2K0BX

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformation and dynamics of the three-helix bundle UBA domain of p62 from experiment and simulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sequestosome-1
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k0bX00
1VEKA 1DO2A 2L2DA 3T6PA 4F1IA 1AIPC 1T6OA 3BBZA 3GLIE 2DAKA 5DFLA 1OQYA 1A5TA 2LBCA 2DAMA 4F2LA 2EJSA 2OOAA 1R4GA 1PGYA 4G3OA 2ZTCA 2HWJA 3GLGE 2JP7A 1HT1E 2EKKA 3FRIA 2QSFX 2B3TA 1T43A 3K9OA 1C7YA 1YLAA 2MJ5B 2HAKA 2MGWA 3LCUA 2JUJA 3GLHE 2JY6B 1VEGA 2JY5A 2JZ1A 2OOBA 2LTUA 2KNAA 1OAIA 2O25A 2CWBA 1G3IA 1ZMWA 1XB2B 1P3QQ 2RRUA 1DV0A 1OKSA 2LVQD 1HT2E 1DO0A 2L4FA 1Q02A 2MROB 1EFUB 1ZMUA 1G4AE 2DAEA 1SG9A 2OO9A 3IHPA 1CUKA 3IECA 2DAGA 2JY8A 1JR3E 2KNVA 2G3QA 1QZEA 1WJ7A 1HQYE 1WR1B 1NV8A 2KNZA 4GEWA 1ZV1A 3FE3A 2DZLA 1WIVA 2KHHA 3K9PA 4R71A 4DBGB 1VG5A 1WGNA 2LVPC 2EKFA 3LCVB 5JI2E 1VDLA 1WGLA 1BVSA 2L4EA 1HJPA 2JZ0A 2K9DA 3E21A 3MMPA 3F92A 2R0IA 4WP2A 2CP8A 2LVAA 2MR9A 2WZJA 1NV9A 2JNHA 1OTRA 2ZTDA 1IFYA 2DI0A 2LVNC 3FRHA 4HEOA 2QNJA 1UFZA 1F4IA 4Q7JA 1ZMVA 1IM2A 4UN2B 1GO5A 1TR8A 1G41A 2DAIA 1E94E 2DENA 1TTEA 1V92A 3E46A 2H5XA 1WHCA 2QHOB 2BWEA 1VQ1A 2DHYA 2LVOC 1Y8GA 2BWBA 1MN3A 3GLFE 1VEJA 2DNAA 1IXSA 2JY7A 3H4JA 1KYIA 3B89A 2DKLA 2K0BX 1XXHE
chains in the Genus database with same CATH superfamily
2L2DA 4W5WA 1NY5A 1AIPC 3GLIE 4B3SM 5EXPA 1QVRA 2R65A 1TGUA 5GKNA 3RGPA 2CRUA 2LBCA 2DAMA 3RE8A 4B3RM 3H4MA 2ZTCA 2KZSA 1NSFA 1NO1A 1GVNA 2JP7A 4IBCA 3GLIB 3A46A 2EKKA 3U6CA 3VKGA 1HNWM 1NNUC 2JXNA 1LTMA 4EIWA 3FKEA 4G4QA 2QSFX 5E6JA 4FWGA 4IBJA 2V6ZM 1T43A 3K9OA 4DV6M 1V33A 4L15A 2R44A 1QAMA 2R45A 2DHRA 4AW4A 3VDUA 2MGWA 2VDBB 3THGA 2L7HA 4LJ9A 4FCVA 4IJEA 4R7GA 2JY6B 1HNXM 3ZH9B 4WURA 2OOBA 3W67A 2BNKA 3SYLA 5BR8M 2F5SA 5KPRA 4QOSA 2M5ZA 1OAIA 4DR7M 2QP9X 1SXJA 5E26A 1XB2B 2QPAA 2LHGA 2ERCA 1L2BA 1PJTA 1J7KA 3EIHA 4GC9A 3W0FA 3DZDA 4WW0A 4L4UA 3J7AS 4GITA 3D8BA 2LH0A 1NY6A 3FTDA 5C18A 2L4FA 1Q02A 3LMMA 1EFUB 3DA1A 3T15A 3UK6A 5LMNM 4DV2M 3A42A 1CUKA 3PXGA 3OTOM 4I81A 4KHPM 3VDPA 4JI5M 3WHLA 3SASA 1HNZM 3HY5A 3V76A 4Z6YA 2Z8YM 3QWLA 4RF1A 3U61A 1TDZA 3M6AA 2M60A 3FUUA 2YNMD 2XFSA 5L8RF 1HQYE 1WJ7A 5A2QS 1NV8A 3GLFA 4AQYM 4G6ZA 3U60A 4GEWA 3AFHA 1GJTA 4L16A 4QHTA 4LZZA 4LJAA 4OU7A 2YR0A 3MK6A 3T1HM 2DWMA 3U6SA 1N75A 1IXSB 3K9PA 4X66M 4R71A 1OFIA 1VG5A 2DWLA 2O5RA 3ILKA 1VDLA 4JXJA 3ZQJA 1I94M 1IY0A 2C9CA 4LJ4A 2EA0A 3FD9A 3IG5A 3M0EA 1GLNA 1R6BX 3CF2A 2R18A 3J80S 3QAUA 4JV5M 3E21A 3CTWB 4GH9A 3SHFA 3MMPA 2P5TA 2C99A 3GRYA 4GC5A 4NSRA 3QYBA 1QUTA 4LF8M 2MR9A 4OW0A 2Y0QA 3BOSA 4MGHA 2EUCA 1OTRA 5EJCA 4IBIA 2XZUA 2XEPA 2JWSA 