2K01A

Structure of a locked sdf1 dimer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k01A00
2B2WA 1KNEA 3I91A 4IUPA 1X3PA 3LWEA 1HUNA 1QNKA 3R93A 1DZ1A 1GUWA 5T1IA 5JJZA 2KECA 5CORA 1M8AA 1G2SA 2HDMA 1ILPA 1HFNA 2L4NA 1BF4A 1RTOA 1CA6A 1F9PA 3HP3A 1HHVA 3GV3A 2FFKB 1BO0A 3KBXA 1ICWA 4X3TA 4OIJA 4IUUA 3D6WA 1B50A 3QO2A 1B53A 1B4OA 1ILQA 1CM9A 5AFWA 2HUGA 4IUVA 2M2LA 5DNFA 2B2YA 4UAIA 1AZPA 1O7YA 1QG7A 2B2UC 2DY7A 1B3AA 3MTSA 1WTRA 3DEOA 2K28A 1PFNA 3I90A 1WD0A 1XX8A 5EPJA 1DOKA 1RJTA 5EPKA 4MHEA 1PDQA 1MSHA 1E0BA 2KEDA 2Q8TA 1J8IA 1PFBA 1WTQA 5EJWA 1PFMA 1TVXA 5EPLA 2L1BA 1HUMA 2K03A 2K05A 4MN3A 4ZLTF 3FDTA 1WTPA 1DOMA 1B2TA 2K1BA 1HFGA 1PLFA 1HRJA 2H1EA 1U4PA 4IURA 5CBAE 1MSGA 2EOTA 2KEEA 2N55A 1CA5A 2FMMA 5CMDA 4X3KA 3ONAB 3SVMA 1F9QA 1IKLA 2X6LA 2X6GA 4CJ0B 1NR2A 4OIKA 2RA4A 4HAEA 1O80A 1WTXA 1IL8A 1RTNA 1VMPA 2RVLA 3H91A 4IUQA 1G6ZA 2BDNA 1U4MA 1F9RA 4R9WA 1RHPA 3TN2A 1WD1A 5D14A 3I8ZA 2HCIA 2KOLA 1AP0A 2N88A 4QUCA 1EIHA 3GV6A 5D65A 1J9OA 1KNAA 2MP1A 2B2TC 1BNZA 2J7ZA 4RWSC 1G91A 1WTWA 5E4WC 1XYIA 2FJ2A 1F9SA 2MGSA 3G7LA 4X3UA 5COYA 4DN4M 1IKMA 2MPMA 1SAPA 2IL8A 1DOLA 3N52A 1HA6A 1O7ZA 2X69A 2L12A 4LMQD 4HSVA 2L11A 4XT3B 1NAPA 2D9UA 3KUPA 2FHTA 1DONA 1F2LA 1G2TA 1WVLA 3F2UA 4ZK9B 2B2VC 1A15A 5EKIA 4ZAIA 1MGSA 1EOTA 2CVRA 1WTVA 5CBEE 1MI2A 2HCCA 2B2YC 2FINB 2R3ZA 1S4ZA 1U4RA 1U4LA 4ZKCB 1ZXTA 5T1GA 2B2UA 4HEDA 2EE1A 1NR4A 4RAUC 3DEPA 3IL8A 1X3QA 2B2WC 2SDFA 2XIWA 1ESRA 2EPBA 1QE6A 1SSOA 1EQTA 1X32A 2B2TA 3MWYW 4O42A 1C8CA 3P7JA 4X3SA 3UI2A 2JP1A 3DM1A 1JE4A 1RODA 2HDLA 2VXWA 3I3CA 4IUTA 4XDXA 4CJ2C 1VMCA 2K04A 1LV9A 3FPUB 4R8IA 2Q8RE 2KVMA 2NZ1D 1SDFA 1EL0A 2RSNA 1EIGA 2NYZD 4XT1B 2K01A 2B2VA 1Q3LA 4CJ1B 2NWGA 2JYOA 4NW2A 1NCVA 5EQ0A 1BBXC 3TZDA 4QUFA 1ML0D 2DY8A 4ZKBB 2MJ8A 1WTOA 5E4XA 4RA8A 3Q6SA 2L9HA 2RSOA 3IFDA 1AZQA 4HCSA 2KUMA 1JICA 4U68A
chains in the Genus database with same CATH superfamily
3L7ZC 3R2IA 4N9TA 1JQYD 4AYBB 1B8AA 3EFXD 3JAME 4MTNA 1TS5A 4N8FA 1RTOA 4C3IB 4A3JH 2EYOA 3BVMA 3U9OA 2F0KA 3IKJA 1HZAA 4A4IA 5ELFA 4J8QA 2A1AA 1W2BA 1VQHA 1ILQA 1HTLD 2XNAC 5AFWA 3I70A 1TIID 3RZDB 1EFID 1NMGA 3GTOB 1CUKA 3GTQB 4YHHQ 1RJTA 1KD1C 2F3VA 4HSPA 3G48A 2EJFC 1E2ZA 5FLMH 1PFMA 3H6MA 1GVPA 2JA7H 5G3LD 1WTPA 4A3FH 4DR7L 1N36L 2DUDA 1OTCA 2SOBA 2UXBL 4OEMB 3GTGB 2CWAA 1IBKQ 1TKWB 4B9XA 1NR2A 1HQMC 2RA4A 5F2DA 4X66L 4BXXH 3I2ZA 1VS0A 2R7FA 3P20A 1RF2D 1Q8IA 4R4TA 2KOLA 1LT6D 4AYBG 4RKBA 1J9OA 3D31A 1GUGA 3MAQA 3S2DB 1H9SB 5C4XH 4C56C 3PIOA 3LX0A 2MPMA 4C3IG 3DUZA 2K14A 1HA6A 2E8GA 1F2MA 1A2TA 2F0OA 3KUPA 4PMWA 2F03A 3W1GA 2PW5A 5IY0A 5KEEA 4ZAIA 5C4HA 5C44H 4OO1G 3I72A 3B6YA 4OWXB 4B3TQ 1SJHD 3L9AX 1SLJA 4FXKC 1UE5A 1ZXTA 2IT1A 2QF7A 2KCTA 1FJGL 3UI2A 1SYBA 2F3WA 2HDLA 1I6VC 3CC2A 2K04A 3QB3A 4ME3A 1S5CD 4TSSA 2I5LX 5C3EB 3QIAA 1BCPB 3E0EA 4XT1B 4QB4A 4OX9L 3ULPA 1ML0D 2IJ0A 2ZTEA 1WTOA 1Y1VB 1K3RA 4B08A 5C4JB 4JBMA 3GDEA 4DK0A 4KY7A 1VCIA 4U673 1CKMA 3JC66 1KRTA 1FL0A 1HUNA 1SMYD 1QNKA 3R93A 1GUWA 1G8ZD 4YCVA 2KECA 1G2SA 4HJ7A 2F52A 3E6ZX 1B70B 2EYFA 3HOZB 2E74C 2K4KA 2MO0A 3S9WA 1YBYA 1PH6A 5CYUA 3Q24A 1E1OA 5EGTA 1QWYA 2LKVA 2HUGA 2M2LA 5DNFA 4YIJA 1B1ZA 3ITPA 4C3IH 3DEOA 3VA7A 1PRTD 1PFNA 1T5XD 4HIDA 1VQLA 2F4IA 3M7GA 1STBA 5J3BA 5FOBB 3H3VI 5C3EG 2F0JA 4DV1L 3RZDH 4OO1H 4LAAA 1CHQD 4DR4L 3K7AB 3GTOH 1RIPA 1OXVA 3GTQH 1Q7YC 3TDQA 4IURA 4RG1A 2AHOB 3A54A 1Y1VG 1O7LA 2ZTDA 2AMCB 2IW3A 3HKZE 1I50B 5IYBG 1X54A 1YIJA 4RCOA 3TSSA 3GTPB 1D2BA 3A5UA 4O0AA 3SHLA 4C2MB 1N33Q 1EIHA 5D65A 3K5OA 1BNZA 3GTGH 2B2TC 2F0QA 3CPWA 3CP0A 3NBIA 4JI6Q 1Q81C 3HOZG 1HXYD 2RDGA 1IKMA 4AH6A 3PUXA 1TS4A 2I5HA 1LTSD 1V43A 3S2DH 3D4WA 3F2UA 4K5XA 4ZK9B 3OW2A 1K9MC 5JJKA 2YV5A 2BE5C 3I4OA 5CV4A 1HNZL 2BCOA 1PYBA 4P72A 3G4SA 1MBYA 4GKKQ 1C4QA 3IL8A 4WJ4A 2BOSA 4DA2A 2C9OA 2KA7A 2OQ0A 5I9PA 4B3ML 1JOKA 2GA4B 3DM1A 3J81i 1JCKB 4DFAA 4EQPA 1SDFA 3SEBA 4FF1A 1EY4A 1EFWA 4DU9A 4F8MA 5EKKA 4LFBQ 4FXGC 1HZCA 1BBXC 3K8AA 3OWEB 4OELB 5C3EH 1XMQQ 4C1NI 2H5XA 3JAMi 3C2PA 2MQHA 1HCZA 3U58A 3HOYB 5CORA 4GZYC 3RLNA 1Y1VH 3BVZA 5I2XA 5C4JH 2PO4A 4B9WA 5IYBH 4DAPA 1I3QB 1R4PB 5HGQA 1Q12A 1NUCA 4JC0A 1CSQA 2HQEA 4JI0Q 4KV6A 4LNQA 2YTXA 5KNDA 3HOZH 1LLRD 2VQEQ 1ENFA 3RMHA 1GM5A 4LF6Q 1XXGA 2RCFA 3M4QA 3K0XA 1EY9A 2CW0C 4V0BA 4HN7A 4JI1L 3J81L 3HKZB 4DXFA 1CQVA 1B2TA 2CWPA 4NMZA 4DR5Q 3F1ZA 2KEEA 2L0CA 4J1MA 3VYSA 1EWIA 3QOLA 1IKLA 3ND8A 3K7AH 2NVXB 1V1OA 2RQXA 1RHPA 1WD1A 1OXSC 2EDGA 3JAML 3HOYG 1I50H 1EU3A 5LHY1 3GTPH 1DOLA 4BWGB 2F0HA 4M1UB 1KAWA 4C2MH 3BU2A 5C0XI 1HNXQ 1VQ9A 1FNUA 4IZ8A 1EIYB 5E3FA 2F0PA 2B2YC 4DNTB 5IGGA 1TR5A 4A76A 2K5VA 4X65Q 1CHPD 4HEDA 1XPRA 1BCPF 4RAUC 2O5IC 1R4QB 3HKZG 1PMRA 4DUYQ 4A3IB 1WCMB 1ESRA 3NBHA 3PIPA 2LMCB 2I0QA 2DGYA 1A3TA 1Y8PB 2VL6A 3E3XA 3KLSA 5LL6S 2IX3A 4JYAQ 4BA1I 1GO3E 1EIGA 1AFPA 3FP9A 5C0XJ 4NW2A 4I65A 1ONLA 3EVQA 1B9NA 3I4MB 4IQZA 4XIGS 1XMOQ 3KF6B 1SXTA 2I46A 3PF5A 1ICFB 1JORA 5IT9L 5BR8L 3KLWA 1EWCA 1AW7A 3CCUA 3UDFA 4ZUJA 3DWQA 4DV5L 1HR0Q 2HHHL 3W1BA 4IUNA 4JI4Q 2AUJD 2Q2HA 1PZKD 3SK5A 3KDFA 1I3QH 4A3IG 1WCMG 4JI8L 3S15B 1VQMA 3A74A 4HIOA 1II3A 2HIVA 3TEHB 1QUQB 2XSCA 1YNJC 3T56B 3M4OH 1SE3A 1SNMA 3RN2A 1ET6A 2DNEA 1SNDA 3T4AC 2X6GA 1TWAB 3I4MG 3WOFA 5M3FB 2RVLA 4GNXA 1HRJA 4JBJA 4K2LA 1QVGA 4K14A 1KC8C 3CF5A 5FKAC 2G9HD 2XRQD 1SMYC 1DM0B 5EKLA 3S16B 1F9SA 2KCMA 4X3UA 1K8GA 3PMFA 1U9RA 2RBMA 3MEHA 1KABA 2NVXH 2D5DA 4LMQD 4DV2Q 1PRTB 1AE3A 4XT3B 2FHTA 2VY3A 4JOIA 3SR1A 5C3WA 4HMIA 3ULLA 1X56A 4DR3Q 1VQGA 4RGMA 2V4DA 3K5NA 5ELNA 1S4ZA 2Z1CA 1GUSA 3A8IE 3BS1A 1L1OA 2KJXA 2UXDQ 2F4VL 2M00A 4EGVA 1G6ZA 2N8NA 3UE1A 4PV1C 2J0TD 3IAYA 3J7AF 3OTOL 3NTKA 5FO7B 1SNCA 3KJOA 3SK6A 5LL6X 1SEBD 2E2IB 3R2TA 3M9BA 4GOPA 1WOCA 4A3IH 1WCMH 3CHBD 4Z9CB 1PVOA 2ICEC 4K0KL 2R61A 4YCUA 5M3FG 3RLOA 4JI7L 4CDEC 2OT2A 2WP8J 1QZHA 3CC4A 4KK7A 2WINB 2RSOA 1O78A 2LFNA 4H7BA 1GUNA 4RCNA 3BDOA 3MZ5A 1PFSA 4C3HB 4JCVE 2A6HD 4JI5L 3I4MH 2QCPX 3ND9A 2ZM6L 2E75C 3SK8A 3R8BA 1KAAA 3J80c 1PTOC 2G5DA 5GADC 5I6YA 2VQFQ 4IUUA 2PQEA 4DK1A 4JI2L 1Q82C 1I94Q 4IPHA 4JI3L 2B2YA 5KRUA 2F0VA 2K28A 1RKNA 4FDBA 5EPJA 4X64L 1CKOA 4XYOA 1HZBA 4A3GB 1TVXA 3GO5A 2K03A 4LF7Q 4JV5Q 4ZLTF 4FNFA 3S15H 1LTTD 5GQOA 2UUAL 5IGEA 4RHRA 1N32L 5LMNL 2XVSA 1F9QA 4IPCA 3TP5A 2OXPA 2A6ED 4OIKA 5KIXA 1HNWQ 4BBSB 2NVYB 4IJLA 3P1HA 1U4MA 3TN2A 1E24A 2RKSA 3VR5A 4C3HG 1KNAA 4YY3Q 1TWAH 2V1CC 4KY6A 3AMUA 3X3NA 5M3FH 5KGUA 4G4KA 1VQ8A 1CFMA 1PXUA 2D9UA 4KJNA 3VR3A 2AQ2B 3TMEA 1SYFA 1VQJA 2ZJPA 4GKJQ 3D8GA 3S16H 2Z6KA 3OHXC 3CPFA 3IFTA 3EJIA 1J5EQ 1DD2A 2GN5A 4A3GG 4GN4B 1W3SA 3G6JB 1X3QA 2XIWA 3T1HQ 4FF2A 1QE6A 2PW7A 1VQEA 2D0PA 2CFMA 4PQXA 3MXNA 3SE0A 5JJLA 1BBUA 4FO2A 4FF4A 1GXDC 3G71A 1ENCA 3UDGA 2A68D 2B8FA 3ERSX 3NP8A 2B2VA 1WTHA 4KLKA 2ATWA 1OXUA 3TZDA 4DR1L 4XXEA 5LMUL 2E2IH 3AFQA 4R8NA 2QKIC 4KN4C 4KHPQ 3VYTA 5D3DA 4UHVA 2CW0D 5JVG3 4CKBA 2N3SA 4IOAA 4KD3A 2MO1A 4EQOA 4WJ3M 3URYA 3J81E 4A3EB 1A8VA 5DM73 1MD2D 1BO0A 4JPBW 5IWAL 3QO2A 4C3HH 1EY6A 2AQ1B 2QEJC 4QL5A 2EY2A 1QG7A 2PI2E 4EX5A 4CDFC 1KL9A 2NVTB 3OW7A 1CK1A 2QA4A 4A3CG 1NBWA 5CV7A 4ZYSA 2KEDA 2RDHA 4LF5L 1HH2P 2G9DA 5EJWA 3J7AV 2L1BA 4KI0A 3MVVA 4R4OA 1WYDA 2ZXRA 3H3VH 2A69D 4MNOA 4LFAQ 4A3GH 2R7DA 4LUZA 1WTXA 4P2CB 5IIFA 3CCJA 2B8GA 3EA6A 3S1NB 1KLUD 1PRTF 4C3JB 3I8ZA 1F2ZA 1LUZA 1K0SA 1P16A 2MP1A 1A63A 3CRLC 5TSSA 3M4PA 1F77A 4A3EG 4BBSH 2NVYH 4HJ8A 1IBML 1G51A 2JJQA 1JOQA 3KOJA 2R93B 2F0NA 2KENA 4DV7L 5EKIA 3WOEA 4X62L 2FMCA 4BY1B 4DAYB 2Q8IB 4CKEA 1SNQA 5L37A 1EYGA 3QR8A 3BG3A 3VYRA 3DXJC 1PH9A 2OTLA 1N36Q 2EIFA 4LF8L 4A93B 2JA9A 2UXBQ 4K8JA 5IT9E 1OO9B 4A3CH 4K5WA 4B3TL 3CW2C 1M90C 4C3JG 4X66Q 3Q22A 1GJXA 4RA8A 2NN6I 1AZQA 1SBBB 1JICA 2K5WA 4K6LA 3J80E 1U0LA 5C0XG 1NNXA 1YNJD 2R93G 2O4XA 1CKNA 5CV6A 1ZYRD 2WAQE 4UY8C 1S5ED 4BY1G 2K75A 3GD7A 4LK1C 1B4OA 3HFZB 2HT1A 4L63B 1JE5A 1CQFA 2OQKA 3MXPA 1XPOA 3MTSA 4GN5A 3AFPA 2JSOA 4A3EH 4R4CA 1V1PA 4IALA 3W5OA 2XN9C 4MHEA 5BN5A 4DAVA 2PZTA 2GVAA 1PA6A 1A62A 1JMCA 3NQIA 5FO8B 1V8QA 4A93G 2NVTH 3NBHB 1DCZA 3HS0C 4OX9Q 4LF9L 1X3EA 1GD7A 2Z8LA 1O80A 4ILWA 1IW7C 4APVA 3KF8B 5FJ8G 1XNRL 4KKUA 4L5SA 1H95A 2YTYA 2CH4W 4LWCA 2UUCL 2Z4IA 4RWSC 1G91A 1H9JA 5E4WC 3HOVB 1S5BD 3RNUA 1YVCA 2A6HC 1Y1WB 2ZXPA 3S1NH 4C3JH 1FR3A 5C3XA 5ELCA 1H9KA 3K59A 1I5FA 1STHA 4OXPA 1EOTA 3IRBA 1AN8A 2R3ZA 1I4HA 5C0XH 2JEAI 1WJJA 1I6HB 2R93H 2KHSA 5D14A 2SDFA 1SSOA 1UE7A 1JE4A 3PSIA 4BY1H 3CCSA 3PO3B 