2K0BX

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title Conformation and dynamics of the three-helix bundle UBA domain of p62 from experiment and simulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k0bX00
1WHCA 1C7YA 2MGWA 1E94E 4F2LA 1OQYA 1VQ1A 1QZEA 1R4GA 3GLGE 1MN3A 2L2DA 5DFLA 2DAMA 2DNAA 1T43A 1VDLA 3H4JA 2CWBA 2HAKA 2KHHA 2QNJA 4WP2A 1DO0A 2MROB 1AIPC 1DO2A 3K9OA 3E46A 2LBCA 2CP8A 1HJPA 1UFZA 1ZV1A 2K0BX 1ZMWA 2MJ5B 2QSFX 2JUJA 2MR9A 2QHOB 1F4IA 1GO5A 2DENA 3IECA 2LTUA 1VG5A 3FRIA 1P3QQ 1XB2B 3FRHA 1WIVA 3IHPA 1HT1E 2KNAA 2DAKA 1G3IA 2JNHA 2BWEA 2H5XA 2KNZA 1TR8A 1OAIA 1XXHE 2LVNC 1T6OA 1WR1B 3LCVB 2KNVA 1JR3E 3GLFE 5JI2E 4G3OA 1IFYA 2JY7A 3F92A 3MMPA 2LVAA 2JZ0A 4DBGB 1G41A 2EJSA 1NV8A 2EKKA 1V92A 1TTEA 1HQYE 2JY5A 1OKSA 1WGNA 1WJ7A 1VEJA 2DKLA 4R71A 3T6PA 1G4AE 2L4FA 1PGYA 2R0IA 3GLHE 1SG9A 2DHYA 1Q02A 2JZ1A 2LVQD 2OOBA 1BVSA 1Y8GA 2HWJA 3FE3A 2B3TA 2DZLA 2ZTDA 2L4EA 1NV9A 2RRUA 3BBZA 2DAIA 1IXSA 1VEGA 2O25A 1YLAA 1OTRA 4F1IA 2K9DA 4HEOA 1WGLA 2G3QA 2JY8A 1CUKA 2DI0A 2DAGA 2EKFA 1VEKA 2ZTCA 1ZMUA 3GLIE 1KYIA 1HT2E 1A5TA 4UN2B 1DV0A 3B89A 3LCUA 2JY6B 2OOAA 1ZMVA 2OO9A 4GEWA 3E21A 4Q7JA 2WZJA 1IM2A 2JP7A 3K9PA 2DAEA 2LVPC 2LVOC 1EFUB 2BWBA
chains in the Genus database with same CATH superfamily
1SXJE 1TH4A 2MGWA 3AOEA 4KODA 1OFHA 5KPRA 1XXHA 3M6AA 1VQ1A 2CHVA 2L7IA 1NHGC 2DZOB 3GLGE 3LW5F 2R6FA 1NY5A 2L2DA 4MGZE 5BPVA 2Z4RA 2Y21A 2CHQA 1Z59A 1NO1A 3T38A 4JI3M 1NHWC 1Z5CA 4IJEA 3LQRA 4PDGA 3H4JA 3W0LB 3U5ZA 4HL4A 4JI1M 2QCUA 3K9OA 4JI5M 3E46A 4TUWA 2CP8A 3JR4A 2JWSA 3HU1A 1R7RA 2UUCM 4B3TM 4D80A 2MJ5B 2QSFX 2ZBKB 2MR9A 3GLHA 2XLJA 3R9XB 1F4IA 4L4UA 2DENA 5BR8M 1GO5A 1L2BA 2KW0A 1QUTA 3FRIA 2R65A 3V76A 1EIJA 4YY3M 2C99A 2QENA 5C1BA 4WW0A 2Z3XA 4REZA 3NBXX 3KW6A 1QVRA 5H37D 