2KZUA 1R5LA 2CV1A 3HU3A 1YSYA 4B7FA 4AZFA 1UFZA 4FWDA 3GP1A 1F4IA 4X62M 4HLQA 3C58A 5ITUA 1R2YA 1QZMA 1ZMVA 3GPUA 3L27A 3KDSE 1N32M 4KT0F 1TTEA 3GPYA 1V92A 3E46A 2H5XA 3L28A 3U61B 1KSFX 4CHTB 1HR0M 1Z59A 1MJGM 2ZANA 3C3DA 4NXMM 5KPTA 2JY7A 3KS4A 2J5YA 4P17A 3PFIA 3U6PA 1EIJA 2X49A 2LVAA 1XXHE 4M0WA 2L6OA 3T6PA 4ITQA 1JR3A 4F1IA 1N77A 2DAKA 3U5ZA 2N35A 4B3TM 1QUSA 4DV0M 1NJFA 3HJQA 2RKOA 1PJIA 5KO3A 4OX9M 1Q3CA 2EJSA 4GRIA 5KQDA 3UJNA 4CGYB 1XXHB 4G3OA 3SARA 2HWJA 1SXJC 3FUWA 1HT1E 3GLHB 4RF0A 2F5QA 2F5PA 3C9PA 2D7HA 4NRVA 1C7YA 4XGIA 1FNNA 1TF0B 2MJ5B 3U6LA 2HAKA 2HCBA 3LCUA 3RGSA 1L1ZA 2JUJA 3GLHE 2JZ1A 4CIZA 1T3TA 3K92A 3ZC7B 3CGWA 2CWBA 4DR2M 1G3IA 3LW5F 1L1TA 1ZMWA 1JR3D 1UM8A 1XWIA 2DWZB 1P3QQ 2RRUA 2VIIA 7CATA 4JI2M 2APLA 1NHWC 2J7OA 3DOAA 4LG2A 4II7A 1IN5A 1HT2E 1I4WA 3Q8XA 4B08A 2A5YB 4IIWA 2DAEA 1SG9A 4M9SA 3IECA 2KEBA 3SMSA 4L78A 4JI4M 2FNAA 2K6BA 2VQEM 1DGHB 2FOIC 3KP0E 2AHMA 3L25A 1S3SA 2F4VM 4HL4A 3GLIA 4DUZM 3HHXA 2RGOA 2CV2A 2Z4RA 1IY1A 1FJGM 4LGMA 3QYEA 4KLNA 2KNZA 2L09A 1E32A 3KOZE 2XZFA 2K47A 3SAUA 3I4VA 4M0DA 1ZV1A 8CATA 1NVMA 3JR4A 5ITXA 3B7QA 4GKJM 3C3EA 3TL4X 4IBFA 1Z6TA 2LHCA 1J5EM 2DZLA 3UZUA 3RFWA 1IBKM 5ITYA 2EKFA 3FUTA 5JI2E 4G4NA 1KFVA 1K82A 3KP1E 1QDTA 3GPXA 1N36M 2ZBKB 3A45A 4DR4M 4AKGA 2CHGA 1IXRC 2XFTA 2L4EA 1HQCA 2E5LM 1TH4A 1L8QA 5BPVA 2CV0A 2ZAOA 1OIZA 1QDRA 3B9PA 1YE9A 4M9XA 1D0MA 2I7NA 1N34M 1NV9A 2JNHA 1NJGA 4B7GA 4LGYA 2V1CA 5EXSA 2DI0A 2X4AA 3NBXX 4IBGA 2LVNC 4HEOA 3UMMA 4AI6A 4AG5A 4DV1M 5ITTA 4LF6M 4GHAA 3TWLA 2KW0A 4PT5A 2V1UA 5EXXA 1IM2A 2KA6B 3GLFB 3SAWA 3AOEA 3KXEC 2UUBM 1QAQA 1GL6A 4PDIA 4NRWA 1E94E 2DENA 1DGHA 3I51A 1VDDA 2Y0TA 1E9SA 2BWEA 1G71A 3K2LA 2DHYA 3JAMS 3I04M 4LJ5A 2LVOC 1Y8GA 4RKUF 2BWBA 3R9XB 3GLFE 2C96A 1IXSA 1OJLA 1JB0F 1KYIA 4LZJA 1DGBA 2J7NA 3HKPA 2C5RA 1G59A 3HJ8A 2XF3A 5EP3A 3L29A 3AOEC 5H37D 2RGHA 3I4YA 1IN7A 3GRRA 2DWNA 2LWXA 5FLXS 3KVWA 2OOAA 1PGYA 3PNYA 4JI8M 2KXEA 1WXQA 2BJWA 2CHQA 5FTJA 4B7HA 5ITXE 2QBYB 3AL0C 1QQWA 3HU2A 3VK8A 1L2CA 2CE7A 4DR1M 4Y28F 1IXZA 1Z5CA 5IZ7D 2GNOA 2UUAM 3VK7A 4L6V6 2HKJA 4OVZA 1TH2A 1YLAA 4NSOB 3U6DA 1GABA 1W5SA 3FUVA 1IN4A 2ZM6M 1RU3A 4PDGA 1VEGA 2JY5A 3SBJA 3CF6E 2LTUA 4DV3M 1GJSA 3NBIA 3SFZA 2O25A 1XMOM 2FH0A 4BLCA 3GQ5A 3U6OA 3TPZA 3T38A 3GRUA 3KOXE 5DYIA 4LCBA 3KSJA 4QHSA 3AOGA 4JI6M 2LVQD 4LFAM 3TQSA 1JQJC 3K1JA 1IN8A 2MROB 1ZMUA 3ZCBB 2D7GA 5DNYA 3FYDA 2G8LA 4IBKA 2DAGA 3GPPA 4DV5M 3JR5A 4BB9A 2FS1A 2R4JA 3FUXA 1XXHA 4MB7A 3HX3A 4X65M 4ZPXA 2D7EA 4LRTA 1JR3E 2KNVA 3J81S 5FTKA 3D8LA 1MX0A 1GKIA 3GO8A 2F5OA 2WSEF 1XNRM 2XSZD 3IG8A 1AUAA 3PNVA 1MU5A 2FE8A 2UXDM 1Z5AA 3WHKA 1N78A 2Q2EB 5EQTA 