4DV1Q 2SNMA 2C5CA 3CCLA 3TS0A 4DR4Q 1AEXA 1CTMA 3T51B 2NYZD 3S17B 4Y7NB 1PTOD 2A6EC 2WIIB 3NHHA 4DV3L 5E4XA 2I5MX 4DV4L 2WAQB 4A93H 5IGBA 3HOVG 1GUOA 3K7UC 3BZKA 1Y1WG 3E9IA 1SNPA 2EYJA 4KKSA 1HFNA 1M8AA 2HDMA 4PZ6A 1XPUA 2R6GA 2OWOA 4FVMA 1CA6A 2R92B 5BN4A 1RCVD 5FJ8H 1N34L 1HTPA 3ER0A 2FFKB 2XWBB 4OIJA 3OSOA 4A3BB 1B53A 4ZQ3A 1PH7A 1BQQT 1HNZQ 4IUVA 4QIWE 4GNXC 1AZPA 4KJOA 1Z6HA 1V1QA 1DOKA 1YJWA 3PO3G 1D1IA 2EY1A 2KCCA 3KYHC 3HOWB 4QJFA 4AQYL 1J8IA 4K8IA 1EZ8A 1Y69U 1NE3A 2SEBD 1JT8A 2KBNA 2A68C 3CCQA 1TY0A 2M9VA 2IX0A 4DR2L 4JOIC 1LTAD 2D0OA 1IYJB 1VQ6A 5IP9G 2F0FA 3U4ZA 2I07B 2VQEL 2WAQG 1RTNA 4Q0FA 5I6WA 2B63B 4IUQA 2P5ZX 3OYYA 3BDLA 4HIMA 4GLXA 2N49A 3NWTA 1L1OC 4UP8A 4JVZA 4QUCA 5I4DA 4LF4L 1KQSA 3I55A 3AB9A 1WTWA 1B7YB 2R92G 2QGQA 4CDDC 5K5PA 1TY2A 1B9MA 1IHZA 1OXXK 2F0EA 4CGYB 4GOPC 4A3BG 2E2HB 1Z7TA 1WVLA 4L5RC 1H9SA 1EY7A 2B3GA 3HOVH 3CMAA 1Y1WH 5ELDA 4ULLA 4IFDI 2UUBL 2EYMA 5JVH3 1RL2A 3HRZC 2EE1A 1NR4A 4DK3C 3HOWG 1Y14B 1G6PA 3H94A 4OL7A 1X32A 3CCMA 3OMCA 4DV0L 3HKSA 4DXGA 3I3CA 4FYDA 4IUTA 2ENBA 1VMCA 2IWHA 1STEA 1I6HH 1VQFA 4V190 2KVMA 3U9SA 2A69C 1UEBA 3AQQA 1FNVA 3MC0B 4KY5A 2NWGA 4QF4A 2B63G 3PO3H 1QILA 1EYDA 3J80i 1IL2A 4IN3A 2VB2X 3EBEA 3DWPA 4IFDJ 4GLAC 2A74C 4U68A 3S17H 4Y7NH 2F0MA 1KDAA 5C4ZA 1DZ1A 3KK7A 5JJZA 3MXGA 4QIWB 1L0WA 2L4NA 5IP9H 5GAHC 5H1SE 1DYQA 1RDPD 3RZOB 5JAVA 3HP3A 2WKCA 3J81j 1PH1A 3D6WA 3TS2A 1D7QA 1CM9A 5FO9B 2R92H 1I4XA 3I90A 1JR0D 5FLXc 1M1KC 1KTKA 1BKBA 1K28A 4TQUS 5CGKA 1EY5A 2EY6A 4XQNA 5DM63 1HUMA 2F0SA 4RHSA 4NXML 4F87A 1X65A 4NKLA 4FP5D 1HR0L 1SE2A 5M5XB 1CA5A 1EQVA 1LABA 4LFCL 2OTJA 4CJ0B 2X6LA 2BDOA 3HOYH 3NK9A 1MJCA 2Z6KC 1VQ7A 2R7ZB 3W3AA 3J80L 2JN4A 2HQLA 1EY0A 4RGOS 1F9RA 5NUCA 3OIPA 3FRPB 4HTHA 3ZJYC 1CT1D 3GV6A 2QW7A 2KHJA 3MHBA 1XWEA 2BA0A 2VZAA 1SE8A 2MGSA 1K0RA 3CU7A 1SYCA 3GTMB 2KHIA 2K32A 4KKTA 2UU9L 5BR8Q 2L12A 4DPGA 2QEXA 1ZYRC 1T9HA 4DV5Q 2B2VC 2HHHQ 3O13A 4S3SA 1PHJA 3V2TA 3VA5A 1MGSA 2O5JC 2ZJRA 1BBWA 1Q46A 4OWWB 1XNQL 4K5VA 3BZDB 1FGBD 1QJOA 1JB7A 4JI8Q 1SN8A 3A0JA 5HGTA 2E2HH 1JWUD 3NEMA 2EZVA 1GUTA 2JP1A 1VQ5A 1SR3A 5E7NA 1E22A 4DV2L 1DJRD 4ME5A 3WDNA 4R8IA 2A8VA 3E0JA 4E6IA 1T5EA 1LTRD 3T1YL 4A3DB 2R7ZG 2HD3A 1Y8NB 4B3SL 3RUZA 2KCNA 5ELEA 2Z0SA 1SRUA 2JA8B 3STBD 3AEVA 5CC4A 2KUMA 3MFYA 1VQ4A 2XTIA 1NMFA 1NSNS 3NPPA 1JJCB 1SYGA 5T1IA 2E2JB 5M9OA 3SGIA 1A2UA 5E1FA 2F1MA 1F9PA 1CZWA 2AUKA 1O7IA 4C1NK 2VUMB 3GTLB 1PZJD 2YU9B 3PIO3 4POFA 3L3OC 5KNCA 3RZOH 2VW9A 1N8RC 3KFUA 1IW7D 5CV5A 1BCPD 1SJED 2A5HA 4N8X1 1CSPA 4JW0A 3PGZA 2VNUD 1PTOB 1A3UA 4F88A 1TWCB 2JEBI 3A7LA 1D5ZC 3PO2B 2K05A 4MN3A 2NVQB 3FDTA 4A3DG 2K1BA 2UXCQ 4PZ7A 4TKOB 4DUZL 1X6OA 2NN6G 3TREA 5CBAE 4K0KQ 2FMMA 5CMDA 2Y0SE 4HAEA 2JA8G 3MXUA 4PMCA 4JI7Q 3LGJA 1PYSB 3M4YA 2BDNA 3NENA 2HCIA 1UWVA 4IPGA 5M5XH 3C1FA 1BVSA 2R7ZH 3BYTB 4JI5Q 1V9PA 1JB3A 2SNSA 3DM3A 3PUWA 5IGCA 4B3RL 1TS2A 2Z6BA 2L11A 2ZM6Q 2VUMG 3NELA 4UP7A 3FPPA 1Z9FA 2MUYA 2WFWA 1A15A 2JK8A 2VS1A 2PZWA 1BXTA 2CVRA 1WTVA 1VQOA 5M5YB 3ULJA 2PMZE 4JI2Q 5CBEE 3GTMH 4Y52H 2ZJQA 2F0UA 4IO9A 2D62A 2EYLA 2K5DA 4A75A 4JI3Q 3CC7A 3GQBA 2QDLA 4WJWA 3N6RA 4HJAA 4M8AA 4YWKA 3MWYW 1NJIC 3PO2G 2EYHA 4X64Q 3TZUA 1LM0A 3NTHA 3KBGA 2ZTCA 1C7YA 3Q0AA 3VR4A 3M85A 5G3LF 4DV6L 5A2QL 1YHAA 3J7YW 2DNCA 3GTKB 5IGDA 1V1PB 2RHQB 4GKJL 2K01A 2UUAQ 1N32Q 1N9WA 2ZT9C 1AE2A 4QUFA 3EQLC 4DR6Q 3HEJA 4HIKA 3UDIA 3VR6A 2L9HA 1TS3A 2XWJB 2E5LQ 4X6AH 4A3DH 3I91A 4IUPA 3K5MA 2NN6H 1E3PA 3CRKC 3ERQA 4NPSA 1BUVT 1STGA 2JA8H 1I4RA 5AJ3L 1IBLL 1HHVA 2JA6B 1ICWA 1BR9A 3L2PA 2AWOA 2E2JH 4DGZA 1K83B 4H0LC 1XTCD 3TP8A 1Q1EA 3VDYA 1CZGA 1VQPA 1PDQA 3C1EA 1TXYA 3PV0A 1PH4A 2Y0SB 2VUMH 3GTLH 3VR2A 2YU9H 1X3GA 3CCRA 3M3YB 5J39A 3RLFA 1IYVA 1U4PA 1MKHA 1DXMA 1PTOH 4LJZC 3SDZA 1PV4A 1GHKA 1TWCH 1L2FA 1QUQA 1EEID 3PO2H 5LMUQ 2NVQH 3H91A 4HJ5A 4KTAA 4POGA 3SXHA 3F8TA 1TWHB 1S40A 1FNWA 4L5QA 2PMZB 3CKIB 5K36G 5COYA 4DN4M 4RKLA 2JA6G 1X3FA 5CV9A 3SK4A 4BBRB 5M5WB 3C46A 3TP6A 4NXNQ 1JWSD 5IWAQ 4K2KA 3CD6A 4G7OC 2RF4A 1LO5D 2TSSA 2OF1A 2EJGC 1IYUA 1M4VA 1SMXA 4IPDA 2ALYB 2Y0SG 5JOBA 4EQNA 4YHHL 5GROA 3KLRA 4O42A 1EZ6A 3EIVA 5M5YH 4DAMA 4LF5Q 4CJ2C 4H13C 1IXRA 1ESFA 2NZ1D 4G57A 1UEAB 3S14B 1IBKL 4WRDA 1TQOA 2Z9HA 3GP7A 3K58A 1E7ZA 1CI3M 1ENAA 3GTKH 2ICIA 3OPOA 2QILA 3S1RB 5FK9C 1KNEA 2A73B 5KYLA 1W6JA 2NBFA 3CQZB 1YHBA 3NUCA 1BF4A 1QVFA 4P74A 2Z4HA 4BBRG 1STAA 1IBMQ 4ABNA 1K8AC 4IFDG 4RGNA 3TP7A 4LW1A 3GV3A 1KDCA 2PZUA 4DR7Q 1PTOF 4X3TA 4DV7Q 5JEAJ 1B50A 4X62Q 4LUVA 4DNRB 2D2CC 1VF7A 3NSWA 5K36H 4LUOA 4HMJA 2JA6H 2BA1A 1LTGD 4RH6A 2NZHA 4JBWA 5EPLA 1K83H 2WV6D 2K5NA 1HZ9A 4A3MB 1HFGA 4LF8Q 1A0IA 1YITA 5ELBA 2AKWB 1AH9A 3PIP3 3G6EA 3M3YH 5LMNW 4H44C 4QCLA 1E1TA 3MFGA 3R3OA 4MIUA 3STBC 3S1MB 3P75A 1K3BC 2ASBA 3V05A 1S72A 1VQDA 2K33A 4NDXA 3HOXB 3G7LA 1FD7D 1FJGQ 3C3LA 3OIQA 5CR3A 4EVOA 2IL8A 1KIXA 3CMEA 2L5TA 2MHVA 1Q90A 1TWHH 1G2TA 3DLLA 3NTIA 4J6HA 3RN5A 4MTKA 1U4LA 2PYKA 4ZKCB 1XJVA 1BCPC 4BBRH 5M5WH 4TRDA 3I56A 3BJUA 1YI2A 4XYQA 4IFDH 1NTGA 3P7JA 4X3SA 4XDXA 4A3MG 4PZ8A 2K50A 4HJ9A 2Q8RE 2YTVA 4CDCC 3HGBA 1EL0A 3FMCA 3QJYA 3E5SA 2F0TA 2A19A 2JYOA 3Q8DA 1NCVA 1ET9A 4LF9Q 4A3KB 4ZKBB 3QWNA 5KNBA 1MHWC 3PCOB 1NY4A 1S5DD 4G7HC 1XNRQ 1WFQA 3DWAA 2QDBA 4HCSA 2L15A 3NWSA 3EN2A 1K8MA 3HOXG 2UUCQ 2VB3X 2B2WA 4WORA 1N33L 4QQBX 3S14H 1HJPA 4JI6L 3I4LA 3HZXA 1MIUA 2GVBA 5I9OA 3K5LA 3KDFB 3BYYB 4I7AA 2F3IA 3S1RH 4RGTA 4Q5VA 4P73A 5JJIA 3KBXA 2PQAA 1PH5A 3CQZH 3E9HA 1Q8KA 3CAMA 2NUCA 1WTRA 2JXMB 4GKKL 3H0GB 1EOVA 1P8LA 3PUVA 1BDOA 1MSHA 2ES2A 4G7ZC 3V96A 2EYPA 1FVIA 1IZ6A 4R4IA 4GNXB 1MJEA 3K81C 5CV8A 1G291 1PLFA 3FEWX 1EIFA 2EOTA 4A3KG 4LFBL 2JA5B 2K7VA 3K80C 4X3KA 3LWUA 3SVMA 4PNYA 2NZOA 2F0LA 2OCEA 3TRZA 4DV3Q 1E2VA 3L0OA 1A6XA 4R9WA 4A3MH 1XMQL 4DV4Q 5IOCA 4L6TB 1AP0A 2N88A 3ICEA 2LXKA 3FVQA 2FJ2A 1ASZA 4B3MQ 1JOOA 3HOUB 5FLXL 3Q23A 3S1MH 1VF5C 1I4PA 4HSVA 2PNHA 1F2LA 1L1OB 5IODA 1N34Q 1KHIA 3HOXH 4L5TA 4JI0L 3EROA 3QG1A 5A2QE 3H0GG 5JPMC 4LF6L 1ZEQX 5T1GA 1HPCA 4GOPB 1STYA 2EPBA 3GTJB 3FHWA 4AQYQ 2LY7A 4EQ5A 4DAYA 3OMGA 5J22A 1R9TB 2RCNA 5HURA 2RSNA 1FGUA 1QOHA 2XGTA 2JA5G 1EUJA 1HQRD 4DR5L 5IGFA 4DR2Q 1D6EC 2CQAA 5EAYA 3M4OB 3BDCA 1X55A 1EY8A 4XTCS 3DHQA 4ZUIA 3Q6SA 2NTSA 3IFDA 4CBVA 2CKZB 4XQJA 4LF4Q 1X3PA 1SFOB 4BA2I 3I4NB 3OOCA 3HOUG 4JI1Q 4A3KH 4QY7A 1SROA 2EXZA 1EYAA 1HNXL 2RDFA 2WKDA 3WWVA 1KXLA 2C35B 2PI2A 1LTBD 4ALPA 1VQIA 2UUBQ 1XTDA 2B2UC 4X65L 1E2WA 4OO1I 1SE4A 1F2YA 2LSSA 4DUYL 1QNUA 1I4QA 1E0BA 2Q8TA 4JBKA 4DV0Q 2E2DC 3FKIB 4OWTB 5C5LA 1WTQA 5IYDG 3A8JE 1TU2B 1JC7A 1LT5D 3H0GH 4JYAL 1DOMA 4O2DA 1EU4A 4N9PA 1KLGD 5J1ZA 2N55A 1K73C 4ID6A 3F2CA 1YNND 3BVGA 1IL8A 1H9RA 1VMPA 2Q2TA 2EY5A 1XMOL 4CHTB 3I4NG 2JA5H 1YNXA 2L55A 1XYIA 2K5HA 3H15A 5IP7G 4A3BH 2WACA 1OXTA 3CCVA 3W2DA 4K6DA 3UE0A 4KN7C 3KF8A 4NB3A 2BH2A 4UP9A 1D1KA 2X69A 1GHJA 5DEHA 3D6CA 2K6AA 4NP5A 2E76C 3S2HB 1UAPA 1B3QA 4MZ9A 4JI4L 3HOWH 2WB1E 4F7XA 5C6AA 3HOUH 3MXNB 4OHJA 4UDUC 5DLQE 3U4VA 2RHSB 2F0IA 3D0FA 1YHQA 1PZID 5M3MB 3CXCA 3FKIG 2J4XA 2B2TA 1EQTA 1C8CA 4DNIA 1QZGA 2F0GA 4DF7A 5GAEC 1Q1BA 1H9MA 3I73A 1EYCA 1J6QA 2B63H 3FPUB 4CKCA 1Q86C 4NXMQ 4BY7B 2NB0A 3T13A 3GTJH 4RMFA 4CJ1B 4LFCQ 3F2DA 2N78A 1LT3D 2DY8A 2H4OA 1R9TH 5IYDH 2OEOA 3J81c 1SNOA 1D5XC 3UDXA 4ZCKA 4JG2A 1QVCA 3D3RA 1UE6A 1Y8OB 3PUYA 5IYCG 4P71A 2AWNA 4OONA 2UU9Q 1B44D 3RD4A 1GKHA 4GS3A 3OWFA 1DGSA 4HR7B 1SFOH 3I4NH 1C0AA 4YWLA 4J15A 4DR3L 3S24A 1WI5A 3JAMc 1XNQQ 5IP7H 5M3MG 1O7YA 2UXDL 2F0WA 2XRSD 5JEAG 5HY6A 3MEFA 4R1JA 3K6OA 4A3LG 4BY7G 4L8JA 4UPAA 1S5FD 1JWMD 3D4RA 4I7ZC 1TWFB 3A55A 3T1YQ 1JJ2A 3ONAB 2TMPA 3FKIH 4B3SQ 3KLSX 3S1QB 2DJGC 3KJPA 1TWGB 2EVBA 4BS9A 1PRTC 5JPNC 1C48A 1YEZA 4KHZA 1PH3A 4H02A 2JE6I 5C5MA 5I2YA 3I7FA 5ELOA 2EQSA 2F4VQ 3PQIA 2J7ZA 4O1NA 3DMUA 1ZKOA 2IX1A 2WB1B 4IOCA 3J7ZC 2YYZA 3OTOQ 4FF3A 2PCFB 1O7ZA 2UXCL 1W6KA 1NAPA 2Q2IA 4GLVB 1LYLA 1U5KA 2NTTA 3NQTA 2VQFL 3PF4A 1SYEA 4ODGA 2FINB 1I94L 2DJFC 3D4DA 4TVAB 5IYCH 2B2UA 1EWHA 1LACA 3DEPA 5IT9c 3S2HH 1BOSA 2HIXA 2PNRC 3K57A 2IHFA 1S3OA 1VQCA 1VQNA 3A7AB 1RODA 1PH2A 4LF7L 4JV5L 1LV9A 3CCEA 5M3MH 1QB5D 4DUZQ 4WFN3 1Q3LA 3J7A5 1L0XB 2CHBD 2EJMA 5EQ0A 2AQ3B 1HNWL 5JEAH 2MJ8A 5A35A 1PH8A 4A3LH 3RR5A 4BY7H 1CKNB 1KRSA 4OGQC 1JJGA 4FXDA 1C9OA 4A3JB 1Z47A 2WB1G 4YY3L 2CQOA 3BZCA 1YZ6A 3LWEA 4KHVA 1VQKA 2B39A 5EBCA 1ILPA 1RD9D 3HG9A 3ZYYX 4B3RQ 1X9NA 3H3VC 2O2LD 4GN3B 4PG3A 5ISRA 4AIMA 1SYDA 1UUPA 3AYHB 4R4QA 4JK1C 4HCEA 4QMGA 2BH8A 3TBIB 1A3VA 5LMNQ 1YJNA 4DR6L 2BE5D 3TQYA 4AYBE 1J5EL 2ZXOA 2JQOA 4UAIA 2DY7A 1B3AA 1D8LA 2JA7B 4YWMA 3LNNA 1UNSA 1WD0A 1XX8A 2E5LL 4A3FB 3NE5B 3T1HL 5EPKA 3A5ZB 1D5MC 1HA5A 1PYWD 1PFBA 1KDBA 1FYCA 1GOZA 4IJHA 1VQBA 1QCBD 2KQ3A 4RFBA 3U50C 2ID0A 3F2BA 4DV6Q 3PUZA 3K0YA 3KF6A 2H1EA 1MSGA 5EBDA 3A56A 3QOJA 1HR0W 5FLXE 5C4XB 4DKAC 5GAGC 4A3JG 1LT4D 4XQQA 1L0YB 3NXWA 4KHPL 1TWFH 2MNAA 2CH4A 2K5QA 2CCZA 5C44B 3S1QH 4P75A 1TWGH 1K8OA 1SAPA 3N52A 1VQAA 2LS01 5AJ3Q 1TT2A 3A8KE 3H09A 1IBLQ 1DONA 3AU7A 2F0DA 3MA2B 4PMBA 5FLMG 4BBSG 1EEFD 2JA7G 1MI2A 2HCCA 2IHEA 1U4RA 4DR1Q 4A3FG 5DAUA 4QGUA 2LXJA 2IY5B 1UE1A 2B2WC 1I4GA 2MFIA 1ASYA 2PQAB 4KMUC 3VYUA 4BXXG 2VXWA 1LTID 4KD4A 2DN8A 1YJ9A 3M7NA 2B29A 5D3IB 4LFAL 2FXQA 1VDZA 4NXNL 2PPBC 5C4XG 4YCWA 2EXDA 1LTLA 3T53B 1YNNC 4ZRZA 2IPKD 4DK6C 5BN3A 1EQQA 3X3MA 1STNA 1EQRA 2K52A 5IE8A 2Q2UA 3T16A 5KYIA 5C44G
