V4G A;  1G59 A;  1N25 A;  1BOB A;  2MAB A;  5FRM A;  4BJ5 C;  3SFI A;  3BZC A;  3RKX A;  4S04 A;  3IHU A;  2BOL A;  4F55 A;  2HOE A;  2CFX A;  1E3P A;  3TED A;  3ZP5 A;  1STZ A;  2F5C A;  4L18 B;  1UHM A;  2V7F A;  4OIN F;  1KZH A;  3PQJ A;  2NXN B;  4BJ6 C;  2A61 A;  2WWY A;  1LEB A;  3PFI A;  3LSP A;  1LPQ A;  1ERD A;  3O3K A;  3OR2 C;  4M3B A;  2CUJ A;  3FMR A;  1HDD C;  3MCZ A;  2VBW A;  1UG2 A;  4WX9 A;  2ELK A;  2JK3 A;  3HSR A;  2Y0S A;  3H92 A;  2H6C A;  3PNV A;  4Y17 A;  1PUF B;  1APL C;  4IXA A;  2A6H F;  4KMF A;  5K5R A;  4NC8 A;  4XMY A;  4Y33 A;  2EIL H;  2HPM A;  4IF4 A;  2MFZ A;  1D0Z A;  3P9K A;  3BG6 A;  4C2T A;  4HDU A;  2PMU A;  2CV1 A;  2BZT A;  2FA5 A;  3MWM A;  3PJR A;  3ML6 A;  2HQ5 A;  2CH0 A;  5FFX A;  3TL4 X;  2JA8 J;  4A5N A;  4UV8 A;  3G71 I;  1Y0N A;  4U88 A;  5DUK A;  3H0D A;  4ANJ A;  4CA0 A;  2EIM H;  2BY3 A;  5M3F J;  3Q3S A;  4RM2 A;  3IP4 B;  4IHW A;  1B59 A;  3Q9V A;  3G2B A;  2HTJ A;  1R5G A;  4UVB A;  1YIJ I;  3L2W A;  2OUM A;  5E20 A;  4ZTJ A;  1GVD A;  2NYX A;  4WXD A;  4LG0 A;  3TDZ C;  2QF7 A;  2KRF A;  4FQG A;  3HEF A;  3DBR B;  4ZYG A;  5J1R A;  1SFK A;  1YG2 A;  1K78 B;  5HNH A;  5D6E A;  5K7Z A;  2BHY A;  5F0H A;  1YJW I;  2PX9 A;  1QVT A;  1SD7 A;  3WGI A;  4BBR J;  3K70 C;  4F7Z A;  5FLX Z;  3F9K A;  3LSR A;  3O6B B;  4KUM A;  2X1C A;  1R1T A;  4O5V A;  2QKM B;  2EPF A;  4ZH4 F;  1OCO H;  2DA7 A;  3K1N A;  4P1W A;  3HZJ A;  3PM1 A;  3EDP A;  3DF8 A;  3EQL F;  2K85 A;  3LL7 A;  1MIJ A;  1XMK A;  4YIF A;  1H9T A;  1HW5 A;  2YUS A;  5FGM A;  3QAH A;  2R7U A;  2DFF A;  2A5Y B;  3PL8 A;  4XQF A;  2M8G X;  3HTU A;  2ZKZ A;  1MNM C;  2COM A;  2HEO A;  4E70 A;  2RQQ A;  4QIW N;  4NDL A;  3JR9 A;  4KA4 A;  3ZMS A;  2NS0 A;  2VL8 A;  5CVI A;  4MFE A;  2XPU A;  1WJ5 A;  3L2U A;  3VB2 A;  2VC0 A;  3R61 A;  2HTS A;  2X6X A;  3A4C A;  1W5C C;  3CCV I;  1ZRC A;  5LEJ A;  2XAH A;  4LLG F;  4KIT B;  3HRM A;  2L9N A;  2GAU A;  2XPW A;  3I53 A;  5J47 A;  1EF4 A;  2EA4 A;  3GZ6 A;  4NBQ A;  4FHT A;  3OYF A;  2XF7 A;  2ESH A;  4BU2 A;  1MSE C;  5E1X A;  3BR5 A;  3CF5 F;  3CCM I;  2VE8 A;  2ZXH A;  3CMY A;  2EQR A;  2K3P A;  4LFU A;  4Z6Y A;  2DT7 B;  3MFK A;  4LIU A;  5E17 F;  3TO9 A;  3HXL A;  1IUF A;  2A69 F;  4WF2 A;  1F9N A;  2B63 J;  5M5X J;  2LYC A;  2WAE A;  5FD5 A;  4CZZ A;  3M4O J;  1ORK A;  2MH2 A;  2XSD C;  5AON A;  2W1O A;  3BPX A;  1IF1 A;  3F8C A;  4X1E A;  2HOA A;  3KCC A;  3W6V A;  2Z1D A;  2LG4 A;  3FWE A;  1GVJ A;  5GAE J;  2Z3Y A;  3CMA I;  2A5W A;  1JJ8 C;  4CCN A;  1GT0 C;  1IV6 A;  4HAM A;  2HDC A;  2BXY A;  2VOP A;  1YJN I;  3S2W A;  1DU6 A;  3G1M A;  4BYY A;  5LHG A;  1R1V A;  2BXZ A;  4JX6 A;  1LDJ A;  3J81 Z;  2AS5 F;  3ASN H;  4CYC A;  4MGR A;  1TQP A;  4HG2 A;  4G7O F;  5H6R A;  1W4M A;  5DUI A;  2M30 A;  2JTV A;  4KFC A;  1FMV A;  4EM1 A;  2DW4 A;  5FKN A;  3K1P A;  3DQV C;  3PUB A;  1Y1V J;  1ZH5 A;  2CV0 A;  2HYJ A;  4KNY A;  2Y69 H;  2LC2 A;  1WVR A;  1JUM A;  3EUA A;  5LLQ A;  3JTH A;  1G3S A;  1O3R A;  3BJ6 A;  2P4W A;  1MMS A;  1YX3 A;  2QUF A;  3CDI A;  2HPI A;  4D5F A;  3HOZ J;  2ZXI A;  2DYR H;  2DA3 A;  4E7K A;  1G8X A;  1T0F C;  3MZ8 A;  4GGG A;  2RNG A;  1MMG A;  3LNQ A;  3PFY A;  5F6F A;  3RZD J;  2OQG A;  4BBS J;  1UEL B;  4B09 A;  4LMY A;  2R7V A;  2MH9 A;  2K9L A;  2FXA A;  2QYO A;  4KN7 X;  1GXQ A;  1U8B A;  1WQ2 A;  2WTE A;  4AM3 A;  2ZNY A;  1FOW A;  1W5S A;  1ETY A;  2XAQ A;  2HQA A;  3GZN B;  3C2H A;  4ZYD A;  2EWN A;  2RQP A;  2XGX A;  4LB6 B;  1VZ0 A;  5CJ9 A;  3K70 D;  1LQ1 A;  2M45 A;  1FBU A;  3K2A A;  4PGG A;  4XON A;  2X0L A;  2Y75 A;  3MEX A;  1ETW A;  2BW3 B;  2P5V A;  1QRY A;  2VJI A;  2KJC A;  1DDN A;  4QWQ A;  2FMY A;  2EZL A;  2OCC H;  2V6C A;  3HL2 A;  3ZCO A;  2KL4 A;  5L3D A;  4XRF A;  3DKY A;  3J80 K;  3FKJ A;  2JPB A;  3H9G A;  1Q1H A;  5EYR A;  4R79 A;  2M9H A;  1VQP I;  1SAX A;  5E3N A;  1Z05 A;  4M3G A;  3OYE A;  3VDX A;  1NH3 A;  4I09 A;  2QLZ A;  4ZZD A;  3GEZ A;  4UNO A;  1N77 A;  5KAI C;  3UR3 C;  5F04 A;  1R23 A;  1MNE A;  2XAG A;  3L7W A;  1X58 A;  3I0T A;  5EGO B;  4CIC A;  1AOY A;  3ABT A;  2L4A A;  1MH3 A;  3QYE A;  3GME A;  4RAZ A;  5L3G A;  4RB3 C;  1E0E A;  5HLT A;  3K4C A;  4ZDL A;  3K4N A;  5E18 F;  5E1Z B;  4MLO A;  3S93 A;  2KIM A;  2XV4 S;  3KEO A;  1JKQ C;  1QHG A;  4YIR X;  3PSI A;  3BRO A;  3BTJ A;  4ITV A;  1GDT A;  2ZJQ F;  1R36 A;  1YW7 A;  3L9F A;  1BI1 A;  3K7A J;  4MQ9 F;  3DCF A;  5EZG A;  3CUQ C;  1SMT A;  3O2P E;  2M1B A;  2WBM A;  2R5Y B;  1HXD A;  4FET A;  3PO3 J;  3I58 A;  3VWB A;  5IYD J;  2KPM A;  2M4G A;  2V4J C;  3DPL C;  3GLX A;  3I59 A;  2DTR A;  2K4J A;  2M5W A;  3KP5 A;  4B44 A;  1EKE A;  1JGS A;  3V8J A;  4M3F A;  5DYM A;  5JHU A;  1FZP B;  4E7S A;  3RIR A;  2P7V B;  4OIP F;  4LIT A;  3KIO A;  5EG0 A;  1UHW A;  3F3X A;  5J1Y A;  4XM3 A;  4HF0 A;  4RBO A;  2C6Y A;  3ZQC A;  2IXS A;  1X19 A;  4XR6 A;  4BAC A;  2E7W A;  3EYY