4CGYB 2KNAA 2K6BA 5DYIA 3HX3A 1TH2A 1ORYB 3W68A 1C1KA 1K82A 2KNZA 3AFHA 1MX0A 5EXSA 3KS8A 1XXHE 2LVNC 2BJWA 3LCVB 4JI6M 1N32M 1YSYA 4MM3B 1R2YA 3T1HM 1SXJD 4FD2A 4D82A 3HKPA 1IBMM 3HWSA 1G71A 1IFYA 2ZAMA 2QBYB 4KLNA 3H4MA 4LRTA 2BJVA 3NWLA 2VQFM 2EKKA 1V92A 4L78A 3GLGB 3U6MA 1WJ7A 3U60B 4R71A 3SBJA 3VDUA 4L16A 3GP1A 1G4AE 2RGHA 2XFTA 2R0IA 4DR2M 2QZ4A 3KP0E 3GLHE 5ITYA 2OQ4A 3J2PB 2F5PA 1SG9A 2J7OA 4LJ9A 1QUSA 4FWDA 4AG5A 4LJAA 2UXCM 3GO8A 2ERCA 1XWIA 4GC9A 1QDRA 3SAWA 5FTMA 2LHGA 1Q39A 2R45A 2GNOA 1Y8GA 4Z6YA 2CHGA 3HJQA 3GPUA 2ZTDA 1QAMA 3ILKA 7CATA 4LFCM 2G5GX 3BBZA 1HNWM 1GJSA 2V6ZM 3PNVA 2X49A 1W5TA 2Z4SA 4MGHA 1OTRA 2D7HA 5L8RF 4JI4M 4OU7A 1IY1A 4M0WA 3VDPA 2Z7JA 2YR0A 4PCZA 1VEKA 1XXHB 1ZMUA 4GRIA 4G4OA 4X64M 4IBCA 1D2NA 4AKHA 1S3SA 3CF6E 1IN4A 4UN2B 4FCTA 4GITA 1FNNA 1DV0A 2FH0A 3LCUA 3GQ4A 3J7AS 3SASA 4G4NA 2QP9X 4B7HA 2O01F 1IN8A 1W5SA 2WZJA 3B7ZA 3B7QA 2A5YB 3FYDA 3A98B 3U6OA 2LVPC 1NNJA 3DZDA 2DWNA 4QNRA 3KOZE 3A46A 1WHCA 2JXNA 4JN6A 3I4VA 4KO8A 1J7KA 3FKEA 5ITUA 1C7YA 1H6UA 3K92A 3GLHB 1OQYA 2WSCF 1N77A 1QZEA 2LWXA 4LJ6A 1NY6A 3I4YA 1MN3A 3HJSA 4L8RC 3KVWA 5EP4A 2DAMA 1D0MA 2D7EA 2DNAA 1G59A 1T43A 1NJFA 3D8BA 1GABA 2ZAOA 3LVVA 4P17A 2EO2A 4MGKE 2CWBA 2HAKA 2KHHA 2QNJA 3PXGA 3FTFA 4GKKM 3RGPA 3C58A 5LMUM 3J80S 2DZNB 1DO2A 4IBBA 3HZJA 3K2LA 2KZSA 4ANRA 4G4QA 2NQ8C 1OIZA 3J7BA 3QWLA 2K0BX 4OVZA 2C9OA 2UU9M 3W0FA 3AL0C 1E9SA 2L09A 4I8OA 2JUJA 3LMMA 3U6LA 4DR6M 3UMMA 4LJ7A 1IY0A 2H1RA 1IBKM 2F5QA 4G4RA 1VG5A 2DVWB 4GKJM 1N36M 2EUCA 4ZPXA 3GRVA 1I4WA 1OAOC 2Y0QA 4JXJA 2X8AA 4I81A 3FUVA 4AG6A 1EE8A 1L1TA 2DAKA 1ZQ9A 3E9SA 2F5SA 4B3RM 1G3IA 2JNHA 2R18A 5EXXA 3FTDA 1L8QA 1TH3A 3SARA 1FJGM 3L29A 2VIIA 2KNVA 3CF0A 2CV1A 4LF5M 1MU5A 1NNUC 2KRKA 1QZMA 2QQ8A 5EP3A 5DNYA 2APLA 3T15A 3AKZA 4G3OA 