chains in the Genus database with same CATH topology
3L7ZC 3R2IA 4N9TA 1JQYD 4AYBB 3EFXD 3JAME 1TS5A 1RTOA 4C3IB 2EYOA 3BVMA 3U9OA 2F0KA 3IKJA 5ELFA 4J8QA 1ILQA 1HTLD 2XNAC 5AFWA 3I70A 1TIID 3RZDB 1EFID 3GTOB 3GTQB 1RJTA 2F3VA 4HSPA 2EJFC 1E2ZA 1PFMA 3H6MA 5G3LD 1WTPA 2SOBA 3GTGB 1TKWB 4B9XA 1NR2A 1HQMC 2RA4A 5F2DA 3P20A 1RF2D 1Q8IA 2KOLA 1LT6D 4RKBA 1J9OA 3D31A 1GUGA 3MAQA 3S2DB 1H9SB 4C56C 3LX0A 2MPMA 4C3IG 3DUZA 1HA6A 1F2MA 1A2TA 2F0OA 3KUPA 4PMWA 2F03A 2PW5A 5KEEA 4ZAIA 5C4HA 4OO1G 3I72A 1SJHD 3L9AX 4FXKC 1ZXTA 2IT1A 2QF7A 3UI2A 1SYBA 2F3WA 2HDLA 1I6VC 2K04A 3QB3A 1S5CD 4TSSA 5C3EB 3QIAA 1BCPB 4XT1B 4QB4A 1ML0D 2IJ0A 1WTOA 1Y1VB 4B08A 5C4JB 4DK0A 4KY7A 1VCIA 4U673 1HUNA 1SMYD 1QNKA 3R93A 1GUWA 1G8ZD 2KECA 1G2SA 3E6ZX 2EYFA 3HOZB 2E74C 3S9WA 5CYUA 3Q24A 5EGTA 1QWYA 2LKVA 2HUGA 2M2LA 5DNFA 4YIJA 1B1ZA 3ITPA 3DEOA 3VA7A 1PRTD 1PFNA 1T5XD 2F4IA 3M7GA 1STBA 5FOBB 2F0JA 4OO1H 4LAAA 1CHQD 3K7AB 1OXVA 3TDQA 4IURA 3A54A 1O7LA 2IW3A 1I50B 4RCOA 3TSSA 3GTPB 1D2BA 3SHLA 4C2MB 1EIHA 5D65A 3K5OA 1BNZA 2B2TC 2F0QA 3NBIA 1HXYD 2RDGA 1IKMA 3PUXA 1TS4A 1LTSD 1V43A 3D4WA 3F2UA 4K5XA 4ZK9B 2BE5C 5CV4A 2BCOA 1MBYA 1C4QA 3IL8A 2BOSA 4DA2A 2C9OA 2KA7A 5I9PA 1JOKA 2GA4B 3DM1A 1JCKB 4DFAA 4EQPA 1SDFA 3SEBA 4FF1A 1EY4A 4DU9A 4F8MA 5EKKA 4FXGC 1BBXC 3OWEB 4C1NI 3C2PA 1HCZA 3HOYB 5CORA 4GZYC 3BVZA 5I2XA 2PO4A 4B9WA 4DAPA 1I3QB 1R4PB 1Q12A 1NUCA 2HQEA 4KV6A 5KNDA 1LLRD 1ENFA 3RMHA 1XXGA 1EY9A 2CW0C 4V0BA 4HN7A 3J81L 3HKZB 4DXFA 1CQVA 1B2TA 4NMZA 2KEEA 3VYSA 4J1MA 2L0CA 3QOLA 1IKLA 3ND8A 2NVXB 1V1OA 2RQXA 1RHPA 1WD1A 1OXSC 2EDGA 3JAML 1EU3A 5LHY1 1DOLA 4BWGB 2F0HA 4M1UB 5C0XI 1FNUA 4IZ8A 5E3FA 2F0PA 2B2YC 5IGGA 4DNTB 1TR5A 1CHPD 4HEDA 1BCPF 4RAUC 2O5IC 1R4QB 1PMRA 4A3IB 1WCMB 1ESRA 3NBHA 2LMCB 1A3TA 1Y8PB 3KLSA 5LL6S 2IX3A 4BA1I 1EIGA 1AFPA 5C0XJ 4NW2A 4I65A 1ONLA 3EVQA 1B9NA 3I4MB 4IQZA 4XIGS 1SXTA 2I46A 1JORA 5IT9L 1EWCA 1AW7A 4ZUJA 3DWQA 4IUNA 2AUJD 1PZKD 3SK5A 3S15B 1II3A 2XSCA 1YNJC 3T56B 1SE3A 1SNMA 1ET6A 2DNEA 1SNDA 3T4AC 2X6GA 1TWAB 3WOFA 5M3FB 2RVLA 1HRJA 4K2LA 4K14A 5FKAC 2G9HD 2XRQD 1SMYC 1DM0B 5EKLA 3S16B 1F9SA 4X3UA 3PMFA 1U9RA 2RBMA 1KABA 3MEHA 2D5DA 4LMQD 1PRTB 4XT3B 2FHTA 5C3WA 3SR1A 4HMIA 4RGMA 2V4DA 3K5NA 1S4ZA 2Z1CA 1GUSA 3A8IE 3BS1A 2KJXA 2M00A 4EGVA 1G6ZA 4PV1C 2J0TD 3IAYA 3J7AF 3NTKA 5FO7B 1SNCA 3SK6A 5LL6X 1SEBD 2E2IB 3R2TA 3CHBD 4Z9CB 2ICEC 2R61A 2OT2A 2WP8J 4KK7A 2WINB 2RSOA 1O78A 2LFNA 4H7BA 1GUNA 4RCNA 3BDOA 3MZ5A 4C3HB 2A6HD 2QCPX 3ND9A 2E75C 3SK8A 3R8BA 1KAAA 1PTOC 5I6YA 4IUUA 2PQEA 4DK1A 5KRUA 2B2YA 2F0VA 2K28A 1RKNA 5EPJA 4XYOA 4A3GB 1TVXA 3GO5A 2K03A 4ZLTF 4FNFA 1LTTD 5IGEA 4RHRA 2XVSA 1F9QA 3TP5A 2OXPA 2A6ED 4OIKA 5KIXA 4BBSB 2NVYB 3P1HA 1U4MA 3TN2A 2RKSA 3VR5A 4C3HG 1KNAA 4KY6A 3AMUA 3X3NA 5KGUA 4G4KA 1CFMA 1PXUA 2D9UA 4KJNA 3VR3A 2AQ2B 3TMEA 1SYFA 3D8GA 3OHXC 3IFTA 3EJIA 1DD2A 3G6JB 1X3QA 2XIWA 4FF2A 1QE6A 2PW7A 4PQXA 3MXNA 3SE0A 4FO2A 4FF4A 1GXDC 1ENCA 2A68D 2B8FA 3NP8A 2B2VA 1OXUA 3TZDA 4XXEA 4R8NA 2QKIC 4KN4C 3VYTA 5D3DA 2CW0D 5JVG3 4CKBA 4KD3A 4EQOA 3URYA 3J81E 4A3EB 5DM73 1MD2D 1BO0A 3QO2A 1EY6A 2AQ1B 2QEJC 2EY2A 1QG7A 2NVTB 3OW7A 1CK1A 5CV7A 4ZYSA 2KEDA 2RDHA 2G9DA 5EJWA 3J7AV 2L1BA 4KI0A 3MVVA 2ZXRA 2A69D 1WTXA 4P2CB 5IIFA 2B8GA 3EA6A 3S1NB 1KLUD 1PRTF 4C3JB 3I8ZA 1F2ZA 2MP1A 3CRLC 5TSSA 1F77A 1JOQA 2R93B 2F0NA 5EKIA 3WOEA 2FMCA 4BY1B 2Q8IB 4CKEA 1SNQA 3BG3A 3VYRA 3DXJC 4A93B 4K8JA 5IT9E 1OO9B 4K5WA 4C3JG 3Q22A 1GJXA 4RA8A 2NN6I 1AZQA 1SBBB 1JICA 2K5WA 4K6LA 3J80E 5C0XG 1YNJD 2O4XA 5CV6A 1ZYRD 1S5ED 3GD7A 4LK1C 1B4OA 4L63B 1CQFA 3MXPA 3MTSA 2JSOA 1V1PA 4IALA 2XN9C 4MHEA 5BN5A 4DAVA 2PZTA 3NQIA 5FO8B 1V8QA 1DCZA 3HS0C 2Z8LA 1O80A 4ILWA 1IW7C 4KKUA 2Z4IA 4RWSC 1G91A 1H9JA 5E4WC 3HOVB 1S5BD 2A6HC 1Y1WB 2ZXPA 1FR3A 5C3XA 5ELCA 1H9KA 3K59A 1STHA 1EOTA 1AN8A 2R3ZA 1I4HA 5C0XH 2JEAI 1I6HB 2KHSA 5D14A 2SDFA 1SSOA 1JE4A 3PO3B 2SNMA 2C5CA 1AEXA 1CTMA 3T51B 2NYZD 3S17B 4Y7NB 1PTOD 2A6EC 2WIIB 3NHHA 5E4XA 2WAQB 5IGBA 1GUOA 1SNPA 2EYJA 4KKSA 1HFNA 1M8AA 2HDMA 2R6GA 4FVMA 1CA6A 2R92B 5BN4A 1RCVD 1HTPA 2FFKB 2XWBB 4OIJA 3OSOA 4A3BB 1B53A 4ZQ3A 1BQQT 4IUVA 1AZPA 4KJOA 1Z6HA 1DOKA 1D1IA 2EY1A 2KCCA 3HOWB 1J8IA 4K8IA 1EZ8A 1Y69U 2SEBD 2A68C 1TY0A 2M9VA 2IX0A 1LTAD 2F0FA 2I07B 1RTNA 4Q0FA 5I6WA 2B63B 4IUQA 3BDLA 3NWTA 4QUCA 5I4DA 3AB9A 1WTWA 5K5PA 1TY2A 1B9MA 1IHZA 1OXXK 2F0EA 4CGYB 2E2HB 1Z7TA 1WVLA 1H9SA 1EY7A 5ELDA 4ULLA 4IFDI 2EYMA 5JVH3 3HRZC 2EE1A 1NR4A 3H94A 4OL7A 1X32A 3OMCA 4DXGA 3I3CA 4FYDA 4IUTA 2ENBA 1VMCA 2IWHA 1STEA 4V190 2KVMA 3U9SA 2A69C 1FNVA 3MC0B 4KY5A 2NWGA 4QF4A 1QILA 1EYDA 4IN3A 2VB2X 4IFDJ 3DWPA 2A74C 4U68A 2F0MA 1KDAA 5C4ZA 1DZ1A 3KK7A 5JJZA 3MXGA 4QIWB 2L4NA 1DYQA 1RDPD 3RZOB 5JAVA 3HP3A 2WKCA 3D6WA 1CM9A 5FO9B 1I4XA 3I90A 1JR0D 1KTKA 4TQUS 5CGKA 1EY5A 2EY6A 4XQNA 5DM63 1HUMA 2F0SA 4RHSA 4F87A 4NKLA 4FP5D 1SE2A 5M5XB 1CA5A 1EQVA 1LABA 4CJ0B 2X6LA 2BDOA 3NK9A 2R7ZB 3W3AA 3J80L 1EY0A 4RGOS 1F9RA 5NUCA 3OIPA 3FRPB 4HTHA 1CT1D 3GV6A 3MHBA 1XWEA 2BA0A 2MGSA 3CU7A 1SYCA 3GTMB 2K32A 4KKTA 2L12A 1ZYRC 2B2VC 3O13A 4S3SA 3V2TA 3VA5A 1MGSA 2O5JC 4K5VA 3BZDB 1FGBD 1QJOA 5HGTA 1JWUD 2EZVA 1GUTA 2JP1A 1DJRD 4ME5A 3WDNA 4R8IA 3E0JA 4E6IA 1T5EA 1LTRD 4A3DB 1Y8NB 3RUZA 2KCNA 5ELEA 2JA8B 5CC4A 2KUMA 3MFYA 3NPPA 1NSNS 1SYGA 5T1IA 2E2JB 5M9OA 1A2UA 5E1FA 2F1MA 1F9PA 1CZWA 2AUKA 4C1NK 2VUMB 3GTLB 1PZJD 2YU9B 3PIO3 3L3OC 5KNCA 1IW7D 5CV5A 1BCPD 1SJED 2A5HA 2VNUD 1PTOB 1A3UA 4F88A 1TWCB 2JEBI 3A7LA 1D5ZC 3PO2B 2K05A 4MN3A 2NVQB 3FDTA 2K1BA 4TKOB 2NN6G 5CBAE 2FMMA 5CMDA 4HAEA 3MXUA 4PMCA 3M4YA 2BDNA 2HCIA 3C1FA 3BYTB 2SNSA 1JB3A 5IGCA 3PUWA 1TS2A 2L11A 3FPPA 2MUYA 1A15A 2PZWA 1BXTA 2CVRA 1WTVA 5M5YB 5CBEE 2F0UA 2D62A 2EYLA 2K5DA 3GQBA 4WJWA 3N6RA 4M8AA 3MWYW 2EYHA 3TZUA 3NTHA 3KBGA 3Q0AA 3VR4A 3M85A 5G3LF 5A2QL 3J7YW 2DNCA 3GTKB 5IGDA 1V1PB 2K01A 2ZT9C 4QUFA 3EQLC 3HEJA 3VR6A 2L9HA 1TS3A 2XWJB 3I91A 4IUPA 3K5MA 2NN6H 3CRKC 3ERQA 1BUVT 1STGA 1I4RA 1HHVA 2JA6B 1ICWA 1BR9A 2AWOA 4DGZA 1K83B 4H0LC 1XTCD 3TP8A 1Q1EA 1CZGA 1PDQA 3C1EA 3PV0A 2Y0SB 3VR2A 3M3YB 5J39A 3RLFA 1IYVA 1U4PA 1DXMA 3SDZA 4LJZC 1PTOH 1GHKA 1EEID 3H91A 4KTAA 3SXHA 1TWHB 1FNWA 2PMZB 3CKIB 5K36G 5COYA 4DN4M 4RKLA 5CV9A 3SK4A 4BBRB 5M5WB 3C46A 3TP6A 1JWSD 4G7OC 4K2KA 1LO5D 2TSSA 2OF1A 2EJGC 1IYUA 1M4VA 4EQNA 5JOBA 3KLRA 4O42A 1EZ6A 4CJ2C 4H13C 1ESFA 2NZ1D 4G57A 1UEAB 3S14B 4WRDA 1TQOA 3GP7A 3K58A 1CI3M 1ENAA 2ICIA 3OPOA 2QILA 3S1RB 5FK9C 1KNEA 2A73B 5KYLA 1W6JA 2NBFA 3CQZB 3NUCA 1BF4A 2Z4HA 1STAA 4ABNA 4IFDG 4RGNA 3TP7A 3GV3A 1KDCA 2PZUA 1PTOF 4X3TA 5JEAJ 1B50A 4DNRB 2D2CC 1VF7A 3NSWA 5K36H 4HMJA 2BA1A 1LTGD 4RH6A 4JBWA 5EPLA 2WV6D 4A3MB 1HFGA 5ELBA 3PIP3 4H44C 4QCLA 3MFGA 3R3OA 4MIUA 3S1MB 3P75A 3V05A 2K33A 4NDXA 3HOXB 3G7LA 1FD7D 3C3LA 3OIQA 5CR3A 4EVOA 2IL8A 2L5TA 2MHVA 1Q90A 1G2TA 3NTIA 4J6HA 1U4LA 2PYKA 4ZKCB 1BCPC 4TRDA 4XYQA 4IFDH 3P7JA 4X3SA 4XDXA 2Q8RE 3HGBA 1EL0A 3FMCA 3E5SA 3QJYA 2F0TA 2JYOA 1NCVA 1ET9A 4A3KB 4ZKBB 3QWNA 5KNBA 1S5DD 4G7HC 3DWAA 2QDBA 4HCSA 3NWSA 1K8MA 2VB3X 2B2WA 4WORA 3I4LA 3HZXA 5I9OA 3K5LA 3BYYB 4RGTA 4Q5VA 3KBXA 2NUCA 1WTRA 2JXMB 3H0GB 3PUVA 1BDOA 1MSHA 4G7ZC 3V96A 2EYPA 5CV8A 1G291 1PLFA 3FEWX 2EOTA 2JA5B 2K7VA 4X3KA 3SVMA 3LWUA 4PNYA 2F0LA 1E2VA 1A6XA 4R9WA 5IOCA 4L6TB 1AP0A 2N88A 3FVQA 2FJ2A 1JOOA 3HOUB 5FLXL 3Q23A 1VF5C 1I4PA 4HSVA 1F2LA 5IODA 3EROA 3QG1A 5A2QE 5JPMC 1ZEQX 5T1GA 1HPCA 1STYA 2EPBA 3GTJB 2LY7A 4DAYA 3OMGA 5J22A 1R9TB 5HURA 2RSNA 1QOHA 1HQRD 5IGFA 