2K04A

Structure of sdf1 in complex with the cxcr4 n-terminus containing no sulfotyrosines
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
b'KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k04A00
1WD0A 4HAEA 1KNEA 2KUMA 1F2LA 1WTRA 1IKLA 1RTNA 4OIJA 1SAPA 3HP3A 2B2YC 2DY8A 4IUVA 5EPKA 4ZLTF 4IUPA 4X3SA 1TVXA 5CMDA 1RJTA 2FINB 1B2TA 1X3QA 1RTOA 1NAPA 2R3ZA 3IFDA 1DOMA 1PLFA 2BDNA 2HCIA 4CJ1B 3GV3A 1WTXA 2B2UA 2FFKB 3FPUB 1GUWA 1B53A 1ESRA 5EJWA 2N88A 2XIWA 4CJ2C 1S4ZA 4ZKBB 1MSHA 1HUNA 3TN2A 1EIGA 1G91A 2B2UC 1B3AA 2MP1A 2HUGA 2KECA 5CORA 4UAIA 5D65A 3FDTA 2RA4A 1HA6A 3Q6SA 4MHEA 1B4OA 1A15A 1KNAA 5D14A 4ZKCB 4XT3B 2B2WC 1WVLA 1WTWA 1C8CA 1AZPA 2MPMA 2X69A 1DONA 3QO2A 5T1GA 1JE4A 1LV9A 1NR2A 2B2TA 2D9UA 5DNFA 2EPBA 4HEDA 4RA8A 3TZDA 1WTVA 2K01A 1WTOA 2JYOA 2Q8TA 1HFNA 4XT1B 5E4WC 1F9SA 1HUMA 2NYZD 3MTSA 1E0BA 4U68A 1DOKA 1WD1A 1B50A 1F9RA 1WTPA 1BF4A 1JICA 1HFGA 4IUQA 4IUUA 1IL8A 4X3TA 3DEOA 2L11A 1VMPA 1RHPA 1ML0D 3G7LA 5EQ0A 1QE6A 2RSNA 1MSGA 2K28A 2IL8A 4XDXA 2K05A 1PFMA 4HSVA 1HHVA 2N55A 1SSOA 4RAUC 4IURA 2EE1A 3I8ZA 3UI2A 1EOTA 1U4MA 2KEEA 2RSOA 2H1EA 1X3PA 2M2LA 4LMQD 4R9WA 3I91A 5JJZA 1WTQA 5AFWA 2X6LA 4R8IA 3IL8A 1F9PA 3DEPA 2L1BA 3LWEA 4OIKA 5E4XA 1BBXC 3H91A 2FHTA 3I3CA 1DOLA 1ICWA 2B2TC 4X3KA 4QUCA 1XYIA 1G2SA 1NCVA 2SDFA 3F2UA 1ILQA 2CVRA 3GV6A 3SVMA 1QNKA 4IUTA 2K1BA 3D6WA 1XX8A 2EOTA 1O7ZA 5EPLA 2FMMA 2B2VA 2DY7A 4QUFA 2L9HA 2NWGA 2NZ1D 5EKIA 1IKMA 1HRJA 4ZK9B 2B2YA 3R93A 3P7JA 1SDFA 5COYA 2MJ8A 2L12A 1X32A 2Q8RE 4O42A 1DZ1A 1O7YA 1U4PA 4HCSA 1ILPA 1BO0A 1RODA 3MWYW 1NR4A 2VXWA 2L4NA 1PFBA 2K04A 4ZAIA 1AP0A 5CBAE 1O80A 1PDQA 2KOLA 2HCCA 5T1IA 1PFNA 1U4LA 1G2TA 1ZXTA 1U4RA 4MN3A 2MGSA 3KUPA 1AZQA 3N52A 1G6ZA 3DM1A 2RVLA 1J8IA 1J9OA 2KVMA 2X6GA 3KBXA 1EQTA 1MI2A 3I90A 3ONAB 1VMCA 1M8AA 4X3UA 1Q3LA 4DN4M 5CBEE 2B2WA 1EL0A 1F9QA 1CA5A 4NW2A 2HDMA 1MGSA 2JP1A 1CM9A 1CA6A 4RWSC 2HDLA 1EIHA 1BNZA 2J7ZA 2KEDA 2K03A 4CJ0B 2FJ2A 1QG7A 5EPJA 2B2VC
chains in the Genus database with same CATH superfamily
4HJ5A 5GAHC 3VR4A 4MTNA 4A3KG 1IBKL 4QQBX 4BY1B 4RKLA 3K7AB 2A6EC 2A6HD 3HOYH 1CSQA 2F3WA 1GUWA 5A2QL 1EIGA 4MNOA 5G3LD 2HUGA 4K5XA 3PIOA 1XXGA 2A5HA 3GTOH 1EY7A 5C5LA 1K0RA 1SNPA 5IGGA 2HQEA 3T16A 4IFDH 3L2PA 3T13A 5M9OA 3A74A 2MNAA 4QCLA 5M5XB 4KY6A 1F9SA 2NYZD 1YVCA 1HH2P 1LTGD 1MHWC 4HCEA 1EY0A 4OWWB 3P1HA 1KD1C 2K5VA 1WTPA 1JICA 1FYCA 3DUZA 3E0JA 3UE1A 1QJOA 2L11A 4C3IB 1ML0D 1F2YA 1DGSA 2CQOA 3ERQA 1MJCA 4JYAL 4IALA 2Z6KC 1EY6A 1I4HA 2OF1A 5IODA 1VQHA 4XQNA 1E22A 1WTQA 1PV4A 2KBNA 3FHWA 4Q0FA 1HNWL 3S1RB 1CKNA 5IWAQ 2OQ0A 2Z4IA 1LT6D 4LF9Q 1TWCH 2F0OA 4A3KH 4WJ3M 4PZ7A 1JOQA 4WFN3 3S16B 3PUXA 4A76A 1HRJA 1BVSA 1HZBA 4JCVE 4O42A 1DZ1A 3CW2C 4K2LA 4RGMA 4GN3B 2WAQB 2K50A 5JJLA 2ZXPA 1SFOH 2HCCA 3EBEA 4NXNL 3H0GG 3HOVB 4LFBL 4LK1C 1KDBA 3CPWA 1SBBB 3BYYB 1JB3A 1TS4A 2JA6B 5C3XA 3SK8A 1A6XA 1G8ZD 4ZUIA 2F0PA 4RWSC 4CDEC 4AH6A 2EJFC 1I4QA 2K28A 2ES2A 2F0SA 2XN9C 4YCVA 4OL7A 3CU7A 4LNQA 2BCOA 3I4NG 3U4ZA 3J7A5 4QIWB 1Q12A 3L0OA 2C9OA 2B2YC 3NTIA 3MZ5A 3KOJA 2VUMG 3S15B 4BY7H 2BA0A 3C1FA 5ELCA 2BDNA 2B2UA 5J22A 2L15A 4F88A 1Y1WG 1LTTD 3PUVA 2B2UC 2CFMA 1GHKA 3CCQA 3SDZA 2K33A 3BVZA 1WVLA 1SE8A 3KLRA 4DR4Q 2A6ED 2NBFA 1WI5A 3CQZH 4JI5L 5TSSA 2F03A 2XGTA 4LFAQ 1E0BA 5C0XG 1NTGA 4C1NK 4DV2Q 5M5WH 4TRDA 1HZCA 1HFGA 4X3TA 3LNNA 3DEOA 1IBMQ 2Q8IB 4C3HG 2E5LQ 1I50B 3H0GH 4CKCA 1AN8A 2EE1A 3J7ZC 3PO2G 3I8ZA 2SEBD 1YIJA 4A3EG 4NPSA 4CKBA 1IZ6A 1JJGA 1XMOL 5CR3A 1TT2A 4KD3A 1YHQA 2WB1B 1BBUA 2A73B 1EYCA 4O1NA 2B39A 1RDPD 2RCNA 3HKZE 1HR0Q 3J80i 3I4NH 2OQKA 4X66Q 1V1QA 3VYRA 2PQAA 3TP5A 4M1UB 1X56A 2EYLA 4YHHL 2VUMH 1FL0A 4B9WA 4DK6C 3S17B 4O0AA 4IZ8A 3STBD 3P7JA 2IWHA 5JEAH 2LMCB 4JI7Q 4P2CB 2HT1A 3GTPH 1Y1WH 4IFDI 3GTLH 1U0LA 4P75A 2PNRC 3VYUA 5IYCG 1NR4A 2K04A 4J1MA 1J5EQ 3FEWX 5IYDG 2F0NA 5FKAC 4AYBE 3GTGB 1XMQQ 4EQOA 1DYQA 4DR2L 2A19A 1G6ZA 1Y69U 3GP7A 3I4MB 1M90C 1VMCA 4K0KQ 1CA5A 1SN8A 1TWHH 3HOUG 2HDMA 3O13A 5C0XH 5EBDA 1JB7A 1N32Q 1NE3A 4KJOA 2MO0A 2VB3X 2JEBI 2E2JB 4C3HH 2I46A 4JK1C 2OT2A 4C3JB 1PZID 3PO2H 2PZWA 3KDFB 4A3EH 1W6KA 1FNVA 2XIWA 1S4ZA 4JI2L 3R2IA 2MP1A 3FDTA 1Z9FA 1HA6A 3RN5A 1XNRL 3U9SA 2B2WC 1X65A 2WACA 3KF6B 1XPOA 3I4LA 3MA2B 1YZ6A 3IFTA 1EU4A 4RA8A 5FJ8G 3AQQA 4XT1B 1T9HA 1HNXL 4K2KA 1LM0A 3M4QA 1YJNA 2KQ3A 5IYCH 3HOXB 4EGVA 3DLLA 1EQVA 5M3MG 4A3GG 1Q8KA 5IYDH 1MSGA 1WYDA 3QOJA 3K5LA 1B9NA 1BR9A 1SR3A 2N8NA 4R9WA 3CCLA 2Y0SE 4WRDA 4FP5D 4OWXB 1A3VA 2K7VA 2WV6D 4R8NA 5IGDA 1DOLA 4JV5Q 1VQ6A 4OONA 4DF7A 4R4IA 3W1BA 2SDFA 1IYJB 2R6GA 4IOCA 4A3IH 1VQ4A 4DR1L 1GJXA 2JA5B 1AEXA 1Q86C 2A8VA 3MEHA 5EPLA 5D3IB 1BQQT 1FGUA 2Y0SG 4N8FA 2J4XA 4LF5Q 2H5XA 3OPOA 1X32A 2J0TD 1W2BA 1E1OA 3HOWG 1ILPA 1RODA 4ZAIA 2OEOA 4DR5Q 1D8LA 3PUYA 4A3MB 2IW3A 4QY7A 3ND9A 3PGZA 3J81i 5ELEA 4MIUA 3A56A 3S2HB 4I7AA 3I72A 4KV6A 1AZQA 4RHSA 2CH4A 4R4TA 1XTDA 1LTBD 1IXRA 5CBEE 1EWHA 2JP1A 4JI8Q 3PSIA 5M3FG 2N49A 4CDCC 3HZXA 1WD0A 3K0XA 2B2VC 2RF4A 3V96A 1KNEA 5C0XJ 5M3MH 3WWVA 3VR6A 1LT3D 4A3GH 4G4KA 1WCMG 4IUPA 2JA8G 1PH9A 1I94Q 3BVGA 3C1EA 1BCPB 1TQOA 3TP8A 5IIFA 2KCNA 3MXGA 1VQOA 1QZGA 2JA7G 5HY6A 1VQLA 1CZWA 1PZKD 2R93B 3OHXC 2ZXRA 2B63B 4A3BB 4MZ9A 3RMHA 3J7AV 1TWGH 1HNZQ 2EZVA 3GTQB 2HHHQ 1BUVT 3A5ZB 2ENBA 1TWAB 1CUKA 3BZCA 4GKJQ 1JE4A 1LV9A 4JC0A 4B08A 3KLSX 2K52A 1PH2A 4AQYQ 4N9PA 5M5YB 2AQ2B 3N6RA 2NB0A 3GTMB 1VQ5A 2Z1CA 3HOWH 1K8OA 2VL6A 3SHLA 1STAA 4QJFA 2NZHA 4C2MB 2YV5A 2KENA 3QG1A 5C0XI 1CQFA 4HIKA 4ME5A 3D4WA 3W3AA 3ERSX 1OO9B 3H91A 4H0LC 5M3FH 2K14A 5ISRA 1RIPA 2PYKA 2F0LA 1ILQA 2BE5D 1PTOB 2NZOA 3JC66 1WCMH 2JA8H 1S5CD 3HOYB 4B3SQ 3G4SA 1OXVA 3S14H 4C56C 2JA7H 1M1KC 4DK3C 3CXCA 3PIPA 3RUZA 1EOVA 5CYUA 2TSSA 3JAME 3UDIA 4DV5Q 4RGNA 1Q81C 4IQZA 1H9JA 4DUZQ 4IN3A 3A8JE 5LL6S 4IUNA 1D5XC 1VDZA 1L1OB 1EEFD 1VQGA 1DXMA 2G5DA 2MUYA 1J9OA 1YEZA 3DWPA 1J8IA 1MI2A 4DNTB 3J81j 1B3QA 5DM73 5L37A 5LHY1 3Q24A 4GN4B 4CDFC 5JAVA 2F4IA 1EIFA 1IKLA 4DV3Q 5C4JB 2YU9H 1ET6A 3A7LA 4ZLTF 5CMDA 2VW9A 2OWOA 5C44G 4KHPL 4ODGA 1KLGD 4JI0Q 4KKUA 1JCKB 1NAPA 1SE2A 4RCNA 3TS2A 2BDOA 2KCMA 5NUCA 1EFID 4FF3A 1ENFA 3PO3B 1JR0D 1TWFH 1T5XD 1VQDA 5ELDA 2F3IA 4KY7A 1G291 4IPHA 3P20A 2LKVA 3EN2A 3KK7A 4A3KB 2MHVA 4GN5A 2QDLA 4JI6Q 3A8IE 2K5DA 1WTWA 2CHBD 2MPMA 4RH6A 3M3YH 1S72A 3F2CA 2F0WA 2EPBA 3T1HL 1Q7YC 2KCCA 4JW0A 3T1YL 2F52A 2ZJRA 2Q8TA 3H09A 1PZJD 5CV9A 2UU9Q 1WD1A 1B50A 2CWPA 1R4PB 4UDUC 2V4DA 5GAEC 4HIMA 1KL9A 3UE0A 4YCWA 2JE6I 4GOPA 5JVH3 4JI4L 1IBKQ 1STGA 2DJGC 1PRTB 4GOPC 1F77A 1ENCA 4PMBA 1QUQA 4S3SA 3RNUA 2NVQH 1JC7A 5C3EB 2ZTEA 1XYIA 4HR7B 2UXCL 4KTAA 1UE5A 5DEHA 3S1QH 4BY7B 1AFPA 4DFAA 5C44H 2K6AA 4IO9A 3ER0A 2KA7A 1GUGA 2OTJA 3HG9A 2JK8A 3E6ZX 3VR3A 1X3FA 2IJ0A 3HKSA 4PQXA 4OXPA 3MXNA 5T1IA 5K36G 2EDGA 2AQ3B 5KYLA 1KTKA 1VQEA 2EY1A 5HGQA 1I6HB 4JYAQ 1YHBA 1H9RA 2LY7A 1GUSA 2X6GA 2GA4B 3U9OA 4DV6L 4ZCKA 5EKLA 1QVGA 1G6PA 5BN4A 1HNWQ 1C0AA 1B9MA 5IT9c 2NVYH 1OXSC 4APVA 3MEFA 1PYSB 1JWSD 1F2LA 3NWSA 4YIJA 4TKOB 2ZM6L 4X64L 3KF6A 3MAQA 3CC7A 2Z6BA 4GLXA 1A63A 3T51B 1QZHA 1R9TB 3RZOB 2IY5B 4XQQA 2EXZA 1VQIA 1I4XA 4ULLA 1Z6HA 4LW1A 1N33L 3IAYA 5KIXA 3NHHA 2KJXA 2L55A 4GNXB 4DAVA 3S9WA 3TBIB 3RLOA 5D14A 1SNQA 2A68C 2UUAL 4DNRB 4NXNQ 1AZPA 1B1ZA 4LFBQ 2NVXH 4Y7NH 3D0FA 1K3BC 3I4OA 4PV1C 2B8GA 2EJGC 3GTLB 5CGKA 5GQOA 5LL6X 2VQEL 4U68A 3G71A 3FMCA 5BR8L 2D62A 2K5WA 1IL8A 1D1KA 4R4OA 4LUVA 5C4XG 1QE6A 5K36H 5JPNC 4TQUS 4XDXA 2R92G 1HPCA 2R61A 1TWHB 4DXGA 1G51A 3HFZB 4P71A 5AFWA 4R8IA 3IL8A 1QILA 3B6YA 3C46A 4OO1G 2PCFB 2DJFC 1NCVA 2ALYB 3D3RA 2A69D 3URYA 1BCPF 3DM3A 3VR2A 3PO2B 3I2ZA 3T56B 1XX8A 2EOTA 4EVOA 1RD9D 4JI5Q 2I5MX 4K14A 3R93A 4XTCS 1EY8A 1SYFA 1CTMA 1AP0A 1XJVA 4L5QA 2JQOA 2Z0SA 4RGOS 1ZXTA 1I3QH 1TY0A 4FXDA 3TDQA 2KVMA 1HA5A 2B3GA 4X3UA 3PUWA 5JPMC 3CKIB 2CCZA 3S1MH 4V190 1LTLA 1ASYA 1UNSA 3HGBA 1XMOQ 3K8AA 3HKZB 2QW7A 4A3DB 1K83B 1WTRA 2LXJA 1X6OA 5CV8A 2R7ZB 5C4XH 1GVPA 1RJTA 1PFSA 3AYHB 3CAMA 3EA6A 4CBVA 1IL2A 5IYBG 1S5ED 3KFUA 4DV4L 2RQXA 4YHHQ 3EFXD 3NTKA 1ESRA 3K6OA 2AUKA 2GVBA 2ZJQA 1MSHA 4LF7L 4OO1H 4A3IB 1ZEQX 4AYBB 5LMNL 1PTOF 1E1TA 5CV5A 1YNNC 2XRSD 1UE7A 1V1OA 3VA7A 3TP7A 4DU9A 2O5IC 3GD7A 1NR2A 1SYEA 2N3SA 4DR2Q 3HOZB 4HEDA 4Q5VA 2P5ZX 1PH1A 4A3JG 1HUMA 2G9DA 2I07B 2K5NA 5GADC 2XRQD 1A8VA 4EQ5A 1STYA 1NMGA 4DR7L 1Y1VG 4A4IA 5C4HA 2RCFA 2A68D 4QB4A 2ICEC 5EQ0A 3K5NA 1Q90A 1PH6A 3SE0A 3SR1A 4N9TA 2HQLA 3A7AB 1K8AC 1F9PA 4OIKA 4JI2Q 4A3GB 