1LTMA 1TGUA 4FWGA 3ZQJA 4DR3M 2JY7A 3MMPA 4DBGB 3C3EA 1G41A 3JR5A 1NV8A 1HQYE 3PNYA 2M5ZA 4NSRA 4NC6A 1WGNA 3B9PA 1DGGA 2V1CA 3BOSA 1VEJA 3RGSA 3SHFA 3K1JA 3B7NA 2MH8A 3T6PA 3NBIA 1E32A 2L4FA 2VDBB 4HLQA 4NXMM 1LV7A 4X65M 1D0KA 2WSFF 2L6OA 4Y28F 4OX9M 3VKHA 5KQ8A 3SFZA 3GPYA 1HR0M 5F3WA 3GQ5A 3AOGA 2OOBA 4RNAA 1Z5BA 3EIHA 3CTWB 2HWJA 1IN6A 2Y0TA 2XGNA 2Y20A 4DV0M 2B3TA 2G8LA 5A2QS 1GVNA 4IBIA 4IIWA 2XEPA 3L28A 1L1ZA 2DAIA 2UUAM 4LZZA 5EQTA 4PD2A 2O25A 5ITXE 3QAUA 2Z8YM 3WHKA 5KQDA 2L7HA 1G8PA 3D8LA 3FUTA 1XNQM 2R46A 1Z6TA 2DI0A 3RE8A 4LFBM 4XGIA 2ZTCA 2OPFA 2VQEM 3GLIE 1I94M 4LY6A 2XF3A 1KYIA 1HT2E 4LGMA 3TPZA 4GMQA 4DV2M 2DWMA 3JAMS 2KEBA 3B89A 3I51A 2FFJA 3Q8XA 5EP2A 2LXEA 2OO9A 3FTEA 3HHXA 4GEWA 3TL4X 4JV5M 4X66M 1IM2A 2EA0A 1PJIA 1DGFA 3K9PA 2F5OA 1QAQA 4GHAA 3KSXA 1EFUB 1PJTA 4R3DA 4W5WA 4OVZB 2R44A 1E9RA 4X62M 4AKIA 3SHGB 4F2LA 4RF1A 3HU2A 4LG2A 3UJNA 1R4GA 1JR3A 4DR1M 1T3TA 4II7A 1WXQA 4QHTA 3SMPA 2R62A 5FTJA 4DUYM 1QDTA 5C18A 2M60A 4JI8M 1N33M 3W67A 4WP2A 4NRWA 3SAUA 5ITQA 1DO0A 3TWLA 2MROB 1AIPC 2I7NA 3L2AA 5JI3E 3M0EA 4M9ZA 2ZANA 4DV5M 1XC8A 2E5LM 1XHBA 1OFIA 1SXJC 1D0LA 3PVSA 3U61B 1N34M 1UFZA 4NSOB 1ZMWA 4B7FA 4QHSA 2FE8A 4JI7M 2QHOB 2XSZA 3FUUA 2C5RA 3IECA 3FD9A 4QNMA 4R7GA 5ITTA 2LTUA 1NJGA 3MHVC 1PRBA 3K8ZA 2F4VM 1XB2B 2DXIA 4B08A 2C96A 1WIVA 3FRHA 4GIPA 4LZJA 3GLIB 4EIWA 1IXSB 4AKGA 4S12A 3IHPA 8CATA 2HKJA 4WURA 1PJQA 3KOWE 4K0KM 3MK6A 3DOAA 1L2CA 1N78A 5FLXS 4DV1M 3VK8A 2BWEA 3E4RA 3U6DA 5EXTA 1TR8A 5IT9S 3VKGA 1YE9A 4JI0M 2CFOA 4I4LA 4PT5A 2C98A 1JR3E 4IBDA 1V33A 1QYRA 5JI2E 2K47A 2F5NA 4FWHA 1NVMA 3FTCA 4LGYA 2FNAA 4PDIA 4CIZA 2JZ0A 2EJSA 1KSFX 3TQSA 3ZH9B 1TTEA 1OKSA 3UK6A 3I01M 3KOYE 3KXEC 3U6PA 2RGOA 4JYAM 2QPAA 3THGA 3FYCA 1PGYA 4G6ZA 5IWAM 2Q2EB 4ITQA 4OW0A 3SMSA 2AHMA 