1D6EC 2CQAA 3M4OB 3BDCA 1EY8A 4XTCS 3DHQA 4ZUIA 3Q6SA 2NTSA 3IFDA 4CBVA 4XQJA 1X3PA 1SFOB 4BA2I 3I4NB 3OOCA 2EXZA 1EYAA 2RDFA 2WKDA 1LTBD 2B2UC 1E2WA 4OO1I 1SE4A 1F2YA 1QNUA 1I4QA 1E0BA 2Q8TA 2E2DC 3FKIB 5C5LA 1WTQA 3A8JE 1TU2B 1JC7A 1LT5D 1DOMA 1EU4A 4N9PA 1KLGD 5J1ZA 2N55A 4ID6A 1YNND 3BVGA 1IL8A 1H9RA 1VMPA 2EY5A 4CHTB 2L55A 1XYIA 2WACA 1OXTA 3W2DA 4K6DA 4KN7C 3KF8A 1D1KA 2X69A 1GHJA 5DEHA 3D6CA 2K6AA 4NP5A 2E76C 3S2HB 1UAPA 4F7XA 5C6AA 4OHJA 4UDUC 2F0IA 1PZID 5M3MB 2J4XA 2B2TA 1EQTA 1C8CA 2F0GA 4DF7A 1Q1BA 1H9MA 3I73A 1EYCA 3FPUB 4CKCA 4BY7B 2NB0A 3T13A 4CJ1B 1LT3D 2DY8A 2H4OA 2OEOA 1SNOA 1D5XC 3D3RA 1Y8OB 3PUYA 2AWNA 1B44D 3RD4A 3OWFA 4HR7B 1O7YA 2F0WA 2XRSD 5JEAG 3K6OA 4L8JA 1S5FD 1JWMD 3D4RA 4I7ZC 1TWFB 3A55A 3ONAB 2TMPA 3KLSX 3S1QB 1TWGB 2EVBA 4BS9A 1PRTC 5JPNC 1C48A 4KHZA 2JE6I 5C5MA 5I2YA 2J7ZA 4O1NA 3DMUA 1ZKOA 2IX1A 2WB1B 2YYZA 4FF3A 2PCFB 1O7ZA 1W6KA 1NAPA 2NTTA 3NQTA 1SYEA 4ODGA 2FINB 3D4DA 2B2UA 1EWHA 1LACA 3DEPA 1BOSA 2PNRC 3K57A 3A7AB 1RODA 1LV9A 1QB5D 4WFN3 1Q3LA 1L0XB 2CHBD 2EJMA 5EQ0A 2AQ3B 5JEAH 2MJ8A 5A35A 4OGQC 4FXDA 4A3JB 1Z47A 3LWEA 4KHVA 2B39A 5EBCA 1ILPA 1RD9D 3HG9A 3ZYYX 3H3VC 2O2LD 5ISRA 1SYDA 1UUPA 4JK1C 4HCEA 4QMGA 3TBIB 1A3VA 2BE5D 2ZXOA 4UAIA 2DY7A 1B3AA 2JA7B 3LNNA 1UNSA 1WD0A 1XX8A 4A3FB 3NE5B 5EPKA 1D5MC 1HA5A 1PYWD 1PFBA 1KDBA 1FYCA 1GOZA 1QCBD 2KQ3A 4RFBA 2ID0A 3PUZA 3K0YA 2H1EA 1MSGA 5EBDA 3A56A 3QOJA 5FLXE 5C4XB 1LT4D 4XQQA 1L0YB 3NXWA 2K5QA 5C44B 1K8OA 1SAPA 3N52A 2LS01 1TT2A 3A8KE 3H09A 1DONA 3AU7A 2F0DA 3MA2B 4PMBA 1EEFD 1MI2A 2HCCA 1U4RA 5DAUA 2B2WC 1I4GA 4KMUC 3VYUA 2VXWA 1LTID 4KD4A 2DN8A 3M7NA 5D3IB 2PPBC 1VDZA 3T53B 1YNNC 4ZRZA 2IPKD 5BN3A 3X3MA 1STNA 3T16A 5KYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W A;  1KNE A;  3I91 A;  4IUP A;  1X3P A;  3LWE A;  1HUN A;  1QNK A;  3R93 A;  1DZ1 A;  1GUW A;  5T1I A;  5JJZ A;  2KEC A;  5COR A;  1M8A A;  1G2S A;  2HDM A;  1ILP A;  1HFN A;  2L4N A;  1BF4 A;  1RTO A;  1CA6 A;  1F9P A;  3HP3 A;  1HHV A;  3GV3 A;  2FFK B;  1BO0 A;  3KBX A;  1ICW A;  4X3T A;  4OIJ A;  4IUU A;  3D6W A;  1B50 A;  3QO2 A;  1B53 A;  1B4O A;  1ILQ A;  1CM9 A;  5AFW A;  2HUG A;  4IUV A;  2M2L A;  5DNF A;  2B2Y A;  4UAI A;  1AZP A;  1O7Y A;  1QG7 A;  2B2U C;  2DY7 A;  1B3A A;  3MTS A;  1WTR A;  3DEO A;  2K28 A;  1PFN A;  3I90 A;  1WD0 A;  1XX8 A;  5EPJ A;  1DOK A;  1RJT A;  5EPK A;  4MHE A;  1PDQ A;  1MSH A;  1E0B A;  2KED A;  2Q8T A;  1J8I A;  1PFB A;  1WTQ A;  5EJW A;  1PFM A;  1TVX A;  5EPL A;  2L1B A;  1HUM A;  2K03 A;  2K05 A;  4MN3 A;  4ZLT F;  3FDT A;  1WTP A;  1DOM A;  1B2T A;  2K1B A;  1HFG A;  1PLF A;  1HRJ A;  2H1E A;  1U4P A;  4IUR A;  5CBA E;  1MSG A;  2EOT A;  2KEE A;  2N55 A;  1CA5 A;  2FMM A;  5CMD A;  4X3K A;  3ONA B;  3SVM A;  1F9Q A;  1IKL A;  2X6L A;  2X6G A;  4CJ0 B;  1NR2 A;  4OIK A;  2RA4 A;  4HAE A;  1O80 A;  1WTX A;  1IL8 A;  1RTN A;  1VMP A;  2RVL A;  3H91 A;  4IUQ A;  1G6Z A;  2BDN A;  1U4M A;  1F9R A;  4R9W A;  1RHP A;  3TN2 A;  1WD1 A;  5D14 A;  3I8Z A;  2HCI A;  2KOL A;  1AP0 A;  2N88 A;  4QUC A;  1EIH A;  3GV6 A;  5D65 A;  1J9O A;  1KNA A;  2MP1 A;  2B2T C;  1BNZ A;  2J7Z A;  4RWS C;  1G91 A;  1WTW A;  5E4W C;  1XYI A;  2FJ2 A;  1F9S A;  2MGS A;  3G7L A;  4X3U A;  5COY A;  4DN4 M;  1IKM A;  2MPM A;  1SAP A;  2IL8 A;  1DOL A;  3N52 A;  1HA6 A;  1O7Z A;  2X69 A;  2L12 A;  4LMQ D;  4HSV A;  2L11 A;  4XT3 B;  1NAP A;  2D9U A;  3KUP A;  2FHT A;  1DON A;  1F2L A;  1G2T A;  1WVL A;  3F2U A;  4ZK9 B;  2B2V C;  1A15 A;  5EKI A;  4ZAI A;  1MGS A;  1EOT A;  2CVR A;  1WTV A;  5CBE E;  1MI2 A;  2HCC A;  2B2Y C;  2FIN B;  2R3Z A;  1S4Z A;  1U4R A;  1U4L A;  4ZKC B;  1ZXT A;  5T1G A;  2B2U A;  4HED A;  2EE1 A;  1NR4 A;  4RAU C;  3DEP A;  3IL8 A;  1X3Q A;  2B2W C;  2SDF A;  2XIW A;  1ESR A;  2EPB A;  1QE6 A;  1SSO A;  1EQT A;  1X32 A;  2B2T A;  3MWY W;  4O42 A;  1C8C A;  3P7J A;  4X3S A;  3UI2 A;  2JP1 A;  3DM1 A;  1JE4 A;  1ROD A;  2HDL A;  2VXW A;  3I3C A;  4IUT A;  4XDX A;  4CJ2 C;  1VMC A;  2K04 A;  1LV9 A;  3FPU B;  4R8I A;  2Q8R E;  2KVM A;  2NZ1 D;  1SDF A;  1EL0 A;  2RSN A;  1EIG A;  2NYZ D;  4XT1 B;  2K01 A;  2B2V A;  1Q3L A;  4CJ1 B;  2NWG A;  2JYO A;  4NW2 A;  1NCV A;  5EQ0 A;  1BBX C;  3TZD A;  4QUF A;  1ML0 D;  2DY8 A;  4ZKB B;  2MJ8 A;  1WTO A;  5E4X A;  4RA8 A;  3Q6S A;  2L9H A;  2RSO A;  3IFD A;  1AZQ A;  4HCS A;  2KUM A;  1JIC A;  4U68 A; 
#chains in the Genus database with same CATH topology
 3L7Z C;  3R2I A;  4N9T A;  1JQY D;  4AYB B;  1B8A A;  3EFX D;  3JAM E;  4MTN A;  1TS5 A;  4N8F A;  1RTO A;  4C3I B;  4A3J H;  2EYO A;  3BVM A;  3U9O A;  2F0K A;  3IKJ A;  1HZA A;  4A4I A;  5ELF A;  4J8Q A;  2A1A A;  1W2B A;  1VQH A;  1ILQ A;  1HTL D;  2XNA C;  5AFW A;  3I70 A;  1TII D;  3RZD B;  1EFI D;  1NMG A;  3GTO B;  1CUK A;  3GTQ B;  4YHH Q;  1RJT A;  1KD1 C;  2F3V A;  4HSP A;  3G48 A;  2EJF C;  1E2Z A;  5FLM H;  1PFM A;  3H6M A;  1GVP A;  2JA7 H;  5G3L D;  1WTP A;  4A3F H;  4DR7 L;  1N36 L;  2DUD A;  1OTC A;  2SOB A;  2UXB L;  4OEM B;  3GTG B;  2CWA A;  1IBK Q;  1TKW B;  4B9X A;  1NR2 A;  1HQM C;  2RA4 A;  5F2D A;  4X66 L;  4BXX H;  3I2Z A;  1VS0 A;  2R7F A;  3P20 A;  1RF2 D;  1Q8I A;  4R4T A;  2KOL A;  1LT6 D;  4AYB G;  4RKB A;  1J9O A;  3D31 A;  1GUG A;  3MAQ A;  3S2D B;  1H9S B;  5C4X H;  4C56 C;  3PIO A;  3LX0 A;  2MPM A;  4C3I G;  3DUZ A;  2K14 A;  1HA6 A;  2E8G A;  1F2M A;  1A2T A;  2F0O A;  3KUP A;  4PMW A;  2F03 A;  3W1G A;  2PW5 A;  5IY0 A;  5KEE A;  4ZAI A;  5C4H A;  5C44 H;  4OO1 G;  3I72 A;  3B6Y A;  4OWX B;  4B3T Q;  1SJH D;  3L9A X;  1SLJ A;  4FXK C;  1UE5 A;  1ZXT A;  2IT1 A;  2QF7 A;  2KCT A;  1FJG L;  3UI2 A;  1SYB A;  2F3W A;  2HDL A;  1I6V C;  3CC2 A;  2K04 A;  3QB3 A;  4ME3 A;  1S5C D;  4TSS A;  2I5L X;  5C3E B;  3QIA A;  1BCP B;  3E0E A;  4XT1 B;  4QB4 A;  4OX9 L;  3ULP A;  1ML0 D;  2IJ0 A;  2ZTE A;  1WTO A;  1Y1V B;  1K3R A;  4B08 A;  5C4J B;  4JBM A;  3GDE A;  4DK0 A;  4KY7 A;  1VCI A;  4U67 3;  1CKM A;  3JC6 6;  1KRT A;  1FL0 A;  1HUN A;  1SMY D;  1QNK A;  3R93 A;  1GUW A;  1G8Z D;  4YCV A;  2KEC A;  1G2S A;  4HJ7 A;  2F52 A;  3E6Z X;  1B70 B;  2EYF A;  3HOZ B;  2E74 C;  2K4K A;  2MO0 A;  3S9W A;  1YBY A;  1PH6 A;  5CYU A;  3Q24 A;  1E1O A;  5EGT A;  1QWY A;  2LKV A;  2HUG A;  2M2L A;  5DNF A;  4YIJ A;  1B1Z A;  3ITP A;  4C3I H;  3DEO A;  3VA7 A;  1PRT D;  1PFN A;  1T5X D;  4HID A;  1VQL A;  2F4I A;  3M7G A;  1STB A;  5J3B A;  5FOB B;  3H3V I;  5C3E G;  2F0J A;  4DV1 L;  3RZD H;  4OO1 H;  4LAA A;  1CHQ D;  4DR4 L;  3K7A B;  3GTO H;  1RIP A;  1OXV A;  3GTQ H;  1Q7Y C;  3TDQ A;  4IUR A;  4RG1 A;  2AHO B;  3A54 A;  1Y1V G;  1O7L A;  2ZTD A;  2AMC B;  2IW3 A;  3HKZ E;  1I50 B;  5IYB G;  1X54 A;  1YIJ A;  4RCO A;  3TSS A;  3GTP B;  1D2B A;  3A5U A;  4O0A A;  3SHL A;  4C2M B;  1N33 Q;  1EIH A;  5D65 A;  3K5O A;  1BNZ A;  3GTG H;  2B2T C;  2F0Q A;  3CPW A;  3CP0 A;  3NBI A;  4JI6 Q;  1Q81 C;  3HOZ G;  1HXY D;  2RDG A;  1IKM A;  4AH6 A;  3PUX A;  1TS4 A;  2I5H A;  1LTS D;  1V43 A;  3S2D H;  3D4W A;  3F2U A;  4K5X A;  4ZK9 B;  3OW2 A;  1K9M C;  5JJK A;  2YV5 A;  2BE5 C;  3I4O A;  5CV4 A;  1HNZ L;  2BCO A;  1PYB A;  4P72 A;  3G4S A;  1MBY A;  4GKK Q;  1C4Q A;  3IL8 A;  4WJ4 A;  2BOS A;  4DA2 A;  2C9O A;  2KA7 A;  2OQ0 A;  5I9P A;  4B3M L;  1JOK A;  2GA4 B;  3DM1 A;  3J81 i;  1JCK B;  4DFA A;  4EQP A;  1SDF A;  3SEB A;  4FF1 A;  1EY4 A;  1EFW A;  4DU9 A;  4F8M A;  5EKK A;  4LFB Q;  4FXG C;  1HZC A;  1BBX C;  3K8A A;  3OWE B;  4OEL B;  5C3E H;  1XMQ Q;  4C1N I;  2H5X A;  3JAM i;  3C2P A;  2MQH A;  1HCZ A;  3U58 A;  3HOY B;  5COR A;  4GZY C;  3RLN A;  1Y1V H;  3BVZ A;  5I2X A;  5C4J H;  2PO4 A;  4B9W A;  5IYB H;  4DAP A;  1I3Q B;  1R4P B;  5HGQ A;  1Q12 A;  1NUC A;  4JC0 A;  1CSQ A;  2HQE A;  4JI0 Q;  4KV6 A;  4LNQ A;  2YTX A;  5KND A;  3HOZ H;  1LLR D;  2VQE Q;  1ENF A;  3RMH A;  1GM5 A;  4LF6 Q;  1XXG A;  2RCF A;  3M4Q A;  3K0X A;  1EY9 A;  2CW0 C;  4V0B A;  4HN7 A;  4JI1 L;  3J81 L;  3HKZ B;  4DXF A;  1CQV A;  1B2T A;  2CWP A;  4NMZ A;  4DR5 Q;  3F1Z A;  2KEE A;  2L0C A;  4J1M A;  3VYS A;  1EWI A;  3QOL A;  1IKL A;  3ND8 A;  3K7A H;  2NVX B;  1V1O A;  2RQX A;  1RHP A;  1WD1 A;  1OXS C;  2EDG A;  3JAM L;  3HOY G;  1I50 H;  1EU3 A;  5LHY 1;  3GTP H;  1DOL A;  4BWG B;  2F0H A;  4M1U B;  1KAW A;  4C2M H;  3BU2 A;  5C0X I;  