3KF8B 3JAMc 1TXYA 3TZUA 3S1NB 4A3LG 3M7GA 4BY1G 2HIXA 3GV6A 1XNRQ 1L0YB 1LTSD 3CCEA 4LF4L 1N8RC 1SROA 4KKSA 5DLQE 4DK1A 4IOAA 2F0IA 5IYBH 4G7HC 1L1OA 4TSSA 3P75A 1V1PB 3CCVA 1SDFA 2RBMA 5COYA 4PZ8A 1HNXQ 2F4VL 1BO0A 4TVAB 1SE4A 3K81C 1U4LA 1CFMA 1TY2A 2E74C 1XNQL 3MFGA 4NMZA 1MJEA 4HJ7A 3X3NA 1HTLD 3J7YW 3RZDB 5E7NA 2MGSA 3M4PA 3KBGA 4BA1I 1EY9A 2Y0SB 4DV1L 3ONAB 3TMEA 1F9QA 4A3JH 2CWAA 3UDGA 5K5PA 1X54A 2I5LX 4KHZA 1K9MC 5IE8A 1EQRA 2DGYA 4C3IG 4DR3L 4OIJA 1PRTF 1S40A 4GLAC 5D3DA 3H94A 5FK9C 5IGFA 4DR1Q 1FJGL 4EQNA 3CC4A 2PW7A 4OWTB 3BVMA 4DXFA 1LYLA 5M3FB 2JJQA 1B53A 2V1CC 2XNAC 4JBWA 4A3FB 2WIIB 5CORA 1CHQD 1VS0A 1A3UA 2RA4A 2CQAA 1K8GA 4A3LH 4JBJA 1MIUA 3SK4A 2JA7B 3K7AH 3BDLA 4IPDA 4B3RL 1UEBA 4UHVA 1HQRD 4H13C 1PH8A 2OCEA 3NUCA 4QIWE 4ZYSA 1HZAA 5IOCA 2BH8A 5DM63 1TS2A 1YNND 1UE1A 3HOVG 5IT9E 3D6CA 2AQ1B 4RAUC 2JA6G 1SE3A 1EOTA 2RSOA 1XPRA 4HJ9A 1EYDA 1TS3A 2PZTA 1BBXC 1B44D 2AKWB 5ELBA 1JJCB 1PH5A 1D5ZC 1L0XB 4OELB 4DV0L 1IW7C 2VQFL 3I55A 4M8AA 3SVMA 3GTKB 5ELNA 2K1BA 2F3VA 1IBLL 3NWTA 4F8MA 3PF4A 4OO1I 1TWFB 2FMMA 4UY8C 3NENA 3CCJA 3A5UA 2F0HA 1CHPD 2WFWA 3CPFA 3SGIA 4CGYB 1I4GA 4Y52H 1N34L 1FGBD 5CV4A 3NELA 1JOOA 3GQBA 4NXML 1PDQA 5C4ZA 1D2BA 3CCRA 3OWFA 3M4OB 2QF7A 3HOUH 3VYTA 2PI2E 4WORA 3U50C 3G48A 2NVTB 1T5EA 3KUPA 1NY4A 1EY5A 3GTJB 1LLRD 1YITA 4F7XA 2WB1E 3A55A 1Q8IA 2KEDA 1IHZA 2EYHA 2PO4A 2UXBL 4GNXA 3HP3A 3HOVH 4X3SA 1K73C 2FINB 1EZ8A 4BBSB 4K5VA 1HJPA 2EYPA 4ABNA 3QWNA 4DNIA 4CJ1B 1QVFA 2WB1G 3VR5A 5IT9L 1A2UA 3H3VC 3I56A 5FJ8H 3S1QB 2F0TA 4DA2A 1CQVA 5JVG3 1SNMA 3E9IA 4ZKCB 4GKKL 1CK1A 1AE3A 5IGCA 2EY5A 2B2TA 2NN6G 1XWEA 3S15H 1RF2D 2F0VA 3OSOA 3J7AF 3PIP3 1UE6A 3NTHA 4A3CG 2UXDL 4P73A 1DJRD 2IX0A 1FNWA 2SOBA 3D4RA 1BF4A 3OW2A 4ALPA 3CMAA 3KLWA 1STEA 5FO7B 5FO9B 1CKOA 1KHIA 1LO5D 1OXXK 1SEBD 2Q2HA 4YY3L 3I4MG 4KHPQ 3PCOB 3M9BA 1KQSA 1GKHA 3T4AC 1X3PA 4J6HA 2RKSA 5JJZA 2NVYB 2PMZB 2X6LA 2PPBC 1M4VA 1X55A 2FMCA 2AWNA 4FVMA 1ICWA 4DPGA 1YJ9A 1ZYRC 1Z47A 1EY4A 1I50H 3UDFA 5EKKA 5AJ3L 4IUTA 2F0KA 4C3JG 3D6WA 1PYBA 4A93B 1MBYA 1QCBD 1GM5A 1A62A 4RHRA 3T1HQ 5EKIA 2NZ1D 3T1YQ 1IKMA 4DAMA 3UDXA 2MJ8A 1Y8PB 4V0BA 2JXMB 3OOCA 4BWGB 5FLXc 4BBRG 2H4OA 1IW7D 4LFCL 2NVXB 1PFNA 4RKBA 4DAYB 3C2PA 2NTTA 1LTRD 4JI4Q 1A2TA 1IYVA 1SJHD 2QKIC 3SK6A 5LMNW 4DAPA 4J8QA 2QDBA 3G6EA 1RL2A 4FF1A 4RGTA 3CCSA 1Q3LA 4DN4M 4FF4A 1QOHA 5HGTA 1MGSA 3HOXG 2G9HD 3CRKC 4A3CH 1KRTA 5J1ZA 2F0EA 3GTGH 2UXCQ 3GTOB 4IUVA 4WJWA 5EPKA 4NB3A 1TVXA 2C35B 5IP9G 1BOSA 1JE5A 1X3QA 4QL5A 2BH2A 1CT1D 4B9XA 3FKIG 4LJZC 1QNUA 3FPUB 4B3ML 1EQQA 3MFYA 1SMYC 2DNEA 2KECA 1SNCA 2E76C 4YWMA 2E2JH 4MHEA 2JA5G 3WOEA 4XXEA 3E3XA 4FDBA 2R7DA 2IX3A 3VYSA 2R7FA 3J80c 3TQYA 4C3JH 2ZT9C 1VQ8A 4R4CA 1EYAA 1YNJC 2K5QA 4XYOA 5E4WC 1L2FA 4DV6Q 2Q2UA 1R4QB 1DOKA 1F9RA 4A3MG 5G3LF 2DNCA 3KF8A 4IUUA 5BN3A 4BBRH 3CRLC 1TWCB 2D0PA 4OGQC 2ZM6Q 4X64Q 2QCPX 1PFMA 1SYCA 1XTCD 2UUCL 3S1MB 3OIPA 2M2LA 1ZKOA 4JVZA 3TRZA 2ZJPA 2L1BA 1V1PA 3I3CA 4FXKC 5JJKA 3HOXH 1OXTA 1N33Q 1GUTA 2PQAB 1JOKA 1SFOB 3H15A 2UUAQ 3L7ZC 2A6HC 1CZGA 1S5BD 4RG1A 4K6LA 2EYMA 4AIMA 4POGA 4DUYL 3JAMi 3E9HA 2R93G 4PMCA 3FKIH 3NEMA 2MFIA 2VQEQ 1GUNA 5BR8Q 3JAML 2KHIA 3F2DA 1D6EC 4HMIA 1OTCA 1IYUA 1ZYRD 4J15A 4PMWA 2JA5H 1UUPA 1EFWA 1S5FD 3K5OA 4HSPA 1B70B 3DM1A 2A1AA 2EYOA 1EQTA 3K80C 3S2DH 1HTPA 3OMGA 4GZYC 2XVSA 4RFBA 2PNHA 2BOSA 4CJ0B 3ZYYX 4A3MH 1Y14B 2WKDA 1QG7A 1PYWD 1EYGA 1E2WA 1CKMA 3S2HH 5JOBA 3SXHA 1UEAB 5I2XA 4X62L 1L0WA 2R3ZA 1O7IA 3KLSA 1GXDC 3CQZB 3R3OA 2WKCA 4KHVA 2HCIA 1A3TA 4ZKBB 4OX9L 4B3TL 1UWVA 5A2QE 1PH3A 1B3AA 5F2DA 5M5WB 4UAIA 1VCIA 2F1MA 3KDFA 3R2TA 4LAAA 1KNAA 3QR8A 2E2HH 2E75C 1NSNS 1C8CA 4RCOA 1ONLA 3H0GB 1I5FA 3W5OA 3QJYA 1E2VA 1Z7TA 2RHSB 3A0JA 2R93H 1CSPA 3EQLC 4WJ4A 4JI3L 4QMGA 4LWCA 1SMYD 3QIAA 4IFDG 5LMUL 3K59A 1DCZA 5FOBB 3GTQH 4H44C 1JORA 1Y8OB 4YWKA 2JSOA 1AH9A 1U9RA 1KAWA 3I4NB 1TWAH 4LF6L 1J6QA 2IL8A 2SNMA 3J81c 3OTOL 1HHVA 2WP8J 2E8GA 4IJHA 3UI2A 5I2YA 1YNJD 5I6WA 2KEEA 5M5YH 4DV4Q 4A3JB 1KRSA 2HD3A 2VUMB 2O2LD 5GROA 4G7ZC 2F0GA 3GTMH 3GTPB 5E4XA 4LF7Q 4X3KA 1Y1WB 4GLVB 5LMNQ 3X3MA 3F2UA 5KNBA 2CVRA 2K4KA 4L8JA 2Z4HA 1O7ZA 3PO3G 2EXDA 2KCTA 2L12A 1PA6A 3FP9A 2F0MA 1JT8A 2VXWA 2L4NA 1C4QA 3BJUA 3M4YA 4IPCA 1SXTA 4DR7Q 1N36L 1PTOH 2VY3A 4JBMA 4C3HB 3ULJA 4EQPA 2JN4A 3W1GA 3M85A 3CF5A 4A3EB 1NJIC 3OIQA 3W2DA 2EQSA 1II3A 4L63B 4FXGC 3EROA 3DXJC 5IGEA 1EWIA 2KUMA 5KYIA 4HN7A 3NQIA 3KJOA 4LF4Q 2CW0C 3DWQA 1P16A 4PNYA 1KABA 4PZ6A 1KDCA 1JWMD 1KLUD 1DOMA 5KGUA 2VB2X 5C3EG 2LXKA 2N88A 2N78A 1HUNA 4OHJA 1G91A 2UUBL 2F4VQ 1H9SB 1C48A 2Z6KA 2GN5A 1BCPC 1B4OA 5JJIA 4BY7G 5C4JH 3AFQA 4P72A 1XNQQ 2SNSA 4H02A 1SRUA 3NK9A 4FF2A 4BS9A 2X69A 5FLXE 3MC0B 3STBC 4DV7L 4DR6L 2K01A 4DV1Q 1H95A 3PO3H 2ASBA 2VNUD 2R92H 2FXQA 1FD7D 3NBIA 3HOUB 2ZTCA 3OYYA 1VQKA 4NDXA 1YNXA 3Q8DA 4HIOA 4DR3Q 1KC8C 2RSNA 4KN4C 1AE2A 1Q46A 3TREA 2VS1A 4ZRZA 1FJGQ 3RD4A 5C6AA 2XWBB 4JI1L 1QB5D 1BBWA 3RN2A 4X65L 2H1EA 1EIYB 2EY2A 4F87A 3VDYA 1DD2A 5CV6A 4XQJA 1LTID 5IP7G 4K5WA 4QGUA 2I0QA 4LF8L 2IT1A 5J39A 3F1ZA 2MQHA 1MD2D 3OMCA 3CHBD 4DAYA 4ME3A 1Y8NB 3QOLA 4B3RQ 2DY7A 2AHOB 5C5MA 4FNFA 4CDDC 3J80E 3AMUA 2B2YA 1ICFB 5C3EH 1V8QA 1PTOC 4L6TB 2JEAI 4KK7A 2ATWA 5M3MB 5JEAG 4MN3A 2AMCB 4HTHA 1PH7A 2IHFA 3MXUA 1Q1EA 2ICIA 2E2IH 4LUOA 2XWJB 5FLXL 1L1OC 1TWGB 4DV0Q 4FYDA 2VQFQ 2TMPA 1SAPA 4N8X1 4IFDJ 4LUZA 3V2TA 1I6HH 3PQIA 1BXTA 1VF5C 1YHAA 2O4XA 1IBLQ 1B2TA 1TU2B 3U58A 1SYGA 3PV0A 2FFKB 1VQMA 2KHJA 2F0JA 4CJ2C 5IP7H 5H1SE 5IWAL 1N34Q 4LF9L 5ELFA 2NUCA 4NXMQ 2L0CA 1FNUA 3HOWB 3Q6SA 1E2ZA 1Q82C 1VQ7A 1I6VC 5A35A 2CW0D 1KDAA 1DONA 3QO2A 2IPKD 3AU7A 3HEJA 1Y1VH 2XSCA 5IGBA 1RCVD 1R9TH 3RZOH 3I70A 3CMEA 4ZUJA 1RKNA 4GOPB 2CKZB 2C5CA 1EZ6A 3SK5A 3NPPA 3CCUA 3H6MA 1WJJA 4IUQA 4O2DA 4X6AH 1BCPD 2WAQE 2UXBQ 2VZAA 4E6IA 1K3RA 1QUQB 3J80L 4A75A 4HSVA 2EVBA 1WCMB 2JA8B 3H3VH 4Z9CB 3S14B 4BY1H 1H9MA 1GHJA 1STNA 1WFQA 4R1JA 3HKZG 3HS0C 1VQJA 1QVCA 3NBHB 4A3DG 1G2SA 1PXUA 4YCUA 3CC2A 1PRTC 4R4QA 5EAYA 3ND8A 2WAQG 2F0FA 3EIVA 2R7ZG 1FR3A 4I65A 1QNKA 3EJIA 4UPAA 3C3LA 4GKKQ 2QILA 1D5MC 3OW7A 3K0YA 1YBYA 1YJWA 2L9HA 2NWGA 4JPBW 2F0QA 2OXPA 3G6JB 3MXNB 4EX5A 1QWYA 4A3IG 3SEBA 4AYBG 5M5XH 1U5KA 2UXDQ 3OWEB 1O7YA 4HCSA 4FO2A 4P74A 2K5HA 3PMFA 3BZKA 2EJMA 2YU9B 1LT5D 3HOZG 4DR4L 4YY3Q 2EYJA 3NP8A 4C3IH 1SNDA 2F0DA 4KKTA 3KBXA 1TR5A 3J81E 1I4RA 2B2WA 3BS1A 4LFAL 4CHTB 2O5JC 1PTOD 4DV2L 3BYTB 2D0OA 4BBRB 1HXYD 3ITPA 1S3OA 1BNZA 1UAPA 3FRPB 2RDFA 1PH4A 4HAEA 3S1RH 1IBML 3A8KE 1RTNA 3DHQA 3BZDB 3I73A 2E5LL 5AJ3Q 1KAAA 1P8LA 4KY5A 3M3YB 3F2BA 3K5MA 1VQBA 4JOIA 4KI0A 5CC4A 3R8BA 3IFDA 1F2MA 1PLFA 4JOIC 3E0EA 4L5TA 2I5HA 1ESFA 5EJWA 3S16H 1K8MA 3RLFA 2IX1A 2BE5C 3AB9A 5D65A 3TEHB 1JMCA 1K83H 1X3EA 2AWOA 5IY0A 1HR0L 4A3DH 1LUZA 2QGQA 4LFCQ 3T53B 3NXWA 3WDNA 5KNDA 1TIID 2R7ZH 4X66L 1A0IA 1C9OA 4PG3A 3FKIB 1STBA 2D9UA 1S5DD 4G7OC 2MO1A 1D7QA 2K32A 4GNXC 4JI7L 3Q22A 2PW5A 1PHJA 2JA6H 1V43A 4KMUC 3Q0AA 2NVQB 1J5EL 1JJ2A 5KRUA 1STHA 1RHPA 3G7LA 4DK0A 1XMQL 1VQ9A 2Q2IA 2A74C 4KN7C 5HURA 4GS3A 3S2DB 2N55A 4UP8A 3HOZH 5C44B 3IRBA 3FPPA 4KD4A 4NP5A 1VQNA 4K0KL 5JEAJ 1E3PA 4B3MQ 3DEPA 1PMRA 1N32L 2B2TC 3L3OC 3RLNA 1B7YB 2RDGA 1TS5A 5I4DA 3S24A 3QB3A 1X3GA 2RHQB 1EEID 3J81L 3PF5A 1C7YA 2Q2TA 2B2VA 2E2DC 2GVAA 1SYDA 1CKNB 1MKHA 4A3FG 2Q8RE 1U4PA 4C1NI 1F2ZA 1PVOA 2E2HB 3S1NH 1O80A 2KOLA 1PRTD 4JG2A 2DN8A 1GUOA 2UUCQ 1LABA 4BXXG 1EUJA 1CM9A 2RDHA 2HDLA 4U673 2J7ZA 4HIDA 2FJ2A 1H9SA 4HJAA 3H3VI 3D8GA 1JQYD 1H9KA 4YWLA 2DY8A 3RZDH 2QEXA 3K57A 4I7ZC 4H7BA 4DUYQ 1OXUA 1VQPA 4Y7NB 1O7LA 3NQTA 1JWUD 3D31A 3GV3A 5KEEA 2HIVA 3CP0A 1SMXA 2NN6H 3EVQA 3S17H 2B29A 4JV5L 1BKBA 1FVIA 1A15A 3ULPA 4XT3B 5I9OA 5KNCA 3ICEA 5I6YA 1NUCA 5DNFA 2JYOA 1NNXA 2M00A 2IHEA 4LF5L 3I4MH 3MTSA 1WOCA 1VQCA 4A3FH 1ENAA 4DR5L 1KIXA 1YI2A 3NSWA 3AFPA 1VQFA 4HJ8A 2LFNA 4UP9A 4ZQ3A 1VMPA 3D4DA 2B8FA 4X62Q 3V05A 1SSOA 2PZUA 3MVVA 1U4MA 4LMQD 3I91A 3GDEA 1V9PA 3BU2A 3E5SA 1HZ9A 5C3WA 1B8AA 1SNOA 3LWEA 4JI8L 4BXXH 3TP6A 4B3TQ 1W3SA 4OX9Q 1WTHA 1NMFA 3WOFA 2Z9HA 3NE5B 4CKEA 2QA4A 1TKWB 1LACA 2F0UA 1AW7A 1N9WA 1I3QB 3LX0A 5E3FA 4BBSG 1I94L 3DMUA 1CI3M 4K8JA 1E7ZA 2Z8LA 1GD7A 2EYFA 1K28A 2D5DA 2JA9A 4NKLA 1I4PA 3GO5A 2AUJD 4JI3Q 3K7UC 1LTAD 5LMUQ 1PFBA 2XTIA 5CBAE 3CCMA 1HNZL 5FLMG 2HHHL 1G2TA 3GTKH 3AEVA 1E24A 2PQEA 1U4RA 4LF6Q 1SJED 4GKJL 4G57A 4XIGS 4UP7A 3OTOQ 1X9NA 5C4XB 2OTLA 3N52A 2R92B 4AQYL 2PMZE 4JBKA 3M7NA 3I90A 3IKJA 3PUZA 1HCZA 5IP9H 1SLJA 4RMFA 3BG3A 1EIHA 1KXLA 2NTSA 2K05A 4MTKA 5EPJA 2EIFA 3M4OH 2B63G 4A3BG 2PI2A 4K6DA 2NVTH 2YTXA 2YTVA 1HQMC 1RTOA 4HMJA 2BA1A 5EBCA 2CH4W 3GTJH 1WTXA 5BN5A 5EGTA 4L5RC 2A69C 3TN2A 1GO3E 1EWCA 1W6JA 3FVQA 1VQAA 3U4VA 1O78A 5E1FA 3L9AX 3KYHC 2YYZA 1N36Q 3K58A 3DWAA 3TS0A 4A93G 5CV7A 3ULLA 5T1GA 4B3SL 5I9PA 4BBSH 2L5TA 4K8IA 3TZDA 3BDCA 1WTVA 1WTOA 1HFNA 1BDOA 4KLKA 4POFA 2YTYA 2EY6A 5DAUA 4DV5L 3RR5A 4DUZL 3NBHA 5FLMH 4ID6A 4L5SA 4XYQA 2LS01 3Q23A 1LT4D 1GOZA 4IURA 2ZTDA 5GAGC 3HOYG 2E2IB 2ZXOA 2ID0A 3PIO3 1DM0B 3BDOA 1SYBA 1VF7A 3A54A 2FHTA 5FO8B 2UUBQ 2K75A 4QUCA 1ET9A 3LGJA 3VA5A 3MHBA 4DV3L 2B63H 4A3BH 4KJNA 3CD6A 4JI0L 2NN6I 4DV7Q 1EU3A 2WINB 4QUFA 1ASZA 4DR6Q 3HRZC 1NBWA 1XPUA 4ZK9B 4DGZA 5ELOA 3MWYW 2LSSA 1K0SA 1D1IA 2DUDA 3ZJYC 4JI6L 2M9VA 4IJLA 4DKAC 4BA2I 4IPGA 1Y1VB 4A93H 1Q1BA 2QEJC 4OEMB 3LWUA 2RVLA 3I7FA 5J3BA 4JI1Q 3KJPA 1HR0W 3TSSA 4X65Q 3F8TA 1M8AA 4C2MH 3MXPA 2UU9L 1EL0A 4NW2A 1CA6A 2KHSA 4QF4A 2K03A 4LF8Q 4ILWA 2D2CC