A;  4JOM A;  3AKZ A;  1Y56 A;  4A3D J;  2XIG A;  3BWG A;  1IV8 A;  3V8L A;  3OYD A;  5ICE A;  3HM5 A;  1MD0 A;  2OQR A;  4P9F A;  2M87 A;  3MVP A;  2GLO A;  1UFM A;  2Y2Z A;  5FD6 A;  4XN0 A;  4DBQ A;  4B3A A;  2O7O A;  4E7I A;  3QYB A;  1Y1W J;  4BQA A;  2G7U A;  1FSE A;  1A31 A;  1YRN A;  1R00 A;  4B48 A;  3U9G A;  1ONV A;  3MMY B;  2R4G A;  4HX8 A;  4B47 A;  3OY9 A;  3Q0W A;  1SFX A;  1LE8 B;  3EPZ A;  1KU9 A;  3CDL A;  4PDK A;  3C2G A;  1HKT A;  2CQN A;  3PQK A;  1A04 A;  2AHQ A;  3S2H J;  2L5Q A;  4BKX A;  5LRR A;  1X1A A;  2Q1Z B;  3F0C A;  3DLL F;  4KDP A;  2ZJP F;  2F6C A;  1MBE A;  3CMM A;  3SHF A;  3HKZ N;  3ZOB A;  4E6K G;  1BA5 A;  3S2D J;  4I98 B;  4CCK A;  4JX5 A;  5IY5 H;  3HRU A;  2P7C B;  3FXR A;  2VON A;  1Z67 A;  2BHZ A;  3CJT B;  1V5E A;  1XTA A;  3I3L A;  2VIX A;  4D5C A;  4WCG A;  3S1N J;  4A2U A;  3QP5 A;  4HYE A;  2HI3 A;  3KLO A;  3ONQ A;  4ZYE A;  4PGH A;  2A6E F;  3GVA A;  1LFP A;  3BG5 A;  5KK1 A;  4HNT A;  1X3U A;  2E5N A;  3CF2 A;  3DEU A;  4XLF A;  4HOB A;  1FIA A;  4H4K C;  1MMD A;  4E4H A;  4JK1 X;  2DOE A;  2LR8 A;  3SDG A;  2R7F A;  5K7F A;  2L7F P;  2PI0 A;  3KFW X;  5D6F A;  4IX7 A;  2ZME A;  2EH3 A;  4D7M A;  1OYY A;  2HS5 A;  3FXU A;  2HU9 A;  2PEX A;  3NWS A;  1Z1D A;  2FSW A;  5TRD A;  2IA0 A;  2DDA A;  4U7D A;  5DCM B;  2ZME B;  1P4X A;  3I71 A;  3L00 A;  4WXC A;  1WH5 A;  3R4K A;  4IOC F;  5DD8 A;  4CXF A;  1TT5 B;  2MBF A;  4DGW B;  3HOX J;  3NQO A;  3VYS B;  4KYW A;  2E1C A;  2IS6 A;  3UKG A;  2V1N A;  1FX7 A;  2FBH A;  1R22 A;  3H3V K;  4LGW A;  1IDZ A;  1QVU A;  4DYQ A;  5IP6 A;  3KP7 A;  1IC8 A;  2V9P A;  1VQM I;  2LBF B;  3DBH B;  4WK8 F;  5FRN A;  5HOD A;  2X51 A;  3BC8 A;  3D0S A;  1H9G A;  2E2H J;  4RB2 C;  2W82 A;  3DFG A;  2DPD A;  4YG2 F;  4ZZL A;  4XOP A;  1F4K A;  3HIF A;  4TV7 A;  1U9N A;  1S3J A;  4RA2 A;  1D1B A;  2H8R A;  2PJR B;  1P9Q C;  3KZY A;  2KJB A;  5F1J A;  3PO2 J;  5D8K B;  2IS4 A;  4B4C A;  1NK3 P;  3I4N J;  1RIO H;  1BM9 A;  1J9I A;  5FJ8 J;  3F8M A;  3RJP A;  3U21 A;  4GDF A;  2NNY A;  2K9N A;  5EDN A;  2M3A A;  1OCR H;  1K79 A;  1FTZ A;  2PFB A;  4W97 A;  1MMN A;  3WHB A;  3ZR8 X;  3RPU A;  3HG9 A;  1USS A;  1D1C A;  3QWL A;  1V55 H;  3MZY A;  4I99 C;  2CW8 A;  1D3Y A;  1ETO A;  1ON1 A;  3GTK J;  1UHS A;  2PBI A;  3FXO A;  1FYL A;  3LMM A;  4MO7 A;  2ZXJ A;  2JPC A;  1BJZ A;  1U9O A;  4KJZ A;  4I76 A;  5HS9 A;  1RRJ A;  1KQ9 A;  4XOT A;  4HX7 A;  2XRL A;  4FE7 A;  3BQY A;  2MD5 A;  1SMY F;  4ZDO A;  4FAS D;  2W4S A;  4Q4Z F;  3L2C A;  1D5Y A;  2DOF A;  4EM2 A;  4B3X A;  5CYV A;  3CD6 I;  4MEY F;  1J2X A;  1G3T A;  1HOM A;  4PJN A;  3RTR A;  3IWF A;  2DMP A;  2CW0 F;  2KFD A;  2DQL A;  2W24 A;  5ED4 A;  1JJ6 C;  1SFO J;  3E97 A;  3ZQG A;  3H5R A;  2V9K A;  3QRF F;  3ERM A;  2FQ4 A;  3CP2 A;  2LD5 A;  4B1R A;  5LHH A;  1D0Y A;  2NOJ B;  1P7J A;  2EZI A;  1X1B A;  3FK6 A;  1B72 A;  1ETX A;  3S1M J;  2NS8 A;  2LKS A;  1XS9 A;  3M8E A;  3IUO A;  2ECC A;  4IQJ A;  4LK0 F;  1ITY A;  4ON0 A;  1OPC A;  5K5Q A;  4YRV A;  1ZLK A;  5E79 C;  5BPI A;  1FIP A;  2DK5 A;  4PSX A;  2QSF X;  3WHC A;  1ZR4 A;  1I39 A;  2W00 A;  3F8F A;  1Y0U A;  2DBB A;  4YEL A;  4RGR A;  2VT3 A;  3OYJ A;  3ROU A;  2OAZ A;  4HQE A;  1RC9 A;  2LKX A;  2KIS A;  5L3C A;  1VQL I;  5E8G A;  3D5R C;  4LB5 A;  2DA5 A;  1FYM A;  1MKM A;  3GTM J;  1VTN C;  1UB9 A;  5H20 A;  3ZQH A;  3BLY A;  3W2V A;  1FOY A;  1DU0 A;  4CZC A;  2V6E A;  3H9Q A;  3ZQ7 A;  2O8X A;  4PJM A;  4OIQ F;  2LK2 A;  3FZV A;  1VQ5 I;  1GLN A;  2QSH X;  3KX2 A;  1SD4 A;  1XGN A;  1LNW A;  3FXK A;  3A01 A;  1XX5 A;  3H3Z A;  3W3C A;  9ANT A;  4ENK A;  2EV0 A;  4EJV A;  2OU2 A;  1ZAO A;  5IOZ A;  1BW5 A;  1IN7 A;  1RES A;  1Z7L A;  4G6D A;  3HGY A;  1G3Y A;  3E6M A;  2D5V A;  3F72 A;  2KHM A;  3KYD B;  1U5T B;  2QQB A;  1D8J A;  4GRI A;  1QNT A;  2ID6 A;  3OR1 C;  4MTD A;  3CP8 A;  3R0J A;  3JRF A;  4AID A;  4D9J A;  2R7Z J;  1FSH A;  3KET A;  2K3F A;  2ZJR F;  2D1H A;  1ZN2 A;  1B9M A;  1Y6I A;  2FX0 A;  1VQ7 I;  3FXJ A;  2F2E A;  2R7D A;  1QZE A;  2V9V A;  3M3Y J;  2JVH A;  2VPR A;  4LIV A;  3BG7 A;  1O3T A;  3HOU J;  1I6H J;  4C3H J;  4BEH A;  4QSH A;  6PAX A;  3BTC A;  3WTS C;  2JUC A;  1B9N A;  1TT0 A;  4CO8 A;  4CYC B;  1LFU P;  2OC6 A;  3VOE A;  3RDI A;  3OYN A;  2CS3 A;  5IYB J;  3MKW B;  2PLY A;  2ICW G;  3ABK H;  5DTD A;  5J8F A;  4CSW A;  1DPU A;  1HST A;  2M0C A;  3BR6 A;  2MC3 A;  5D5V B;  2X48 A;  3DPU A;  1V54 H;  3I59 B;  1ODD A;  3P7N A;  1R71 A;  1ZG5 A;  4XBF A;  3ZMV A;  4IVN A;  4PCQ A;  2GA2 A;  1XN7 A;  2DK8 A;  4OMZ A;  2RV8 A;  1TQM A;  5ILS A;  2XGC A;  5C44 J;  3BOQ A;  4NUB A;  3SEZ A;  3CCL I;  2P6T A;  5EG0 B;  1XMA A;  1VND A;  3T1B A;  3DPT A;  2IPQ X;  2M4K A;  4S05 A;  3PIP F;  1S7O A;  2B7E A;  3OIO A;  1FYK A;  5FLV A;  2L3D A;  3BG9 A;  1J0R A;  1FP2 A;  4CDG A;  3JSP A;  3C18 A;  3LST A;  4OAZ A;  2R5Z A;  1K6O A;  1YX5 A;  