1XMQM 1Q39A 3SMPA 3EIEA 3GLGA 3FE3A 2QBYA 5IT9S 5IWAM 5LMUM 1WIVA 5IREB 2KHHA 4A3VB 1ZAEA 2H1RA 2FFJA 2LVPC 4GMQA 4DUYM 3LCVB 3A98B 4IBBA 4FCWA 4L8RC 1WGLA 1QYRA 4I8OA 4OVZB 1BVSA 2NQ8C 1PM5A 3TWMA 3L26A 1OAOC 1HJPA 3HZJA 3TWKA 1N33M 4AKHA 4TUWA 1NHGC 1QANA 1DGGA 2K9DA 3AV0A 2UU9M 2UUCM 4QOZC 1XC8A 1D0KA 5KQ8A 5EP4A 4LF9M 2ZTDA 1R7RA 4JN6A 1R2ZA 1DGFA 1Z5BA 2GQFA 4MGZE 3KSXA 5FTMA 3HHYA 3KW6A 3B7ZA 3FRHA 2QNJA 4JI0M 4GHLA 1IY2A 1PRBA 1SXJE 2EO2A 2DZOB 2KRKA 4FVMA 4IBEA 3FTEA 4JI3M 2CUZA 4UN2B 1NNJA 5DYGA 1XNQM 4AG6A 2DAIA 2HL7A 3HHWA 4KO8A 1YUBA 1WHCA 1TDHA 1VQ1A 1XHBA 4K0KM 1SXJB 4LJ6A 2MH8A 5FTNA 3U6MA 3AKZA 4FWHA 3LVVA 4LFBM 4AKIA 4I5SA 4LY6A 4PD2A 2DNAA 4D82A 4IBDA 5FSWA 1L2DA 3M7GA 4Z8XA 3B89A 3CF0A 2K0BX 1IBLM 1VEKA 1DO2A 3U6QA 3GLGB 3GQ4A 1T6OA 2DVWB 3BBZA 4NC6A 4GIPA 5ITQA 2XLJA 5DFLA 3J27B 1OQYA 1A5TA 1K3WA 4F2LA 2QCUA 4LF4M 4LJ8A 1R4GA 2UXCM 2Z4SA 3MHVC 2VQFM 3FTCA 1PJJA 3GLGE 4JI1M 3FRIA 3J2PB 3J7BA 2R46A 2B3TA 4MGYE 3U60B 3DFZA 5EP1A 5KPZA 4B3MM 1LV7A 4DV4M 3W0LB 3FYCA 2DZNB 4CJ6A 4NOOB 2X8AA 4DR3M 2Y20A 3KOYE 3K8ZA 4LF5M 2KNAA 3BXWA 4MGIE 1SXJD 1IQPA 2JA2A 1TH3A 3B7NA 4DR6M 2DXIA 3HGIA 2L7IA 4I4LA 3B74A 2YQZA 4MM3B 1PJQA 4IJFA 3UGJA 1DV0A 1IBMM 1OKSA 4PCZA 4NXNM 3AJIB 2UXBM 2HHHM 1DO0A 4NL4H 3MJ5A 1G4AE 2OO9A 1OFHA 3Q8GA 4ANRA 3IHPA 3U6EA 4FW9A 2QQ8A 1X37A 2OPFA 3KS8A 2C9OA 3KOWE 4MH0E 4G4RA 2JY8A 3I01M 5JI3E 2YFQA 3L2AA 1K3XA 2G3QA 1IN6A 4GKKM 3SC3A 1QAOA 1QZEA 4P16A 1WR1B 3E4RA 4R3DA 3FTFA 3GRVA 3GQ3A 4LJ7A 2Z3XA 2BJVA 4FCTA 4G4OA 3T1YM 2XSZA 1EE8A 5FTLA 1GL7A 4FD2A 2R4EA 3R8FA 1W5TA 3HJSA 2Y21A 3LVWA 3LQRA 3SHGB 3SATA 4D81A 4X64M 4DBGB 1WGNA 4YHHM 1E9RA 4YY3M 4S12A 2KRUA 4QNMA 2WSFF 3E9SA 5ITRA 2OQ4A 2QENA 2QZ4A 1PJSA 3NWLA 2CEAA 3U5ZB 1Q3BA 2JZ0A 1C1KA 1OIPA 3SYKA 2VF8A 1D2NA 3W68A 4LF7M 4DR5M 3VKHA 3F92A 4RNAA 2G5GX 2R0IA 3PVSA 2CP8A 2WZJA 4LRSA 2WSCF 4M9ZA 4REZA 4WP2A 3GLHA 3HWSA 2XGNA 1IFYA 4QNRA 2F5NA 3VFDA 2W82A 5C1BA 3HU1A 2KDLA 1G8PA 4XK8F 1ORYB 1J09A 4MGKE 3HHZA 4LFCM 1D0LA 4Q7JA 4JYAM 2I7PA 1ZQ9A 2R62A 2ZAMA 4XBOA 5EXTA 5F3WA 1GO5A 2VF7A 3TE6A 3VLFB 1TR8A 1G41A 2C98A 2LNHC 4DV7M 1H6UA 3LQQA 2O01F 2R6FA 2QHOB 2Z7JA 4KODA 1V34A 2CFOA 2CHVA 4D80A 4JI7M 1MN3A 2XH9A 3KFUG 1VEJA 4BBAA 3H4JA 4CISA 5EP2A 2DKLA 2LXEA 3SAVA
chains in the Genus database with same CATH topology