chains in the Genus database with same CATH topology
3VR4A 4BY1B 4RKLA 3K7AB 2A6EC 2A6HD 2F3WA 1GUWA 5A2QL 1EIGA 5G3LD 2HUGA 4K5XA 1XXGA 2A5HA 1EY7A 5C5LA 1SNPA 5IGGA 2HQEA 3T16A 4IFDH 3T13A 5M9OA 4QCLA 5M5XB 4KY6A 1F9SA 2NYZD 1LTGD 4HCEA 1EY0A 3P1HA 1WTPA 1JICA 1FYCA 3DUZA 3E0JA 1QJOA 2L11A 4C3IB 1ML0D 1F2YA 3ERQA 4IALA 1EY6A 1I4HA 2OF1A 5IODA 1WTQA 4XQNA 4Q0FA 3S1RB 2Z4IA 1LT6D 2F0OA 1JOQA 4WFN3 3S16B 3PUXA 1HRJA 4O42A 1DZ1A 4K2LA 4RGMA 2WAQB 2ZXPA 2HCCA 3HOVB 4LK1C 1KDBA 1SBBB 3BYYB 1JB3A 1TS4A 2JA6B 5C3XA 3SK8A 1A6XA 1G8ZD 4ZUIA 2F0PA 4RWSC 2EJFC 1I4QA 2K28A 2F0SA 2XN9C 4OL7A 3CU7A 2BCOA 4QIWB 1Q12A 2C9OA 2B2YC 3NTIA 3MZ5A 3S15B 2BA0A 3C1FA 5ELCA 2BDNA 2B2UA 5J22A 4F88A 1LTTD 3PUVA 2B2UC 1GHKA 3SDZA 2K33A 3BVZA 1WVLA 3KLRA 2A6ED 2NBFA 5TSSA 2F03A 1E0BA 5C0XG 4C1NK 4TRDA 1HFGA 4X3TA 3LNNA 3DEOA 2Q8IB 4C3HG 1I50B 4CKCA 1AN8A 2EE1A 3I8ZA 2SEBD 4CKBA 5CR3A 1TT2A 4KD3A 2WB1B 2A73B 1EYCA 4O1NA 2B39A 1RDPD 3VYRA 3TP5A 4M1UB 2EYLA 4B9WA 3S17B 4IZ8A 3P7JA 2IWHA 5JEAH 2LMCB 4P2CB 4IFDI 2PNRC 3VYUA 1NR4A 2K04A 4J1MA 3FEWX 2F0NA 5FKAC 3GTGB 4EQOA 1DYQA 1G6ZA 1Y69U 3GP7A 3I4MB 1VMCA 1CA5A 2HDMA 3O13A 5C0XH 5EBDA 4KJOA 2VB3X 2JEBI 2E2JB 2I46A 4JK1C 2OT2A 4C3JB 1PZID 2PZWA 1W6KA 1FNVA 2XIWA 1S4ZA 3R2IA 2MP1A 3FDTA 1HA6A 3U9SA 2B2WC 2WACA 3I4LA 3MA2B 3IFTA 1EU4A 4RA8A 4XT1B 4K2KA 2KQ3A 3HOXB 4EGVA 1EQVA 1MSGA 3QOJA 3K5LA 1B9NA 1BR9A 4R9WA 4WRDA 4FP5D 1A3VA 2K7VA 2WV6D 4R8NA 5IGDA 1DOLA 4DF7A 2SDFA 2R6GA 1GJXA 2JA5B 1AEXA 3MEHA 5EPLA 5D3IB 1BQQT 2J4XA 3OPOA 1X32A 2J0TD 1ILPA 1RODA 4ZAIA 2OEOA 3PUYA 4A3MB 2IW3A 3ND9A 5ELEA 4MIUA 3A56A 3S2HB 3I72A 4KV6A 1AZQA 4RHSA 1LTBD 5CBEE 1EWHA 2JP1A 3HZXA 1WD0A 2B2VC 3V96A 1KNEA 5C0XJ 3VR6A 1LT3D 4G4KA 4IUPA 3BVGA 3C1EA 5IIFA 1BCPB 1TQOA 3TP8A 2KCNA 3MXGA 1CZWA 1PZKD 2R93B 3OHXC 2ZXRA 2B63B 4A3BB 3RMHA 3J7AV 2EZVA 3GTQB 1BUVT 2ENBA 1TWAB 1JE4A 1LV9A 4B08A 3KLSX 4N9PA 5M5YB 2AQ2B 3N6RA 2NB0A 3GTMB 2Z1CA 1K8OA 3SHLA 1STAA 4C2MB 3QG1A 5C0XI 1CQFA 4ME5A 3D4WA 3W3AA 1OO9B 3H91A 4H0LC 5ISRA 2PYKA 2F0LA 1ILQA 2BE5D 1PTOB 3HOYB 1S5CD 1OXVA 4C56C 3RUZA 5CYUA 2TSSA 3JAME 4RGNA 4IQZA 1H9JA 4IN3A 3A8JE 5LL6S 4IUNA 1D5XC 1VDZA 1EEFD 1DXMA 2MUYA 1J9OA 3DWPA 1J8IA 1MI2A 4DNTB 5DM73 5LHY1 3Q24A 5JAVA 2F4IA 1IKLA 5C4JB 1ET6A 3A7LA 4ZLTF 5CMDA 4ODGA 1KLGD 4KKUA 1JCKB 1NAPA 1SE2A 4RCNA 2BDOA 5NUCA 1EFID 4FF3A 1ENFA 3PO3B 1JR0D 1T5XD 5ELDA 4KY7A 1G291 3P20A 2LKVA 3KK7A 4A3KB 2MHVA 3A8IE 2K5DA 1WTWA 2CHBD 2MPMA 4RH6A 2F0WA 2EPBA 2KCCA 2Q8TA 3H09A 1PZJD 5CV9A 1WD1A 1B50A 1R4PB 4UDUC 2V4DA 2JE6I 5JVH3 1STGA 1PRTB 1F77A 1ENCA 4PMBA 4S3SA 1JC7A 5C3EB 1XYIA 4HR7B 4KTAA 5DEHA 4BY7B 1AFPA 4DFAA 2K6AA 2KA7A 1GUGA 3HG9A 3E6ZX 3VR3A 2IJ0A 4PQXA 3MXNA 5T1IA 5K36G 2EDGA 2AQ3B 5KYLA 1KTKA 2EY1A 1I6HB 1H9RA 2LY7A 1GUSA 2X6GA 2GA4B 3U9OA 5EKLA 5BN4A 1B9MA 1OXSC 1JWSD 1F2LA 3NWSA 4YIJA 4TKOB 3MAQA 3T51B 1R9TB 3RZOB 4XQQA 2EXZA 1I4XA 4ULLA 1Z6HA 3IAYA 5KIXA 3NHHA 2KJXA 2L55A 4DAVA 3S9WA 3TBIB 5D14A 1SNQA 2A68C 4DNRB 1AZPA 1B1ZA 4PV1C 2B8GA 2EJGC 3GTLB 5CGKA 5LL6X 4U68A 3FMCA 2D62A 2K5WA 1IL8A 1D1KA 1QE6A 5K36H 5JPNC 4TQUS 4XDXA 1HPCA 2R61A 1TWHB 4DXGA 5AFWA 4R8IA 3IL8A 1QILA 4OO1G 3C46A 2PCFB 1NCVA 3D3RA 2A69D 3URYA 1BCPF 3VR2A 3PO2B 3T56B 1XX8A 2EOTA 4EVOA 1RD9D 4K14A 3R93A 4XTCS 1EY8A 1SYFA 1CTMA 1AP0A 4RGOS 1ZXTA 1TY0A 4FXDA 3TDQA 2KVMA 1HA5A 4X3UA 3PUWA 5JPMC 3CKIB 4V190 1UNSA 3HGBA 3HKZB 4A3DB 1K83B 1WTRA 5CV8A 2R7ZB 1RJTA 3EA6A 4CBVA 1S5ED 2RQXA 3EFXD 3NTKA 1ESRA 3K6OA 2AUKA 1MSHA 4OO1H 4A3IB 1ZEQX 4AYBB 1PTOF 5CV5A 1YNNC 2XRSD 1V1OA 3VA7A 3TP7A 4DU9A 2O5IC 3GD7A 1NR2A 1SYEA 3HOZB 4HEDA 4Q5VA 1HUMA 2G9DA 2I07B 2XRQD 1STYA 5C4HA 2A68D 4QB4A 2ICEC 5EQ0A 3K5NA 1Q90A 3SE0A 3SR1A 4N9TA 3A7AB 1F9PA 4OIKA 4A3GB 3TZUA 3S1NB 3M7GA 3GV6A 1L0YB 1LTSD 4KKSA 4DK1A 2F0IA 4G7HC 4TSSA 3P75A 1V1PB 1SDFA 2RBMA 5COYA 1BO0A 1SE4A 1U4LA 1CFMA 1TY2A 2E74C 3MFGA 4NMZA 3X3NA 1HTLD 3J7YW 3RZDB 2MGSA 3KBGA 4BA1I 1EY9A 2Y0SB 3ONAB 3TMEA 1F9QA 5K5PA 4KHZA 4C3IG 4OIJA 1PRTF 5D3DA 5FK9C 3H94A 5IGFA 4EQNA 2PW7A 4DXFA 3BVMA 5M3FB 1B53A 2XNAC 4JBWA 4A3FB 2WIIB 5CORA 1CHQD 1A3UA 2RA4A 2CQAA 3SK4A 2JA7B 3BDLA 1HQRD 4H13C 3NUCA 4ZYSA 5IOCA 5DM63 1TS2A 1YNND 5IT9E 3D6CA 2AQ1B 4RAUC 1SE3A 1EOTA 2RSOA 1EYDA 1TS3A 2PZTA 1BBXC 1B44D 5ELBA 1D5ZC 1L0XB 1IW7C 4M8AA 3SVMA 3GTKB 2K1BA 2F3VA 3NWTA 4F8MA 4OO1I 1TWFB 2FMMA 2F0HA 1CHPD 4CGYB 1I4GA 1FGBD 5CV4A 1JOOA 3GQBA 1PDQA 5C4ZA 1D2BA 3OWFA 3M4OB 2QF7A 3VYTA 4WORA 2NVTB 1T5EA 3KUPA 1EY5A 3GTJB 1LLRD 4F7XA 3A55A 1Q8IA 2KEDA 1IHZA 2EYHA 2PO4A 3HP3A 4X3SA 2FINB 1EZ8A 4BBSB 4K5VA 2EYPA 4ABNA 3QWNA 4CJ1B 3VR5A 5IT9L 1A2UA 3H3VC 3S1QB 2F0TA 4DA2A 1CQVA 5JVG3 1SNMA 4ZKCB 1CK1A 5IGCA 2EY5A 2B2TA 2NN6G 1XWEA 1RF2D 2F0VA 3OSOA 3J7AF 3PIP3 3NTHA 1DJRD 2IX0A 1FNWA 2SOBA 3D4RA 1BF4A 1STEA 5FO7B 5FO9B 1LO5D 1OXXK 1SEBD 3T4AC 1X3PA 4J6HA 2RKSA 5JJZA 2NVYB 2PMZB 2X6LA 2PPBC 1M4VA 2FMCA 2AWNA 4FVMA 1ICWA 1ZYRC 1Z47A 1EY4A 5EKKA 4IUTA 2F0KA 4C3JG 3D6WA 4A93B 1MBYA 1QCBD 4RHRA 5EKIA 2NZ1D 1IKMA 2MJ8A 1Y8PB 4V0BA 2JXMB 3OOCA 4BWGB 2H4OA 1IW7D 2NVXB 1PFNA 4RKBA 3C2PA 2NTTA 1LTRD 1A2TA 1IYVA 1SJHD 2QKIC 3SK6A 4DAPA 4J8QA 2QDBA 4FF1A 4RGTA 1Q3LA 4DN4M 4FF4A 1QOHA 5HGTA 1MGSA 2G9HD 3CRKC 5J1ZA 2F0EA 3GTOB 4IUVA 4WJWA 5EPKA 1TVXA 1BOSA 1X3QA 1CT1D 4B9XA 4LJZC 1QNUA 3FPUB 3MFYA 1SMYC 2DNEA 2KECA 1SNCA 2E76C 4MHEA 3WOEA 4XXEA 2IX3A 3VYSA 2ZT9C 1EYAA 1YNJC 2K5QA 4XYOA 5E4WC 1R4QB 1DOKA 1F9RA 5G3LF 2DNCA 3KF8A 4IUUA 5BN3A 3CRLC 1TWCB 4OGQC 2QCPX 1PFMA 1SYCA 1XTCD 3S1MB 3OIPA 2M2LA 1ZKOA 2L1BA 1V1PA 3I3CA 4FXKC 1OXTA 1GUTA 1JOKA 1SFOB 3L7ZC 2A6HC 1CZGA 1S5BD 4K6LA 2EYMA 4PMCA 1GUNA 3JAML 1D6EC 4HMIA 1IYUA 1ZYRD 4PMWA 1UUPA 1S5FD 3K5OA 4HSPA 3DM1A 2EYOA 1EQTA 1HTPA 3OMGA 4GZYC 2XVSA 4RFBA 2BOSA 4CJ0B 3ZYYX 2WKDA 1QG7A 1PYWD 1E2WA 5JOBA 3SXHA 1UEAB 5I2XA 2R3ZA 3KLSA 1GXDC 3CQZB 3R3OA 2WKCA 4KHVA 2HCIA 1A3TA 4ZKBB 5A2QE 1B3AA 5F2DA 5M5WB 4UAIA 1VCIA 2F1MA 3R2TA 4LAAA 1KNAA 2E75C 1NSNS 1C8CA 4RCOA 1ONLA 3H0GB 3QJYA 1E2VA 1Z7TA 3EQLC 4QMGA 1SMYD 3QIAA 4IFDG 3K59A 1DCZA 5FOBB 4H44C 1JORA 1Y8OB 2JSOA 1U9RA 3I4NB 2IL8A 2SNMA 1HHVA 2WP8J 3UI2A 4A3JB 5I6WA 5I2YA 1YNJD 2KEEA 2VUMB 2O2LD 4G7ZC 2F0GA 3GTPB 5E4XA 4X3KA 1Y1WB 3X3MA 3F2UA 5KNBA 2CVRA 4L8JA 2Z4HA 1O7ZA 2L12A 2F0MA 2VXWA 2L4NA 1C4QA 3M4YA 1SXTA 1PTOH 4C3HB 4EQPA 3M85A 4A3EB 3OIQA 3W2DA 1II3A 4L63B 4FXGC 3EROA 3DXJC 5IGEA 2KUMA 5KYIA 4HN7A 3NQIA 2CW0C 3DWQA 4PNYA 1KABA 1KDCA 1JWMD 1KLUD 1DOMA 5KGUA 2VB2X 2N88A 1HUNA 4OHJA 1G91A 1H9SB 1C48A 1BCPC 1B4OA 2SNSA 3NK9A 4FF2A 4BS9A 2X69A 5FLXE 3MC0B 2K01A 2VNUD 1FD7D 3NBIA 3HOUB 4NDXA 2RSNA 4KN4C 4ZRZA 3RD4A 5C6AA 2XWBB 1QB5D 2H1EA 2EY2A 4F87A 1DD2A 5CV6A 4XQJA 1LTID 4K5WA 2IT1A 5J39A 1MD2D 3OMCA 3CHBD 4DAYA 1Y8NB 3QOLA 2DY7A 5C5MA 4FNFA 3J80E 2B2YA 1V8QA 1PTOC 4L6TB 2JEAI 4KK7A 5M3MB 5JEAG 4MN3A 4HTHA 3MXUA 1Q1EA 2ICIA 2XWJB 5FLXL 1TWGB 4FYDA 2TMPA 1SAPA 4IFDJ 3V2TA 1BXTA 1VF5C 2O4XA 1B2TA 1TU2B 1SYGA 3PV0A 2FFKB 2F0JA 4CJ2C 5ELFA 2NUCA 3HOWB 2L0CA 1FNUA 3Q6SA 1E2ZA 1I6VC 5A35A 2CW0D 1KDAA 1DONA 3QO2A 2IPKD 3AU7A 3HEJA 2XSCA 5IGBA 1RCVD 3I70A 4ZUJA 1RKNA 2C5CA 1EZ6A 3SK5A 3NPPA 3H6MA 4IUQA 1BCPD 4E6IA 3J80L 4HSVA 2EVBA 1WCMB 2JA8B 4Z9CB 3S14B 1H9MA 1GHJA 1STNA 3HS0C 1G2SA 1PXUA 1PRTC 3ND8A 2F0FA 1FR3A 4I65A 1QNKA 3EJIA 3C3LA 2QILA 1D5MC 3OW7A 3K0YA 2L9HA 2NWGA 2F0QA 2OXPA 3G6JB 1QWYA 3SEBA 3OWEB 1O7YA 4HCSA 4FO2A 3PMFA 2EJMA 2YU9B 