2FML A;  3NEU A;  3HRT A;  4GCV A;  2QM3 A;  5HS7 A;  3CJQ B;  4G12 A;  2CFO A;  2VQH A;  3MKZ A;  3OYM A;  2GM4 A;  2R7X A;  2VJ5 A;  4HBL A;  4EV0 A;  4IHS A;  2R0Q C;  1NG7 A;  2Y31 A;  4XKB A;  5LHI A;  3J7Z I;  4ZYA A;  3EUK L;  4J19 A;  4IRH A;  1MBG A;  3JSO A;  3ZPL A;  1T98 A;  3BZK A;  1WI9 A;  2GWR A;  2JRT A;  3K4J A;  1IN6 A;  1OCZ H;  2KDZ A;  2F5F A;  3SZP A;  1TW3 A;  1E2X A;  1IN8 A;  2DLL A;  4U0V A;  3F23 A;  2Y0S N;  3OYK A;  2MG4 A;  4C9Y A;  4BY7 J;  1YW9 A;  4GXO A;  3MAJ A;  5GAH J;  2LF8 A;  1OR7 A;  2NVY J;  3WE2 A;  1P92 A;  3FHZ A;  3K4B A;  3BTL A;  1XSD A;  4DYC A;  5DEQ A;  5BS6 A;  2E60 A;  1OCT C;  2JUG A;  4Q5S F;  2EIK H;  2LRD A;  3VPR A;  2W25 A;  2ZFW A;  3ELK A;  5D4R A;  5FKL A;  3GBG A;  3OYI A;  2YSR A;  1WI3 A;  3ULQ B;  4Q47 A;  2HGC A;  5LGN A;  3IL2 A;  2HKX A;  3CJN A;  1XC5 A;  3DBL B;  2VXD A;  1T33 A;  4A3G J;  5GAG J;  2ZO4 A;  5M5Y J;  3MZH A;  5GAD J;  2LRE A;  2XF6 A;  2CQX A;  4IHX A;  2OTJ I;  4JYK A;  4Y15 A;  1IN5 A;  3LSH A;  2KZV A;  4EEF G;  3I56 I;  5B5E C;  3AL0 C;  1ZG3 A;  2FNP A;  3BR3 A;  4I0A A;  2GQQ A;  2ZB9 A;  2JMW A;  2IGN A;  2GIV A;  3FXM A;  3HOV J;  4OWR B;  2ESN A;  3LAJ A;  3I4P A;  1XGS A;  2WA0 A;  4G7Z F;  3LAP A;  3OIQ A;  2B9S A;  1TWH J;  4L9V A;  3S17 J;  5JR3 A;  3BPV A;  1CF7 B;  4Y52 J;  2ECB A;  4BAY A;  4PFO A;  3PUF A;  3HSF A;  3DTK A;  1O4X A;  4QTR A;  1LDD A;  3HKZ A;  2AO9 A;  3KEY A;  1KA8 A;  4KIS A;  1WZ2 A;  4P96 A;  1NK2 P;  1H89 C;  3JW4 A;  4HF1 A;  5EZH A;  1EJ9 A;  4XKW A;  2QEX I;  4A3F J;  2OF7 A;  5L3B A;  3GF2 A;  1LB2 A;  4XLN F;  3OYA A;  4PUS A;  1UZC A;  4OOI A;  1DGR M;  2YS9 A;  3K2Z A;  3OS0 A;  2E7X A;  1WFX A;  3TMO A;  4X0G A;  4PJL A;  2KMU A;  2WAD A;  4A0Y A;  4BL0 B;  1H8A C;  1VQ6 I;  5HLG A;  4ZJZ A;  2NVX J;  1XSV A;  4GYG A;  3IAS 2;  3A02 A;  1TZL A;  1DGW Y;  4XRS G;  1ZRF A;  4LG0 B;  1IN4 A;  2RRE A;  3PNY A;  4Y13 A;  1IXC A;  3NWT A;  3WTX C;  4IEJ A;  1KYZ A;  3CME I;  1PP7 U;  5D5W B;  1BI0 A;  2HQR A;  2JJ7 A;  3KYC B;  4PZJ A;  1ZHF A;  1SAN A;  2LY1 A;  1T08 B;  3VFZ A;  4E7L A;  1ZR2 A;  2UZK A;  4QPO A;  1WWX A;  4IOA F;  3PIO F;  1K7A A;  2H6B A;  2M2E A;  3CLO A;  4BE0 A;  5LD2 C;  3F6O A;  2CQ7 A;  5A2Q K;  2IA2 A;  4D7N A;  2WAQ N;  3WG9 A;  5J40 A;  1GHC A;  2DOD A;  1JT6 A;  3S3M A;  1OLT A;  3VYU B;  1XB4 A;  4C2U A;  1QA6 A;  3L1P A;  1GV2 A;  2CV2 A;  4BXF A;  3GZ5 A;  3TKY A;  4G9Y A;  2FRH A;  1RR8 C;  4FT8 A;  2TDX A;  4CCO A;  2P6S A;  3F8B A;  1ZLJ A;  2XRO A;  3B6C A;  1JE8 A;  3L09 A;  2GXB A;  4BJT A;  1IDY A;  2QA4 I;  1L0O C;  2Z9O A;  1Z3X A;  2Q0O A;  2W85 A;  4JQF A;  5C4X J;  2VKV A;  4M74 A;  1X1D A;  1J75 A;  2JWT A;  2RGV A;  1MJ9 A;  3CTA A;  5HDG A;  3GW2 A;  1WHU A;  4DZP A;  4AIK A;  1W7P A;  2I10 A;  1QZY A;  1T39 A;  2BW3 A;  1FY7 A;  5LGU A;  3E7L A;  3F22 A;  1A36 A;  1IZ1 A;  2EV6 A;  2NVU B;  4CCL A;  1Z3Y A;  1QU3 A;  4KIC A;  1KQ0 A;  4N4N B;  1BIA A;  2M7B A;  2QEN A;  5FKK A;  2NVQ J;  1QPM A;  3U1K A;  4OAY A;  2A68 F;  3BG3 A;  2VI6 A;  1YTY A;  2BVL A;  3OMY A;  2IRF G;  4MNU A;  1W5T A;  4A6E A;  1H88 C;  1M1E B;  3DEE A;  1MJB A;  1K61 A;  4FCY A;  4L0Y B;  1NG6 A;  3DV8 A;  1SVO A;  2Y9Z A;  3R0A A;  3BCB A;  1AKH A;  4Y3O A;  1VQK I;  3MD2 A;  2BY0 A;  5KHD A;  3P9I A;  4BQQ A;  1RUN A;  4M9S A;  3D1N I;  5EGO A;  5IT9 Z;  1JHH A;  1G3W A;  1XD7 A;  4XRS A;  2JVG A;  1Y8R B;  2HDW A;  2XC7 A;  3ECH A;  2IP2 A;  1BOA A;  1UJ8 A;  3HHH A;  1YS6 A;  2FOW A;  2X1E A;  4IJA A;  2IBD A;  4PSW A;  1ACI A;  3CCQ I;  1JKO C;  3L2V A;  1XSX A;  2OPT A;  2V1D A;  1RNL A;  2KT0 A;  2LTP A;  1R49 A;  2I8D A;  2E71 A;  3BR1 A;  3ZMD A;  1F36 A;  1CF7 A;  2E2J J;  3HOW J;  2XF5 A;  5AIQ A;  4BHP A;  1ENH A;  4DIQ A;  1MND A;  3C2B A;  3HJE A;  4NQW A;  3WTY C;  4XK4 A;  1DP3 A;  2BVM A;  1A6Q A;  2KLO A;  2NNN A;  4L0Z B;  4DZJ A;  2WC2 A;  4A3B J;  4IHV A;  2MA3 A;  2XGE A;  4C3I J;  3BTI A;  4KT6 A;  1K4T A;  1U2W A;  3N05 A;  4HA8 A;  5JFR A;  3TO6 A;  3REO A;  2JA6 J;  2KIQ A;  1LFB A;  2LF7 A;  1WCM J;  1WJE A;  4GO1 A;  4NB5 A;  5FB2 A;  4F93 B;  4MFD A;  4PJ0 C;  2F5E A;  5IT9 K;  2BEO A;  3RKQ A;  4IRG A;  2VBY A;  2JA7 J;  1YQA A;  5L3E A;  5CKT A;  1AHD P;  3KE2 A;  2VQC A;  2VC1 A;  3FIS A;  3W6K B;  2IGO A;  2M34 A;  1FP1 D;  4HW0 A;  2HVS A;  4HQM A;  2X4H A;  3I9V 2;  5KCM A;  5TJJ A;  2WY8 Q;  2EZK A;  5GTI C;  1FBS A;  1F1Z A;  1ZGA A;  2CUF A;  3AG2 H;  5FO5 A;  3S32 A;  5J4Y A;  5EEA A;  3OYG A;  2HVQ A;  3JRI A;  2Z33 A;  2DA4 A;  1FEX A;  4UUS B;  3C7J A;  4BE1 A;  2LSO A;  4A3C J;  5D4S A;  4M3E A;  2O3F A;  4A0X A;  3LA3 A;  2DFH A;  1HLV A;  4R8H A;  3M8F A;  4PFP A;  4AC0 A;  3QU3 A;  3RCO A;  4NC6 A;  2M8E A;  3T8R A;  3CUQ B;  3JRA A;  4AYB A;  3ASO H;  1U6G A;  1O3S A;  1XMX A;  1OR7 C;  5E3M A;  1W7P B;  2YPR A;  4HST A;  3S3N A;  2LVS A;  4YFN F;  5GPC A;  3V7C A;  