1HNX Q;  1VQ9 A;  1FNU A;  4IZ8 A;  1EIY B;  5E3F A;  2F0P A;  2B2Y C;  4DNT B;  5IGG A;  1TR5 A;  4A76 A;  2K5V A;  4X65 Q;  1CHP D;  4HED A;  1XPR A;  1BCP F;  4RAU C;  2O5I C;  1R4Q B;  3HKZ G;  1PMR A;  4DUY Q;  4A3I B;  1WCM B;  1ESR A;  3NBH A;  3PIP A;  2LMC B;  2I0Q A;  2DGY A;  1A3T A;  1Y8P B;  2VL6 A;  3E3X A;  3KLS A;  5LL6 S;  2IX3 A;  4JYA Q;  4BA1 I;  1GO3 E;  1EIG A;  1AFP A;  3FP9 A;  5C0X J;  4NW2 A;  4I65 A;  1ONL A;  3EVQ A;  1B9N A;  3I4M B;  4IQZ A;  4XIG S;  1XMO Q;  3KF6 B;  1SXT A;  2I46 A;  3PF5 A;  1ICF B;  1JOR A;  5IT9 L;  5BR8 L;  3KLW A;  1EWC A;  1AW7 A;  3CCU A;  3UDF A;  4ZUJ A;  3DWQ A;  4DV5 L;  1HR0 Q;  2HHH L;  3W1B A;  4IUN A;  4JI4 Q;  2AUJ D;  2Q2H A;  1PZK D;  3SK5 A;  3KDF A;  1I3Q H;  4A3I G;  1WCM G;  4JI8 L;  3S15 B;  1VQM A;  3A74 A;  4HIO A;  1II3 A;  2HIV A;  3TEH B;  1QUQ B;  2XSC A;  1YNJ C;  3T56 B;  3M4O H;  1SE3 A;  1SNM A;  3RN2 A;  1ET6 A;  2DNE A;  1SND A;  3T4A C;  2X6G A;  1TWA B;  3I4M G;  3WOF A;  5M3F B;  2RVL A;  4GNX A;  1HRJ A;  4JBJ A;  4K2L A;  1QVG A;  4K14 A;  1KC8 C;  3CF5 A;  5FKA C;  2G9H D;  2XRQ D;  1SMY C;  1DM0 B;  5EKL A;  3S16 B;  1F9S A;  2KCM A;  4X3U A;  1K8G A;  3PMF A;  1U9R A;  2RBM A;  3MEH A;  1KAB A;  2NVX H;  2D5D A;  4LMQ D;  4DV2 Q;  1PRT B;  1AE3 A;  4XT3 B;  2FHT A;  2VY3 A;  4JOI A;  3SR1 A;  5C3W A;  4HMI A;  3ULL A;  1X56 A;  4DR3 Q;  1VQG A;  4RGM A;  2V4D A;  3K5N A;  5ELN A;  1S4Z A;  2Z1C A;  1GUS A;  3A8I E;  3BS1 A;  1L1O A;  2KJX A;  2UXD Q;  2F4V L;  2M00 A;  4EGV A;  1G6Z A;  2N8N A;  3UE1 A;  4PV1 C;  2J0T D;  3IAY A;  3J7A F;  3OTO L;  3NTK A;  5FO7 B;  1SNC A;  3KJO A;  3SK6 A;  5LL6 X;  1SEB D;  2E2I B;  3R2T A;  3M9B A;  4GOP A;  1WOC A;  4A3I H;  1WCM H;  3CHB D;  4Z9C B;  1PVO A;  2ICE C;  4K0K L;  2R61 A;  4YCU A;  5M3F G;  3RLO A;  4JI7 L;  4CDE C;  2OT2 A;  2WP8 J;  1QZH A;  3CC4 A;  4KK7 A;  2WIN B;  2RSO A;  1O78 A;  2LFN A;  4H7B A;  1GUN A;  4RCN A;  3BDO A;  3MZ5 A;  1PFS A;  4C3H B;  4JCV E;  2A6H D;  4JI5 L;  3I4M H;  2QCP X;  3ND9 A;  2ZM6 L;  2E75 C;  3SK8 A;  3R8B A;  1KAA A;  3J80 c;  1PTO C;  2G5D A;  5GAD C;  5I6Y A;  2VQF Q;  4IUU A;  2PQE A;  4DK1 A;  4JI2 L;  1Q82 C;  1I94 Q;  4IPH A;  4JI3 L;  2B2Y A;  5KRU A;  2F0V A;  2K28 A;  1RKN A;  4FDB A;  5EPJ A;  4X64 L;  1CKO A;  4XYO A;  1HZB A;  4A3G B;  1TVX A;  3GO5 A;  2K03 A;  4LF7 Q;  4JV5 Q;  4ZLT F;  4FNF A;  3S15 H;  1LTT D;  5GQO A;  2UUA L;  5IGE A;  4RHR A;  1N32 L;  5LMN L;  2XVS A;  1F9Q A;  4IPC A;  3TP5 A;  2OXP A;  2A6E D;  4OIK A;  5KIX A;  1HNW Q;  4BBS B;  2NVY B;  4IJL A;  3P1H A;  1U4M A;  3TN2 A;  1E24 A;  2RKS A;  3VR5 A;  4C3H G;  1KNA A;  4YY3 Q;  1TWA H;  2V1C C;  4KY6 A;  3AMU A;  3X3N A;  5M3F H;  5KGU A;  4G4K A;  1VQ8 A;  1CFM A;  1PXU A;  2D9U A;  4KJN A;  3VR3 A;  2AQ2 B;  3TME A;  1SYF A;  1VQJ A;  2ZJP A;  4GKJ Q;  3D8G A;  3S16 H;  2Z6K A;  3OHX C;  3CPF A;  3IFT A;  3EJI A;  1J5E Q;  1DD2 A;  2GN5 A;  4A3G G;  4GN4 B;  1W3S A;  3G6J B;  1X3Q A;  2XIW A;  3T1H Q;  4FF2 A;  1QE6 A;  2PW7 A;  1VQE A;  2D0P A;  2CFM A;  4PQX A;  3MXN A;  3SE0 A;  5JJL A;  1BBU A;  4FO2 A;  4FF4 A;  1GXD C;  3G71 A;  1ENC A;  3UDG A;  2A68 D;  2B8F A;  3ERS X;  3NP8 A;  2B2V A;  1WTH A;  4KLK A;  2ATW A;  1OXU A;  3TZD A;  4DR1 L;  4XXE A;  5LMU L;  2E2I H;  3AFQ A;  4R8N A;  2QKI C;  4KN4 C;  4KHP Q;  3VYT A;  5D3D A;  4UHV A;  2CW0 D;  5JVG 3;  4CKB A;  2N3S A;  4IOA A;  4KD3 A;  2MO1 A;  4EQO A;  4WJ3 M;  3URY A;  3J81 E;  4A3E B;  1A8V A;  5DM7 3;  1MD2 D;  1BO0 A;  4JPB W;  5IWA L;  3QO2 A;  4C3H H;  1EY6 A;  2AQ1 B;  2QEJ C;  4QL5 A;  2EY2 A;  1QG7 A;  2PI2 E;  4EX5 A;  4CDF C;  1KL9 A;  2NVT B;  3OW7 A;  1CK1 A;  2QA4 A;  4A3C G;  1NBW A;  5CV7 A;  4ZYS A;  2KED A;  2RDH A;  4LF5 L;  1HH2 P;  2G9D A;  5EJW A;  3J7A V;  2L1B A;  4KI0 A;  3MVV A;  4R4O A;  1WYD A;  2ZXR A;  3H3V H;  2A69 D;  4MNO A;  4LFA Q;  4A3G H;  2R7D A;  4LUZ A;  1WTX A;  4P2C B;  5IIF A;  3CCJ A;  2B8G A;  3EA6 A;  3S1N B;  1KLU D;  1PRT F;  4C3J B;  3I8Z A;  1F2Z A;  1LUZ A;  1K0S A;  1P16 A;  2MP1 A;  1A63 A;  3CRL C;  5TSS A;  3M4P A;  1F77 A;  4A3E G;  4BBS H;  2NVY H;  4HJ8 A;  1IBM L;  1G51 A;  2JJQ A;  1JOQ A;  3KOJ A;  2R93 B;  2F0N A;  2KEN A;  4DV7 L;  5EKI A;  3WOE A;  4X62 L;  2FMC A;  4BY1 B;  4DAY B;  2Q8I B;  4CKE A;  1SNQ A;  5L37 A;  1EYG A;  3QR8 A;  3BG3 A;  3VYR A;  3DXJ C;  1PH9 A;  2OTL A;  1N36 Q;  2EIF A;  4LF8 L;  4A93 B;  2JA9 A;  2UXB Q;  4K8J A;  5IT9 E;  1OO9 B;  4A3C H;  4K5W A;  4B3T L;  3CW2 C;  1M90 C;  4C3J G;  4X66 Q;  3Q22 A;  1GJX A;  4RA8 A;  2NN6 I;  1AZQ A;  1SBB B;  1JIC A;  2K5W A;  4K6L A;  3J80 E;  1U0L A;  5C0X G;  1NNX A;  1YNJ D;  2R93 G;  2O4X A;  1CKN A;  5CV6 A;  1ZYR D;  2WAQ E;  4UY8 C;  1S5E D;  4BY1 G;  2K75 A;  3GD7 A;  4LK1 C;  1B4O A;  3HFZ B;  2HT1 A;  4L63 B;  1JE5 A;  1CQF A;  2OQK A;  3MXP A;  1XPO A;  3MTS A;  4GN5 A;  3AFP A;  2JSO A;  4A3E H;  4R4C A;  1V1P A;  4IAL A;  3W5O A;  2XN9 C;  4MHE A;  5BN5 A;  4DAV A;  2PZT A;  2GVA A;  1PA6 A;  1A62 A;  1JMC A;  3NQI A;  5FO8 B;  1V8Q A;  4A93 G;  2NVT H;  3NBH B;  1DCZ A;  3HS0 C;  4OX9 Q;  4LF9 L;  1X3E A;  1GD7 A;  2Z8L A;  1O80 A;  4ILW A;  1IW7 C;  4APV A;  3KF8 B;  5FJ8 G;  1XNR L;  4KKU A;  4L5S A;  1H95 A;  2YTY A;  2CH4 W;  4LWC A;  2UUC L;  2Z4I A;  4RWS C;  1G91 A;  1H9J A;  5E4W C;  3HOV B;  1S5B D;  3RNU A;  1YVC A;  2A6H C;  1Y1W B;  2ZXP A;  3S1N H;  4C3J H;  1FR3 A;  5C3X A;  5ELC A;  1H9K A;  3K59 A;  1I5F A;  1STH A;  4OXP A;  1EOT A;  3IRB A;  1AN8 A;  2R3Z A;  1I4H A;  5C0X H;  2JEA I;  1WJJ A;  1I6H B;  2R93 H;  2KHS A;  5D14 A;  2SDF A;  1SSO A;  1UE7 A;  1JE4 A;  3PSI A;  4BY1 H;  3CCS A;  3PO3 B;  4DV1 Q;  2SNM A;  2C5C A;  3CCL A;  3TS0 A;  4DR4 Q;  1AEX A;  1CTM A;  3T51 B;  2NYZ D;  3S17 B;  4Y7N B;  1PTO D;  2A6E C;  2WII B;  3NHH A;  4DV3 L;  5E4X A;  2I5M X;  4DV4 L;  2WAQ B;  4A93 H;  5IGB A;  3HOV G;  1GUO A;  3K7U C;  3BZK A;  1Y1W G;  3E9I A;  1SNP A;  2EYJ A;  4KKS A;  1HFN A;  1M8A A;  2HDM A;  4PZ6 A;  1XPU A;  2R6G A;  2OWO A;  4FVM A;  1CA6 A;  2R92 B;  5BN4 A;  1RCV D;  5FJ8 H;  1N34 L;  1HTP A;  3ER0 A;  2FFK B;  2XWB B;  4OIJ A;  3OSO A;  4A3B B;  1B53 A;  4ZQ3 A;  1PH7 A;  1BQQ T;  1HNZ Q;  4IUV A;  4QIW E;  4GNX C;  1AZP A;  4KJO A;  1Z6H A;  1V1Q A;  1DOK A;  1YJW A;  3PO3 G;  1D1I A;  2EY1 A;  2KCC A;  3KYH C;  3HOW B;  4QJF A;  4AQY L;  1J8I A;  4K8I A;  1EZ8 A;  1Y69 U;  1NE3 A;  2SEB D;  1JT8 A;  2KBN A;  2A68 C;  3CCQ A;  1TY0 A;  2M9V A;  2IX0 A;  4DR2 L;  4JOI C;  1LTA D;  2D0O A;  1IYJ B;  1VQ6 A;  5IP9 G;  2F0F A;  3U4Z A;  2I07 B;  2VQE L;  2WAQ G;  1RTN A;  4Q0F A;  5I6W A;  2B63 B;  4IUQ A;  2P5Z X;  3OYY A;  3BDL A;  4HIM A;  4GLX A;  2N49 A;  3NWT A;  1L1O C;  4UP8 A;  4JVZ A;  4QUC A;  5I4D A;  4LF4 L;  1KQS A;  3I55 A;  3AB9 A;  1WTW A;  1B7Y B;  2R92 G;  2QGQ A;  4CDD C;  5K5P A;  1TY2 A;  1B9M A;  1IHZ A;  1OXX K;  2F0E A;  4CGY B;  4GOP C;  4A3B G;  2E2H B;  1Z7T A;  1WVL A;  4L5R C;  1H9S A;  1EY7 A;  2B3G A;  3HOV H;  3CMA A;  1Y1W H;  5ELD A;  4ULL A;  4IFD I;  2UUB L;  2EYM A;  5JVH 3;  1RL2 A;  3HRZ C;  2EE1 A;  1NR4 A;  4DK3 C;  3HOW G;  1Y14 B;  1G6P A;  3H94 A;  4OL7 A;  1X32 A;  3CCM A;  3OMC A;  4DV0 L;  3HKS A;  4DXG A;  3I3C A;  4FYD A;  4IUT A;  2ENB A;  1VMC A;  2IWH A;  1STE A;  1I6H H;  1VQF A;  4V19 0;  2KVM A;  3U9S A;  2A69 C;  1UEB A;  3AQQ A;  1FNV A;  3MC0 B;  4KY5 A;  2NWG A;  4QF4 A;  2B63 G;  3PO3 H;  1QIL A;  1EYD A;  3J80 i;  1IL2 A;  4IN3 A;  2VB2 X;  3EBE A;  3DWP A;  4IFD J;  4GLA C;  2A74 C;  4U68 A;  3S17 H;  4Y7N H;  2F0M A;  1KDA A;  5C4Z A;  1DZ1 A;  3KK7 A;  5JJZ A;  3MXG A;  4QIW B;  1L0W A;  2L4N A;  5IP9 H;  5GAH C;  5H1S E;  1DYQ A;  1RDP D;  3RZO B;  5JAV A;  3HP3 A;  2WKC A;  3J81 j;  1PH1 A;  3D6W A;  3TS2 A;  1D7Q A;  1CM9 A;  5FO9 B;  2R92 H;  1I4X A;  3I90 A;  1JR0 D;  5FLX c;  1M1K C;  1KTK A;  1BKB A;  1K28 A;  4TQU S;  5CGK A;  1EY5 A;  2EY6 A;  4XQN A;  5DM6 3;  1HUM A;  2F0S A;  4RHS A;  4NXM L;  4F87 A;  1X65 A;  4NKL A;  4FP5 D;  1HR0 L;  1SE2 A;  5M5X B;  1CA5 A;  1EQV A;  1LAB A;  4LFC L;  2OTJ A;  4CJ0 B;  2X6L A;  2BDO A;  3HOY H;  3NK9 A;  1MJC A;  2Z6K C;  1VQ7 A;  2R7Z B;  3W3A A;  3J80 L;  2JN4 A;  2HQL A;  1EY0 A;  4RGO S;  1F9R A;  