1LT5D 2EYJA 3NP8A 1SNDA 2F0DA 4KKTA 3KBXA 1TR5A 3J81E 1I4RA 2B2WA 3BS1A 4CHTB 2O5JC 1PTOD 3AMUA 3BYTB 4BBRB 1HXYD 3ITPA 1BNZA 1UAPA 3FRPB 2RDFA 4HAEA 3A8KE 1RTNA 3DHQA 3BZDB 3I73A 1KAAA 4KY5A 3M3YB 3K5MA 4KI0A 5CC4A 3R8BA 3IFDA 1F2MA 1PLFA 5EJWA 1ESFA 1K8MA 3RLFA 2IX1A 2BE5C 3AB9A 5D65A 2AWOA 3T53B 3NXWA 3WDNA 5KNDA 1TIID 3FKIB 1STBA 2D9UA 1S5DD 4G7OC 2K32A 3Q22A 2PW5A 1V43A 4KMUC 3Q0AA 2NVQB 5KRUA 1STHA 1RHPA 3G7LA 4DK0A 2A74C 4KN7C 5HURA 3S2DB 2N55A 5C44B 3FPPA 4KD4A 4NP5A 5JEAJ 3DEPA 1PMRA 2B2TC 3L3OC 2RDGA 1TS5A 5I4DA 3QB3A 3J81L 1EEID 2B2VA 2E2DC 1SYDA 2Q8RE 1U4PA 4C1NI 1F2ZA 2E2HB 1O80A 2KOLA 1PRTD 2DN8A 1GUOA 1LABA 1CM9A 2RDHA 2HDLA 4U673 2J7ZA 2FJ2A 1H9SA 3D8GA 1JQYD 1H9KA 2DY8A 3K57A 4I7ZC 4H7BA 1OXUA 4Y7NB 1O7LA 3NQTA 1JWUD 3D31A 3GV3A 5KEEA 2NN6H 3EVQA 1A15A 4XT3B 5I9OA 5KNCA 5I6YA 1NUCA 5DNFA 2JYOA 2M00A 3MTSA 1ENAA 3NSWA 2LFNA 4ZQ3A 1VMPA 3D4DA 2B8FA 3V05A 1SSOA 2PZUA 3MVVA 1U4MA 4LMQD 3I91A 3E5SA 5C3WA 1SNOA 3LWEA 3TP6A 3WOFA 3NE5B 4CKEA 1TKWB 1LACA 2F0UA 1AW7A 3LX0A 1I3QB 5E3FA 3DMUA 1CI3M 4K8JA 2Z8LA 2EYFA 2D5DA 4NKLA 1I4PA 3GO5A 2AUJD 1LTAD 1PFBA 5CBAE 1G2TA 2PQEA 1U4RA 1SJED 4G57A 4XIGS 5C4XB 3N52A 2R92B 3M7NA 3I90A 3IKJA 3PUZA 1HCZA 3BG3A 1EIHA 2NTSA 2K05A 5EPJA 4K6DA 1HQMC 1RTOA 4HMJA 2BA1A 5EBCA 1WTXA 5BN5A 5EGTA 2A69C 3TN2A 1EWCA 1W6JA 3FVQA 1O78A 5E1FA 3L9AX 2YYZA 3K58A 3DWAA 5CV7A 5T1GA 5I9PA 2L5TA 4K8IA 3TZDA 3BDCA 1WTVA 1WTOA 1HFNA 1BDOA 2EY6A 5DAUA 3NBHA 4ID6A 4XYQA 2LS01 3Q23A 1LT4D 1GOZA 4IURA 2E2IB 2ZXOA 2ID0A 3PIO3 1DM0B 3BDOA 1SYBA 1VF7A 3A54A 2FHTA 5FO8B 4QUCA 1ET9A 3VA5A 3MHBA 4KJNA 2NN6I 1EU3A 2WINB 4QUFA 3HRZC 4ZK9B 4DGZA 3MWYW 1D1IA 2M9VA 4BA2I 1Y1VB 1Q1BA 2QEJC 3LWUA 2RVLA 3TSSA 1M8AA 3MXPA 1EL0A 4NW2A 1CA6A 2KHSA 4QF4A 2K03A 4ILWA 2D2CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  4HAE A;  1KNE A;  2KUM A;  1F2L A;  1WTR A;  1IKL A;  1RTN A;  4OIJ A;  1SAP A;  3HP3 A;  2B2Y C;  2DY8 A;  4IUV A;  5EPK A;  4ZLT F;  4IUP A;  4X3S A;  1TVX A;  5CMD A;  1RJT A;  2FIN B;  1B2T A;  1X3Q A;  1RTO A;  1NAP A;  2R3Z A;  3IFD A;  1DOM A;  1PLF A;  2BDN A;  2HCI A;  4CJ1 B;  3GV3 A;  1WTX A;  2B2U A;  2FFK B;  3FPU B;  1GUW A;  1B53 A;  1ESR A;  5EJW A;  2N88 A;  2XIW A;  4CJ2 C;  1S4Z A;  4ZKB B;  1MSH A;  1HUN A;  3TN2 A;  1EIG A;  1G91 A;  2B2U C;  1B3A A;  2MP1 A;  2HUG A;  2KEC A;  5COR A;  4UAI A;  5D65 A;  3FDT A;  2RA4 A;  1HA6 A;  3Q6S A;  4MHE A;  1B4O A;  1A15 A;  1KNA A;  5D14 A;  4ZKC B;  4XT3 B;  2B2W C;  1WVL A;  1WTW A;  1C8C A;  1AZP A;  2MPM A;  2X69 A;  1DON A;  3QO2 A;  5T1G A;  1JE4 A;  1LV9 A;  1NR2 A;  2B2T A;  2D9U A;  5DNF A;  2EPB A;  4HED A;  4RA8 A;  3TZD A;  1WTV A;  2K01 A;  1WTO A;  2JYO A;  2Q8T A;  1HFN A;  4XT1 B;  5E4W C;  1F9S A;  1HUM A;  2NYZ D;  3MTS A;  1E0B A;  4U68 A;  1DOK A;  1WD1 A;  1B50 A;  1F9R A;  1WTP A;  1BF4 A;  1JIC A;  1HFG A;  4IUQ A;  4IUU A;  1IL8 A;  4X3T A;  3DEO A;  2L11 A;  1VMP A;  1RHP A;  1ML0 D;  3G7L A;  5EQ0 A;  1QE6 A;  2RSN A;  1MSG A;  2K28 A;  2IL8 A;  4XDX A;  2K05 A;  1PFM A;  4HSV A;  1HHV A;  2N55 A;  1SSO A;  4RAU C;  4IUR A;  2EE1 A;  3I8Z A;  3UI2 A;  1EOT A;  1U4M A;  2KEE A;  2RSO A;  2H1E A;  1X3P A;  2M2L A;  4LMQ D;  4R9W A;  3I91 A;  5JJZ A;  1WTQ A;  5AFW A;  2X6L A;  4R8I A;  3IL8 A;  1F9P A;  3DEP A;  2L1B A;  3LWE A;  4OIK A;  5E4X A;  1BBX C;  3H91 A;  2FHT A;  3I3C A;  1DOL A;  1ICW A;  2B2T C;  4X3K A;  4QUC A;  1XYI A;  1G2S A;  1NCV A;  2SDF A;  3F2U A;  1ILQ A;  2CVR A;  3GV6 A;  3SVM A;  1QNK A;  4IUT A;  2K1B A;  3D6W A;  1XX8 A;  2EOT A;  1O7Z A;  5EPL A;  2FMM A;  2B2V A;  2DY7 A;  4QUF A;  2L9H A;  2NWG A;  2NZ1 D;  5EKI A;  1IKM A;  1HRJ A;  4ZK9 B;  2B2Y A;  3R93 A;  3P7J A;  1SDF A;  5COY A;  2MJ8 A;  2L12 A;  1X32 A;  2Q8R E;  4O42 A;  1DZ1 A;  1O7Y A;  1U4P A;  4HCS A;  1ILP A;  1BO0 A;  1ROD A;  3MWY W;  1NR4 A;  2VXW A;  2L4N A;  1PFB A;  2K04 A;  4ZAI A;  1AP0 A;  5CBA E;  1O80 A;  1PDQ A;  2KOL A;  2HCC A;  5T1I A;  1PFN A;  1U4L A;  1G2T A;  1ZXT A;  1U4R A;  4MN3 A;  2MGS A;  3KUP A;  1AZQ A;  3N52 A;  1G6Z A;  3DM1 A;  2RVL A;  1J8I A;  1J9O A;  2KVM A;  2X6G A;  3KBX A;  1EQT A;  1MI2 A;  3I90 A;  3ONA B;  1VMC A;  1M8A A;  4X3U A;  1Q3L A;  4DN4 M;  5CBE E;  2B2W A;  1EL0 A;  1F9Q A;  1CA5 A;  4NW2 A;  2HDM A;  1MGS A;  2JP1 A;  1CM9 A;  1CA6 A;  4RWS C;  2HDL A;  1EIH A;  1BNZ A;  2J7Z A;  2KED A;  2K03 A;  4CJ0 B;  2FJ2 A;  1QG7 A;  5EPJ A;  2B2V C; 
#chains in the Genus database with same CATH topology
 4HJ5 A;  5GAH C;  3VR4 A;  4MTN A;  4A3K G;  1IBK L;  4QQB X;  4BY1 B;  4RKL A;  3K7A B;  2A6E C;  2A6H D;  3HOY H;  1CSQ A;  2F3W A;  1GUW A;  5A2Q L;  1EIG A;  4MNO A;  5G3L D;  2HUG A;  4K5X A;  3PIO A;  1XXG A;  2A5H A;  3GTO H;  1EY7 A;  5C5L A;  1K0R A;  1SNP A;  5IGG A;  2HQE A;  3T16 A;  4IFD H;  3L2P A;  3T13 A;  5M9O A;  3A74 A;  2MNA A;  4QCL A;  5M5X B;  4KY6 A;  1F9S A;  2NYZ D;  1YVC A;  1HH2 P;  1LTG D;  1MHW C;  4HCE A;  1EY0 A;  4OWW B;  3P1H A;  1KD1 C;  2K5V A;  1WTP A;  1JIC A;  1FYC A;  3DUZ A;  3E0J A;  3UE1 A;  1QJO A;  2L11 A;  4C3I B;  1ML0 D;  1F2Y A;  1DGS A;  2CQO A;  3ERQ A;  1MJC A;  4JYA L;  4IAL A;  2Z6K C;  1EY6 A;  1I4H A;  2OF1 A;  5IOD A;  1VQH A;  4XQN A;  1E22 A;  1WTQ A;  1PV4 A;  2KBN A;  3FHW A;  4Q0F A;  1HNW L;  3S1R B;  1CKN A;  5IWA Q;  2OQ0 A;  2Z4I A;  1LT6 D;  4LF9 Q;  1TWC H;  2F0O A;  4A3K H;  4WJ3 M;  4PZ7 A;  1JOQ A;  4WFN 3;  3S16 B;  3PUX A;  4A76 A;  1HRJ A;  1BVS A;  1HZB A;  4JCV E;  4O42 A;  1DZ1 A;  3CW2 C;  4K2L A;  4RGM A;  4GN3 B;  2WAQ B;  2K50 A;  5JJL A;  2ZXP A;  1SFO H;  2HCC A;  3EBE A;  4NXN L;  3H0G G;  3HOV B;  4LFB L;  4LK1 C;  1KDB A;  3CPW A;  1SBB B;  3BYY B;  1JB3 A;  1TS4 A;  2JA6 B;  5C3X A;  3SK8 A;  1A6X A;  1G8Z D;  4ZUI A;  2F0P A;  4RWS C;  4CDE C;  4AH6 A;  2EJF C;  1I4Q A;  2K28 A;  2ES2 A;  2F0S A;  2XN9 C;  4YCV A;  4OL7 A;  3CU7 A;  4LNQ A;  2BCO A;  3I4N G;  3U4Z A;  3J7A 5;  4QIW B;  1Q12 A;  3L0O A;  2C9O A;  2B2Y C;  3NTI A;  3MZ5 A;  3KOJ A;  2VUM G;  3S15 B;  4BY7 H;  2BA0 A;  3C1F A;  5ELC A;  2BDN A;  2B2U A;  5J22 A;  2L15 A;  4F88 A;  1Y1W G;  1LTT D;  3PUV A;  2B2U C;  2CFM A;  1GHK A;  3CCQ A;  3SDZ A;  2K33 A;  3BVZ A;  1WVL A;  1SE8 A;  3KLR A;  4DR4 Q;  2A6E D;  2NBF A;  1WI5 A;  3CQZ H;  4JI5 L;  5TSS A;  2F03 A;  2XGT A;  4LFA Q;  1E0B A;  5C0X G;  1NTG A;  4C1N K;  4DV2 Q;  5M5W H;  4TRD A;  1HZC A;  1HFG A;  4X3T A;  3LNN A;  3DEO A;  1IBM Q;  2Q8I B;  4C3H G;  2E5L Q;  1I50 B;  3H0G H;  4CKC A;  1AN8 A;  2EE1 A;  3J7Z C;  3PO2 G;  3I8Z A;  2SEB D;  1YIJ A;  4A3E G;  4NPS A;  4CKB A;  1IZ6 A;  1JJG A;  1XMO L;  5CR3 A;  1TT2 A;  4KD3 A;  1YHQ A;  2WB1 B;  1BBU A;  2A73 B;  1EYC A;  4O1N A;  2B39 A;  1RDP D;  2RCN A;  3HKZ E;  1HR0 Q;  3J80 i;  3I4N H;  2OQK A;  4X66 Q;  1V1Q A;  3VYR A;  2PQA A;  3TP5 A;  4M1U B;  1X56 A;  2EYL A;  4YHH L;  2VUM H;  1FL0 A;  4B9W A;  4DK6 C;  3S17 B;  4O0A A;  4IZ8 A;  3STB D;  3P7J A;  2IWH A;  5JEA H;  2LMC B;  4JI7 Q;  4P2C B;  2HT1 A;  3GTP H;  1Y1W H;  4IFD I;  3GTL H;  1U0L A;  4P75 A;  2PNR C;  3VYU A;  5IYC G;  1NR4 A;  2K04 A;  4J1M A;  1J5E Q;  3FEW X;  5IYD G;  2F0N A;  5FKA C;  4AYB E;  3GTG B;  1XMQ Q;  4EQO A;  1DYQ A;  4DR2 L;  2A19 A;  1G6Z A;  1Y69 U;  3GP7 A;  3I4M B;  1M90 C;  1VMC A;  4K0K Q;  1CA5 A;  1SN8 A;  1TWH H;  3HOU G;  2HDM A;  3O13 A;  5C0X H;  5EBD A;  1JB7 A;  1N32 Q;  1NE3 A;  4KJO A;  2MO0 A;  2VB3 X;  2JEB I;  2E2J B;  4C3H H;  2I46 A;  4JK1 C;  2OT2 A;  4C3J B;  1PZI D;  3PO2 H;  2PZW A;  3KDF B;  4A3E H;  1W6K A;  1FNV A;  2XIW A;  1S4Z A;  4JI2 L;  3R2I A;  2MP1 A;  3FDT A;  1Z9F A;  1HA6 A;  3RN5 A;  1XNR L;  3U9S A;  2B2W C;  1X65 A;  2WAC A;  3KF6 B;  1XPO A;  3I4L A;  3MA2 B;  1YZ6 A;  3IFT A;  1EU4 A;  4RA8 A;  5FJ8 G;  3AQQ A;  4XT1 B;  1T9H A;  1HNX L;  4K2K A;  1LM0 A;  3M4Q A;  1YJN A;  2KQ3 A;  5IYC H;  3HOX B;  4EGV A;  3DLL A;  1EQV A;  5M3M G;  4A3G G;  1Q8K A;  5IYD H;  1MSG A;  1WYD A;  3QOJ A;  3K5L A;  1B9N A;  1BR9 A;  1SR3 A;  2N8N A;  4R9W A;  3CCL A;  2Y0S E;  4WRD A;  4FP5 D;  4OWX B;  1A3V A;  2K7V A;  2WV6 D;  4R8N A;  5IGD A;  1DOL A;  4JV5 Q;  1VQ6 A;  4OON A;  4DF7 A;  4R4I A;  3W1B A;  2SDF A;  1IYJ B;  2R6G A;  4IOC A;  4A3I H;  1VQ4 A;  4DR1 L;  1GJX A;  2JA5 B;  1AEX A;  1Q86 C;  2A8V