2E1M B;  5HLH A;  5M5W J;  3S1R J;  3K4M A;  3ZN0 A;  4EVI A;  2HKO A;  4E7Z A;  2ID3 A;  1D8K A;  1NHA A;  5IPA A;  3I4M J;  3DXJ F;  2F4O B;  2R5Z B;  3CQZ J;  1IGN A;  3J7A O;  2PMZ A;  2WB1 N;  4OIR F;  1W0U A;  2LKP A;  4GFB A;  2QKL B;  3WE3 A;  5L3F A;  1G4D A;  4MQV A;  5D5U B;  5ERI A;  3OOP A;  3ZQL A;  3E1S A;  3ZMT A;  4HSR A;  1LDK B;  3IC7 A;  3IH4 A;  2E34 A;  1B1B A;  1X4O A;  3JCU C;  2E5Z A;  2EFP A;  5CVR A;  1IG7 A;  2L9S A;  3BP8 A;  3KLN A;  3S15 J;  3FM5 A;  4RS8 A;  3HOY J;  2ELJ A;  4U0W A;  4XLP F;  2CQK A;  2EFN A;  3S3O A;  2K9M A;  3VYR B;  1CGP A;  1IW7 F;  2GBY A;  2PG4 A;  3JRG A;  2OJE D;  3IKV A;  1N75 A;  1S6L A;  1B8I A;  1XGM A;  2H27 A;  4IRI A;  2IJL A;  2K4B A;  3QOE A;  3T8T A;  4DNC A;  1S5L C;  2O9L A;  3GLL A;  3FMQ A;  2HYG D;  4IZZ A;  1VQ9 I;  4FE4 A;  3ABM H;  1ZGW A;  1K83 J;  1YFH A;  1T0F A;  3R60 A;  4G6Q A;  2ZSH B;  3WGH A;  1JKP C;  1TWA J;  2JRM A;  1J09 A;  2EJR A;  4RLQ A;  3O8G A;  3SZT A;  1T8I A;  1OMI A;  2OZU A;  1QHH D;  3DLA A;  2R7T A;  2XDV A;  3GYH X;  3QU6 A;  1HC8 A;  2FOK A;  3TP3 A;  2STT A;  5LFA A;  1OIS A;  4K2E A;  4NQW B;  5DM7 F;  4BEH B;  3D5S C;  1BBY A;  1POG A;  3EUH A;  1BL0 A;  4Q48 A;  1B4A A;  2VOD A;  4I01 A;  2EIN H;  1YRN B;  1FBQ A;  4E7H A;  4FX4 A;  4RMN A;  1T95 A;  4ESB A;  1UCR A;  2HZD A;  1T38 A;  4WXH A;  4EJU A;  1LVA A;  2R7O A;  4BH9 A;  1OJL A;  4BQO A;  5LBQ A;  4HNV A;  2VKD A;  1SVM A;  2FU4 A;  1F5T A;  4A0Z A;  1FJL A;  1DPR A;  1RZ4 A;  1KYW A;  3HHG A;  3CJR B;  4N0B A;  4YEJ A;  3D5L A;  2GZW A;  3G1L A;  2DFI A;  3MQ0 A;  4KMU X;  3WU0 A;  3GTO J;  1GXP A;  4FX0 A;  2PQ8 A;  1WJB A;  2Z5U A;  3G3Z A;  2H1L A;  1R4M B;  4ESJ A;  2VLA A;  1I1G A;  1Z0X A;  1PUF A;  1RI7 A;  1WJA A;  2G0E A;  4N9I A;  4ENM A;  1HF0 A;  2QGU A;  2VJ4 A;  4M72 A;  3IV5 A;  2AQF A;  2VE9 A;  1YS7 A;  3U2R A;  4EGZ A;  3ZRG A;  2DN0 A;  4DYR A;  1EH7 A;  3H35 A;  5ICF A;  3V8K A;  2A07 F;  5F27 A;  1LUJ B;  2GIZ A;  3HPG A;  5EEH A;  4ENN A;  3H36 A;  2JT1 A;  3VSK A;  1ETV A;  2HXI A;  1GUU A;  1OCP A;  3CCU I;  2Z16 A;  4A6D A;  1XCV A;  4RGX A;  3LOC A;  4IPA A;  3M9A A;  3JRH A;  1Z77 A;  2P5L C;  2VKH A;  3L2R A;  1EV7 A;  1HCR A;  2UWM A;  4BQN A;  1OFC X;  4HLX A;  3KP6 A;  1DUX C;  2DU9 A;  2HQN A;  3GFM A;  1ZEL A;  4DBR A;  2LNB A;  4XL9 A;  1EH8 A;  5B3S H;  2W48 A;  1LJ9 A;  1OYI A;  1TP4 A;  2QWW A;  1WJD A;  4I6Z A;  4MHG A;  1ZAR A;  3H9J A;  1L3L A;  4RGU A;  1MW7 A;  3LSG A;  2XKO A;  4A3L J;  2BGC A;  4UUS A;  2OBP A;  2DYS H;  3WG7 H;  3GUD A;  3MKL A;  5DCM A;  1FWZ A;  3ZMU A;  1AU7 A;  3JRD A;  4DOZ A;  3HSE A;  1S29 A;  3HTS B;  3W2A A;  3IKT A;  1YI2 I;  3VYT B;  2IGM A;  4M9Z A;  5A2Q Z;  1UAA A;  4HX4 A;  5HDN A;  4CGZ A;  5K7H A;  3Q0U A;  1Z7U A;  5CQG A;  2E19 A;  2L7K A;  3A0H C;  3F21 A;  2XAS A;  3A01 B;  1HW1 A;  5BPD A;  3KYL A;  1KON A;  4S0H B;  1PDN C;  2ADU A;  1ZKG A;  1XDS A;  2DA6 A;  3CLQ A;  3ESW B;  5F0C A;  2XAJ A;  4RAF A;  2W57 A;  4V2F A;  3M7G A;  1JUS A;  3RI4 A;  4RM3 A;  4ZYH A;  2XUB A;  5HVQ C;  3ZGK A;  3ERE D;  1BJA A;  2DOA A;  5IT3 A;  3CES A;  1WH7 A;  2EFO A;  1U78 A;  5DDG A;  3DTI A;  3DWL E;  2VB6 A;  3RKW A;  2VUM J;  1B6A A;  2CUE A;  2CJJ A;  5B1B H;  1WKM A;  2KIU A;  1D0X A;  2NAZ A;  3FX3 A;  3SZG A;  5IYC J;  2FJ1 A;  3CZ6 A;  1KU7 A;  2E1N A;  3HUG B;  4EMS A;  4WWC A;  5AIP A;  3JRB A;  2L9R A;  3FDY A;  4HRI A;  2OZ6 A;  5GTH C;  4II2 A;  2Q2E B;  2MW8 A;  4O6J A;  4DW6 A;  4A3K J;  2ELH A;  3V7S A;  1Q1V A;  2F5D A;  1W7P D;  2LP0 A;  1MMA A;  3GTP J;  4L5I A;  4LG3 A;  2EIJ H;  4A12 A;  5IP9 J;  5C4J J;  2L7M P;  1SC7 A;  2K40 A;  1TC3 C;  1S9H A;  3GXO A;  1W36 C;  1X2M A;  1XG1 A;  2DMU A;  3N97 A;  1R1U A;  5B1A H;  4XLH A;  3OYB A;  2FE3 A;  1X1C A;  2JSC A;  2RDP A;  3QP6 A;  5FLX K;  3TGN A;  4R1H A;  2KDO A;  1TBX A;  1QBJ A;  3L2Q A;  2MGQ A;  1ZK8 A;  4UV9 A;  3HC7 A;  4BGD A;  2RKH A;  5DM6 F;  1BC8 C;  1YIO A;  1RPW A;  2OCE A;  5D5X B;  1O7F A;  2JN6 A;  2KP6 A;  1F43 A;  2XSJ C;  1Y8Q B;  3KP3 A;  1UST A;  2A6T A;  3NAU A;  1IXS B;  4BHB A;  4XLE A;  2AXT C;  4LLN A;  2F4I A;  4RAG A;  2HR3 A;  1I27 A;  3OL3 A;  2NVT J;  1TWC J;  4UVA A;  5KVR A;  5JLW A;  1PJR A;  2X9D A;  2KZG A;  5E3O A;  3BCA A;  3LWF A;  1IRX A;  1AA7 A;  1JI8 A;  3I54 A;  1Z9C A;  4XID A;  2YX4 A;  2K9S A;  5BMZ A;  4P9U A;  2H94 A;  3BY6 A;  3GWZ A;  2ISY A;  1VQ4 I;  3Q5F A;  5CPR B;  3E5U A;  4ETS A;  4HF2 A;  4D1Q A;  1JTX A;  3OOU A;  2IS2 A;  4BHC A;  2G7H A;  2CRG A;  2E2I J;  1E17 A;  1FNN A;  4UVC A;  5ICC A;  4EJT A;  4FIS A;  2IW5 A;  2L2O A;  2DT6 A;  4EQQ A;  1FTT A;  1UMQ A;  1EA3 A;  4MTE A;  1RUO A;  2OA4 A;  4ZC3 A;  1ON2 A;  4HDV A;  2HDD A;  2O61 A;  3TP0 A;  1VQ8 I;  5JHF A;  4X6A J;  4HZF A;  3J7A Y;  4QPQ A;  4M6V A;  1MZB A;  2QCO A;  2VOO A;  3DKW A;  1IUY A;  1PYV A;  2XB0 X;  3HGG A;  3K69 