5NUC A;  3OIP A;  3FRP B;  4HTH A;  3ZJY C;  1CT1 D;  3GV6 A;  2QW7 A;  2KHJ A;  3MHB A;  1XWE A;  2BA0 A;  2VZA A;  1SE8 A;  2MGS A;  1K0R A;  3CU7 A;  1SYC A;  3GTM B;  2KHI A;  2K32 A;  4KKT A;  2UU9 L;  5BR8 Q;  2L12 A;  4DPG A;  2QEX A;  1ZYR C;  1T9H A;  4DV5 Q;  2B2V C;  2HHH Q;  3O13 A;  4S3S A;  1PHJ A;  3V2T A;  3VA5 A;  1MGS A;  2O5J C;  2ZJR A;  1BBW A;  1Q46 A;  4OWW B;  1XNQ L;  4K5V A;  3BZD B;  1FGB D;  1QJO A;  1JB7 A;  4JI8 Q;  1SN8 A;  3A0J A;  5HGT A;  2E2H H;  1JWU D;  3NEM A;  2EZV A;  1GUT A;  2JP1 A;  1VQ5 A;  1SR3 A;  5E7N A;  1E22 A;  4DV2 L;  1DJR D;  4ME5 A;  3WDN A;  4R8I A;  2A8V A;  3E0J A;  4E6I A;  1T5E A;  1LTR D;  3T1Y L;  4A3D B;  2R7Z G;  2HD3 A;  1Y8N B;  4B3S L;  3RUZ A;  2KCN A;  5ELE A;  2Z0S A;  1SRU A;  2JA8 B;  3STB D;  3AEV A;  5CC4 A;  2KUM A;  3MFY A;  1VQ4 A;  2XTI A;  1NMF A;  1NSN S;  3NPP A;  1JJC B;  1SYG A;  5T1I A;  2E2J B;  5M9O A;  3SGI A;  1A2U A;  5E1F A;  2F1M A;  1F9P A;  1CZW A;  2AUK A;  1O7I A;  4C1N K;  2VUM B;  3GTL B;  1PZJ D;  2YU9 B;  3PIO 3;  4POF A;  3L3O C;  5KNC A;  3RZO H;  2VW9 A;  1N8R C;  3KFU A;  1IW7 D;  5CV5 A;  1BCP D;  1SJE D;  2A5H A;  4N8X 1;  1CSP A;  4JW0 A;  3PGZ A;  2VNU D;  1PTO B;  1A3U A;  4F88 A;  1TWC B;  2JEB I;  3A7L A;  1D5Z C;  3PO2 B;  2K05 A;  4MN3 A;  2NVQ B;  3FDT A;  4A3D G;  2K1B A;  2UXC Q;  4PZ7 A;  4TKO B;  4DUZ L;  1X6O A;  2NN6 G;  3TRE A;  5CBA E;  4K0K Q;  2FMM A;  5CMD A;  2Y0S E;  4HAE A;  2JA8 G;  3MXU A;  4PMC A;  4JI7 Q;  3LGJ A;  1PYS B;  3M4Y A;  2BDN A;  3NEN A;  2HCI A;  1UWV A;  4IPG A;  5M5X H;  3C1F A;  1BVS A;  2R7Z H;  3BYT B;  4JI5 Q;  1V9P A;  1JB3 A;  2SNS A;  3DM3 A;  3PUW A;  5IGC A;  4B3R L;  1TS2 A;  2Z6B A;  2L11 A;  2ZM6 Q;  2VUM G;  3NEL A;  4UP7 A;  3FPP A;  1Z9F A;  2MUY A;  2WFW A;  1A15 A;  2JK8 A;  2VS1 A;  2PZW A;  1BXT A;  2CVR A;  1WTV A;  1VQO A;  5M5Y B;  3ULJ A;  2PMZ E;  4JI2 Q;  5CBE E;  3GTM H;  4Y52 H;  2ZJQ A;  2F0U A;  4IO9 A;  2D62 A;  2EYL A;  2K5D A;  4A75 A;  4JI3 Q;  3CC7 A;  3GQB A;  2QDL A;  4WJW A;  3N6R A;  4HJA A;  4M8A A;  4YWK A;  3MWY W;  1NJI C;  3PO2 G;  2EYH A;  4X64 Q;  3TZU A;  1LM0 A;  3NTH A;  3KBG A;  2ZTC A;  1C7Y A;  3Q0A A;  3VR4 A;  3M85 A;  5G3L F;  4DV6 L;  5A2Q L;  1YHA A;  3J7Y W;  2DNC A;  3GTK B;  5IGD A;  1V1P B;  2RHQ B;  4GKJ L;  2K01 A;  2UUA Q;  1N32 Q;  1N9W A;  2ZT9 C;  1AE2 A;  4QUF A;  3EQL C;  4DR6 Q;  3HEJ A;  4HIK A;  3UDI A;  3VR6 A;  2L9H A;  1TS3 A;  2XWJ B;  2E5L Q;  4X6A H;  4A3D H;  3I91 A;  4IUP A;  3K5M A;  2NN6 H;  1E3P A;  3CRK C;  3ERQ A;  4NPS A;  1BUV T;  1STG A;  2JA8 H;  1I4R A;  5AJ3 L;  1IBL L;  1HHV A;  2JA6 B;  1ICW A;  1BR9 A;  3L2P A;  2AWO A;  2E2J H;  4DGZ A;  1K83 B;  4H0L C;  1XTC D;  3TP8 A;  1Q1E A;  3VDY A;  1CZG A;  1VQP A;  1PDQ A;  3C1E A;  1TXY A;  3PV0 A;  1PH4 A;  2Y0S B;  2VUM H;  3GTL H;  3VR2 A;  2YU9 H;  1X3G A;  3CCR A;  3M3Y B;  5J39 A;  3RLF A;  1IYV A;  1U4P A;  1MKH A;  1DXM A;  1PTO H;  4LJZ C;  3SDZ A;  1PV4 A;  1GHK A;  1TWC H;  1L2F A;  1QUQ A;  1EEI D;  3PO2 H;  5LMU Q;  2NVQ H;  3H91 A;  4HJ5 A;  4KTA A;  4POG A;  3SXH A;  3F8T A;  1TWH B;  1S40 A;  1FNW A;  4L5Q A;  2PMZ B;  3CKI B;  5K36 G;  5COY A;  4DN4 M;  4RKL A;  2JA6 G;  1X3F A;  5CV9 A;  3SK4 A;  4BBR B;  5M5W B;  3C46 A;  3TP6 A;  4NXN Q;  1JWS D;  5IWA Q;  4K2K A;  3CD6 A;  4G7O C;  2RF4 A;  1LO5 D;  2TSS A;  2OF1 A;  2EJG C;  1IYU A;  1M4V A;  1SMX A;  4IPD A;  2ALY B;  2Y0S G;  5JOB A;  4EQN A;  4YHH L;  5GRO A;  3KLR A;  4O42 A;  1EZ6 A;  3EIV A;  5M5Y H;  4DAM A;  4LF5 Q;  4CJ2 C;  4H13 C;  1IXR A;  1ESF A;  2NZ1 D;  4G57 A;  1UEA B;  3S14 B;  1IBK L;  4WRD A;  1TQO A;  2Z9H A;  3GP7 A;  3K58 A;  1E7Z A;  1CI3 M;  1ENA A;  3GTK H;  2ICI A;  3OPO A;  2QIL A;  3S1R B;  5FK9 C;  1KNE A;  2A73 B;  5KYL A;  1W6J A;  2NBF A;  3CQZ B;  1YHB A;  3NUC A;  1BF4 A;  1QVF A;  4P74 A;  2Z4H A;  4BBR G;  1STA A;  1IBM Q;  4ABN A;  1K8A C;  4IFD G;  4RGN A;  3TP7 A;  4LW1 A;  3GV3 A;  1KDC A;  2PZU A;  4DR7 Q;  1PTO F;  4X3T A;  4DV7 Q;  5JEA J;  1B50 A;  4X62 Q;  4LUV A;  4DNR B;  2D2C C;  1VF7 A;  3NSW A;  5K36 H;  4LUO A;  4HMJ A;  2JA6 H;  2BA1 A;  1LTG D;  4RH6 A;  2NZH A;  4JBW A;  5EPL A;  1K83 H;  2WV6 D;  2K5N A;  1HZ9 A;  4A3M B;  1HFG A;  4LF8 Q;  1A0I A;  1YIT A;  5ELB A;  2AKW B;  1AH9 A;  3PIP 3;  3G6E A;  3M3Y H;  5LMN W;  4H44 C;  4QCL A;  1E1T A;  3MFG A;  3R3O A;  4MIU A;  3STB C;  3S1M B;  3P75 A;  1K3B C;  2ASB A;  3V05 A;  1S72 A;  1VQD A;  2K33 A;  4NDX A;  3HOX B;  3G7L A;  1FD7 D;  1FJG Q;  3C3L A;  3OIQ A;  5CR3 A;  4EVO A;  2IL8 A;  1KIX A;  3CME A;  2L5T A;  2MHV A;  1Q90 A;  1TWH H;  1G2T A;  3DLL A;  3NTI A;  4J6H A;  3RN5 A;  4MTK A;  1U4L A;  2PYK A;  4ZKC B;  1XJV A;  1BCP C;  4BBR H;  5M5W H;  4TRD A;  3I56 A;  3BJU A;  1YI2 A;  4XYQ A;  4IFD H;  1NTG A;  3P7J A;  4X3S A;  4XDX A;  4A3M G;  4PZ8 A;  2K50 A;  4HJ9 A;  2Q8R E;  2YTV A;  4CDC C;  3HGB A;  1EL0 A;  3FMC A;  3QJY A;  3E5S A;  2F0T A;  2A19 A;  2JYO A;  3Q8D A;  1NCV A;  1ET9 A;  4LF9 Q;  4A3K B;  4ZKB B;  3QWN A;  5KNB A;  1MHW C;  3PCO B;  1NY4 A;  1S5D D;  4G7H C;  1XNR Q;  1WFQ A;  3DWA A;  2QDB A;  4HCS A;  2L15 A;  3NWS A;  3EN2 A;  1K8M A;  3HOX G;  2UUC Q;  2VB3 X;  2B2W A;  4WOR A;  1N33 L;  4QQB X;  3S14 H;  1HJP A;  4JI6 L;  3I4L A;  3HZX A;  1MIU A;  2GVB A;  5I9O A;  3K5L A;  3KDF B;  3BYY B;  4I7A A;  2F3I A;  3S1R H;  4RGT A;  4Q5V A;  4P73 A;  5JJI A;  3KBX A;  2PQA A;  1PH5 A;  3CQZ H;  3E9H A;  1Q8K A;  3CAM A;  2NUC A;  1WTR A;  2JXM B;  4GKK L;  3H0G B;  1EOV A;  1P8L A;  3PUV A;  1BDO A;  1MSH A;  2ES2 A;  4G7Z C;  3V96 A;  2EYP A;  1FVI A;  1IZ6 A;  4R4I A;  4GNX B;  1MJE A;  3K81 C;  5CV8 A;  1G29 1;  1PLF A;  3FEW X;  1EIF A;  2EOT A;  4A3K G;  4LFB L;  2JA5 B;  2K7V A;  3K80 C;  4X3K A;  3LWU A;  3SVM A;  4PNY A;  2NZO A;  2F0L A;  2OCE A;  3TRZ A;  4DV3 Q;  1E2V A;  3L0O A;  1A6X A;  4R9W A;  4A3M H;  1XMQ L;  4DV4 Q;  5IOC A;  4L6T B;  1AP0 A;  2N88 A;  3ICE A;  2LXK A;  3FVQ A;  2FJ2 A;  1ASZ A;  4B3M Q;  1JOO A;  3HOU B;  5FLX L;  3Q23 A;  3S1M H;  1VF5 C;  1I4P A;  4HSV A;  2PNH A;  1F2L A;  1L1O B;  5IOD A;  1N34 Q;  1KHI A;  3HOX H;  4L5T A;  4JI0 L;  3ERO A;  3QG1 A;  5A2Q E;  3H0G G;  5JPM C;  4LF6 L;  1ZEQ X;  5T1G A;  1HPC A;  4GOP B;  1STY A;  2EPB A;  3GTJ B;  3FHW A;  4AQY Q;  2LY7 A;  4EQ5 A;  4DAY A;  3OMG A;  5J22 A;  1R9T B;  2RCN A;  5HUR A;  2RSN A;  1FGU A;  1QOH A;  2XGT A;  2JA5 G;  1EUJ A;  1HQR D;  4DR5 L;  5IGF A;  4DR2 Q;  1D6E C;  2CQA A;  5EAY A;  3M4O B;  3BDC A;  1X55 A;  1EY8 A;  4XTC S;  3DHQ A;  4ZUI A;  3Q6S A;  2NTS A;  3IFD A;  4CBV A;  2CKZ B;  4XQJ A;  4LF4 Q;  1X3P A;  1SFO B;  4BA2 I;  3I4N B;  3OOC A;  3HOU G;  4JI1 Q;  4A3K H;  4QY7 A;  1SRO A;  2EXZ A;  1EYA A;  1HNX L;  2RDF A;  2WKD A;  3WWV A;  1KXL A;  2C35 B;  2PI2 A;  1LTB D;  4ALP A;  1VQI A;  2UUB Q;  1XTD A;  2B2U C;  4X65 L;  1E2W A;  4OO1 I;  1SE4 A;  1F2Y A;  2LSS A;  4DUY L;  1QNU A;  1I4Q A;  1E0B A;  2Q8T A;  4JBK A;  4DV0 Q;  2E2D C;  3FKI B;  4OWT B;  5C5L A;  1WTQ A;  5IYD G;  3A8J E;  1TU2 B;  1JC7 A;  1LT5 D;  3H0G H;  4JYA L;  1DOM A;  4O2D A;  1EU4 A;  4N9P A;  1KLG D;  5J1Z A;  2N55 A;  1K73 C;  4ID6 A;  3F2C A;  1YNN D;  3BVG A;  1IL8 A;  1H9R A;  1VMP A;  2Q2T A;  2EY5 A;  1XMO L;  4CHT B;  3I4N G;  2JA5 H;  1YNX A;  2L55 A;  1XYI A;  2K5H A;  3H15 A;  5IP7 G;  4A3B H;  2WAC A;  1OXT A;  3CCV A;  3W2D A;  4K6D A;  3UE0 A;  4KN7 C;  3KF8 A;  4NB3 A;  2BH2 A;  4UP9 A;  1D1K A;  2X69 A;  1GHJ A;  5DEH A;  3D6C A;  2K6A A;  4NP5 A;  2E76 C;  3S2H B;  1UAP A;  1B3Q A;  4MZ9 A;  4JI4 L;  3HOW H;  2WB1 E;  4F7X A;  5C6A A;  3HOU H;  3MXN B;  4OHJ A;  4UDU C;  5DLQ E;  3U4V A;  2RHS B;  2F0I A;  3D0F A;  1YHQ A;  1PZI D;  5M3M B;  3CXC A;  3FKI G;  2J4X A;  2B2T A;  1EQT A;  1C8C A;  4DNI A;  1QZG A;  2F0G A;  4DF7 A;  5GAE C;  1Q1B A;  1H9M A;  3I73 A;  1EYC A;  1J6Q A;  2B63 H;  3FPU B;  4CKC A;  1Q86 C;  4NXM Q;  4BY7 B;  2NB0 A;  3T13 A;  3GTJ H;  4RMF A;  4CJ1 B;  4LFC Q;  3F2D A;  2N78 A;  1LT3 D;  2DY8 A;  2H4O A;  1R9T H;  5IYD H;  2OEO A;  3J81 c;  1SNO A;  1D5X C;  3UDX A;  4ZCK A;  4JG2 A;  1QVC A;  3D3R A;  1UE6 A;  1Y8O B;  3PUY A;  5IYC G;  4P71 A;  2AWN A;  4OON A;  2UU9 Q;  1B44 D;  3RD4 A;  1GKH