1VEKA 1DO2A 2L2DA 3T6PA 4F1IA 1AIPC 1T6OA 3BBZA 3GLIE 2DAKA 5DFLA 1OQYA 1A5TA 2LBCA 2DAMA 4F2LA 2EJSA 2OOAA 1R4GA 1PGYA 4G3OA 2ZTCA 2HWJA 3GLGE 2JP7A 1HT1E 2EKKA 3FRIA 2QSFX 2B3TA 1T43A 3K9OA 1C7YA 1YLAA 2MJ5B 2HAKA 2MGWA 3LCUA 2JUJA 3GLHE 2JY6B 1VEGA 2JY5A 2JZ1A 2OOBA 2LTUA 2KNAA 1OAIA 2O25A 2CWBA 1G3IA 1ZMWA 1XB2B 1P3QQ 2RRUA 1DV0A 1OKSA 2LVQD 1HT2E 1DO0A 2L4FA 1Q02A 2MROB 1EFUB 1ZMUA 1G4AE 2DAEA 1SG9A 2OO9A 3IHPA 1CUKA 3IECA 2DAGA 2JY8A 1JR3E 2KNVA 2G3QA 1QZEA 1WJ7A 1HQYE 1WR1B 1NV8A 2KNZA 4GEWA 1ZV1A 3FE3A 2DZLA 1WIVA 2KHHA 3K9PA 4R71A 4DBGB 1VG5A 1WGNA 2LVPC 2EKFA 3LCVB 5JI2E 1VDLA 1WGLA 1BVSA 2L4EA 1HJPA 2JZ0A 2K9DA 3E21A 3MMPA 3F92A 2R0IA 4WP2A 2CP8A 2LVAA 2MR9A 2WZJA 1NV9A 2JNHA 1OTRA 2ZTDA 1IFYA 2DI0A 2LVNC 3FRHA 4HEOA 2QNJA 1UFZA 1F4IA 4Q7JA 1ZMVA 1IM2A 4UN2B 1GO5A 1TR8A 1G41A 2DAIA 1E94E 2DENA 1TTEA 1V92A 3E46A 2H5XA 1WHCA 2QHOB 2BWEA 1VQ1A 2DHYA 2LVOC 1Y8GA 2BWBA 1MN3A 3GLFE 1VEJA 2DNAA 1IXSA 2JY7A 3H4JA 1KYIA 3B89A 2DKLA 2K0BX 1XXHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEK A;  1DO2 A;  2L2D A;  3T6P A;  4F1I A;  1AIP C;  1T6O A;  3BBZ A;  3GLI E;  2DAK A;  5DFL A;  1OQY A;  1A5T A;  2LBC A;  2DAM A;  4F2L A;  2EJS A;  2OOA A;  1R4G A;  1PGY A;  4G3O A;  2ZTC A;  2HWJ A;  3GLG E;  2JP7 A;  1HT1 E;  2EKK A;  3FRI A;  2QSF X;  2B3T A;  1T43 A;  3K9O A;  1C7Y A;  1YLA A;  2MJ5 B;  2HAK A;  2MGW A;  3LCU A;  2JUJ A;  3GLH E;  2JY6 B;  1VEG A;  2JY5 A;  2JZ1 A;  2OOB A;  2LTU A;  2KNA A;  1OAI A;  2O25 A;  2CWB A;  1G3I A;  1ZMW A;  1XB2 B;  1P3Q Q;  2RRU A;  1DV0 A;  1OKS A;  2LVQ D;  1HT2 E;  1DO0 A;  2L4F A;  1Q02 A;  2MRO B;  1EFU B;  1ZMU A;  1G4A E;  2DAE A;  1SG9 A;  2OO9 A;  3IHP A;  1CUK A;  3IEC A;  2DAG A;  2JY8 A;  1JR3 E;  2KNV A;  2G3Q A;  1QZE A;  1WJ7 A;  1HQY E;  1WR1 B;  1NV8 A;  2KNZ A;  4GEW A;  1ZV1 A;  3FE3 A;  2DZL A;  1WIV A;  2KHH A;  3K9P A;  4R71 A;  4DBG B;  1VG5 A;  1WGN A;  2LVP C;  2EKF A;  3LCV B;  5JI2 E;  1VDL A;  1WGL A;  1BVS A;  2L4E A;  1HJP A;  2JZ0 A;  2K9D A;  3E21 A;  3MMP A;  3F92 A;  2R0I A;  4WP2 A;  2CP8 A;  2LVA A;  2MR9 A;  2WZJ A;  1NV9 A;  2JNH A;  1OTR A;  2ZTD A;  1IFY A;  2DI0 A;  2LVN C;  3FRH A;  4HEO A;  2QNJ A;  1UFZ A;  1F4I A;  4Q7J A;  1ZMV A;  1IM2 A;  4UN2 B;  1GO5 A;  1TR8 A;  1G41 A;  2DAI A;  1E94 E;  2DEN A;  1TTE A;  1V92 A;  3E46 A;  2H5X A;  1WHC A;  2QHO B;  2BWE A;  1VQ1 A;  2DHY A;  2LVO C;  1Y8G A;  2BWB A;  1MN3 A;  3GLF E;  1VEJ A;  2DNA A;  1IXS A;  2JY7 A;  3H4J A;  1KYI A;  3B89 A;  2DKL A;  2K0B X;  1XXH E; 
#chains in the Genus database with same CATH topology