A;  3MEH A;  5EPL A;  5D3I B;  1BQQ T;  1FGU A;  2Y0S G;  4N8F A;  2J4X A;  4LF5 Q;  2H5X A;  3OPO A;  1X32 A;  2J0T D;  1W2B A;  1E1O A;  3HOW G;  1ILP A;  1ROD A;  4ZAI A;  2OEO A;  4DR5 Q;  1D8L A;  3PUY A;  4A3M B;  2IW3 A;  4QY7 A;  3ND9 A;  3PGZ A;  3J81 i;  5ELE A;  4MIU A;  3A56 A;  3S2H B;  4I7A A;  3I72 A;  4KV6 A;  1AZQ A;  4RHS A;  2CH4 A;  4R4T A;  1XTD A;  1LTB D;  1IXR A;  5CBE E;  1EWH A;  2JP1 A;  4JI8 Q;  3PSI A;  5M3F G;  2N49 A;  4CDC C;  3HZX A;  1WD0 A;  3K0X A;  2B2V C;  2RF4 A;  3V96 A;  1KNE A;  5C0X J;  5M3M H;  3WWV A;  3VR6 A;  1LT3 D;  4A3G H;  4G4K A;  1WCM G;  4IUP A;  2JA8 G;  1PH9 A;  1I94 Q;  3BVG A;  3C1E A;  1BCP B;  1TQO A;  3TP8 A;  5IIF A;  2KCN A;  3MXG A;  1VQO A;  1QZG A;  2JA7 G;  5HY6 A;  1VQL A;  1CZW A;  1PZK D;  2R93 B;  3OHX C;  2ZXR A;  2B63 B;  4A3B B;  4MZ9 A;  3RMH A;  3J7A V;  1TWG H;  1HNZ Q;  2EZV A;  3GTQ B;  2HHH Q;  1BUV T;  3A5Z B;  2ENB A;  1TWA B;  1CUK A;  3BZC A;  4GKJ Q;  1JE4 A;  1LV9 A;  4JC0 A;  4B08 A;  3KLS X;  2K52 A;  1PH2 A;  4AQY Q;  4N9P A;  5M5Y B;  2AQ2 B;  3N6R A;  2NB0 A;  3GTM B;  1VQ5 A;  2Z1C A;  3HOW H;  1K8O A;  2VL6 A;  3SHL A;  1STA A;  4QJF A;  2NZH A;  4C2M B;  2YV5 A;  2KEN A;  3QG1 A;  5C0X I;  1CQF A;  4HIK A;  4ME5 A;  3D4W A;  3W3A A;  3ERS X;  1OO9 B;  3H91 A;  4H0L C;  5M3F H;  2K14 A;  5ISR A;  1RIP A;  2PYK A;  2F0L A;  1ILQ A;  2BE5 D;  1PTO B;  2NZO A;  3JC6 6;  1WCM H;  2JA8 H;  1S5C D;  3HOY B;  4B3S Q;  3G4S A;  1OXV A;  3S14 H;  4C56 C;  2JA7 H;  1M1K C;  4DK3 C;  3CXC A;  3PIP A;  3RUZ A;  1EOV A;  5CYU A;  2TSS A;  3JAM E;  3UDI A;  4DV5 Q;  4RGN A;  1Q81 C;  4IQZ A;  1H9J A;  4DUZ Q;  4IN3 A;  3A8J E;  5LL6 S;  4IUN A;  1D5X C;  1VDZ A;  1L1O B;  1EEF D;  1VQG A;  1DXM A;  2G5D A;  2MUY A;  1J9O A;  1YEZ A;  3DWP A;  1J8I A;  1MI2 A;  4DNT B;  3J81 j;  1B3Q A;  5DM7 3;  5L37 A;  5LHY 1;  3Q24 A;  4GN4 B;  4CDF C;  5JAV A;  2F4I A;  1EIF A;  1IKL A;  4DV3 Q;  5C4J B;  2YU9 H;  1ET6 A;  3A7L A;  4ZLT F;  5CMD A;  2VW9 A;  2OWO A;  5C44 G;  4KHP L;  4ODG A;  1KLG D;  4JI0 Q;  4KKU A;  1JCK B;  1NAP A;  1SE2 A;  4RCN A;  3TS2 A;  2BDO A;  2KCM A;  5NUC A;  1EFI D;  4FF3 A;  1ENF A;  3PO3 B;  1JR0 D;  1TWF H;  1T5X D;  1VQD A;  5ELD A;  2F3I A;  4KY7 A;  1G29 1;  4IPH A;  3P20 A;  2LKV A;  3EN2 A;  3KK7 A;  4A3K B;  2MHV A;  4GN5 A;  2QDL A;  4JI6 Q;  3A8I E;  2K5D A;  1WTW A;  2CHB D;  2MPM A;  4RH6 A;  3M3Y H;  1S72 A;  3F2C A;  2F0W A;  2EPB A;  3T1H L;  1Q7Y C;  2KCC A;  4JW0 A;  3T1Y L;  2F52 A;  2ZJR A;  2Q8T A;  3H09 A;  1PZJ D;  5CV9 A;  2UU9 Q;  1WD1 A;  1B50 A;  2CWP A;  1R4P B;  4UDU C;  2V4D A;  5GAE C;  4HIM A;  1KL9 A;  3UE0 A;  4YCW A;  2JE6 I;  4GOP A;  5JVH 3;  4JI4 L;  1IBK Q;  1STG A;  2DJG C;  1PRT B;  4GOP C;  1F77 A;  1ENC A;  4PMB A;  1QUQ A;  4S3S A;  3RNU A;  2NVQ H;  1JC7 A;  5C3E B;  2ZTE A;  1XYI A;  4HR7 B;  2UXC L;  4KTA A;  1UE5 A;  5DEH A;  3S1Q H;  4BY7 B;  1AFP A;  4DFA A;  5C44 H;  2K6A A;  4IO9 A;  3ER0 A;  2KA7 A;  1GUG A;  2OTJ A;  3HG9 A;  2JK8 A;  3E6Z X;  3VR3 A;  1X3F A;  2IJ0 A;  3HKS A;  4PQX A;  4OXP A;  3MXN A;  5T1I A;  5K36 G;  2EDG A;  2AQ3 B;  5KYL A;  1KTK A;  1VQE A;  2EY1 A;  5HGQ A;  1I6H B;  4JYA Q;  1YHB A;  1H9R A;  2LY7 A;  1GUS A;  2X6G A;  2GA4 B;  3U9O A;  4DV6 L;  4ZCK A;  5EKL A;  1QVG A;  1G6P A;  5BN4 A;  1HNW Q;  1C0A A;  1B9M A;  5IT9 c;  2NVY H;  1OXS C;  4APV A;  3MEF A;  1PYS B;  1JWS D;  1F2L A;  3NWS A;  4YIJ A;  4TKO B;  2ZM6 L;  4X64 L;  3KF6 A;  3MAQ A;  3CC7 A;  2Z6B A;  4GLX A;  1A63 A;  3T51 B;  1QZH A;  1R9T B;  3RZO B;  2IY5 B;  4XQQ A;  2EXZ A;  1VQI A;  1I4X A;  4ULL A;  1Z6H A;  4LW1 A;  1N33 L;  3IAY A;  5KIX A;  3NHH A;  2KJX A;  2L55 A;  4GNX B;  4DAV A;  3S9W A;  3TBI B;  3RLO A;  5D14 A;  1SNQ A;  2A68 C;  2UUA L;  4DNR B;  4NXN Q;  1AZP A;  1B1Z A;  4LFB Q;  2NVX H;  4Y7N H;  3D0F A;  1K3B C;  3I4O A;  4PV1 C;  2B8G A;  2EJG C;  3GTL B;  5CGK A;  5GQO A;  5LL6 X;  2VQE L;  4U68 A;  3G71 A;  3FMC A;  5BR8 L;  2D62 A;  2K5W A;  1IL8 A;  1D1K A;  4R4O A;  4LUV A;  5C4X G;  1QE6 A;  5K36 H;  5JPN C;  4TQU S;  4XDX A;  2R92 G;  1HPC A;  2R61 A;  1TWH B;  4DXG A;  1G51 A;  3HFZ B;  4P71 A;  5AFW A;  4R8I A;  3IL8 A;  1QIL A;  3B6Y A;  3C46 A;  4OO1 G;  2PCF B;  2DJF C;  1NCV A;  2ALY B;  3D3R A;  2A69 D;  3URY A;  1BCP F;  3DM3 A;  3VR2 A;  3PO2 B;  3I2Z A;  3T56 B;  1XX8 A;  2EOT A;  4EVO A;  1RD9 D;  4JI5 Q;  2I5M X;  4K14 A;  3R93 A;  4XTC S;  1EY8 A;  1SYF A;  1CTM A;  1AP0 A;  1XJV A;  4L5Q A;  2JQO A;  2Z0S A;  4RGO S;  1ZXT A;  1I3Q H;  1TY0 A;  4FXD A;  3TDQ A;  2KVM A;  1HA5 A;  2B3G A;  4X3U A;  3PUW A;  5JPM C;  3CKI B;  2CCZ A;  3S1M H;  4V19 0;  1LTL A;  1ASY A;  1UNS A;  3HGB A;  1XMO Q;  3K8A A;  3HKZ B;  2QW7 A;  4A3D B;  1K83 B;  1WTR A;  2LXJ A;  1X6O A;  5CV8 A;  2R7Z B;  5C4X H;  1GVP A;  1RJT A;  1PFS A;  3AYH B;  3CAM A;  3EA6 A;  4CBV A;  1IL2 A;  5IYB G;  1S5E D;  3KFU A;  4DV4 L;  2RQX A;  4YHH Q;  3EFX D;  3NTK A;  1ESR A;  3K6O A;  2AUK A;  2GVB A;  2ZJQ A;  1MSH A;  4LF7 L;  4OO1 H;  4A3I B;  1ZEQ X;  4AYB B;  5LMN L;  1PTO F;  1E1T A;  5CV5 A;  1YNN C;  2XRS D;  1UE7 A;  1V1O A;  3VA7 A;  3TP7 A;  4DU9 A;  2O5I C;  3GD7 A;  1NR2 A;  1SYE A;  2N3S A;  4DR2 Q;  3HOZ B;  4HED A;  4Q5V A;  2P5Z X;  1PH1 A;  4A3J G;  1HUM A;  2G9D A;  2I07 B;  2K5N A;  5GAD C;  2XRQ D;  1A8V A;  4EQ5 A;  1STY A;  1NMG A;  4DR7 L;  1Y1V G;  4A4I A;  5C4H A;  2RCF A;  2A68 D;  4QB4 A;  2ICE C;  5EQ0 A;  3K5N A;  1Q90 A;  1PH6 A;  3SE0 A;  3SR1 A;  4N9T A;  2HQL A;  3A7A B;  1K8A C;  1F9P A;  4OIK A;  4JI2 Q;  4A3G B;  3KF8 B;  3JAM c;  1TXY A;  3TZU A;  3S1N B;  4A3L G;  3M7G A;  4BY1 G;  2HIX A;  3GV6 A;  1XNR Q;  1L0Y B;  1LTS D;  3CCE A;  4LF4 L;  1N8R C;  1SRO A;  4KKS A;  5DLQ E;  4DK1 A;  4IOA A;  2F0I A;  5IYB H;  4G7H C;  1L1O A;  4TSS A;  3P75 A;  1V1P B;  3CCV A;  1SDF A;  2RBM A;  5COY A;  4PZ8 A;  1HNX Q;  2F4V L;  1BO0 A;  4TVA B;  1SE4 A;  3K81 C;  1U4L A;  1CFM A;  1TY2 A;  2E74 C;  1XNQ L;  3MFG A;  4NMZ A;  1MJE A;  4HJ7 A;  3X3N A;  1HTL D;  3J7Y W;  3RZD B;  5E7N A;  2MGS A;  3M4P A;  3KBG A;  4BA1 I;  1EY9 A;  2Y0S B;  4DV1 L;  3ONA B;  3TME A;  1F9Q A;  4A3J H;  2CWA A;  3UDG A;  5K5P A;  1X54 A;  2I5L X;  4KHZ A;  1K9M C;  5IE8 A;  1EQR A;  2DGY A;  4C3I G;  4DR3 L;  4OIJ A;  1PRT F;  1S40 A;  4GLA C;  5D3D A;  3H94 A;  5FK9 C;  5IGF A;  4DR1 Q;  1FJG L;  4EQN A;  3CC4 A;  2PW7 A;  4OWT B;  3BVM A;  4DXF A;  1LYL A;  5M3F B;  2JJQ A;  1B53 A;  2V1C C;  2XNA C;  4JBW A;  4A3F B;  2WII B;  5COR A;  1CHQ D;  1VS0 A;  1A3U A;  2RA4 A;  2CQA A;  1K8G A;  4A3L H;  4JBJ A;  1MIU A;  3SK4 A;  2JA7 B;  3K7A H;  3BDL A;  4IPD A;  4B3R L;  1UEB A;  4UHV A;  1HQR D;  4H13 C;  1PH8 A;  2OCE A;  3NUC A;  4QIW E;  4ZYS A;  1HZA A;  5IOC A;  2BH8 A;  5DM6 3;  1TS2 A;  1YNN D;  1UE1 A;  3HOV G;  5IT9 E;  3D6C A;  2AQ1 B;  4RAU C;  2JA6 G;  1SE3 A;  1EOT A;  2RSO A;  1XPR A;  4HJ9 A;  1EYD A;  1TS3 A;  2PZT A;  1BBX C;  1B44 D;  2AKW B;  5ELB A;  1JJC B;  1PH5 A;  1D5Z C;  1L0X B;  4OEL B;  4DV0 L;  1IW7 C;  2VQF L;  3I55 A;  4M8A A;  3SVM A;  3GTK B;  5ELN A;  2K1B A;  2F3V A;  1IBL L;  3NWT A;  4F8M A;  3PF4 A;  4OO1 I;  1TWF B;  2FMM A;  4UY8 C;  3NEN A;  3CCJ A;  3A5U A;  2F0H A;  1CHP D;  2WFW A;  3CPF A;  3SGI A;  4CGY B;  1I4G A;  4Y52 H;  1N34 L;  1FGB D;  5CV4 A;  3NEL A;  1JOO A;  3GQB A;  4NXM L;  1PDQ A;  5C4Z A;  1D2B A;  3CCR A;  3OWF A;  3M4O B;  2QF7 A;  3HOU H;  3VYT A;  2PI2 E;  4WOR A;  3U50 C;  3G48 A;  2NVT B;  1T5E A;  3KUP A;  1NY4 A;  1EY5 A;  3GTJ B;  1LLR D;  1YIT A;  4F7X A;  2WB1 E;  3A55 A;  1Q8I A;  2KED A;  1IHZ A;  2EYH A;  2PO4 A;  2UXB L;  4GNX A;  3HP3 A;  3HOV H;  4X3S A;  1K73 C;  2FIN B;  1EZ8 A;  4BBS B;  4K5V A;  1HJP A;  2EYP A;  4ABN A;  3QWN A;  4DNI A;  4CJ1 B;  1QVF A;  2WB1 G;  3VR5 A;  5IT9 L;  1A2U A;  3H3V C;  3I56 A;  5FJ8 H;  3S1Q B;  2F0T A;  4DA2 A;  1CQV A;  5JVG 3;  1SNM A;  3E9I A;  4ZKC B;  4GKK L;  1CK1 A;  1AE3 A;  5IGC A;  2EY5 A;  2B2T A;  2NN6 G;  1XWE A;  3S15 H;  1RF2 D;  2F0V A;  3OSO A;  3J7A F;  3PIP 3;  1UE6 A;  3NTH A;  4A3C G;  2UXD L;  4P73 A;  1DJR D;  2IX0 A;  1FNW A;  2SOB A;  3D4R A;  1BF4 A;  3OW2 A;  4ALP A;  3CMA A;  3KLW A;  1STE A;  5FO7 B;  5FO9 B;  1CKO A;  1KHI A;  1LO5 