5EP1A 2JZ1A 3KDSE 3KP1E 1AUAA 4DV6M 3U61A 3U6CA 5IREB 1X37A 2O5RA 1RU3A 2R4JA 3HY5A 3HHYA 1XNRM 1IQPA 5ITRA 4LFAM 5ITXA 4B7GA 1OJLA 4CHTB 1PJJA 3L25A 1V34A 3FUWA 3LVWA 4M9XA 2V1UA 4IBJA 4IBEA 5E6JA 1GLNA 3GLIA 2CV2A 4LF9M 1KFVA 1IXSA 2XFSA 4L15A 1XMOM 4NRVA 1GKIA 3J27B 3QYEA 1YLAA 3UGJA 1GJTA 4B3MM 4DR7M 2ZM6M 3IG5A 4MGYE 1QQWA 2JY8A 3QYBA 1IXRC 2N35A 3WHLA 2UUBM 1JR3D 4CISA 4JI2M 4KT0F 3SYKA 2P5TA 3U6SA 5FTNA 3TE6A 4BLCA 4IBKA 2FOIC 3HU3A 4YHHM 1IXZA 4D81A 4A3VB 1L2DA 2JY6B 2OOAA 3A42A 3EIEA 3UZUA 4DR5M 2KA6B 3KOXE 2DWZB 2FS1A 1Q3CA 3GRUA 3HGIA 2LVOC 4LF7M 1K3WA 2UXBM 3SYLA 3Q8GA 4NL4H 3L26A 2XSZD 1E94E 2BNKA 3A45A 2CV0A 2VF7A 5IZ7D 5FTLA 3GLFA 2C9CA 1TDHA 3AV0A 5DFLA 3VK7A 3U6QA 4FCWA 5DYGA 4P16A 4LJ5A 1VDLA 4DR4M 3MJ5A 2YFQA 4L6V6 3R8FA 4LRSA 1DGHB 2JA2A 3ZCBB 1R5LA 1ZAEA 4FCVA 1TDZA 2LBCA 4LF6M 1QAOA 1HJPA 1IY2A 1PJSA 3IG8A 1SXJB 5GKNA 5LMNM 1ZV1A 2CEAA 4AQYM 2I7PA 2KRUA 4XBOA 1K3XA 3GPPA 2HCBA 4GH9A 4KHPM 3SATA 4I5SA 3GRYA 4FVMA 1P3QQ 4MGIE 5EJCA 2KZUA 2J5YA 2XH9A 1GL6A 1J09A 3LQQA 1N75A 2YNMD 3TWMA 2HHHM 1YUBA 1HT1E 4B3SM 5KPTA 2YQZA 2CUZA 3DA1A 1IBLM 2LH0A 4QOSA 3AJIB 4FW9A 1Q3BA 4GHLA 2H5XA 3FUXA 5KO3A 1IN7A 1OAIA 2RKOA 1T6OA 1WR1B 3HHWA 3GLFE 1J5EM 3HJ8A 4MB7A 3PFIA 4QOZC 2VF8A 1JB0F 4CJ6A 3I04M 3F92A 4DV3M 2LVAA 2DWLA 2JY5A 4BBAA 3U6EA 4IBFA 2DHRA 4NXNM 1HNXM 1TF0B 2DKLA 5FSWA 4IJFA 4DUZM 3GQ3A 4LF4M 2KXEA 2J7NA 1IN5A 4RKUF 5EXPA 1NSFA 1OIPA 1GL7A 1DGHA 4DV7M 5E26A 2DHYA 3B74A 1Q02A 4IBGA 3SAVA 4M9SA 1QANA 3T1YM 1UM8A 2LVQD 1VDDA 2UXDM 3KS4A 1SXJA 3J81S 4LJ4A 2QBYA 3RFWA 3ZC7B 2CRUA 1BVSA 3U5ZB 3CF2A 3U60A 3FE3A 3GLGA 4AZFA 1Z5AA 2DZLA 3KSJA 3VFDA 2X4AA 2L4EA 3L27A 4RF0A 1NV9A 4BB9A 5KPZA 2RRUA 3M7GA 4MH0E 3CGWA 3OTOM 1HQCA 3TWKA 1R2ZA 2LNHC 4LCBA 1VEGA 4LF8M 4F1IA 2K9DA 4HEOA 2XZFA 