 2L2D A;  4W5W A;  1NY5 A;  1AIP C;  3GLI E;  4B3S M;  5EXP A;  1QVR A;  2R65 A;  1TGU A;  5GKN A;  3RGP A;  2CRU A;  2LBC A;  2DAM A;  3RE8 A;  4B3R M;  3H4M A;  2ZTC A;  2KZS A;  1NSF A;  1NO1 A;  1GVN A;  2JP7 A;  4IBC A;  3GLI B;  3A46 A;  2EKK A;  3U6C A;  3VKG A;  1HNW M;  1NNU C;  2JXN A;  1LTM A;  4EIW A;  3FKE A;  4G4Q A;  2QSF X;  5E6J A;  4FWG A;  4IBJ A;  2V6Z M;  1T43 A;  3K9O A;  4DV6 M;  1V33 A;  4L15 A;  2R44 A;  1QAM A;  2R45 A;  2DHR A;  4AW4 A;  3VDU A;  2MGW A;  2VDB B;  3THG A;  2L7H A;  4LJ9 A;  4FCV A;  4IJE A;  4R7G A;  2JY6 B;  1HNX M;  3ZH9 B;  4WUR A;  2OOB A;  3W67 A;  2BNK A;  3SYL A;  5BR8 M;  2F5S A;  5KPR A;  4QOS A;  2M5Z A;  1OAI A;  4DR7 M;  2QP9 X;  1SXJ A;  5E26 A;  1XB2 B;  2QPA A;  2LHG A;  2ERC A;  1L2B A;  1PJT A;  1J7K A;  3EIH A;  4GC9 A;  3W0F A;  3DZD A;  4WW0 A;  4L4U A;  3J7A S;  4GIT A;  3D8B A;  2LH0 A;  1NY6 A;  3FTD A;  5C18 A;  2L4F A;  1Q02 A;  3LMM A;  1EFU B;  3DA1 A;  3T15 A;  3UK6 A;  5LMN M;  4DV2 M;  3A42 A;  1CUK A;  3PXG A;  3OTO M;  4I81 A;  4KHP M;  3VDP A;  4JI5 M;  3WHL A;  3SAS A;  1HNZ M;  3HY5 A;  3V76 A;  4Z6Y A;  2Z8Y M;  3QWL A;  4RF1 A;  3U61 A;  1TDZ A;  3M6A A;  2M60 A;  3FUU A;  2YNM D;  2XFS A;  5L8R F;  1HQY E;  1WJ7 A;  5A2Q S;  1NV8 A;  3GLF A;  4AQY M;  4G6Z A;  3U60 A;  4GEW A;  3AFH A;  1GJT A;  4L16 A;  4QHT A;  4LZZ A;  4LJA A;  4OU7 A;  2YR0 A;  3MK6 A;  3T1H M;  2DWM A;  3U6S A;  1N75 A;  1IXS B;  3K9P A;  4X66 M;  4R71 A;  1OFI A;  1VG5 A;  2DWL A;  2O5R A;  3ILK A;  1VDL A;  4JXJ A;  3ZQJ A;  1I94 M;  1IY0 A;  2C9C A;  4LJ4 A;  2EA0 A;  3FD9 A;  3IG5 A;  3M0E A;  1GLN A;  1R6B X;  3CF2 A;  2R18 A;  3J80 S;  3QAU A;  4JV5 M;  3E21 A;  3CTW B;  4GH9 A;  3SHF A;  3MMP A;  2P5T A;  2C99 A;  3GRY A;  4GC5 A;  4NSR A;  3QYB A;  1QUT A;  4LF8 M;  2MR9 A;  4OW0 A;  2Y0Q A;  3BOS A;  4MGH A;  2EUC A;  1OTR A;  5EJC A;  4IBI A;  2XZU A;  2XEP A;  2JWS A;  2KZU A;  1R5L A;  2CV1 A;  3HU3 A;  1YSY A;  4B7F A;  4AZF A;  1UFZ A;  4FWD A;  3GP1 A;  1F4I A;  4X62 M;  4HLQ A;  3C58 A;  5ITU A;  1R2Y A;  1QZM A;  1ZMV A;  3GPU A;  3L27 A;  3KDS E;  1N32 M;  4KT0 F;  1TTE A;  3GPY A;  1V92 A;  3E46 A;  2H5X A;  3L28 A;  3U61 B;  1KSF X;  4CHT B;  1HR0 M;  1Z59 A;  1MJG M;  2ZAN A;  3C3D A;  4NXM M;  5KPT A;  2JY7 A;  3KS4 A;  2J5Y A;  4P17 A;  3PFI A;  3U6P A;  1EIJ A;  2X49 A;  2LVA A;  1XXH E;  4M0W A;  2L6O A;  3T6P A;  4ITQ A;  1JR3 A;  4F1I A;  1N77 A;  2DAK A;  3U5Z A;  2N35 A;  4B3T M;  1QUS A;  4DV0 M;  1NJF A;  3HJQ A;  2RKO A;  1PJI A;  5KO3 A;  4OX9 M;  1Q3C A;  2EJS A;  4GRI A;  5KQD A;  3UJN A;  4CGY B;  1XXH B;  4G3O A;  3SAR A;  2HWJ A;  1SXJ C;  3FUW A;  1HT1 E;  3GLH B;  4RF0 A;  2F5Q A;  2F5P A;  3C9P A;  2D7H A;  4NRV A;  1C7Y A;  4XGI A;  1FNN A;  1TF0 B;  2MJ5 B;  3U6L A;  2HAK A;  2HCB A;  3LCU A;  3RGS A;  1L1Z A;  2JUJ A;  3GLH E;  2JZ1 A;  4CIZ A;  1T3T A;  3K92 A;  3ZC7 B;  3CGW A;  2CWB A;  4DR2 M;  1G3I A;  3LW5 F;  1L1T A;  