D;  1OXX K;  1SEB D;  2Q2H A;  4YY3 L;  3I4M G;  4KHP Q;  3PCO B;  3M9B A;  1KQS A;  1GKH A;  3T4A C;  1X3P A;  4J6H A;  2RKS A;  5JJZ A;  2NVY B;  2PMZ B;  2X6L A;  2PPB C;  1M4V A;  1X55 A;  2FMC A;  2AWN A;  4FVM A;  1ICW A;  4DPG A;  1YJ9 A;  1ZYR C;  1Z47 A;  1EY4 A;  1I50 H;  3UDF A;  5EKK A;  5AJ3 L;  4IUT A;  2F0K A;  4C3J G;  3D6W A;  1PYB A;  4A93 B;  1MBY A;  1QCB D;  1GM5 A;  1A62 A;  4RHR A;  3T1H Q;  5EKI A;  2NZ1 D;  3T1Y Q;  1IKM A;  4DAM A;  3UDX A;  2MJ8 A;  1Y8P B;  4V0B A;  2JXM B;  3OOC A;  4BWG B;  5FLX c;  4BBR G;  2H4O A;  1IW7 D;  4LFC L;  2NVX B;  1PFN A;  4RKB A;  4DAY B;  3C2P A;  2NTT A;  1LTR D;  4JI4 Q;  1A2T A;  1IYV A;  1SJH D;  2QKI C;  3SK6 A;  5LMN W;  4DAP A;  4J8Q A;  2QDB A;  3G6E A;  1RL2 A;  4FF1 A;  4RGT A;  3CCS A;  1Q3L A;  4DN4 M;  4FF4 A;  1QOH A;  5HGT A;  1MGS A;  3HOX G;  2G9H D;  3CRK C;  4A3C H;  1KRT A;  5J1Z A;  2F0E A;  3GTG H;  2UXC Q;  3GTO B;  4IUV A;  4WJW A;  5EPK A;  4NB3 A;  1TVX A;  2C35 B;  5IP9 G;  1BOS A;  1JE5 A;  1X3Q A;  4QL5 A;  2BH2 A;  1CT1 D;  4B9X A;  3FKI G;  4LJZ C;  1QNU A;  3FPU B;  4B3M L;  1EQQ A;  3MFY A;  1SMY C;  2DNE A;  2KEC A;  1SNC A;  2E76 C;  4YWM A;  2E2J H;  4MHE A;  2JA5 G;  3WOE A;  4XXE A;  3E3X A;  4FDB A;  2R7D A;  2IX3 A;  3VYS A;  2R7F A;  3J80 c;  3TQY A;  4C3J H;  2ZT9 C;  1VQ8 A;  4R4C A;  1EYA A;  1YNJ C;  2K5Q A;  4XYO A;  5E4W C;  1L2F A;  4DV6 Q;  2Q2U A;  1R4Q B;  1DOK A;  1F9R A;  4A3M G;  5G3L F;  2DNC A;  3KF8 A;  4IUU A;  5BN3 A;  4BBR H;  3CRL C;  1TWC B;  2D0P A;  4OGQ C;  2ZM6 Q;  4X64 Q;  2QCP X;  1PFM A;  1SYC A;  1XTC D;  2UUC L;  3S1M B;  3OIP A;  2M2L A;  1ZKO A;  4JVZ A;  3TRZ A;  2ZJP A;  2L1B A;  1V1P A;  3I3C A;  4FXK C;  5JJK A;  3HOX H;  1OXT A;  1N33 Q;  1GUT A;  2PQA B;  1JOK A;  1SFO B;  3H15 A;  2UUA Q;  3L7Z C;  2A6H C;  1CZG A;  1S5B D;  4RG1 A;  4K6L A;  2EYM A;  4AIM A;  4POG A;  4DUY L;  3JAM i;  3E9H A;  2R93 G;  4PMC A;  3FKI H;  3NEM A;  2MFI A;  2VQE Q;  1GUN A;  5BR8 Q;  3JAM L;  2KHI A;  3F2D A;  1D6E C;  4HMI A;  1OTC A;  1IYU A;  1ZYR D;  4J15 A;  4PMW A;  2JA5 H;  1UUP A;  1EFW A;  1S5F D;  3K5O A;  4HSP A;  1B70 B;  3DM1 A;  2A1A A;  2EYO A;  1EQT A;  3K80 C;  3S2D H;  1HTP A;  3OMG A;  4GZY C;  2XVS A;  4RFB A;  2PNH A;  2BOS A;  4CJ0 B;  3ZYY X;  4A3M H;  1Y14 B;  2WKD A;  1QG7 A;  1PYW D;  1EYG A;  1E2W A;  1CKM A;  3S2H H;  5JOB A;  3SXH A;  1UEA B;  5I2X A;  4X62 L;  1L0W A;  2R3Z A;  1O7I A;  3KLS A;  1GXD C;  3CQZ B;  3R3O A;  2WKC A;  4KHV A;  2HCI A;  1A3T A;  4ZKB B;  4OX9 L;  4B3T L;  1UWV A;  5A2Q E;  1PH3 A;  1B3A A;  5F2D A;  5M5W B;  4UAI A;  1VCI A;  2F1M A;  3KDF A;  3R2T A;  4LAA A;  1KNA A;  3QR8 A;  2E2H H;  2E75 C;  1NSN S;  1C8C A;  4RCO A;  1ONL A;  3H0G B;  1I5F A;  3W5O A;  3QJY A;  1E2V A;  1Z7T A;  2RHS B;  3A0J A;  2R93 H;  1CSP A;  3EQL C;  4WJ4 A;  4JI3 L;  4QMG A;  4LWC A;  1SMY D;  3QIA A;  4IFD G;  5LMU L;  3K59 A;  1DCZ A;  5FOB B;  3GTQ H;  4H44 C;  1JOR A;  1Y8O B;  4YWK A;  2JSO A;  1AH9 A;  1U9R A;  1KAW A;  3I4N B;  1TWA H;  4LF6 L;  1J6Q A;  2IL8 A;  2SNM A;  3J81 c;  3OTO L;  1HHV A;  2WP8 J;  2E8G A;  4IJH A;  3UI2 A;  5I2Y A;  1YNJ D;  5I6W A;  2KEE A;  5M5Y H;  4DV4 Q;  4A3J B;  1KRS A;  2HD3 A;  2VUM B;  2O2L D;  5GRO A;  4G7Z C;  2F0G A;  3GTM H;  3GTP B;  5E4X A;  4LF7 Q;  4X3K A;  1Y1W B;  4GLV B;  5LMN Q;  3X3M A;  3F2U A;  5KNB A;  2CVR A;  2K4K A;  4L8J A;  2Z4H A;  1O7Z A;  3PO3 G;  2EXD A;  2KCT A;  2L12 A;  1PA6 A;  3FP9 A;  2F0M A;  1JT8 A;  2VXW A;  2L4N A;  1C4Q A;  3BJU A;  3M4Y A;  4IPC A;  1SXT A;  4DR7 Q;  1N36 L;  1PTO H;  2VY3 A;  4JBM A;  4C3H B;  3ULJ A;  4EQP A;  2JN4 A;  3W1G A;  3M85 A;  3CF5 A;  4A3E B;  1NJI C;  3OIQ A;  3W2D A;  2EQS A;  1II3 A;  4L63 B;  4FXG C;  3ERO A;  3DXJ C;  5IGE A;  1EWI A;  2KUM A;  5KYI A;  4HN7 A;  3NQI A;  3KJO A;  4LF4 Q;  2CW0 C;  3DWQ A;  1P16 A;  4PNY A;  1KAB A;  4PZ6 A;  1KDC A;  1JWM D;  1KLU D;  1DOM A;  5KGU A;  2VB2 X;  5C3E G;  2LXK A;  2N88 A;  2N78 A;  1HUN A;  4OHJ A;  1G91 A;  2UUB L;  2F4V Q;  1H9S B;  1C48 A;  2Z6K A;  2GN5 A;  1BCP C;  1B4O A;  5JJI A;  4BY7 G;  5C4J H;  3AFQ A;  4P72 A;  1XNQ Q;  2SNS A;  4H02 A;  1SRU A;  3NK9 A;  4FF2 A;  4BS9 A;  2X69 A;  5FLX E;  3MC0 B;  3STB C;  4DV7 L;  4DR6 L;  2K01 A;  4DV1 Q;  1H95 A;  3PO3 H;  2ASB A;  2VNU D;  2R92 H;  2FXQ A;  1FD7 D;  3NBI A;  3HOU B;  2ZTC A;  3OYY A;  1VQK A;  4NDX A;  1YNX A;  3Q8D A;  4HIO A;  4DR3 Q;  1KC8 C;  2RSN A;  4KN4 C;  1AE2 A;  1Q46 A;  3TRE A;  2VS1 A;  4ZRZ A;  1FJG Q;  3RD4 A;  5C6A A;  2XWB B;  4JI1 L;  1QB5 D;  1BBW A;  3RN2 A;  4X65 L;  2H1E A;  1EIY B;  2EY2 A;  4F87 A;  3VDY A;  1DD2 A;  5CV6 A;  4XQJ A;  1LTI D;  5IP7 G;  4K5W A;  4QGU A;  2I0Q A;  4LF8 L;  2IT1 A;  5J39 A;  3F1Z A;  2MQH A;  1MD2 D;  3OMC A;  3CHB D;  4DAY A;  4ME3 A;  1Y8N B;  3QOL A;  4B3R Q;  2DY7 A;  2AHO B;  5C5M A;  4FNF A;  4CDD C;  3J80 E;  3AMU A;  2B2Y A;  1ICF B;  5C3E H;  1V8Q A;  1PTO C;  4L6T B;  2JEA I;  4KK7 A;  2ATW A;  5M3M B;  5JEA G;  4MN3 A;  2AMC B;  4HTH A;  1PH7 A;  2IHF A;  3MXU A;  1Q1E A;  2ICI A;  2E2I H;  4LUO A;  2XWJ B;  5FLX L;  1L1O C;  1TWG B;  4DV0 Q;  4FYD A;  2VQF Q;  2TMP A;  1SAP A;  4N8X 1;  4IFD J;  4LUZ A;  3V2T A;  1I6H H;  3PQI A;  1BXT A;  1VF5 C;  1YHA A;  2O4X A;  1IBL Q;  1B2T A;  1TU2 B;  3U58 A;  1SYG A;  3PV0 A;  2FFK B;  1VQM A;  2KHJ A;  2F0J A;  4CJ2 C;  5IP7 H;  5H1S E;  5IWA L;  1N34 Q;  4LF9 L;  5ELF A;  2NUC A;  4NXM Q;  2L0C A;  1FNU A;  3HOW B;  3Q6S A;  1E2Z A;  1Q82 C;  1VQ7 A;  1I6V C;  5A35 A;  2CW0 D;  1KDA A;  1DON A;  3QO2 A;  2IPK D;  3AU7 A;  3HEJ A;  1Y1V H;  2XSC A;  5IGB A;  1RCV D;  1R9T H;  3RZO H;  3I70 A;  3CME A;  4ZUJ A;  1RKN A;  4GOP B;  2CKZ B;  2C5C A;  1EZ6 A;  3SK5 A;  3NPP A;  3CCU A;  3H6M A;  1WJJ A;  4IUQ A;  4O2D A;  4X6A H;  1BCP D;  2WAQ E;  2UXB Q;  2VZA A;  4E6I A;  1K3R A;  1QUQ B;  3J80 L;  4A75 A;  4HSV A;  2EVB A;  1WCM B;  2JA8 B;  3H3V H;  4Z9C B;  3S14 B;  4BY1 H;  1H9M A;  1GHJ A;  1STN A;  1WFQ A;  4R1J A;  3HKZ G;  3HS0 C;  1VQJ A;  1QVC A;  3NBH B;  4A3D G;  1G2S A;  1PXU A;  4YCU A;  3CC2 A;  1PRT C;  4R4Q A;  5EAY A;  3ND8 A;  2WAQ G;  2F0F A;  3EIV A;  2R7Z G;  1FR3 A;  4I65 A;  1QNK A;  3EJI A;  4UPA A;  3C3L A;  4GKK Q;  2QIL A;  1D5M C;  3OW7 A;  3K0Y A;  1YBY A;  1YJW A;  2L9H A;  2NWG A;  4JPB W;  2F0Q A;  2OXP A;  3G6J B;  3MXN B;  4EX5 A;  1QWY A;  4A3I G;  3SEB A;  4AYB G;  5M5X H;  1U5K A;  2UXD Q;  3OWE B;  1O7Y A;  4HCS A;  4FO2 A;  4P74 A;  2K5H A;  3PMF A;  3BZK A;  2EJM A;  2YU9 B;  1LT5 D;  3HOZ G;  4DR4 L;  4YY3 Q;  2EYJ A;  3NP8 A;  4C3I H;  1SND A;  2F0D A;  4KKT A;  3KBX A;  1TR5 A;  3J81 E;  1I4R A;  2B2W A;  3BS1 A;  4LFA L;  4CHT B;  2O5J C;  1PTO D;  4DV2 L;  3BYT B;  2D0O A;  4BBR B;  1HXY D;  3ITP A;  1S3O A;  1BNZ A;  1UAP A;  3FRP B;  2RDF A;  1PH4 A;  4HAE A;  3S1R H;  1IBM L;  3A8K E;  1RTN A;  3DHQ A;  3BZD B;  3I73 A;  2E5L L;  5AJ3 Q;  1KAA A;  1P8L A;  4KY5 A;  3M3Y B;  3F2B A;  3K5M A;  1VQB A;  4JOI A;  4KI0 A;  5CC4 A;  3R8B A;  3IFD A;  1F2M A;  1PLF A;  4JOI C;  3E0E A;  4L5T A;  2I5H A;  1ESF A;  5EJW A;  3S16 H;  1K8M A;  3RLF A;  2IX1 A;  2BE5 C;  3AB9 A;  5D65 A;  3TEH B;  1JMC A;  1K83 H;  1X3E A;  2AWO A;  5IY0 A;  1HR0 L;  4A3D H;  1LUZ A;  2QGQ A;  4LFC Q;  3T53 B;  3NXW A;  3WDN A;  5KND A;  1TII D;  2R7Z H;  4X66 L;  1A0I A;  1C9O A;  4PG3 A;  3FKI B;  1STB A;  2D9U A;  1S5D D;  4G7O C;  2MO1 A;  1D7Q A;  2K32 A;  4GNX C;  4JI7 L;  3Q22 A;  2PW5 A;  1PHJ A;  2JA6 H;  1V43 A;  4KMU C;  3Q0A A;  2NVQ B;  1J5E L;  1JJ2 A;  5KRU A;  1STH A;  1RHP A;  3G7L A;  4DK0 A;  1XMQ L;  1VQ9 A;  2Q2I A;  2A74 C;  4KN7 C;  5HUR A;  4GS3 A;  3S2D B;  2N55 A;  4UP8 A;  3HOZ H;  5C44 B;  3IRB A;  3FPP A;  4KD4 A;  4NP5 A;  1VQN A;  4K0K L;  5JEA J;  1E3P A;  4B3M Q;  3DEP A;  1PMR A;  1N32 L;  2B2T C;  3L3O C;  3RLN A;  1B7Y B;  2RDG A;  1TS5 A;  5I4D A;  3S24 A;  3QB3 A;  1X3G A;  2RHQ B;  1EEI D;  3J81 L;  3PF5 A;  1C7Y A;  2Q2T A;  2B2V A;  2E2D C;  2GVA A;  1SYD A;  1CKN B;  1MKH A;  4A3F G;  2Q8R E;  1U4P A;  4C1N I;  1F2Z A;  1PVO A;  2E2H B;  3S1N H;  1O80 A;  2KOL A;  1PRT D;  4JG2 A;  2DN8 A;  1GUO A;  2UUC Q;  1LAB A;  4BXX G;  1EUJ A;  1CM9 A;  2RDH A;  2HDL A;  4U67 3;  2J7Z A;  4HID