A;  4XIC A;  3MN2 A;  2V1X A;  1AWC A;  2X1D A;  2HNH A;  3F6V A;  2Y0M A;  3U1D A;  4F3Q A;  2EFQ A;  2CUZ A;  3RPQ A;  3P9C A;  2DPU A;  1XCB A;  5BNG A;  2QZ8 A;  1Z6R A;  3C3W A;  3CUQ A;  1MGT A;  3WU2 C;  1IRG A;  4EJW A;  2X6W A;  1ETQ A;  1SAU A;  3C1D A;  2Z2S B;  2IA1 A;  3FBI B;  2LY9 A;  3LFU A;  1T6S A;  2IS1 A;  1MJA A;  1MDM A;  3CCE I;  1XGO A;  2PMH A;  2JA5 J;  3TQN A;  4KIG A;  4PK4 A;  3QPH A;  2COB A;  4RLF A;  5FFZ A;  4DQ2 A;  4HLY A;  1K4S A;  1JGG A;  2FBI A;  3HDD A;  3AAF A;  1SVL A;  2W7N A;  2QVO A;  1HBX G;  1HA8 A;  2L7Z A;  4A3E J;  1TQI A;  1R5H A;  3O8H A;  3GFJ A;  3EYI A;  3ABL H;  1S7A A;  3OSF A;  5GPA A;  2DMN A;  1RKW A;  3WGG A;  2XVC A;  3GTG J;  1D1A A;  2W84 A;  2L54 A;  4W1U A;  2KIF A;  2ZBK A;  4YII A;  2DJI A;  1LVK A;  3CUO A;  4V2G A;  5FRO A;  1TW2 A;  2CW7 A;  5E8I A;  2ZNZ A;  2L01 A;  2VBZ A;  2R7S A;  4F92 B;  2NOG A;  3R6S A;  2VT2 A;  4MIM A;  4UUT A;  4U87 A;  2VBX A;  3RKY A;  3TOB A;  3OL4 A;  2FNA A;  4C30 A;  1X1P A;  3J81 K;  1U5T A;  2R7R A;  2X85 A;  5K5O A;  1IRZ A;  2BY2 A;  4L9J A;  3CO7 C;  4UHT A;  1PVE A;  1FPQ A;  3BZ6 A;  4XNF A;  4MEX F;  2EZH A;  3EUH C;  1BN5 A;  3LA7 A;  1X2N A;  5HLI A;  4F91 B;  3OWT A;  3TW6 A;  2E35 A;  2BBY A;  2K7L A;  1BI2 A;  2QBY A;  1N78 A;  2QQ9 A;  3ZQI A;  2UUZ A;  2XB5 A;  2ZXW H;  4OIO F;  3G6E I;  2E36 A;  3K4K A;  4AWX B;  4M9X A;  1JXS A;  3M1C A;  5DV5 A;  4XOR A;  1KGS A;  1VFC A;  4BXU A;  1MBK A;  2MYS A;  2LDU A;  5DCF A;  1FMW A;  1IXR C;  1FOK A;  3TOA A;  1UG0 A;  3FXL A;  3X2Q H;  1PUE E;  5LRS A;  4EAT A;  3IH2 A;  1V5G A;  2J5P A;  4HNU A;  5CVU A;  3TBI A;  4N4O B;  1JT0 A;  1I3A A;  3CCS I;  2L4M A;  3H1C A;  4M3D A;  4Y4R A;  2ZJ2 A;  2CG4 A;  2XAF A;  4HV6 A;  4DJA A;  3OYH A;  4NC7 A;  1RKT A;  5HOO A;  4PJJ A;  5CLS A;  2DXI A;  3A0B C;  3TDU C;  2VPL A;  1MBF A;  1Z21 A;  2R93 J;  4CCJ A;  2LMD A;  1SFE A;  4RDU A;  2ETH A;  4F52 A;  2A3S A;  2XPV A;  3OIP A;  1MBH A;  2HXO A;  5DS9 A;  3WU1 B;  4AD9 A;  2LY2 A;  3LQQ A;  3IWZ A;  1ZQ3 P;  4M6Y A;  5JVG F;  1ZRD A;  3OS2 A;  3S16 J;  2EBI A;  2G9W A;  3CC4 I;  1FC3 A;  1KQ8 A;  2HZT A;  3GX4 X;  4LLL A;  2H1K A;  3J7Y J;  1Y39 A;  1S72 I;  1WSU A;  4IQ4 A;  1HKS A;  4BUP A;  2LOO A;  1T2K A;  2RVC A;  2A05 A;  4J01 A;  4HEA 2;  5C3E J;  2DQR A;  3QPS A;  3FK7 A;  2VN2 A;  3M07 A;  2Y9Y A;  1ZYR F;  2WV1 A;  3LSJ A;  2O03 A;  1R5I D;  5F08 A;  1P4W A;  2KQR A;  3IRR A;  3OS1 A;  1ZTR A;  3DKX A;  5KNL A;  1AKH B;  1XPX A;  2OD5 A;  4YFX F;  1W0T A;  1SFU A;  2RN7 A;  3HYI A;  3OYC A;  3V42 A;  2UV1 A;  3K9T A;  2DJN A;  5CVJ A;  3DTE A;  4ASN A;  2DO7 A;  3SQN A;  3FF5 A;  1EH6 A;  4YFK F;  5M3M J;  4J00 A;  1A6I A;  4ABZ A;  2XRN A;  2CQQ A;  2CO5 A;  1OYW A;  4UUV A;  3G4S I;  2WAQ A;  4EGY A;  1WRJ A;  2CMP A;  1X4P A;  2NS7 A;  2M0M A;  2QQA A;  1X3Z B;  4BDZ A;  3M8J A;  2YX7 A;  3K10 A;  2VXZ A;  4AIH A;  3LSK A;  1R4N B;  2H09 A;  1JHF A;  1RET A;  3CCR I;  2X6Y A;  3WTW C;  2ZFU A;  3LSI A;  3LQR A;  4CHU A;  2MLG A;  2GOM A;  1R7J A;  2KKO A;  5F64 A;  3TO7 A;  1WPK A;  2LLK A;  3B02 A;  1JUP A;  1BIB A;  4I02 A;  2J5O A;  3I55 I;  4I7H A;  1TWG J;  2YU3 A;  2IEK A;  3ZQQ A;  5BQT A;  3AFH A;  3GFI A;  1Z6T A;  3WTV C;  1O57 A;  1ZGJ A;  3KP2 A;  3SJM A;  1IO2 A;  4UB8 C;  4L5J A;  1P7I A;  1WJC A;  1MH4 A;  1I6X A;  2HOT A;  2E1O A;  2R92 J;  4L9N A;  3BDD A;  5IOY A;  2QSG X;  3CC2 I;  5J8C A;  2JA2 A;  1HKQ A;  3BQZ A;  3ZQF A;  1TLH B;  2ME6 A;  3TW7 A;  4G7H F;  2FBK A;  2O8K A;  3ECO A;  1R9T J;  4HV5 A;  2PN6 A;  2EB7 A;  1C0W A;  4ZDP A;  3HOT A;  4AU7 A;  2VAS A;  4NHJ A;  3FXQ A;  4JP0 A;  1U3E M;  3COA C;  4E7J A;  3CO6 C;  3AG4 H;  2V1U A;  2P0W A;  1J5Y A;  2XAU A;  3EET A;  3Q9S A;  3KEQ A;  3W6J B;  2TRT A;  3PNT A;  3BT9 A;  2ZCW A;  3J80 Z;  3IRQ A;  1QGP A;  4L9T A;  2DA1 A;  5E3L A;  1YE9 A;  2AQE A;  3BR0 A;  1SD5 A;  4UB6 C;  4OMY A;  3A1Y A;  2AXL A;  5H2F C;  5JVT A;  3CCJ I;  4QLC U;  2F5V A;  2HVR A;  1R6R A;  4RB0 A;  2IT0 A;  4JBA A;  2LFB A;  5LGT A;  2CU7 A;  2F4M B;  2L02 A;  4XRM A;  2QBY B;  2DMQ A;  3FBN B;  3FIW A;  3RQ4 A;  3DU6 A;  5J4V A;  3G73 A;  4A3J J;  1I50 J;  3N4M A;  3FMS A;  1W36 D;  1MSF C;  1LKX A;  1VQN I;  1ZRE A;  4UY8 I;  3K0L A;  3RPU D;  4BY1 J;  2IVM A;  4A93 J;  1OCC H;  4XSX F;  4U0Y A;  1H0M A;  3AG3 H;  2DDB A;  1HQC A;  2ZME C;  2EK5 A;  2ZSI B;  3ABU A;  2P8T A;  2D2W A;  3HB9 A;  3FHN A;  1YW8 A;  2V79 A;  2IAI A;  2GXG A;  3DEW A;  2F48 A;  1U8R A;  2HWV A;  4BE2 A;  1REP C;  5BOX A;  1YHQ I;  2QQ8 A;  1RR7 A;  5J3L A;  2DFE A;  3QOD A;  5ICG A;  4ZTF A;  1K78 A;  3W2W A;  1KU3 A;  4EJO A;  4I0B A;  1SEU A;  3ZN1 A;  3VEP A;  3HRS A;  2K02 A;  4GYI A;  4Y7N J;  3BJA A;  1IAW A;  3E5X A;  3GCM A;  2XGD A;  2VJJ A;  1YO5 C;  4AUX A;  1J59 A;  3LSM A;  2RC4 A;  2ME0 A;  4KIB A;  1YIT I;  1JKR C;  2K27 A;  2TCT A;  