1ZMW A;  1JR3 D;  1UM8 A;  1XWI A;  2DWZ B;  1P3Q Q;  2RRU A;  2VII A;  7CAT A;  4JI2 M;  2APL A;  1NHW C;  2J7O A;  3DOA A;  4LG2 A;  4II7 A;  1IN5 A;  1HT2 E;  1I4W A;  3Q8X A;  4B08 A;  2A5Y B;  4IIW A;  2DAE A;  1SG9 A;  4M9S A;  3IEC A;  2KEB A;  3SMS A;  4L78 A;  4JI4 M;  2FNA A;  2K6B A;  2VQE M;  1DGH B;  2FOI C;  3KP0 E;  2AHM A;  3L25 A;  1S3S A;  2F4V M;  4HL4 A;  3GLI A;  4DUZ M;  3HHX A;  2RGO A;  2CV2 A;  2Z4R A;  1IY1 A;  1FJG M;  4LGM A;  3QYE A;  4KLN A;  2KNZ A;  2L09 A;  1E32 A;  3KOZ E;  2XZF A;  2K47 A;  3SAU A;  3I4V A;  4M0D A;  1ZV1 A;  8CAT A;  1NVM A;  3JR4 A;  5ITX A;  3B7Q A;  4GKJ M;  3C3E A;  3TL4 X;  4IBF A;  1Z6T A;  2LHC A;  1J5E M;  2DZL A;  3UZU A;  3RFW A;  1IBK M;  5ITY A;  2EKF A;  3FUT A;  5JI2 E;  4G4N A;  1KFV A;  1K82 A;  3KP1 E;  1QDT A;  3GPX A;  1N36 M;  2ZBK B;  3A45 A;  4DR4 M;  4AKG A;  2CHG A;  1IXR C;  2XFT A;  2L4E A;  1HQC A;  2E5L M;  1TH4 A;  1L8Q A;  5BPV A;  2CV0 A;  2ZAO A;  1OIZ A;  1QDR A;  3B9P A;  1YE9 A;  4M9X A;  1D0M A;  2I7N A;  1N34 M;  1NV9 A;  2JNH A;  1NJG A;  4B7G A;  4LGY A;  2V1C A;  5EXS A;  2DI0 A;  2X4A A;  3NBX X;  4IBG A;  2LVN C;  4HEO A;  3UMM A;  4AI6 A;  4AG5 A;  4DV1 M;  5ITT A;  4LF6 M;  4GHA A;  3TWL A;  2KW0 A;  4PT5 A;  2V1U A;  5EXX A;  1IM2 A;  2KA6 B;  3GLF B;  3SAW A;  3AOE A;  3KXE C;  2UUB M;  1QAQ A;  1GL6 A;  4PDI A;  4NRW A;  1E94 E;  2DEN A;  1DGH A;  3I51 A;  1VDD A;  2Y0T A;  1E9S A;  2BWE A;  1G71 A;  3K2L A;  2DHY A;  3JAM S;  3I04 M;  4LJ5 A;  2LVO C;  1Y8G A;  4RKU F;  2BWB A;  3R9X B;  3GLF E;  2C96 A;  1IXS A;  1OJL A;  1JB0 F;  1KYI A;  4LZJ A;  1DGB A;  2J7N A;  3HKP A;  2C5R A;  1G59 A;  3HJ8 A;  2XF3 A;  5EP3 A;  3L29 A;  3AOE C;  5H37 D;  2RGH A;  3I4Y A;  1IN7 A;  3GRR A;  2DWN A;  2LWX A;  5FLX S;  3KVW A;  2OOA A;  1PGY A;  3PNY A;  4JI8 M;  2KXE A;  1WXQ A;  2BJW A;  2CHQ A;  5FTJ A;  4B7H A;  5ITX E;  2QBY B;  3AL0 C;  1QQW A;  3HU2 A;  3VK8 A;  1L2C A;  2CE7 A;  4DR1 M;  4Y28 F;  1IXZ A;  1Z5C A;  5IZ7 D;  2GNO A;  2UUA M;  3VK7 A;  4L6V 6;  2HKJ A;  4OVZ A;  1TH2 A;  1YLA A;  4NSO B;  3U6D A;  1GAB A;  1W5S A;  3FUV A;  1IN4 A;  2ZM6 M;  1RU3 A;  4PDG A;  1VEG A;  2JY5 A;  3SBJ A;  3CF6 E;  2LTU A;  4DV3 M;  1GJS A;  3NBI A;  3SFZ A;  2O25 A;  1XMO M;  2FH0 A;  4BLC A;  3GQ5 A;  3U6O A;  3TPZ A;  3T38 A;  3GRU A;  3KOX E;  5DYI A;  4LCB A;  3KSJ A;  4QHS A;  3AOG A;  4JI6 M;  2LVQ D;  4LFA M;  3TQS A;  1JQJ C;  3K1J A;  1IN8 A;  2MRO B;  1ZMU A;  3ZCB B;  2D7G A;  5DNY A;  3FYD A;  2G8L A;  4IBK A;  2DAG A;  3GPP A;  4DV5 M;  3JR5 A;  4BB9 A;  2FS1 A;  2R4J A;  3FUX A;  1XXH A;  4MB7 A;  3HX3 A;  4X65 M;  4ZPX A;  2D7E A;  4LRT A;  1JR3 E;  2KNV A;  3J81 S;  5FTK A;  3D8L A;  1MX0 A;  1GKI A;  3GO8 A;  2F5O A;  2WSE F;  1XNR M;  2XSZ D;  3IG8 A;  1AUA A;  3PNV A;  1MU5 A;  2FE8 A;  2UXD M;  1Z5A A;  3WHK A;  1N78 A;  2Q2E B;  5EQT A;  1XMQ M;  1Q39 A;  3SMP A;  3EIE A;  3GLG A;  3FE3 A;  2QBY A;  5IT9 S;  5IWA M;  5LMU M;  1WIV A;  5IRE B;  2KHH A;  4A3V B;  1ZAE A;  2H1R A;  2FFJ A;  2LVP C;  4GMQ A;  4DUY M;  3LCV B;  3A98 B;  4IBB A;  4FCW A;  4L8R C;  1WGL A;  1QYR A;  4I8O A;  4OVZ B;  1BVS A;  2NQ8 C;  1PM5 A;  3TWM A;  3L26 A;  1OAO C;  1HJP A;  3HZJ A;  3TWK A;  1N33 M;  4AKH A;  4TUW A;  1NHG C;  1QAN A;  1DGG A;  2K9D A;  3AV0 A;  2UU9 M;  2UUC M;  4QOZ C;  1XC8 A;  1D0K A;  5KQ8 A;  5EP4 A;  4LF9 M;  2ZTD A;  1R7R A;  4JN6 A;  1R2Z A;  1DGF A;  1Z5B A;  2GQF A;  4MGZ E;  3KSX A;  5FTM A;  3HHY A;  3KW6 A;  3B7Z A;  3FRH A;  2QNJ A;  4JI0 M;  4GHL A;  1IY2 A;  1PRB A;  1SXJ E;  2EO2 A;  2DZO B;  2KRK A;  4FVM A;  4IBE A;  3FTE A;  4JI3 M;  2CUZ A;  4UN2 B;  1NNJ A;  5DYG A;  1XNQ M;  4AG6 A;  2DAI A;  2HL7 A;  3HHW A;  4KO8 A;  1YUB A;  1WHC A;  1TDH A;  1VQ1 A;  1XHB A;  4K0K M;  1SXJ B;  4LJ6 A;  2MH8 A;  5FTN A;  3U6M A;  3AKZ A;  4FWH A;  3LVV A;  4LFB M;  4AKI A;  4I5S A;  4LY6 A;  4PD2 A;  2DNA A;  4D82 A;  4IBD A;  5FSW A;  1L2D A;  3M7G A;  4Z8X A;  3B89 A;  3CF0 A;  2K0B X;  1IBL M;  1VEK A;  1DO2 A;  3U6Q A;  3GLG B;  3GQ4 A;  1T6O A;  2DVW B;  3BBZ A;  4NC6 A;  4GIP A;  5ITQ A;  2XLJ A;  5DFL A;  3J27 B;  1OQY A;  1A5T A;  1K3W A;  4F2L A;  2QCU A;  4LF4 M;  4LJ8 A;  1R4G A;  2UXC M;  2Z4S A;  3MHV C;  2VQF M;  3FTC A;  1PJJ A;  3GLG E;  4JI1 M;  3FRI A;  3J2P B;  3J7B A;  2R46 A;  2B3T A;  4MGY E;  3U60 B;  3DFZ A;  5EP1 A;  5KPZ A;  4B3M M;  1LV7 A;  4DV4 M;  3W0L B;  3FYC A;  2DZN B;  4CJ6 A;  4NOO B;  2X8A A;  4DR3 M;  2Y20 A;  3KOY E;  3K8Z A;  4LF5 M;  2KNA A;  3BXW A;  4MGI E;  1SXJ D;  1IQP A;  2JA2 A;  1TH3 A;  3B7N A;  4DR6 M;  2DXI A;  3HGI A;  2L7I A;  4I4L A;  3B74 A;  2YQZ A;  4MM3 B;  1PJQ A;  4IJF A;  3UGJ A;  1DV0 A;  1IBM M;  1OKS A;  4PCZ A;  4NXN M;  3AJI B;  2UXB M;  2HHH M;  1DO0 A;  4NL4 H;  3MJ5 A;  1G4A E;  2OO9 A;  1OFH A;  3Q8G A;  4ANR A;  3IHP A;  3U6E A;  4FW9 A;  2QQ8 A;  1X37 A;  2OPF A;  3KS8 A;  2C9O A;  3KOW E;  4MH0 E;  4G4R A;  2JY8 A;  3I01 M;  5JI3 E;  2YFQ A;  3L2A A;  1K3X A;  2G3Q A;  1IN6 A;  4GKK M;  3SC3 A;  1QAO A;  1QZE A;  4P16 A;  1WR1 B;  3E4R A;  4R3D A;  3FTF A;  3GRV A;  3GQ3 A;  4LJ7 A;  2Z3X A;  2BJV A;  4FCT A;  4G4O A;  3T1Y M;  2XSZ A;  1EE8 A;  5FTL A;  1GL7 A;  4FD2 A;  2R4E A;  3R8F A;  