A;  4GS3 A;  3OWF A;  1DGS A;  4HR7 B;  1SFO H;  3I4N H;  1C0A A;  4YWL A;  4J15 A;  4DR3 L;  3S24 A;  1WI5 A;  3JAM c;  1XNQ Q;  5IP7 H;  5M3M G;  1O7Y A;  2UXD L;  2F0W A;  2XRS D;  5JEA G;  5HY6 A;  3MEF A;  4R1J A;  3K6O A;  4A3L G;  4BY7 G;  4L8J A;  4UPA A;  1S5F D;  1JWM D;  3D4R A;  4I7Z C;  1TWF B;  3A55 A;  3T1Y Q;  1JJ2 A;  3ONA B;  2TMP A;  3FKI H;  4B3S Q;  3KLS X;  3S1Q B;  2DJG C;  3KJP A;  1TWG B;  2EVB A;  4BS9 A;  1PRT C;  5JPN C;  1C48 A;  1YEZ A;  4KHZ A;  1PH3 A;  4H02 A;  2JE6 I;  5C5M A;  5I2Y A;  3I7F A;  5ELO A;  2EQS A;  2F4V Q;  3PQI A;  2J7Z A;  4O1N A;  3DMU A;  1ZKO A;  2IX1 A;  2WB1 B;  4IOC A;  3J7Z C;  2YYZ A;  3OTO Q;  4FF3 A;  2PCF B;  1O7Z A;  2UXC L;  1W6K A;  1NAP A;  2Q2I A;  4GLV B;  1LYL A;  1U5K A;  2NTT A;  3NQT A;  2VQF L;  3PF4 A;  1SYE A;  4ODG A;  2FIN B;  1I94 L;  2DJF C;  3D4D A;  4TVA B;  5IYC H;  2B2U A;  1EWH A;  1LAC A;  3DEP A;  5IT9 c;  3S2H H;  1BOS A;  2HIX A;  2PNR C;  3K57 A;  2IHF A;  1S3O A;  1VQC A;  1VQN A;  3A7A B;  1ROD A;  1PH2 A;  4LF7 L;  4JV5 L;  1LV9 A;  3CCE A;  5M3M H;  1QB5 D;  4DUZ Q;  4WFN 3;  1Q3L A;  3J7A 5;  1L0X B;  2CHB D;  2EJM A;  5EQ0 A;  2AQ3 B;  1HNW L;  5JEA H;  2MJ8 A;  5A35 A;  1PH8 A;  4A3L H;  3RR5 A;  4BY7 H;  1CKN B;  1KRS A;  4OGQ C;  1JJG A;  4FXD A;  1C9O A;  4A3J B;  1Z47 A;  2WB1 G;  4YY3 L;  2CQO A;  3BZC A;  1YZ6 A;  3LWE A;  4KHV A;  1VQK A;  2B39 A;  5EBC A;  1ILP A;  1RD9 D;  3HG9 A;  3ZYY X;  4B3R Q;  1X9N A;  3H3V C;  2O2L D;  4GN3 B;  4PG3 A;  5ISR A;  4AIM A;  1SYD A;  1UUP A;  3AYH B;  4R4Q A;  4JK1 C;  4HCE A;  4QMG A;  2BH8 A;  3TBI B;  1A3V A;  5LMN Q;  1YJN A;  4DR6 L;  2BE5 D;  3TQY A;  4AYB E;  1J5E L;  2ZXO A;  2JQO A;  4UAI A;  2DY7 A;  1B3A A;  1D8L A;  2JA7 B;  4YWM A;  3LNN A;  1UNS A;  1WD0 A;  1XX8 A;  2E5L L;  4A3F B;  3NE5 B;  3T1H L;  5EPK A;  3A5Z B;  1D5M C;  1HA5 A;  1PYW D;  1PFB A;  1KDB A;  1FYC A;  1GOZ A;  4IJH A;  1VQB A;  1QCB D;  2KQ3 A;  4RFB A;  3U50 C;  2ID0 A;  3F2B A;  4DV6 Q;  3PUZ A;  3K0Y A;  3KF6 A;  2H1E A;  1MSG A;  5EBD A;  3A56 A;  3QOJ A;  1HR0 W;  5FLX E;  5C4X B;  4DKA C;  5GAG C;  4A3J G;  1LT4 D;  4XQQ A;  1L0Y B;  3NXW A;  4KHP L;  1TWF H;  2MNA A;  2CH4 A;  2K5Q A;  2CCZ A;  5C44 B;  3S1Q H;  4P75 A;  1TWG H;  1K8O A;  1SAP A;  3N52 A;  1VQA A;  2LS0 1;  5AJ3 Q;  1TT2 A;  3A8K E;  3H09 A;  1IBL Q;  1DON A;  3AU7 A;  2F0D A;  3MA2 B;  4PMB A;  5FLM G;  4BBS G;  1EEF D;  2JA7 G;  1MI2 A;  2HCC A;  2IHE A;  1U4R A;  4DR1 Q;  4A3F G;  5DAU A;  4QGU A;  2LXJ A;  2IY5 B;  1UE1 A;  2B2W C;  1I4G A;  2MFI A;  1ASY A;  2PQA B;  4KMU C;  3VYU A;  4BXX G;  2VXW A;  1LTI D;  4KD4 A;  2DN8 A;  1YJ9 A;  3M7N A;  2B29 A;  5D3I B;  4LFA L;  2FXQ A;  1VDZ A;  4NXN L;  2PPB C;  5C4X G;  4YCW A;  2EXD A;  1LTL A;  3T53 B;  1YNN C;  4ZRZ A;  2IPK D;  4DK6 C;  5BN3 A;  1EQQ A;  3X3M A;  1STN A;  1EQR A;  2K52 A;  5IE8 A;  2Q2U A;  3T16 A;  5KYI A;  5C44 G; 
#chains in the Genus database with same CATH homology
 3L7Z C;  3R2I A;  4N9T A;  1JQY D;  4AYB B;  3EFX D;  3JAM E;  1TS5 A;  1RTO A;  4C3I B;  2EYO A;  3BVM A;  3U9O A;  2F0K A;  3IKJ A;  5ELF A;  4J8Q A;  1ILQ A;  1HTL D;  2XNA C;  5AFW A;  3I70 A;  1TII D;  3RZD B;  1EFI D;  3GTO B;  3GTQ B;  1RJT A;  2F3V A;  4HSP A;  2EJF C;  1E2Z A;  1PFM A;  3H6M A;  5G3L D;  1WTP A;  2SOB A;  3GTG B;  1TKW B;  4B9X A;  1NR2 A;  1HQM C;  2RA4 A;  5F2D A;  3P20 A;  1RF2 D;  1Q8I A;  2KOL A;  1LT6 D;  4RKB A;  1J9O A;  3D31 A;  1GUG A;  3MAQ A;  3S2D B;  1H9S B;  4C56 C;  3LX0 A;  2MPM A;  4C3I G;  3DUZ A;  1HA6 A;  1F2M A;  1A2T A;  2F0O A;  3KUP A;  4PMW A;  2F03 A;  2PW5 A;  5KEE A;  4ZAI A;  5C4H A;  4OO1 G;  3I72 A;  1SJH D;  3L9A X;  4FXK C;  1ZXT A;  2IT1 A;  2QF7 A;  3UI2 A;  1SYB A;  2F3W A;  2HDL A;  1I6V C;  2K04 A;  3QB3 A;  1S5C D;  4TSS A;  5C3E B;  3QIA A;  1BCP B;  4XT1 B;  4QB4 A;  1ML0 D;  2IJ0 A;  1WTO A;  1Y1V B;  4B08 A;  5C4J B;  4DK0 A;  4KY7 A;  1VCI A;  4U67 3;  1HUN A;  1SMY D;  1QNK A;  3R93 A;  1GUW A;  1G8Z D;  2KEC A;  1G2S A;  3E6Z X;  2EYF A;  3HOZ B;  2E74 C;  3S9W A;  5CYU A;  3Q24 A;  5EGT A;  1QWY A;  2LKV A;  2HUG A;  2M2L A;  5DNF A;  4YIJ A;  1B1Z A;  3ITP A;  3DEO A;  3VA7 A;  1PRT D;  1PFN A;  1T5X D;  2F4I A;  3M7G A;  1STB A;  5FOB B;  2F0J A;  4OO1 H;  4LAA A;  1CHQ D;  3K7A B;  1OXV A;  3TDQ A;  4IUR A;  3A54 A;  1O7L A;  2IW3 A;  1I50 B;  4RCO A;  3TSS A;  3GTP B;  1D2B A;  3SHL A;  4C2M B;  1EIH A;  5D65 A;  3K5O A;  1BNZ A;  2B2T C;  2F0Q A;  3NBI A;  1HXY D;  2RDG A;  1IKM A;  3PUX A;  1TS4 A;  1LTS D;  1V43 A;  3D4W A;  3F2U A;  4K5X A;  4ZK9 B;  2BE5 C;  5CV4 A;  2BCO A;  1MBY A;  1C4Q A;  3IL8 A;  2BOS A;  4DA2 A;  2C9O A;  2KA7 A;  5I9P A;  1JOK A;  2GA4 B;  3DM1 A;  1JCK B;  4DFA A;  4EQP A;  1SDF A;  3SEB A;  4FF1 A;  1EY4 A;  4DU9 A;  4F8M A;  5EKK A;  4FXG C;  1BBX C;  3OWE B;  4C1N I;  3C2P A;  1HCZ A;  3HOY B;  5COR A;  4GZY C;  3BVZ A;  5I2X A;  2PO4 A;  4B9W A;  4DAP A;  1I3Q B;  1R4P B;  1Q12 A;  1NUC A;  2HQE A;  4KV6 A;  5KND A;  1LLR D;  1ENF A;  3RMH A;  1XXG A;  1EY9 A;  2CW0 C;  4V0B A;  4HN7 A;  3J81 L;  3HKZ B;  4DXF A;  1CQV A;  1B2T A;  4NMZ A;  2KEE A;  3VYS A;  4J1M A;  2L0C A;  3QOL A;  1IKL A;  3ND8 A;  2NVX B;  1V1O A;  2RQX A;  1RHP A;  1WD1 A;  1OXS C;  2EDG A;  3JAM L;  1EU3 A;  5LHY 1;  1DOL A;  4BWG B;  2F0H A;  4M1U B;  5C0X I;  1FNU A;  4IZ8 A;  5E3F A;  2F0P A;  2B2Y C;  5IGG A;  4DNT B;  1TR5 A;  1CHP D;  4HED A;  1BCP F;  4RAU C;  2O5I C;  1R4Q B;  1PMR A;  4A3I B;  1WCM B;  1ESR A;  3NBH A;  2LMC B;  1A3T A;  1Y8P B;  3KLS A;  5LL6 S;  2IX3 A;  4BA1 I;  1EIG A;  1AFP A;  5C0X J;  4NW2 A;  4I65 A;  1ONL A;  3EVQ A;  1B9N A;  3I4M B;  4IQZ A;  4XIG S;  1SXT A;  2I46 A;  1JOR A;  5IT9 L;  1EWC A;  1AW7 A;  4ZUJ A;  3DWQ A;  4IUN A;  2AUJ D;  1PZK D;  3SK5 A;  3S15 B;  1II3 A;  2XSC A;  1YNJ C;  3T56 B;  1SE3 A;  1SNM A;  1ET6 A;  2DNE A;  1SND A;  3T4A C;  2X6G A;  1TWA B;  3WOF A;  5M3F B;  2RVL A;  1HRJ A;  4K2L A;  4K14 A;  5FKA C;  2G9H D;  2XRQ D;  1SMY C;  1DM0 B;  5EKL A;  3S16 B;  1F9S A;  4X3U A;  3PMF A;  1U9R A;  2RBM A;  1KAB A;  3MEH A;  2D5D A;  4LMQ D;  1PRT B;  4XT3 B;  2FHT A;  5C3W A;  3SR1 A;  4HMI A;  4RGM A;  2V4D A;  3K5N A;  1S4Z A;  2Z1C A;  1GUS A;  3A8I E;  3BS1 A;  2KJX A;  2M00 A;  4EGV A;  1G6Z A;  4PV1 C;  2J0T D;  3IAY A;  3J7A F;  3NTK A;  5FO7 B;  1SNC A;  3SK6 A;  5LL6 X;  1SEB D;  2E2I B;  3R2T A;  3CHB D;  4Z9C B;  2ICE C;  2R61 A;  2OT2 A;  2WP8 J;  4KK7 A;  2WIN B;  2RSO A;  1O78 A;  2LFN A;  4H7B A;  1GUN A;  4RCN A;  3BDO A;  3MZ5 A;  4C3H B;  2A6H D;  2QCP X;  3ND9 A;  2E75 C;  3SK8 A;  3R8B A;  1KAA A;  1PTO C;  5I6Y A;  4IUU A;  2PQE A;  4DK1 A;  5KRU A;  2B2Y A;  2F0V A;  2K28 A;  1RKN A;  5EPJ A;  4XYO A;  4A3G B;  1TVX A;  3GO5 A;  2K03 A;  4ZLT F;  4FNF A;  1LTT D;  5IGE A;  4RHR A;  2XVS A;  1F9Q A;  3TP5 A;  2OXP A;  2A6E D;  4OIK A;  5KIX A;  4BBS B;  2NVY B;  3P1H A;  1U4M A;  3TN2 A;  2RKS A;  3VR5 A;  4C3H G;  1KNA A;  4KY6 A;  3AMU A;  3X3N A;  5KGU A;  4G4K A;  1CFM A;  1PXU A;  2D9U A;  4KJN A;  3VR3 A;  2AQ2 B;  3TME A;  1SYF A;  3D8G A;  3OHX C;  3IFT A;  3EJI A;  1DD2 A;  3G6J B;  1X3Q A;  2XIW A;  4FF2 A;  1QE6 A;  2PW7 A;  4PQX A;  3MXN A;  3SE0 A;  4FO2 A;  4FF4 A;  1GXD C;  1ENC A;  2A68 D;  2B8F A;  3NP8 A;  2B2V A;  1OXU A;  3TZD A;  4XXE A;  4R8N A;  2QKI C;  4KN4 C;  3VYT A;  5D3D A;  2CW0 D;  5JVG 3;  4CKB A;  4KD3 A;  4EQO A;  3URY A;  3J81 E;  4A3E B;  5DM7 3;  1MD2 D;  1BO0 A;  3QO2 A;  1EY6 A;  2AQ1 B;  2QEJ C;  2EY2 A;  1QG7 A;  2NVT B;  3OW7 A;  1CK1 A;  5CV7 A;  4ZYS A;  2KED A;  2RDH A;  2G9D A;  5EJW A;  3J7A V;  2L1B A;  4KI0 A;  3MVV A;  2ZXR A;  2A69 D;  1WTX A;  4P2C B;  5IIF A;  2B8G A;  3EA6 A;  3S1N B;  1KLU D;  1PRT F;  4C3J B;  3I8Z A;  1F2Z A;  2MP1 A;  3CRL C;  5TSS A;  1F77 A;  1JOQ A;  2R93 B;  2F0N A;  5EKI A;  3WOE A;  2FMC A;  4BY1 B;  2Q8I B;  4CKE A;  1SNQ A;  3BG3 A;  3VYR A;  3DXJ C;  4A93 B;  4K8J A;  5IT9 E;  1OO9 B;  4K5W A;  4C3J G;  3Q22 A;  1GJX A;  4RA8 A;  2NN6 I;  1AZQ A;  1SBB B;  1JIC A;  2K5W A;  4K6L A;  3J80 E;  5C0X G;  1YNJ D;  2O4X A;  5CV6 A;  1ZYR D;  1S5E D;  3GD7 A;  4LK1 C;  1B4O A;  4L63 B;  1CQF A;  3MXP A;  3MTS A;  2JSO A;  1V1P A;  4IAL A;  2XN9 C;  