3QPT A;  5FKO A;  4RGS A;  4XN3 A;  1QPI A;  5EF6 A;  3QQA A;  1ETK A;  3GTJ J;  3KP4 A;  3GTL J;  2WY7 Q;  2O5R A;  3NRV A;  3B6A A;  1QQI A;  5D8L B;  3FKI J;  3RQI A;  3A2K A;  1E3O C;  2GOX B;  4H0E A;  5ILU A;  3HOS A;  2YU9 J;  3VOD A;  2GXA A;  5KAF C;  1TTY A;  4KIF A;  1TNT A;  3E5Q A;  1BW6 A;  4OU0 A;  4CYD A;  1W1W E;  1XDU A;  3S1Q J;  3T5X A;  2EA2 A;  3WTU C;  2L9V A;  2KRH A;  3HUG A;  3RZO J;  5J6X A;  3JTG A;  2N8G A;  1S7E A;  2FD5 A;  2JZY A;  3ZMZ A;  2MC4 A;  2K5C A;  1BC7 C;  2EV5 A;  2PJR A;  1CQT A;  4RAY A;  3RYR A;  4XSZ F;  5HDK A;  1YYV A;  2WAF A;  5FLM J;  3E6B A;  4JX4 A;  4P5O A;  4ENJ A;  2R3S A;  2FUG 2;  1Z91 A;  3SYT A;  3ISP A;  2E1M C;  5H6Q A;  4D0P A;  1FOX A;  2D1V A;  4BS9 A;  1IJW C;  3I5U A;  4M6X A;  2UXX A;  2R7Q A;  4C2M J;  2PMZ N;  2WB1 A;  1MBJ A;  3JRE A;  2PJP A;  3OYL A;  3QOP A;  5K1Y A;  5DD4 A;  3H3U A;  4NNJ A;  1V4R A;  3CDH A;  4CCM A;  3MKY B;  2D45 A;  4L5E A;  2XKP A;  3ZXS A;  2BYV E;  2JSP A;  2LBF A;  2M7A A;  4IL6 C;  5CVV A;  3BR2 A;  1ULY A;  1TNS A;  3LA2 A;  4LJZ F;  5CQE A;  1BR4 A;  3F8N A;  4BNC A;  2ISZ A;  2H8W A;  2ZC2 A;  3A03 A;  4XKC A;  2Q8K A;  5EEG A;  4IHT A;  2DCE A;  5J1U A;  5TIS C;  3S14 J;  3I64 A;  3K6G A;  2XHK A;  2BE5 F;  4I2O A;  2BV6 A;  5GP9 A;  5JLX A;  2P5K A;  3SDB A;  4B8X A;  2OV7 A;  2CWE A;  4ESF A;  1PP8 F;  3OV8 A;  1R58 A;  2IGK A;  5IP7 J;  1O7L A;  3QPL A;  4V19 K;  4IKF A;  1I3Q J;  3GTQ J;  1HDP A;  3IH3 A;  3RSN A;  2VKE A;  4AYB N;  1DP7 P;  4IHY A;  3RYP A;  2V26 A;  4M73 A;  1K6Y A;  4G6T B;  2UXN A;  4CH7 A; 
#chains in the Genus database with same CATH homology
 3E6D A;  1G6N A;  5F1R A;  1QO0 D;  3WOD F;  2K86 A;  3B73 A;  1U5T C;  1HW2 A;  4LD5 A;  2NRA C;  1FT9 A;  2RNJ A;  2HYF A;  3LFK A;  2CGP A;  3DP7 A;  3GO5 A;  4KN4 X;  4AIJ A;  3V7R A;  3KZZ A;  2FF4 A;  2CYY A;  1I5Z A;  4M71 A;  3K1M A;  3M1E A;  4A5M A;  4N9H A;  1SD6 A;  3FM3 A;  4RB1 A;  5LEK A;  3E3V A;  2DI3 A;  3GFL A;  1V3F A;  2FQ3 A;  4G94 A;  1MDM B;  1QZZ A;  3E6C C;  2Z99 A;  2ACJ A;  2O6G E;  2STW A;  2MLK A;  2WV0 A;  3WTZ A;  1LEA A;  1OKR A;  1S8N A;  4AVP A;  2CSO A;  2DT5 A;  3SFZ A;  1P4A A;  4O3M A;  5HS8 A;  2Y48 A;  2Q2E A;  2B0L A;  4Z2Y A;  2FEZ A;  5JI6 A;  4KT5 C;  4P55 A;  1I1S A;  4EM0 B;  1O3Q A;  2HFH A;  4G8X A;  2YR2 A;  5E1W A;  2GA1 A;  2DAO A;  3JAM Z;  3BJO A;  1FLI A;  1D5V A;  1ZG1 A;  1HSJ A;  4UXN A;  3T0Y A;  1BI3 A;  1KU2 A;  1YLF A;  2EFW A;  1IRF A;  3SXY A;  5ILV A;  4U7B A;  1P2F A;  4LK1 F;  3WTT C;  1P6R A;  3JAM K;  1J7K A;  2O0Y A;  3V4G A;  3RKX A;  4S04 A;  3IHU A;  2HOE A;  2CFX A;  3ZP5 A;  1STZ A;  2F5C A;  4L18 B;  1UHM A;  4OIN F;  3PQJ A;  2A61 A;  2WWY A;  1LEB A;  3PFI A;  3O3K A;  3FMR A;  3MCZ A;  2VBW A;  4WX9 A;  3HSR A;  3H92 A;  2H6C A;  4Y17 A;  4IXA A;  2A6H F;  4KMF A;  5K5R A;  4IF4 A;  3P9K A;  4HDU A;  2PMU A;  2FA5 A;  3MWM A;  3ML6 A;  5FFX A;  4A5N A;  4UV8 A;  4U88 A;  5DUK A;  1B59 A;  3Q9V A;  2HTJ A;  1R5G A;  4UVB A;  5E20 A;  2NYX A;  4WXD A;  4LG0 A;  3TDZ C;  2KRF A;  4ZYG A;  1YG2 A;  1K78 B;  5D6E A;  3WGI A;  1SD7 A;  4F7Z A;  5FLX Z;  3O6B B;  4KUM A;  4O5V A;  1R1T A;  4ZH4 F;  3K1N A;  3EDP A;  3DF8 A;  3EQL F;  1XMK A;  4YIF A;  1H9T A;  1HW5 A;  5FGM A;  3QAH A;  2A5Y B;  3HTU A;  2ZKZ A;  2COM A;  2HEO A;  4E70 A;  4KA4 A;  3ZMS A;  2NS0 A;  5CVI A;  3VB2 A;  2VC0 A;  3R61 A;  2HTS A;  1ZRC A;  5LEJ A;  2XAH A;  4LLG F;  3HRM A;  2GAU A;  3I53 A;  2EA4 A;  3GZ6 A;  4FHT A;  2ESH A;  5E1X A;  2VE8 A;  4LFU A;  3MFK A;  5E17 F;  3TO9 A;  2A69 F;  4WF2 A;  1F9N A;  5FD5 A;  4CZZ A;  2MH2 A;  5AON A;  3BPX A;  1IF1 A;  3F8C A;  3KCC A;  3FWE A;  1GVJ A;  2Z3Y A;  2HDC A;  4HAM A;  2VOP A;  3S2W A;  4BYY A;  5LHG A;  1R1V A;  1LDJ A;  3J81 Z;  2AS5 F;  4MGR A;  1TQP A;  4G7O F;  5H6R A;  1W4M A;  5DUI A;  2M30 A;  2JTV A;  4KFC A;  4EM1 A;  2DW4 A;  3K1P A;  3DQV C;  1ZH5 A;  4KNY A;  5LLQ A;  3JTH A;  1G3S A;  1O3R A;  3BJ6 A;  2P4W A;  2QUF A;  4GGG A;  5F6F A;  2OQG A;  4B09 A;  4LMY A;  2MH9 A;  2FXA A;  2QYO A;  4KN7 X;  1GXQ A;  1WQ2 A;  2WTE A;  2ZNY A;  1W5S A;  2XAQ A;  4ZYD A;  2EWN A;  2RQP A;  2XGX A;  4LB6 B;  5CJ9 A;  1LQ1 A;  2M45 A;  1FBU A;  4PGG A;  2X0L A;  2Y75 A;  3MEX A;  2P5V A;  2KJC A;  1DDN A;  4QWQ A;  2FMY A;  2V6C A;  5L3D A;  4XRF A;  3J80 K;  2JPB A;  1Q1H A;  1SAX A;  4R79 A;  1Z05 A;  4I09 A;  2QLZ A;  4ZZD A;  3GEZ A;  4UNO A;  1R23 A;  2XAG A;  3L7W A;  3I0T A;  4CIC A;  1AOY A;  3ABT A;  2L4A A;  4RAZ A;  5L3G A;  4RB3 C;  5E18 F;  5E1Z B;  2KIM A;  2XV4 S;  3KEO A;  3BRO A;  1R36 A;  1YW7 A;  3L9F A;  1BI1 A;  4MQ9 F;  3CUQ C;  1SMT A;  3O2P E;  2M1B A;  1HXD A;  3I58 A;  3DPL C;  3GLX A;  3I59 A;  2DTR A;  2K4J A;  2M5W A;  3KP5 A;  1JGS A;  3V8J A;  5DYM A;  5JHU A;  1FZP B;  3RIR A;  2P7V B;  4OIP F;  1UHW A;  3F3X A;  4HF0 A;  2C6Y A;  2E7W A;  3EYY A;  2XIG