1WGLA 2G3QA 4NOOB 1CUKA 2KDLA 3AOEC 1MJGM 2DAGA 2EKFA 3SC3A 2WSEF 4DV4M 1PM5A 5FTKA 4AW4A 4M0DA 1R6BX 3GLFB 2CE7A 2R4EA 2D7GA 1A5TA 4Z8XA 1HNZM 2LHCA 4LJ8A 1JQJC 3BXWA 4XK8F 4GC5A 1ZMVA 2W82A 2GQFA 3VLFB 3E21A 1DGBA 3GRRA 4Q7JA 2HL7A 3DFZA 2JP7A 3HHZA 1XMQM 3KFUG 3C9PA 4AI6A 2DAEA 3C3DA 2BWBA 3GPXA 2XZUA
chains in the Genus database with same CATH topology
1WHCA 1C7YA 2MGWA 1E94E 4F2LA 1OQYA 1VQ1A 1QZEA 1R4GA 3GLGE 1MN3A 2L2DA 5DFLA 2DAMA 2DNAA 1T43A 1VDLA 3H4JA 2CWBA 2HAKA 2KHHA 2QNJA 4WP2A 1DO0A 2MROB 1AIPC 1DO2A 3K9OA 3E46A 2LBCA 2CP8A 1HJPA 1UFZA 1ZV1A 2K0BX 1ZMWA 2MJ5B 2QSFX 2JUJA 2MR9A 2QHOB 1F4IA 1GO5A 2DENA 3IECA 2LTUA 1VG5A 3FRIA 1P3QQ 1XB2B 3FRHA 1WIVA 3IHPA 1HT1E 2KNAA 2DAKA 1G3IA 2JNHA 2BWEA 2H5XA 2KNZA 1TR8A 1OAIA 1XXHE 2LVNC 1T6OA 1WR1B 3LCVB 2KNVA 1JR3E 3GLFE 5JI2E 4G3OA 1IFYA 2JY7A 3F92A 3MMPA 2LVAA 2JZ0A 4DBGB 1G41A 2EJSA 1NV8A 2EKKA 1V92A 1TTEA 1HQYE 2JY5A 1OKSA 1WGNA 1WJ7A 1VEJA 2DKLA 4R71A 3T6PA 1G4AE 2L4FA 1PGYA 2R0IA 3GLHE 1SG9A 2DHYA 1Q02A 2JZ1A 2LVQD 2OOBA 1BVSA 1Y8GA 2HWJA 3FE3A 2B3TA 2DZLA 2ZTDA 2L4EA 1NV9A 2RRUA 3BBZA 2DAIA 1IXSA 1VEGA 2O25A 1YLAA 1OTRA 4F1IA 2K9DA 4HEOA 1WGLA 2G3QA 2JY8A 1CUKA 2DI0A 2DAGA 2EKFA 1VEKA 2ZTCA 1ZMUA 3GLIE 1KYIA 1HT2E 1A5TA 4UN2B 1DV0A 3B89A 3LCUA 2JY6B 2OOAA 1ZMVA 2OO9A 4GEWA 3E21A 4Q7JA 2WZJA 1IM2A 2JP7A 3K9PA 2DAEA 2LVPC 2LVOC 1EFUB 2BWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHC A;  1C7Y A;  2MGW A;  1E94 E;  4F2L A;  1OQY A;  1VQ1 A;  1QZE A;  1R4G A;  3GLG E;  1MN3 A;  2L2D A;  5DFL A;  2DAM A;  2DNA A;  1T43 A;  1VDL A;  3H4J A;  2CWB A;  2HAK A;  2KHH A;  2QNJ A;  4WP2 A;  1DO0 A;  2MRO B;  1AIP C;  1DO2 A;  3K9O A;  3E46 A;  2LBC A;  2CP8 A;  1HJP A;  1UFZ A;  1ZV1 A;  2K0B X;  1ZMW A;  2MJ5 B;  2QSF X;  2JUJ A;  2MR9 