4MHE A;  5BN5 A;  4DAV A;  2PZT A;  3NQI A;  5FO8 B;  1V8Q A;  1DCZ A;  3HS0 C;  2Z8L A;  1O80 A;  4ILW A;  1IW7 C;  4KKU A;  2Z4I A;  4RWS C;  1G91 A;  1H9J A;  5E4W C;  3HOV B;  1S5B D;  2A6H C;  1Y1W B;  2ZXP A;  1FR3 A;  5C3X A;  5ELC A;  1H9K A;  3K59 A;  1STH A;  1EOT A;  1AN8 A;  2R3Z A;  1I4H A;  5C0X H;  2JEA I;  1I6H B;  2KHS A;  5D14 A;  2SDF A;  1SSO A;  1JE4 A;  3PO3 B;  2SNM A;  2C5C A;  1AEX A;  1CTM A;  3T51 B;  2NYZ D;  3S17 B;  4Y7N B;  1PTO D;  2A6E C;  2WII B;  3NHH A;  5E4X A;  2WAQ B;  5IGB A;  1GUO A;  1SNP A;  2EYJ A;  4KKS A;  1HFN A;  1M8A A;  2HDM A;  2R6G A;  4FVM A;  1CA6 A;  2R92 B;  5BN4 A;  1RCV D;  1HTP A;  2FFK B;  2XWB B;  4OIJ A;  3OSO A;  4A3B B;  1B53 A;  4ZQ3 A;  1BQQ T;  4IUV A;  1AZP A;  4KJO A;  1Z6H A;  1DOK A;  1D1I A;  2EY1 A;  2KCC A;  3HOW B;  1J8I A;  4K8I A;  1EZ8 A;  1Y69 U;  2SEB D;  2A68 C;  1TY0 A;  2M9V A;  2IX0 A;  1LTA D;  2F0F A;  2I07 B;  1RTN A;  4Q0F A;  5I6W A;  2B63 B;  4IUQ A;  3BDL A;  3NWT A;  4QUC A;  5I4D A;  3AB9 A;  1WTW A;  5K5P A;  1TY2 A;  1B9M A;  1IHZ A;  1OXX K;  2F0E A;  4CGY B;  2E2H B;  1Z7T A;  1WVL A;  1H9S A;  1EY7 A;  5ELD A;  4ULL A;  4IFD I;  2EYM A;  5JVH 3;  3HRZ C;  2EE1 A;  1NR4 A;  3H94 A;  4OL7 A;  1X32 A;  3OMC A;  4DXG A;  3I3C A;  4FYD A;  4IUT A;  2ENB A;  1VMC A;  2IWH A;  1STE A;  4V19 0;  2KVM A;  3U9S A;  2A69 C;  1FNV A;  3MC0 B;  4KY5 A;  2NWG A;  4QF4 A;  1QIL A;  1EYD A;  4IN3 A;  2VB2 X;  4IFD J;  3DWP A;  2A74 C;  4U68 A;  2F0M A;  1KDA A;  5C4Z A;  1DZ1 A;  3KK7 A;  5JJZ A;  3MXG A;  4QIW B;  2L4N A;  1DYQ A;  1RDP D;  3RZO B;  5JAV A;  3HP3 A;  2WKC A;  3D6W A;  1CM9 A;  5FO9 B;  1I4X A;  3I90 A;  1JR0 D;  1KTK A;  4TQU S;  5CGK A;  1EY5 A;  2EY6 A;  4XQN A;  5DM6 3;  1HUM A;  2F0S A;  4RHS A;  4F87 A;  4NKL A;  4FP5 D;  1SE2 A;  5M5X B;  1CA5 A;  1EQV A;  1LAB A;  4CJ0 B;  2X6L A;  2BDO A;  3NK9 A;  2R7Z B;  3W3A A;  3J80 L;  1EY0 A;  4RGO S;  1F9R A;  5NUC A;  3OIP A;  3FRP B;  4HTH A;  1CT1 D;  3GV6 A;  3MHB A;  1XWE A;  2BA0 A;  2MGS A;  3CU7 A;  1SYC A;  3GTM B;  2K32 A;  4KKT A;  2L12 A;  1ZYR C;  2B2V C;  3O13 A;  4S3S A;  3V2T A;  3VA5 A;  1MGS A;  2O5J C;  4K5V A;  3BZD B;  1FGB D;  1QJO A;  5HGT A;  1JWU D;  2EZV A;  1GUT A;  2JP1 A;  1DJR D;  4ME5 A;  3WDN A;  4R8I A;  3E0J A;  4E6I A;  1T5E A;  1LTR D;  4A3D B;  1Y8N B;  3RUZ A;  2KCN A;  5ELE A;  2JA8 B;  5CC4 A;  2KUM A;  3MFY A;  3NPP A;  1NSN S;  1SYG A;  5T1I A;  2E2J B;  5M9O A;  1A2U A;  5E1F A;  2F1M A;  1F9P A;  1CZW A;  2AUK A;  4C1N K;  2VUM B;  3GTL B;  1PZJ D;  2YU9 B;  3PIO 3;  3L3O C;  5KNC A;  1IW7 D;  5CV5 A;  1BCP D;  1SJE D;  2A5H A;  2VNU D;  1PTO B;  1A3U A;  4F88 A;  1TWC B;  2JEB I;  3A7L A;  1D5Z C;  3PO2 B;  2K05 A;  4MN3 A;  2NVQ B;  3FDT A;  2K1B A;  4TKO B;  2NN6 G;  5CBA E;  2FMM A;  5CMD A;  4HAE A;  3MXU A;  4PMC A;  3M4Y A;  2BDN A;  2HCI A;  3C1F A;  3BYT B;  2SNS A;  1JB3 A;  5IGC A;  3PUW A;  1TS2 A;  2L11 A;  3FPP A;  2MUY A;  1A15 A;  2PZW A;  1BXT A;  2CVR A;  1WTV A;  5M5Y B;  5CBE E;  2F0U A;  2D62 A;  2EYL A;  2K5D A;  3GQB A;  4WJW A;  3N6R A;  4M8A A;  3MWY W;  2EYH A;  3TZU A;  3NTH A;  3KBG A;  3Q0A A;  3VR4 A;  3M85 A;  5G3L F;  5A2Q L;  3J7Y W;  2DNC A;  3GTK B;  5IGD A;  1V1P B;  2K01 A;  2ZT9 C;  4QUF A;  3EQL C;  3HEJ A;  3VR6 A;  2L9H A;  1TS3 A;  2XWJ B;  3I91 A;  4IUP A;  3K5M A;  2NN6 H;  3CRK C;  3ERQ A;  1BUV T;  1STG A;  1I4R A;  1HHV A;  2JA6 B;  1ICW A;  1BR9 A;  2AWO A;  4DGZ A;  1K83 B;  4H0L C;  1XTC D;  3TP8 A;  1Q1E A;  1CZG A;  1PDQ A;  3C1E A;  3PV0 A;  2Y0S B;  3VR2 A;  3M3Y B;  5J39 A;  3RLF A;  1IYV A;  1U4P A;  1DXM A;  3SDZ A;  4LJZ C;  1PTO H;  1GHK A;  1EEI D;  3H91 A;  4KTA A;  3SXH A;  1TWH B;  1FNW A;  2PMZ B;  3CKI B;  5K36 G;  5COY A;  4DN4 M;  4RKL A;  5CV9 A;  3SK4 A;  4BBR B;  5M5W B;  3C46 A;  3TP6 A;  1JWS D;  4G7O C;  4K2K A;  1LO5 D;  2TSS A;  2OF1 A;  2EJG C;  1IYU A;  1M4V A;  4EQN A;  5JOB A;  3KLR A;  4O42 A;  1EZ6 A;  4CJ2 C;  4H13 C;  1ESF A;  2NZ1 D;  4G57 A;  1UEA B;  3S14 B;  4WRD A;  1TQO A;  3GP7 A;  3K58 A;  1CI3 M;  1ENA A;  2ICI A;  3OPO A;  2QIL A;  3S1R B;  5FK9 C;  1KNE A;  2A73 B;  5KYL A;  1W6J A;  2NBF A;  3CQZ B;  3NUC A;  1BF4 A;  2Z4H A;  1STA A;  4ABN A;  4IFD G;  4RGN A;  3TP7 A;  3GV3 A;  1KDC A;  2PZU A;  1PTO F;  4X3T A;  5JEA J;  1B50 A;  4DNR B;  2D2C C;  1VF7 A;  3NSW A;  5K36 H;  4HMJ A;  2BA1 A;  1LTG D;  4RH6 A;  4JBW A;  5EPL A;  2WV6 D;  4A3M B;  1HFG A;  5ELB A;  3PIP 3;  4H44 C;  4QCL A;  3MFG A;  3R3O A;  4MIU A;  3S1M B;  3P75 A;  3V05 A;  2K33 A;  4NDX A;  3HOX B;  3G7L A;  1FD7 D;  3C3L A;  3OIQ A;  5CR3 A;  4EVO A;  2IL8 A;  2L5T A;  2MHV A;  1Q90 A;  1G2T A;  3NTI A;  4J6H A;  1U4L A;  2PYK A;  4ZKC B;  1BCP C;  4TRD A;  4XYQ A;  4IFD H;  3P7J A;  4X3S A;  4XDX A;  2Q8R E;  3HGB A;  1EL0 A;  3FMC A;  3E5S A;  3QJY A;  2F0T A;  2JYO A;  1NCV A;  1ET9 A;  4A3K B;  4ZKB B;  3QWN A;  5KNB A;  1S5D D;  4G7H C;  3DWA A;  2QDB A;  4HCS A;  3NWS A;  1K8M A;  2VB3 X;  2B2W A;  4WOR A;  3I4L A;  3HZX A;  5I9O A;  3K5L A;  3BYY B;  4RGT A;  4Q5V A;  3KBX A;  2NUC A;  1WTR A;  2JXM B;  3H0G B;  3PUV A;  1BDO A;  1MSH A;  4G7Z C;  3V96 A;  2EYP A;  5CV8 A;  1G29 1;  1PLF A;  3FEW X;  2EOT A;  2JA5 B;  2K7V A;  4X3K A;  3SVM A;  3LWU A;  4PNY A;  2F0L A;  1E2V A;  1A6X A;  4R9W A;  5IOC A;  4L6T B;  1AP0 A;  2N88 A;  3FVQ A;  2FJ2 A;  1JOO A;  3HOU B;  5FLX L;  3Q23 A;  1VF5 C;  1I4P A;  4HSV A;  1F2L A;  5IOD A;  3ERO A;  3QG1 A;  5A2Q E;  5JPM C;  1ZEQ X;  5T1G A;  1HPC A;  1STY A;  2EPB A;  3GTJ B;  2LY7 A;  4DAY A;  3OMG A;  5J22 A;  1R9T B;  5HUR A;  2RSN A;  1QOH A;  1HQR D;  5IGF A;  1D6E C;  2CQA A;  3M4O B;  3BDC A;  1EY8 A;  4XTC S;  3DHQ A;  4ZUI A;  3Q6S A;  2NTS A;  3IFD A;  4CBV A;  4XQJ A;  1X3P A;  1SFO B;  4BA2 I;  3I4N B;  3OOC A;  2EXZ A;  1EYA A;  2RDF A;  2WKD A;  1LTB D;  2B2U C;  1E2W A;  4OO1 I;  1SE4 A;  1F2Y A;  1QNU A;  1I4Q A;  1E0B A;  2Q8T A;  2E2D C;  3FKI B;  5C5L A;  1WTQ A;  3A8J E;  1TU2 B;  1JC7 A;  1LT5 D;  1DOM A;  1EU4 A;  4N9P A;  1KLG D;  5J1Z A;  2N55 A;  4ID6 A;  1YNN D;  3BVG A;  1IL8 A;  1H9R A;  1VMP A;  2EY5 A;  4CHT B;  2L55 A;  1XYI A;  2WAC A;  1OXT A;  3W2D A;  4K6D A;  4KN7 C;  3KF8 A;  1D1K A;  2X69 A;  1GHJ A;  5DEH A;  3D6C A;  2K6A A;  4NP5 A;  2E76 C;  3S2H B;  1UAP A;  4F7X A;  5C6A A;  4OHJ A;  4UDU C;  2F0I A;  1PZI D;  5M3M B;  2J4X A;  2B2T A;  1EQT A;  1C8C A;  2F0G A;  4DF7 A;  1Q1B A;  1H9M A;  3I73 A;  1EYC A;  3FPU B;  4CKC A;  4BY7 B;  2NB0 A;  3T13 A;  4CJ1 B;  1LT3 D;  2DY8 A;  2H4O A;  2OEO A;  1SNO A;  1D5X C;  3D3R A;  1Y8O B;  3PUY A;  2AWN A;  1B44 D;  3RD4 A;  3OWF A;  4HR7 B;  1O7Y A;  2F0W A;  2XRS D;  5JEA G;  3K6O A;  4L8J A;  1S5F D;  1JWM D;  3D4R A;  4I7Z C;  1TWF B;  3A55 A;  3ONA B;  2TMP A;  3KLS X;  3S1Q B;  1TWG B;  2EVB A;  4BS9 A;  1PRT C;  5JPN C;  1C48 A;  4KHZ A;  2JE6 I;  5C5M A;  5I2Y A;  2J7Z A;  4O1N A;  3DMU A;  1ZKO A;  2IX1 A;  2WB1 B;  2YYZ A;  4FF3 A;  2PCF B;  1O7Z A;  1W6K A;  1NAP A;  2NTT A;  3NQT A;  1SYE A;  4ODG A;  2FIN B;  3D4D A;  2B2U A;  1EWH A;  1LAC A;  3DEP A;  1BOS A;  2PNR C;  3K57 A;  3A7A B;  1ROD A;  1LV9 A;  1QB5 D;  4WFN 3;  1Q3L A;  1L0X B;  2CHB D;  2EJM A;  5EQ0 A;  2AQ3 B;  5JEA H;  2MJ8 A;  5A35 A;  4OGQ C;  4FXD A;  4A3J B;  1Z47 A;  3LWE A;  4KHV A;  2B39 A;  5EBC A;  1ILP A;  1RD9 D;  3HG9 A;  3ZYY X;  3H3V C;  2O2L D;  5ISR A;  1SYD A;  1UUP A;  4JK1 C;  4HCE A;  4QMG A;  3TBI B;  1A3V A;  2BE5 D;  2ZXO A;  4UAI A;  2DY7 A;  1B3A A;  2JA7 B;  3LNN A;  1UNS A;  1WD0 A;  1XX8 A;  4A3F B;  3NE5 B;  5EPK A;  1D5M C;  1HA5 A;  1PYW D;  1PFB A;  1KDB A;  1FYC A;  1GOZ A;  1QCB D;  2KQ3 A;  4RFB A;  2ID0 A;  3PUZ A;  3K0Y A;  2H1E A;  1MSG A;  5EBD A;  3A56 A;  3QOJ A;  5FLX E;  5C4X B;  1LT4 D;  4XQQ A;  1L0Y B;  3NXW A;  2K5Q A;  5C44 B;  1K8O A;  1SAP A;  3N52 A;  2LS0 1;  1TT2 A;  3A8K E;  3H09 A;  1DON A;  3AU7 A;  2F0D A;  3MA2 B;  4PMB A;  1EEF D;  1MI2 A;  2HCC A;  1U4R A;  5DAU A;  2B2W C;  1I4G A;  4KMU C;  3VYU A;  2VXW A;  1LTI D;  4KD4 A;  2DN8 A;  3M7N A;  5D3I B;  2PPB C;  1VDZ A;  3T53 B;  1YNN C;  4ZRZ A;  2IPK D;  5BN3 A;  3X3M A;  1STN A;  3T16 A;  5KYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...