A;  3BWG A;  3V8L A;  5ICE A;  1MD0 A;  2OQR A;  4P9F A;  2M87 A;  1UFM A;  5FD6 A;  4BQA A;  2G7U A;  1FSE A;  1R00 A;  3U9G A;  1ONV A;  4HX8 A;  1SFX A;  1KU9 A;  4PDK A;  1HKT A;  3PQK A;  1A04 A;  5LRR A;  4KDP A;  3SHF A;  4I98 B;  3HRU A;  2P7C B;  3FXR A;  2VON A;  4WCG A;  4A2U A;  3QP5 A;  4HYE A;  3KLO A;  4ZYE A;  4PGH A;  2A6E F;  3GVA A;  5KK1 A;  1X3U A;  3DEU A;  4HOB A;  4JK1 X;  2R7F A;  2PI0 A;  3KFW X;  5D6F A;  2ZME A;  1OYY A;  2HS5 A;  3FXU A;  2PEX A;  1Z1D A;  2FSW A;  5TRD A;  2IA0 A;  4U7D A;  5DCM B;  2ZME B;  1P4X A;  3I71 A;  3L00 A;  4WXC A;  3R4K A;  5DD8 A;  4CXF A;  2MBF A;  3NQO A;  4KYW A;  2E1C A;  1FX7 A;  2FBH A;  1R22 A;  4LGW A;  3KP7 A;  4WK8 F;  3D0S A;  1H9G A;  4RB2 C;  3DFG A;  2DPD A;  4YG2 F;  4ZZL A;  1F4K A;  3HIF A;  4TV7 A;  1S3J A;  3KZY A;  2KJB A;  5D8K B;  1J9I A;  1RIO H;  1BM9 A;  3F8M A;  3RJP A;  2NNY A;  1K79 A;  2PFB A;  3RPU A;  1USS A;  3MZY A;  1D3Y A;  1ON1 A;  2PBI A;  1FYL A;  2ZXJ A;  2JPC A;  5HS9 A;  1KQ9 A;  4HX7 A;  2MD5 A;  1SMY F;  4Q4Z F;  3L2C A;  4EM2 A;  5CYV A;  4MEY F;  1J2X A;  1G3T A;  3RTR A;  3IWF A;  2CW0 F;  2DQL A;  2W24 A;  5ED4 A;  3E97 A;  3QRF F;  5LHH A;  3M8E A;  4LK0 F;  4ON0 A;  1OPC A;  5K5Q A;  1ZLK A;  5BPI A;  2DK5 A;  3F8F A;  1Y0U A;  2DBB A;  4RGR A;  2VT3 A;  3ROU A;  2OAZ A;  4HQE A;  5L3C A;  4LB5 A;  5E8G A;  1FYM A;  1MKM A;  1VTN C;  1UB9 A;  5H20 A;  3ZQ7 A;  2O8X A;  4OIQ F;  3FZV A;  1SD4 A;  1XGN A;  1LNW A;  3H3Z A;  4ENK A;  2EV0 A;  4EJV A;  2OU2 A;  1ZAO A;  1IN7 A;  4G6D A;  1G3Y A;  3E6M A;  3F72 A;  1U5T B;  2QQB A;  1D8J A;  1QNT A;  4MTD A;  3R0J A;  1FSH A;  3KET A;  2D1H A;  1ZN2 A;  1B9M A;  2F2E A;  2R7D A;  2V9V A;  1O3T A;  6PAX A;  3WTS C;  1B9N A;  4CO8 A;  3VOE A;  3RDI A;  2PLY A;  5J8F A;  1DPU A;  1HST A;  2MC3 A;  5D5V B;  3I59 B;  1ODD A;  3P7N A;  1ZG5 A;  4XBF A;  3ZMV A;  4IVN A;  4PCQ A;  2GA2 A;  1XN7 A;  2DK8 A;  4OMZ A;  2RV8 A;  1TQM A;  5ILS A;  3BOQ A;  2P6T A;  1XMA A;  3T1B A;  3DPT A;  2IPQ X;  4S05 A;  1FYK A;  1S7O A;  2L3D A;  1J0R A;  1FP2 A;  4CDG A;  3JSP A;  3C18 A;  3LST A;  1K6O A;  2FML A;  3NEU A;  3HRT A;  4GCV A;  2QM3 A;  5HS7 A;  4HBL A;  4EV0 A;  4IHS A;  5LHI A;  4IRH A;  3JSO A;  3ZPL A;  1T98 A;  1WI9 A;  2GWR A;  2JRT A;  1IN6 A;  2F5F A;  3SZP A;  1TW3 A;  1E2X A;  1IN8 A;  2DLL A;  4U0V A;  3F23 A;  1YW9 A;  4GXO A;  3MAJ A;  2LF8 A;  1OR7 A;  3WE2 A;  1P92 A;  3FHZ A;  1XSD A;  5BS6 A;  5DEQ A;  4Q5S F;  2W25 A;  2ZFW A;  3ELK A;  5D4R A;  2YSR A;  3ULQ B;  4Q47 A;  2HGC A;  5LGN A;  3IL2 A;  2HKX A;  3CJN A;  2ZO4 A;  3MZH A;  4Y15 A;  1IN5 A;  1ZG3 A;  2FNP A;  4I0A A;  2GQQ A;  2GIV A;  2ESN A;  3LAJ A;  3I4P A;  1XGS A;  4G7Z F;  3LAP A;  4L9V A;  5JR3 A;  3BPV A;  1CF7 B;  4BAY A;  3HSF A;  1LDD A;  1KA8 A;  4P96 A;  3JW4 A;  4HF1 A;  5L3B A;  3GF2 A;  1LB2 A;  4XLN F;  4OOI A;  3K2Z A;  2E7X A;  4A0Y A;  5HLG A;  1XSV A;  4GYG A;  4LG0 B;  1ZRF A;  1IN4 A;  4Y13 A;  1IXC A;  3WTX C;  1KYZ A;  1PP7 U;  5D5W B;  1BI0 A;  2HQR A;  4PZJ A;  1ZHF A;  3VFZ A;  2UZK A;  1WWX A;  1K7A A;  2H6B A;  3CLO A;  3F6O A;  5A2Q K;  2IA2 A;  3WG9 A;  1GHC A;  1XB4 A;  3GZ5 A;  3TKY A;  4G9Y A;  2FRH A;  4FT8 A;  2TDX A;  2P6S A;  3F8B A;  1ZLJ A;  2XRO A;  1JE8 A;  3L09 A;  2GXB A;  1L0O C;  2Z9O A;  2Q0O A;  2W85 A;  4JQF A;  4M74 A;  1J75 A;  2RGV A;  1MJ9 A;  3CTA A;  5HDG A;  3GW2 A;  4AIK A;  1W7P A;  1QZY A;  1T39 A;  1FY7 A;  5LGU A;  3F22 A;  1IZ1 A;  2EV6 A;  4KIC A;  1KQ0 A;  1BIA A;  2QEN A;  1QPM A;  2A68 F;  1YTY A;  2IRF G;  4MNU A;  1W5T A;  4A6E A;  1MJB A;  4L0Y B;  3DV8 A;  3R0A A;  3P9I A;  1RUN A;  4M9S A;  5IT9 Z;  1JHH A;  1G3W A;  1XD7 A;  3ECH A;  2IP2 A;  1BOA A;  3HHH A;  1YS6 A;  4IJA A;  1XSX A;  2V1D A;  1RNL A;  3ZMD A;  1CF7 A;  5AIQ A;  4BHP A;  4NQW A;  3WTY C;  2NNN A;  4L0Z B;  2WC2 A;  2MA3 A;  1U2W A;  4HA8 A;  5JFR A;  3TO6 A;  3REO A;  2LF7 A;  4GO1 A;  4NB5 A;  5FB2 A;  2F5E A;  5IT9 K;  2BEO A;  4IRG A;  2VBY A;  1YQA A;  5L3E A;  3KE2 A;  2VC1 A;  3W6K B;  1FP1 D;  4HW0 A;  4HQM A;  2X4H A;  5TJJ A;  1FBS A;  1F1Z A;  1ZGA A;  5FO5 A;  2Z33 A;  3C7J A;  2LSO A;  5D4S A;  2O3F A;  4A0X A;  3LA3 A;  4R8H A;  3M8F A;  3QU3 A;  2M8E A;  3T8R A;  3CUQ B;  1U6G A;  1O3S A;  1W7P B;  2YPR A;  4YFN F;  3V7C A;  5HLH A;  3ZN0 A;  4EVI A;  2HKO A;  1D8K A;  1NHA A;  3DXJ F;  3J7A O;  4OIR F;  2LKP A;  3WE3 A;  5L3F A;  1G4D A;  4MQV A;  5D5U B;  5ERI A;  3OOP A;  3ZMT A;  1LDK B;  3IC7 A;  1B1B A;  2EFP A;  5CVR A;  3BP8 A;  3KLN A;  3FM5 A;  4RS8 A;  4U0W A;  4XLP F;  2CQK A;  2EFN A;  1CGP A;  1IW7 F;  2PG4 A;  3IKV A;  1S6L A;  1XGM A;  4IRI A;  2H27 A;  2IJL A;  2K4B A;  3T8T A;  4DNC A;  3FMQ A;  2HYG D;  1YFH A;  1T0F A;  3R60 A;  4G6Q A;  3WGH A;  2EJR A;  3SZT A;  1OMI A;  2OZU A;  3GYH X;  3QU6 A;  2FOK A;  2STT A;  4K2E A;  1BBY A;  3EUH A;  4Q48 A;  1B4A A;  