A;  2QHO B;  1F4I A;  1GO5 A;  2DEN A;  3IEC A;  2LTU A;  1VG5 A;  3FRI A;  1P3Q Q;  1XB2 B;  3FRH A;  1WIV A;  3IHP A;  1HT1 E;  2KNA A;  2DAK A;  1G3I A;  2JNH A;  2BWE A;  2H5X A;  2KNZ A;  1TR8 A;  1OAI A;  1XXH E;  2LVN C;  1T6O A;  1WR1 B;  3LCV B;  2KNV A;  1JR3 E;  3GLF E;  5JI2 E;  4G3O A;  1IFY A;  2JY7 A;  3F92 A;  3MMP A;  2LVA A;  2JZ0 A;  4DBG B;  1G41 A;  2EJS A;  1NV8 A;  2EKK A;  1V92 A;  1TTE A;  1HQY E;  2JY5 A;  1OKS A;  1WGN A;  1WJ7 A;  1VEJ A;  2DKL A;  4R71 A;  3T6P A;  1G4A E;  2L4F A;  1PGY A;  2R0I A;  3GLH E;  1SG9 A;  2DHY A;  1Q02 A;  2JZ1 A;  2LVQ D;  2OOB A;  1BVS A;  1Y8G A;  2HWJ A;  3FE3 A;  2B3T A;  2DZL A;  2ZTD A;  2L4E A;  1NV9 A;  2RRU A;  3BBZ A;  2DAI A;  1IXS A;  1VEG A;  2O25 A;  1YLA A;  1OTR A;  4F1I A;  2K9D A;  4HEO A;  1WGL A;  2G3Q A;  2JY8 A;  1CUK A;  2DI0 A;  2DAG A;  2EKF A;  1VEK A;  2ZTC A;  1ZMU A;  3GLI E;  1KYI A;  1HT2 E;  1A5T A;  4UN2 B;  1DV0 A;  3B89 A;  3LCU A;  2JY6 B;  2OOA A;  1ZMV A;  2OO9 A;  4GEW A;  3E21 A;  4Q7J A;  2WZJ A;  1IM2 A;  2JP7 A;  3K9P A;  2DAE A;  2LVP C;  2LVO C;  1EFU B;  2BWB A; 
#chains in the Genus database with same CATH topology
 1SXJ E;  1TH4 A;  2MGW A;  3AOE A;  4KOD A;  1OFH A;  5KPR A;  1XXH A;  3M6A A;  1VQ1 A;  2CHV A;  2L7I A;  1NHG C;  2DZO B;  3GLG E;  3LW5 F;  2R6F A;  1NY5 A;  2L2D A;  4MGZ E;  5BPV A;  2Z4R A;  2Y21 A;  2CHQ A;  1Z59 A;  1NO1 A;  3T38 A;  4JI3 M;  1NHW C;  1Z5C A;  4IJE A;  3LQR A;  4PDG A;  3H4J A;  3W0L B;  3U5Z A;  4HL4 A;  4JI1 M;  2QCU A;  3K9O A;  4JI5 M;  3E46 A;  4TUW A;  2CP8 A;  3JR4 A;  2JWS A;  3HU1 A;  1R7R A;  2UUC M;  4B3T M;  4D80 A;  2MJ5 B;  2QSF X;  2ZBK B;  2MR9 A;  3GLH A;  2XLJ A;  3R9X B;  1F4I A;  4L4U A;  2DEN A;  5BR8 M;  1GO5 A;  1L2B A;  2KW0 