1W5T A;  3HJS A;  2Y21 A;  3LVW A;  3LQR A;  3SHG B;  3SAT A;  4D81 A;  4X64 M;  4DBG B;  1WGN A;  4YHH M;  1E9R A;  4YY3 M;  4S12 A;  2KRU A;  4QNM A;  2WSF F;  3E9S A;  5ITR A;  2OQ4 A;  2QEN A;  2QZ4 A;  1PJS A;  3NWL A;  2CEA A;  3U5Z B;  1Q3B A;  2JZ0 A;  1C1K A;  1OIP A;  3SYK A;  2VF8 A;  1D2N A;  3W68 A;  4LF7 M;  4DR5 M;  3VKH A;  3F92 A;  4RNA A;  2G5G X;  2R0I A;  3PVS A;  2CP8 A;  2WZJ A;  4LRS A;  2WSC F;  4M9Z A;  4REZ A;  4WP2 A;  3GLH A;  3HWS A;  2XGN A;  1IFY A;  4QNR A;  2F5N A;  3VFD A;  2W82 A;  5C1B A;  3HU1 A;  2KDL A;  1G8P A;  4XK8 F;  1ORY B;  1J09 A;  4MGK E;  3HHZ A;  4LFC M;  1D0L A;  4Q7J A;  4JYA M;  2I7P A;  1ZQ9 A;  2R62 A;  2ZAM A;  4XBO A;  5EXT A;  5F3W A;  1GO5 A;  2VF7 A;  3TE6 A;  3VLF B;  1TR8 A;  1G41 A;  2C98 A;  2LNH C;  4DV7 M;  1H6U A;  3LQQ A;  2O01 F;  2R6F A;  2QHO B;  2Z7J A;  4KOD A;  1V34 A;  2CFO A;  2CHV A;  4D80 A;  4JI7 M;  1MN3 A;  2XH9 A;  3KFU G;  1VEJ A;  4BBA A;  3H4J A;  4CIS A;  5EP2 A;  2DKL A;  2LXE A;  3SAV A; 
#chains in the Genus database with same CATH homology
 1VEK A;  1DO2 A;  2L2D A;  3T6P A;  4F1I A;  1AIP C;  1T6O A;  3BBZ A;  3GLI E;  2DAK A;  5DFL A;  1OQY A;  1A5T A;  2LBC A;  2DAM A;  4F2L A;  2EJS A;  2OOA A;  1R4G A;  1PGY A;  4G3O A;  2ZTC A;  2HWJ A;  3GLG E;  2JP7 A;  1HT1 E;  2EKK A;  3FRI A;  2QSF X;  2B3T A;  1T43 A;  3K9O A;  1C7Y A;  1YLA A;  2MJ5 B;  2HAK A;  2MGW A;  3LCU A;  2JUJ A;  3GLH E;  2JY6 B;  1VEG A;  2JY5 A;  2JZ1 A;  2OOB A;  2LTU A;  2KNA A;  1OAI A;  2O25 A;  2CWB A;  1G3I A;  1ZMW A;  1XB2 B;  1P3Q Q;  2RRU A;  1DV0 A;  1OKS A;  2LVQ D;  1HT2 E;  1DO0 A;  2L4F A;  1Q02 A;  2MRO B;  1EFU B;  1ZMU A;  1G4A E;  2DAE A;  1SG9 A;  2OO9 A;  3IHP A;  1CUK A;  3IEC A;  2DAG A;  2JY8 A;  1JR3 E;  2KNV A;  2G3Q A;  1QZE A;  1WJ7 A;  1HQY E;  1WR1 B;  1NV8 A;  2KNZ A;  4GEW A;  1ZV1 A;  3FE3 A;  2DZL A;  1WIV A;  2KHH A;  3K9P A;  4R71 A;  4DBG B;  1VG5 A;  1WGN A;  2LVP C;  2EKF A;  3LCV B;  5JI2 E;  1VDL A;  1WGL A;  1BVS A;  2L4E A;  1HJP A;  2JZ0 A;  2K9D A;  3E21 A;  3MMP A;  3F92 A;  2R0I A;  4WP2 A;  2CP8 A;  2LVA A;  2MR9 A;  2WZJ A;  1NV9 A;  2JNH A;  1OTR A;  2ZTD A;  1IFY A;  2DI0 A;  2LVN C;  3FRH A;  4HEO A;  2QNJ A;  1UFZ A;  1F4I A;  4Q7J A;  1ZMV A;  1IM2 A;  4UN2 B;  1GO5 A;  1TR8 A;  1G41 A;  2DAI A;  1E94 E;  2DEN A;  1TTE A;  1V92 A;  3E46 A;  2H5X A;  1WHC A;  2QHO B;  2BWE A;  1VQ1 A;  2DHY A;  2LVO C;  1Y8G A;  2BWB A;  1MN3 A;  3GLF E;  1VEJ A;  2DNA A;  1IXS A;  2JY7 A;  3H4J A;  1KYI A;  3B89 A;  2DKL A;  2K0B X;  1XXH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...