2VOD A;  4I01 A;  1FBQ A;  4FX4 A;  4ESB A;  1UCR A;  1T38 A;  4WXH A;  4EJU A;  1LVA A;  4BH9 A;  5LBQ A;  2FU4 A;  1F5T A;  4A0Z A;  1DPR A;  1RZ4 A;  1KYW A;  3HHG A;  4N0B A;  3D5L A;  2GZW A;  2DFI A;  3MQ0 A;  4KMU X;  3WU0 A;  1GXP A;  4FX0 A;  2PQ8 A;  2Z5U A;  3G3Z A;  4ESJ A;  1I1G A;  1RI7 A;  4ENM A;  4N9I A;  4M72 A;  2VE9 A;  1YS7 A;  3U2R A;  4EGZ A;  1EH7 A;  5ICF A;  3V8K A;  2A07 F;  4ENN A;  5EEH A;  2JT1 A;  4A6D A;  1XCV A;  4RGX A;  4IPA A;  3M9A A;  2P5L C;  1EV7 A;  2UWM A;  4HLX A;  3KP6 A;  1DUX C;  2DU9 A;  2HQN A;  3GFM A;  2LNB A;  1EH8 A;  1LJ9 A;  1OYI A;  2QWW A;  4MHG A;  1ZAR A;  1L3L A;  4RGU A;  2XKO A;  2BGC A;  2OBP A;  3GUD A;  5DCM A;  1FWZ A;  3ZMU A;  3HSE A;  1S29 A;  3HTS B;  3IKT A;  4M9Z A;  5A2Q Z;  4HX4 A;  5HDN A;  4CGZ A;  1Z7U A;  3F21 A;  2XAS A;  1HW1 A;  5BPD A;  1PDN C;  2ADU A;  1XDS A;  2XAJ A;  2W57 A;  3M7G A;  3RI4 A;  4ZYH A;  2XUB A;  5HVQ C;  3ERE D;  1BJA A;  5IT3 A;  2EFO A;  1U78 A;  5DDG A;  3RKW A;  1B6A A;  1WKM A;  2KIU A;  2NAZ A;  3FX3 A;  1KU7 A;  2E1N A;  4EMS A;  4WWC A;  5AIP A;  2OZ6 A;  4O6J A;  2ELH A;  3V7S A;  2F5D A;  1W7P D;  4L5I A;  4A12 A;  3GXO A;  3N97 A;  1R1U A;  2FE3 A;  2JSC A;  2RDP A;  3QP6 A;  5FLX K;  3TGN A;  4R1H A;  1TBX A;  1QBJ A;  4UV9 A;  2RKH A;  1BC8 C;  1YIO A;  5D5X B;  1O7F A;  3KP3 A;  1UST A;  4BHB A;  1IXS B;  4LLN A;  2HR3 A;  1I27 A;  4UVA A;  5KVR A;  3LWF A;  3I54 A;  1Z9C A;  2YX4 A;  5BMZ A;  4P9U A;  2H94 A;  3BY6 A;  3GWZ A;  2ISY A;  3Q5F A;  3E5U A;  4ETS A;  4HF2 A;  4BHC A;  2G7H A;  1E17 A;  1FNN A;  4UVC A;  5ICC A;  4EJT A;  2IW5 A;  4EQQ A;  4MTE A;  1RUO A;  2OA4 A;  1ON2 A;  4HDV A;  2O61 A;  4HZF A;  1MZB A;  2VOO A;  3DKW A;  1IUY A;  3K69 A;  2V1X A;  1AWC A;  3U1D A;  3F6V A;  2Y0M A;  2EFQ A;  3RPQ A;  3P9C A;  2DPU A;  1XCB A;  2QZ8 A;  1Z6R A;  3C3W A;  3CUQ A;  1MGT A;  1IRG A;  4EJW A;  3C1D A;  2IA1 A;  1T6S A;  1MJA A;  1MDM A;  1XGO A;  2PMH A;  3TQN A;  4KIG A;  3QPH A;  5FFZ A;  4DQ2 A;  4HLY A;  2FBI A;  3AAF A;  2QVO A;  1HBX G;  1TQI A;  1R5H A;  3GFJ A;  3EYI A;  1S7A A;  3WGG A;  2XVC A;  2W84 A;  2L54 A;  2KIF A;  2ZBK A;  4YII A;  3CUO A;  1TW2 A;  5E8I A;  2ZNZ A;  2L01 A;  2VBZ A;  3R6S A;  2VT2 A;  3RKY A;  2VBX A;  3TOB A;  2FNA A;  3J81 K;  1U5T A;  5K5O A;  4L9J A;  3CO7 C;  4UHT A;  1FPQ A;  3BZ6 A;  4MEX F;  1BN5 A;  3LA7 A;  5HLI A;  2BBY A;  2K7L A;  1BI2 A;  2QBY A;  2QQ9 A;  4OIO F;  4AWX B;  4M9X A;  1JXS A;  5DV5 A;  1KGS A;  4BXU A;  2LDU A;  5DCF A;  1IXR C;  1FOK A;  3TOA A;  1PUE E;  5LRS A;  2J5P A;  5CVU A;  2L4M A;  2ZJ2 A;  2CG4 A;  2XAF A;  4HV6 A;  5HOO A;  5CLS A;  3TDU C;  1SFE A;  2ETH A;  2A3S A;  3WU1 B;  4AD9 A;  3LQQ A;  3IWZ A;  4M6Y A;  1ZRD A;  2G9W A;  1FC3 A;  1KQ8 A;  2HZT A;  3GX4 X;  4LLL A;  1WSU A;  1HKS A;  1T2K A;  2RVC A;  2DQR A;  2VN2 A;  1ZYR F;  2O03 A;  1P4W A;  3IRR A;  2OD5 A;  4YFX F;  1SFU A;  2RN7 A;  3HYI A;  3K9T A;  5CVJ A;  4ASN A;  2DO7 A;  3SQN A;  3FF5 A;  1EH6 A;  4YFK F;  2XRN A;  2CO5 A;  1OYW A;  4UUV A;  4EGY A;  1WRJ A;  2QQA A;  2YX7 A;  2VXZ A;  4AIH A;  2H09 A;  1JHF A;  3WTW C;  4CHU A;  3LQR A;  2MLG A;  1R7J A;  2KKO A;  5F64 A;  3TO7 A;  3B02 A;  1BIB A;  4I02 A;  2J5O A;  4I7H A;  2YU3 A;  5BQT A;  3GFI A;  1Z6T A;  3WTV C;  1O57 A;  1ZGJ A;  3KP2 A;  4L5J A;  1I6X A;  4L9N A;  3BDD A;  5J8C A;  1HKQ A;  1TLH B;  4G7H F;  2FBK A;  3ECO A;  4HV5 A;  2PN6 A;  2EB7 A;  1C0W A;  3HOT A;  4NHJ A;  3FXQ A;  1U3E M;  3COA C;  3CO6 C;  2V1U A;  1J5Y A;  3EET A;  3Q9S A;  3KEQ A;  3W6J B;  2ZCW A;  3J80 Z;  3IRQ A;  1QGP A;  4L9T A;  1SD5 A;  4OMY A;  2AXL A;  5JVT A;  4QLC U;  2IT0 A;  4RB0 A;  4JBA A;  5LGT A;  2L02 A;  2QBY B;  3G73 A;  3N4M A;  3FMS A;  1ZRE A;  3K0L A;  2IVM A;  4XSX F;  4U0Y A;  1H0M A;  1HQC A;  2EK5 A;  3ABU A;  2P8T A;  2D2W A;  1YW8 A;  2V79 A;  2GXG A;  1U8R A;  2HWV A;  1REP C;  5BOX A;  5ICG A;  1K78 A;  1KU3 A;  4EJO A;  4I0B A;  3ZN1 A;  3VEP A;  3HRS A;  2K02 A;  4GYI A;  1IAW A;  3BJA A;  3E5X A;  1YO5 C;  1J59 A;  2RC4 A;  4KIB A;  2K27 A;  3QPT A;  4RGS A;  3KP4 A;  3NRV A;  1QQI A;  5D8L B;  4H0E A;  5ILU A;  3HOS A;  3VOD A;  1TTY A;  4KIF A;  1TNT A;  3E5Q A;  4OU0 A;  4CYD A;  1XDU A;  3T5X A;  2EA2 A;  3WTU C;  3HUG A;  5J6X A;  3JTG A;  2JZY A;  3ZMZ A;  1BC7 C;  2EV5 A;  4RAY A;  3RYR A;  4XSZ F;  5HDK A;  1YYV A;  3E6B A;  4P5O A;  4ENJ A;  2R3S A;  1Z91 A;  3ISP A;  5H6Q A;  4D0P A;  2D1V A;  3I5U A;  4M6X A;  2UXX A;  2PJP A;  3QOP A;  5K1Y A;  5DD4 A;  3H3U A;  2D45 A;  1V4R A;  3CDH A;  2XKP A;  2BYV E;  5CVV A;  1ULY A;  1TNS A;  3LA2 A;  4LJZ F;  3F8N A;  4BNC A;  2ISZ A;  2Q8K A;  5EEG A;  4IHT A;  3I64 A;  2XHK A;  2BE5 F;  4I2O A;  2BV6 A;  2P5K A;  4B8X A;  2CWE A;  4ESF A;  1PP8 F;  3OV8 A;  1R58 A;  1O7L A;  1DP7 P;  3RYP A;  4M73 A;  2UXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...