A;  1QUT A;  3FRI A;  2R65 A;  3V76 A;  1EIJ A;  4YY3 M;  2C99 A;  2QEN A;  5C1B A;  4WW0 A;  2Z3X A;  4REZ A;  3NBX X;  3KW6 A;  1QVR A;  5H37 D;  4CGY B;  2KNA A;  2K6B A;  5DYI A;  3HX3 A;  1TH2 A;  1ORY B;  3W68 A;  1C1K A;  1K82 A;  2KNZ A;  3AFH A;  1MX0 A;  5EXS A;  3KS8 A;  1XXH E;  2LVN C;  2BJW A;  3LCV B;  4JI6 M;  1N32 M;  1YSY A;  4MM3 B;  1R2Y A;  3T1H M;  1SXJ D;  4FD2 A;  4D82 A;  3HKP A;  1IBM M;  3HWS A;  1G71 A;  1IFY A;  2ZAM A;  2QBY B;  4KLN A;  3H4M A;  4LRT A;  2BJV A;  3NWL A;  2VQF M;  2EKK A;  1V92 A;  4L78 A;  3GLG B;  3U6M A;  1WJ7 A;  3U60 B;  4R71 A;  3SBJ A;  3VDU A;  4L16 A;  3GP1 A;  1G4A E;  2RGH A;  2XFT A;  2R0I A;  4DR2 M;  2QZ4 A;  3KP0 E;  3GLH E;  5ITY A;  2OQ4 A;  3J2P B;  2F5P A;  1SG9 A;  2J7O A;  4LJ9 A;  1QUS A;  4FWD A;  4AG5 A;  4LJA A;  2UXC M;  3GO8 A;  2ERC A;  1XWI A;  4GC9 A;  1QDR A;  3SAW A;  5FTM A;  2LHG A;  1Q39 A;  2R45 A;  2GNO A;  1Y8G A;  4Z6Y A;  2CHG A;  3HJQ A;  3GPU A;  2ZTD A;  1QAM A;  3ILK A;  7CAT A;  4LFC M;  2G5G X;  3BBZ A;  1HNW M;  1GJS A;  2V6Z M;  3PNV A;  2X49 A;  1W5T A;  2Z4S A;  4MGH A;  1OTR A;  2D7H A;  5L8R F;  4JI4 M;  4OU7 A;  1IY1 A;  4M0W A;  3VDP A;  2Z7J A;  2YR0 A;  4PCZ A;  1VEK A;  1XXH B;  1ZMU A;  4GRI A;  4G4O A;  4X64 M;  4IBC A;  1D2N A;  4AKH A;  1S3S A;  3CF6 E;  1IN4 A;  4UN2 B;  4FCT A;  4GIT A;  1FNN A;  1DV0 A;  2FH0 A;  3LCU A;  3GQ4 A;  3J7A S;  3SAS A;  4G4N A;  2QP9 X;  4B7H A;  2O01 F;  1IN8 A;  1W5S A;  2WZJ A;  3B7Z A;  3B7Q A;  2A5Y B;  3FYD A;  3A98 B;  3U6O A;  2LVP C;  1NNJ A;  3DZD A;  2DWN A;  4QNR A;  3KOZ E;  3A46 A;  1WHC A;  2JXN A;  4JN6 A;  3I4V A;  4KO8 A;  1J7K A;  3FKE A;  5ITU A;  1C7Y A;  1H6U A;  3K92 A;  3GLH B;  1OQY A;  2WSC F;  1N77 A;  1QZE A;  2LWX A;  4LJ6 A;  