A;  2FJ2 A;  1H9S A;  4HJA A;  3H3V I;  3D8G A;  1JQY D;  1H9K A;  4YWL A;  2DY8 A;  3RZD H;  2QEX A;  3K57 A;  4I7Z C;  4H7B A;  4DUY Q;  1OXU A;  1VQP A;  4Y7N B;  1O7L A;  3NQT A;  1JWU D;  3D31 A;  3GV3 A;  5KEE A;  2HIV A;  3CP0 A;  1SMX A;  2NN6 H;  3EVQ A;  3S17 H;  2B29 A;  4JV5 L;  1BKB A;  1FVI A;  1A15 A;  3ULP A;  4XT3 B;  5I9O A;  5KNC A;  3ICE A;  5I6Y A;  1NUC A;  5DNF A;  2JYO A;  1NNX A;  2M00 A;  2IHE A;  4LF5 L;  3I4M H;  3MTS A;  1WOC A;  1VQC A;  4A3F H;  1ENA A;  4DR5 L;  1KIX A;  1YI2 A;  3NSW A;  3AFP A;  1VQF A;  4HJ8 A;  2LFN A;  4UP9 A;  4ZQ3 A;  1VMP A;  3D4D A;  2B8F A;  4X62 Q;  3V05 A;  1SSO A;  2PZU A;  3MVV A;  1U4M A;  4LMQ D;  3I91 A;  3GDE A;  1V9P A;  3BU2 A;  3E5S A;  1HZ9 A;  5C3W A;  1B8A A;  1SNO A;  3LWE A;  4JI8 L;  4BXX H;  3TP6 A;  4B3T Q;  1W3S A;  4OX9 Q;  1WTH A;  1NMF A;  3WOF A;  2Z9H A;  3NE5 B;  4CKE A;  2QA4 A;  1TKW B;  1LAC A;  2F0U A;  1AW7 A;  1N9W A;  1I3Q B;  3LX0 A;  5E3F A;  4BBS G;  1I94 L;  3DMU A;  1CI3 M;  4K8J A;  1E7Z A;  2Z8L A;  1GD7 A;  2EYF A;  1K28 A;  2D5D A;  2JA9 A;  4NKL A;  1I4P A;  3GO5 A;  2AUJ D;  4JI3 Q;  3K7U C;  1LTA D;  5LMU Q;  1PFB A;  2XTI A;  5CBA E;  3CCM A;  1HNZ L;  5FLM G;  2HHH L;  1G2T A;  3GTK H;  3AEV A;  1E24 A;  2PQE A;  1U4R A;  4LF6 Q;  1SJE D;  4GKJ L;  4G57 A;  4XIG S;  4UP7 A;  3OTO Q;  1X9N A;  5C4X B;  2OTL A;  3N52 A;  2R92 B;  4AQY L;  2PMZ E;  4JBK A;  3M7N A;  3I90 A;  3IKJ A;  3PUZ A;  1HCZ A;  5IP9 H;  1SLJ A;  4RMF A;  3BG3 A;  1EIH A;  1KXL A;  2NTS A;  2K05 A;  4MTK A;  5EPJ A;  2EIF A;  3M4O H;  2B63 G;  4A3B G;  2PI2 A;  4K6D A;  2NVT H;  2YTX A;  2YTV A;  1HQM C;  1RTO A;  4HMJ A;  2BA1 A;  5EBC A;  2CH4 W;  3GTJ H;  1WTX A;  5BN5 A;  5EGT A;  4L5R C;  2A69 C;  3TN2 A;  1GO3 E;  1EWC A;  1W6J A;  3FVQ A;  1VQA A;  3U4V A;  1O78 A;  5E1F A;  3L9A X;  3KYH C;  2YYZ A;  1N36 Q;  3K58 A;  3DWA A;  3TS0 A;  4A93 G;  5CV7 A;  3ULL A;  5T1G A;  4B3S L;  5I9P A;  4BBS H;  2L5T A;  4K8I A;  3TZD A;  3BDC A;  1WTV A;  1WTO A;  1HFN A;  1BDO A;  4KLK A;  4POF A;  2YTY A;  2EY6 A;  5DAU A;  4DV5 L;  3RR5 A;  4DUZ L;  3NBH A;  5FLM H;  4ID6 A;  4L5S A;  4XYQ A;  2LS0 1;  3Q23 A;  1LT4 D;  1GOZ A;  4IUR A;  2ZTD A;  5GAG C;  3HOY G;  2E2I B;  2ZXO A;  2ID0 A;  3PIO 3;  1DM0 B;  3BDO A;  1SYB A;  1VF7 A;  3A54 A;  2FHT A;  5FO8 B;  2UUB Q;  2K75 A;  4QUC A;  1ET9 A;  3LGJ A;  3VA5 A;  3MHB A;  4DV3 L;  2B63 H;  4A3B H;  4KJN A;  3CD6 A;  4JI0 L;  2NN6 I;  4DV7 Q;  1EU3 A;  2WIN B;  4QUF A;  1ASZ A;  4DR6 Q;  3HRZ C;  1NBW A;  1XPU A;  4ZK9 B;  4DGZ A;  5ELO A;  3MWY W;  2LSS A;  1K0S A;  1D1I A;  2DUD A;  3ZJY C;  4JI6 L;  2M9V A;  4IJL A;  4DKA C;  4BA2 I;  4IPG A;  1Y1V B;  4A93 H;  1Q1B A;  2QEJ C;  4OEM B;  3LWU A;  2RVL A;  3I7F A;  5J3B A;  4JI1 Q;  3KJP A;  1HR0 W;  3TSS A;  4X65 Q;  3F8T A;  1M8A A;  4C2M H;  3MXP A;  2UU9 L;  1EL0 A;  4NW2 A;  1CA6 A;  2KHS A;  4QF4 A;  2K03 A;  4LF8 Q;  4ILW A;  2D2C C; 
#chains in the Genus database with same CATH homology
 3VR4 A;  4BY1 B;  4RKL A;  3K7A B;  2A6E C;  2A6H D;  2F3W A;  1GUW A;  5A2Q L;  1EIG A;  5G3L D;  2HUG A;  4K5X A;  1XXG A;  2A5H A;  1EY7 A;  5C5L A;  1SNP A;  5IGG A;  2HQE A;  3T16 A;  4IFD H;  3T13 A;  5M9O A;  4QCL A;  5M5X B;  4KY6 A;  1F9S A;  2NYZ D;  1LTG D;  4HCE A;  1EY0 A;  3P1H A;  1WTP A;  1JIC A;  1FYC A;  3DUZ A;  3E0J A;  1QJO A;  2L11 A;  4C3I B;  1ML0 D;  1F2Y A;  3ERQ A;  4IAL A;  1EY6 A;  1I4H A;  2OF1 A;  5IOD A;  1WTQ A;  4XQN A;  4Q0F A;  3S1R B;  2Z4I A;  1LT6 D;  2F0O A;  1JOQ A;  4WFN 3;  3S16 B;  3PUX A;  1HRJ A;  4O42 A;  1DZ1 A;  4K2L A;  4RGM A;  2WAQ B;  2ZXP A;  2HCC A;  3HOV B;  4LK1 C;  1KDB A;  1SBB B;  3BYY B;  1JB3 A;  1TS4 A;  2JA6 B;  5C3X A;  3SK8 A;  1A6X A;  1G8Z D;  4ZUI A;  2F0P A;  4RWS C;  2EJF C;  1I4Q A;  2K28 A;  2F0S A;  2XN9 C;  4OL7 A;  3CU7 A;  2BCO A;  4QIW B;  1Q12 A;  2C9O A;  2B2Y C;  3NTI A;  3MZ5 A;  3S15 B;  2BA0 A;  3C1F A;  5ELC A;  2BDN A;  2B2U A;  5J22 A;  4F88 A;  1LTT D;  3PUV A;  2B2U C;  1GHK A;  3SDZ A;  2K33 A;  3BVZ A;  1WVL A;  3KLR A;  2A6E D;  2NBF A;  5TSS A;  2F03 A;  1E0B A;  5C0X G;  4C1N K;  4TRD A;  1HFG A;  4X3T A;  3LNN A;  3DEO A;  2Q8I B;  4C3H G;  1I50 B;  4CKC A;  1AN8 A;  2EE1 A;  3I8Z A;  2SEB D;  4CKB A;  5CR3 A;  1TT2 A;  4KD3 A;  2WB1 B;  2A73 B;  1EYC A;  4O1N A;  2B39 A;  1RDP D;  3VYR A;  3TP5 A;  4M1U B;  2EYL A;  4B9W A;  3S17 B;  4IZ8 A;  3P7J A;  2IWH A;  5JEA H;  2LMC B;  4P2C B;  4IFD I;  2PNR C;  3VYU A;  1NR4 A;  2K04 A;  4J1M A;  3FEW X;  2F0N A;  5FKA C;  3GTG B;  4EQO A;  1DYQ A;  1G6Z A;  1Y69 U;  3GP7 A;  3I4M B;  1VMC A;  1CA5 A;  2HDM A;  3O13 A;  5C0X H;  5EBD A;  4KJO A;  2VB3 X;  2JEB I;  2E2J B;  2I46 A;  4JK1 C;  2OT2 A;  4C3J B;  1PZI D;  2PZW A;  1W6K A;  1FNV A;  2XIW A;  1S4Z A;  3R2I A;  2MP1 A;  3FDT A;  1HA6 A;  3U9S A;  2B2W C;  2WAC A;  3I4L A;  3MA2 B;  3IFT A;  1EU4 A;  4RA8 A;  4XT1 B;  4K2K A;  2KQ3 A;  3HOX B;  4EGV A;  1EQV A;  1MSG A;  3QOJ A;  3K5L A;  1B9N A;  1BR9 A;  4R9W A;  4WRD A;  4FP5 D;  1A3V A;  2K7V A;  2WV6 D;  4R8N A;  5IGD A;  1DOL A;  4DF7 A;  2SDF A;  2R6G A;  1GJX A;  2JA5 B;  1AEX A;  3MEH A;  5EPL A;  5D3I B;  1BQQ T;  2J4X A;  3OPO A;  1X32 A;  2J0T D;  1ILP A;  1ROD A;  4ZAI A;  2OEO A;  3PUY A;  4A3M B;  2IW3 A;  3ND9 A;  5ELE A;  4MIU A;  3A56 A;  3S2H B;  3I72 A;  4KV6 A;  1AZQ A;  4RHS A;  1LTB D;  5CBE E;  1EWH A;  2JP1 A;  3HZX A;  1WD0 A;  2B2V C;  3V96 A;  1KNE A;  5C0X J;  3VR6 A;  1LT3 D;  4G4K A;  4IUP A;  3BVG A;  3C1E A;  5IIF A;  1BCP B;  1TQO A;  3TP8 A;  2KCN A;  3MXG A;  1CZW A;  1PZK D;  2R93 B;  3OHX C;  2ZXR A;  2B63 B;  4A3B B;  3RMH A;  3J7A V;  2EZV A;  3GTQ B;  1BUV T;  2ENB A;  1TWA B;  1JE4 A;  1LV9 A;  4B08 A;  3KLS X;  4N9P A;  5M5Y B;  2AQ2 B;  3N6R A;  2NB0 A;  3GTM B;  2Z1C A;  1K8O A;  3SHL A;  1STA A;  4C2M B;  3QG1 A;  5C0X I;  1CQF A;  4ME5 A;  3D4W A;  3W3A A;  1OO9 B;  3H91 A;  4H0L C;  5ISR A;  2PYK A;  2F0L A;  1ILQ A;  2BE5 D;  1PTO B;  3HOY B;  1S5C D;  1OXV A;  4C56 C;  3RUZ A;  5CYU A;  2TSS A;  3JAM E;  4RGN A;  4IQZ A;  1H9J A;  4IN3 A;  3A8J E;  5LL6 S;  4IUN A;  1D5X C;  1VDZ A;  1EEF D;  1DXM A;  2MUY A;  1J9O A;  3DWP A;  1J8I A;  1MI2 A;  4DNT B;  5DM7 3;  5LHY 1;  3Q24 A;  5JAV A;  2F4I A;  1IKL A;  5C4J B;  1ET6 A;  3A7L A;  4ZLT F;  5CMD A;  4ODG A;  1KLG D;  4KKU A;  1JCK B;  1NAP A;  1SE2 A;  4RCN A;  2BDO A;  5NUC A;  1EFI D;  4FF3 A;  1ENF A;  3PO3 B;  1JR0 D;  1T5X D;  5ELD A;  4KY7 A;  1G29 1;  3P20 A;  2LKV A;  3KK7 A;  4A3K B;  2MHV A;  3A8I E;  2K5D A;  1WTW A;  2CHB D;  2MPM A;  4RH6 A;  2F0W A;  2EPB A;  2KCC A;  2Q8T A;  3H09 A;  1PZJ D;  5CV9 A;  1WD1 A;  1B50 A;  1R4P B;  4UDU C;  2V4D A;  2JE6 I;  5JVH 3;  1STG A;  1PRT B;  1F77 A;  1ENC A;  4PMB A;  4S3S A;  1JC7 A;  5C3E B;  1XYI A;  4HR7 B;  4KTA A;  5DEH A;  4BY7 B;  1AFP A;  4DFA A;  2K6A A;  2KA7 A;  1GUG A;  3HG9 A;  3E6Z X;  3VR3 A;  2IJ0 A;  4PQX A;  3MXN A;  5T1I A;  5K36 G;  2EDG A;  2AQ3 B;  5KYL A;  1KTK A;  2EY1 A;  1I6H B;  1H9R A;  2LY7 A;  1GUS A;  2X6G A;  2GA4 B;  3U9O A;  5EKL A;  5BN4 A;  1B9M A;  1OXS C;  1JWS D;  1F2L A;  3NWS A;  4YIJ A;  4TKO B;  3MAQ A;  3T51 B;  1R9T B;  3RZO B;  4XQQ A;  2EXZ A;  1I4X A;  4ULL A;  1Z6H A;  3IAY A;  5KIX A;  3NHH A;  2KJX A;  2L55 A;  4DAV A;  3S9W A;  3TBI B;  5D14 A;  1SNQ A;  2A68 C;  4DNR B;  1AZP A;  1B1Z A;  4PV1 C;  2B8G A;  2EJG C;  3GTL B;  5CGK A;  5LL6 X;  4U68 A;  3FMC A;  2D62 A;  2K5W A;  1IL8 A;  1D1K A;  1QE6 A;  5K36 H;  5JPN C;  4TQU S;  4XDX A;  1HPC A;  2R61 A;  1TWH B;  4DXG A;  5AFW A;  4R8I A;  3IL8 A;  1QIL A;  4OO1 G;  3C46 A;  2PCF B;  1NCV A;  3D3R A;  2A69 D;  3URY A;  1BCP F;  3VR2 A;  3PO2 B;  3T56 B;  1XX8 A;  2EOT A;  4EVO A;  1RD9 D;  4K14 A;  3R93 A;  4XTC S;  1EY8 A;  1SYF A;  1CTM A;  1AP0 A;  4RGO S;  1ZXT A;  1TY0 A;  4FXD A;  3TDQ A;  2KVM A;  1HA5 A;  4X3U A;  3PUW A;  5JPM C;  3CKI B;  4V19 0;  1UNS A;  3HGB A;  3HKZ B;  4A3D B;  1K83 B;  1WTR A;  5CV8 A;  2R7Z B;  1RJT A;  3EA6 A;  4CBV A;  1S5E D;  2RQX A;  3EFX D;  3NTK A;  1ESR A;  3K6O A;  2AUK A;  1MSH A;  4OO1 H;  4A3I B;  1ZEQ X;  4AYB B;  1PTO F;  5CV5 A;  1YNN C;  2XRS D;  1V1O A;  3VA7 A;  3TP7 A;  4DU9 A;  2O5I C;  3GD7 A;  1NR2 A;  1SYE A;  3HOZ B;  4HED A;  4Q5V A;  1HUM A;  2G9D A;  2I07 B;  2XRQ D;  1STY A;  5C4H A;  2A68 D;  4QB4 A;  2ICE C;  5EQ0 A;  3K5N A;  1Q90 A;  3SE0 A;  3SR1 A;  4N9T A;  3A7A B;  1F9P A;  4OIK A;  4A3G B;  3TZU A;  3S1N B;  3M7G A;  3GV6 A;  1L0Y B;  1LTS D;  4KKS A;  4DK1 A;  2F0I A;  4G7H C;  4TSS A;  3P75 A;  1V1P B;  1SDF A;  2RBM A;  5COY A;  1BO0 A;  1SE4 A;  1U4L A;  1CFM A;  1TY2 A;  2E74 C;  3MFG A;  4NMZ A;  3X3N A;  1HTL D;  3J7Y W;  3RZD B;  2MGS A;  3KBG A;  4BA1 I;  1EY9 A;  2Y0S B;  3ONA B;  3TME A;  1F9Q A;  5K5P A;  4KHZ A;  4C3I G;  4OIJ A;  1PRT F;  5D3D A;  5FK9 C;  3H94 A;  5IGF A;  4EQN A;  2PW7 A;  4DXF A;  3BVM A;  5M3F B;  1B53 A;  2XNA C;  4JBW A;  4A3F B;  2WII B;  5COR A;  1CHQ D;  1A3U A;  2RA4 A;  2CQA A;  3SK4 A;  2JA7 B;  3BDL A;  1HQR D;  4H13 C;  3NUC A;  4ZYS A;  5IOC A;  5DM6 3;  1TS2 A;  1YNN D;  5IT9 E;  3D6C A;  2AQ1 B;  4RAU C;  1SE3 A;  1EOT A;  2RSO A;  1EYD A;  1TS3 A;  2PZT A;  1BBX C;  1B44 D;  5ELB A;  1D5Z C;  1L0X B;  1IW7 C;  4M8A A;  3SVM A;  3GTK B;  2K1B A;  2F3V A;  3NWT A;  4F8M A;  4OO1 I;  1TWF B;  2FMM A;  2F0H A;  1CHP D;  4CGY B;  1I4G A;  1FGB D;  5CV4 A;  1JOO A;  3GQB A;  1PDQ A;  5C4Z A;  1D2B A;  3OWF A;  3M4O B;  2QF7 A;  3VYT A;  4WOR A;  2NVT B;  1T5E A;  3KUP A;  1EY5 A;  3GTJ B;  1LLR D;  4F7X A;  3A55 A;  1Q8I A;  2KED A;  1IHZ A;  2EYH A;  2PO4 A;  3HP3 A;  4X3S A;  2FIN B;  1EZ8 A;  4BBS B;  4K5V A;  2EYP A;  4ABN A;  3QWN A;  4CJ1 B;  3VR5 A;  5IT9 L;  1A2U A;  3H3V C;  3S1Q B;  2F0T A;  4DA2 A;  1CQV A;  5JVG 3;  1SNM A;  4ZKC B;  1CK1 A;  5IGC A;  2EY5 A;  2B2T A;  2NN6 G;  1XWE A;  1RF2 D;  2F0V A;  3OSO A;  3J7A F;  3PIP 3;  3NTH A;  1DJR D;  2IX0 A;  1FNW A;  2SOB A;  3D4R A;  1BF4 A;  1STE A;  5FO7 B;  5FO9 B;  1LO5 D;  1OXX K;  1SEB D;  3T4A C;  1X3P A;  4J6H A;  2RKS A;  5JJZ A;  2NVY B;  2PMZ B;  2X6L A;  2PPB C;  1M4V A;  2FMC A;  2AWN A;  4FVM A;  1ICW A;  1ZYR C;  1Z47 A;  1EY4 A;  5EKK A;  4IUT A;  2F0K A;  4C3J G;  3D6W A;  4A93 B;  1MBY A;  1QCB D;  4RHR A;  5EKI A;  2NZ1 D;  1IKM A;  2MJ8 A;  1Y8P B;  4V0B A;  2JXM B;  3OOC A;  4BWG B;  2H4O A;  1IW7 D;  2NVX B;  1PFN A;  4RKB A;  3C2P A;  2NTT A;  1LTR D;  1A2T A;  1IYV A;  1SJH D;  2QKI C;  3SK6 A;  4DAP A;  4J8Q A;  2QDB A;  4FF1 A;  4RGT A;  1Q3L A;  4DN4 M;  4FF4 A;  1QOH A;  5HGT A;  1MGS A;  2G9H D;  3CRK C;  5J1Z A;  2F0E A;  3GTO B;  4IUV A;  4WJW A;  5EPK A;  1TVX A;  1BOS A;  1X3Q A;  1CT1 D;  4B9X A;  4LJZ C;  1QNU A;  3FPU B;  3MFY A;  1SMY C;  2DNE A;  2KEC A;  1SNC A;  2E76 C;  4MHE A;  3WOE A;  4XXE A;  2IX3 A;  3VYS A;  2ZT9 C;  1EYA A;  1YNJ C;  2K5Q A;  4XYO A;  5E4W C;  1R4Q B;  1DOK A;  1F9R A;  5G3L F;  2DNC A;  3KF8 A;  4IUU A;  5BN3 A;  3CRL C;  1TWC B;  4OGQ C;  2QCP X;  1PFM A;  1SYC A;  1XTC D;  3S1M B;  3OIP A;  2M2L A;  1ZKO A;  2L1B A;  1V1P A;  3I3C A;  4FXK C;  1OXT A;  1GUT A;  1JOK A;  1SFO B;  3L7Z C;  2A6H C;  1CZG A;  1S5B D;  4K6L A;  2EYM A;  4PMC A;  1GUN A;  3JAM L;  1D6E C;  4HMI A;  1IYU A;  1ZYR D;  4PMW A;  1UUP A;  1S5F D;  3K5O A;  4HSP A;  3DM1 A;  2EYO A;  1EQT A;  1HTP A;  3OMG A;  4GZY C;  2XVS A;  4RFB A;  2BOS A;  4CJ0 B;  3ZYY X;  2WKD A;  1QG7 A;  1PYW D;  1E2W A;  5JOB A;  3SXH A;  1UEA B;  5I2X A;  2R3Z A;  3KLS A;  1GXD C;  3CQZ B;  3R3O A;  2WKC A;  4KHV A;  2HCI A;  1A3T A;  4ZKB B;  5A2Q E;  1B3A A;  5F2D A;  5M5W B;  4UAI A;  1VCI A;  2F1M A;  3R2T A;  4LAA A;  1KNA A;  2E75 C;  1NSN S;  1C8C A;  4RCO A;  1ONL A;  3H0G B;  3QJY A;  1E2V A;  1Z7T A;  3EQL C;  4QMG A;  1SMY D;  3QIA A;  4IFD G;  3K59 A;  1DCZ A;  5FOB B;  4H44 C;  1JOR A;  1Y8O B;  2JSO A;  1U9R A;  3I4N B;  2IL8 A;  2SNM A;  1HHV A;  2WP8 J;  3UI2 A;  4A3J B;  5I6W A;  5I2Y A;  1YNJ D;  2KEE A;  2VUM B;  2O2L D;  4G7Z C;  2F0G A;  3GTP B;  5E4X A;  4X3K A;  1Y1W B;  3X3M A;  3F2U A;  5KNB A;  2CVR A;  4L8J A;  2Z4H A;  1O7Z A;  2L12 A;  2F0M A;  2VXW A;  2L4N A;  1C4Q A;  3M4Y A;  1SXT A;  1PTO H;  4C3H B;  4EQP A;  3M85 A;  4A3E B;  3OIQ A;  3W2D A;  1II3 A;  4L63 B;  4FXG C;  3ERO A;  3DXJ C;  5IGE A;  2KUM A;  5KYI A;  4HN7 A;  3NQI A;  2CW0 C;  3DWQ A;  4PNY A;  1KAB A;  1KDC A;  1JWM D;  1KLU D;  1DOM A;  5KGU A;  2VB2 X;  2N88 A;  1HUN A;  4OHJ A;  1G91 A;  1H9S B;  1C48 A;  1BCP C;  1B4O A;  2SNS A;  3NK9 A;  4FF2 A;  4BS9 A;  2X69 A;  5FLX E;  3MC0 B;  2K01 A;  2VNU D;  1FD7 D;  3NBI A;  3HOU B;  4NDX A;  2RSN A;  4KN4 C;  4ZRZ A;  3RD4 A;  5C6A A;  2XWB B;  1QB5 D;  2H1E A;  2EY2 A;  4F87 A;  1DD2 A;  5CV6 A;  4XQJ A;  1LTI D;  4K5W A;  2IT1 A;  5J39 A;  1MD2 D;  3OMC A;  3CHB D;  4DAY A;  1Y8N B;  3QOL A;  2DY7 A;  5C5M A;  4FNF A;  3J80 E;  2B2Y A;  1V8Q A;  1PTO C;  4L6T B;  2JEA I;  4KK7 A;  5M3M B;  5JEA G;  4MN3 A;  4HTH A;  3MXU A;  1Q1E A;  2ICI A;  2XWJ B;  5FLX L;  1TWG B;  4FYD A;  2TMP A;  1SAP A;  4IFD J;  3V2T A;  1BXT A;  1VF5 C;  2O4X A;  1B2T A;  1TU2 B;  1SYG A;  3PV0 A;  2FFK B;  2F0J A;  4CJ2 C;  5ELF A;  2NUC A;  3HOW B;  2L0C A;  1FNU A;  3Q6S A;  1E2Z A;  1I6V C;  5A35 A;  2CW0 D;  1KDA A;  1DON A;  3QO2 A;  2IPK D;  3AU7 A;  3HEJ A;  2XSC A;  5IGB A;  1RCV D;  3I70 A;  4ZUJ A;  1RKN A;  2C5C A;  1EZ6 A;  3SK5 A;  3NPP A;  3H6M A;  4IUQ A;  1BCP D;  4E6I A;  3J80 L;  4HSV A;  2EVB A;  1WCM B;  2JA8 B;  4Z9C B;  3S14 B;  1H9M A;  1GHJ A;  1STN A;  3HS0 C;  1G2S A;  1PXU A;  1PRT C;  3ND8 A;  2F0F A;  1FR3 A;  4I65 A;  1QNK A;  3EJI A;  3C3L A;  2QIL A;  1D5M C;  3OW7 A;  3K0Y A;  2L9H A;  2NWG A;  2F0Q A;  2OXP A;  3G6J B;  1QWY A;  3SEB A;  3OWE B;  1O7Y A;  4HCS A;  4FO2 A;  3PMF A;  2EJM A;  2YU9 B;  1LT5 D;  2EYJ A;  3NP8 A;  1SND A;  2F0D A;  4KKT A;  3KBX A;  1TR5 A;  3J81 E;  1I4R A;  2B2W A;  3BS1 A;  4CHT B;  2O5J C;  1PTO D;  3AMU A;  3BYT B;  4BBR B;  1HXY D;  3ITP A;  1BNZ A;  1UAP A;  3FRP B;  2RDF A;  4HAE A;  3A8K E;  1RTN A;  3DHQ A;  3BZD B;  3I73 A;  1KAA A;  4KY5 A;  3M3Y B;  3K5M A;  4KI0 A;  5CC4 A;  3R8B A;  3IFD A;  1F2M A;  1PLF A;  5EJW A;  1ESF A;  1K8M A;  3RLF A;  2IX1 A;  2BE5 C;  3AB9 A;  5D65 A;  2AWO A;  3T53 B;  3NXW A;  3WDN A;  5KND A;  1TII D;  3FKI B;  1STB A;  2D9U A;  1S5D D;  4G7O C;  2K32 A;  3Q22 A;  2PW5 A;  1V43 A;  4KMU C;  3Q0A A;  2NVQ B;  5KRU A;  1STH A;  1RHP A;  3G7L A;  4DK0 A;  2A74 C;  4KN7 C;  5HUR A;  3S2D B;  2N55 A;  5C44 B;  3FPP A;  4KD4 A;  4NP5 A;  5JEA J;  3DEP A;  1PMR A;  2B2T C;  3L3O C;  2RDG A;  1TS5 A;  5I4D A;  3QB3 A;  3J81 L;  1EEI D;  2B2V A;  2E2D C;  1SYD A;  2Q8R E;  1U4P A;  4C1N I;  1F2Z A;  2E2H B;  1O80 A;  2KOL A;  1PRT D;  2DN8 A;  1GUO A;  1LAB A;  1CM9 A;  2RDH A;  2HDL A;  4U67 3;  2J7Z A;  2FJ2 A;  1H9S A;  3D8G A;  1JQY D;  1H9K A;  2DY8 A;  3K57 A;  4I7Z C;  4H7B A;  1OXU A;  4Y7N B;  1O7L A;  3NQT A;  1JWU D;  3D31 A;  3GV3 A;  5KEE A;  2NN6 H;  3EVQ A;  1A15 A;  4XT3 B;  5I9O A;  5KNC A;  5I6Y A;  1NUC A;  5DNF A;  2JYO A;  2M00 A;  3MTS A;  1ENA A;  3NSW A;  2LFN A;  4ZQ3 A;  1VMP A;  3D4D A;  2B8F A;  3V05 A;  1SSO A;  2PZU A;  3MVV A;  1U4M A;  4LMQ D;  3I91 A;  3E5S A;  5C3W A;  1SNO A;  3LWE A;  3TP6 A;  3WOF A;  3NE5 B;  4CKE A;  1TKW B;  1LAC A;  2F0U A;  1AW7 A;  3LX0 A;  1I3Q B;  5E3F A;  3DMU A;  1CI3 M;  4K8J A;  2Z8L A;  2EYF A;  2D5D A;  4NKL A;  1I4P A;  3GO5 A;  2AUJ D;  1LTA D;  1PFB A;  5CBA E;  1G2T A;  2PQE A;  1U4R A;  1SJE D;  4G57 A;  4XIG S;  5C4X B;  3N52 A;  2R92 B;  3M7N A;  3I90 A;  3IKJ A;  3PUZ A;  1HCZ A;  3BG3 A;  1EIH A;  2NTS A;  2K05 A;  5EPJ A;  4K6D A;  1HQM C;  1RTO A;  4HMJ A;  2BA1 A;  5EBC A;  1WTX A;  5BN5 A;  5EGT A;  2A69 C;  3TN2 A;  1EWC A;  1W6J A;  3FVQ A;  1O78 A;  5E1F A;  3L9A X;  2YYZ A;  3K58 A;  3DWA A;  5CV7 A;  5T1G A;  5I9P A;  2L5T A;  4K8I A;  3TZD A;  3BDC A;  1WTV A;  1WTO A;  1HFN A;  1BDO A;  2EY6 A;  5DAU A;  3NBH A;  4ID6 A;  4XYQ A;  2LS0 1;  3Q23 A;  1LT4 D;  1GOZ A;  4IUR A;  2E2I B;  2ZXO A;  2ID0 A;  3PIO 3;  1DM0 B;  3BDO A;  1SYB A;  1VF7 A;  3A54 A;  2FHT A;  5FO8 B;  4QUC A;  1ET9 A;  3VA5 A;  3MHB A;  4KJN A;  2NN6 I;  1EU3 A;  2WIN B;  4QUF A;  3HRZ C;  4ZK9 B;  4DGZ A;  3MWY W;  1D1I A;  2M9V A;  4BA2 I;  1Y1V B;  1Q1B A;  2QEJ C;  3LWU A;  2RVL A;  3TSS A;  1M8A A;  3MXP A;  1EL0 A;  4NW2 A;  1CA6 A;  2KHS A;  4QF4 A;  2K03 A;  4ILW A;  2D2C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...