1NY6 A;  3I4Y A;  1MN3 A;  3HJS A;  4L8R C;  3KVW A;  5EP4 A;  2DAM A;  1D0M A;  2D7E A;  2DNA A;  1G59 A;  1T43 A;  1NJF A;  3D8B A;  1GAB A;  2ZAO A;  3LVV A;  4P17 A;  2EO2 A;  4MGK E;  2CWB A;  2HAK A;  2KHH A;  2QNJ A;  3PXG A;  3FTF A;  4GKK M;  3RGP A;  3C58 A;  5LMU M;  3J80 S;  2DZN B;  1DO2 A;  4IBB A;  3HZJ A;  3K2L A;  2KZS A;  4ANR A;  4G4Q A;  2NQ8 C;  1OIZ A;  3J7B A;  3QWL A;  2K0B X;  4OVZ A;  2C9O A;  2UU9 M;  3W0F A;  3AL0 C;  1E9S A;  2L09 A;  4I8O A;  2JUJ A;  3LMM A;  3U6L A;  4DR6 M;  3UMM A;  4LJ7 A;  1IY0 A;  2H1R A;  1IBK M;  2F5Q A;  4G4R A;  1VG5 A;  2DVW B;  4GKJ M;  1N36 M;  2EUC A;  4ZPX A;  3GRV A;  1I4W A;  1OAO C;  2Y0Q A;  4JXJ A;  2X8A A;  4I81 A;  3FUV A;  4AG6 A;  1EE8 A;  1L1T A;  2DAK A;  1ZQ9 A;  3E9S A;  2F5S A;  4B3R M;  1G3I A;  2JNH A;  2R18 A;  5EXX A;  3FTD A;  1L8Q A;  1TH3 A;  3SAR A;  1FJG M;  3L29 A;  2VII A;  2KNV A;  3CF0 A;  2CV1 A;  4LF5 M;  1MU5 A;  1NNU C;  2KRK A;  1QZM A;  2QQ8 A;  5EP3 A;  5DNY A;  2APL A;  3T15 A;  3AKZ A;  4G3O A;  1LTM A;  1TGU A;  4FWG A;  3ZQJ A;  4DR3 M;  2JY7 A;  3MMP A;  4DBG B;  3C3E A;  1G41 A;  3JR5 A;  1NV8 A;  1HQY E;  3PNY A;  2M5Z A;  4NSR A;  4NC6 A;  1WGN A;  3B9P A;  1DGG A;  2V1C A;  3BOS A;  1VEJ A;  3RGS A;  3SHF A;  3K1J A;  3B7N A;  2MH8 A;  3T6P A;  3NBI A;  1E32 A;  2L4F A;  2VDB B;  4HLQ A;  4NXM M;  1LV7 A;  4X65 M;  1D0K A;  2WSF F;  2L6O A;  4Y28 F;  4OX9 M;  3VKH A;  5KQ8 A;  3SFZ A;  3GPY A;  1HR0 M;  5F3W A;  3GQ5 A;  3AOG A;  2OOB A;  4RNA A;  1Z5B A;  3EIH A;  3CTW B;  2HWJ A;  1IN6 A;  2Y0T A;  2XGN A;  2Y20 A;  4DV0 M;  2B3T A;  2G8L A;  5A2Q S;  1GVN A;  4IBI A;  4IIW A;  2XEP A;  3L28 A;  1L1Z A;  2DAI A;  2UUA M;  4LZZ A;  5EQT A;  4PD2 A;  2O25 A;  5ITX E;  3QAU A;  2Z8Y M;  3WHK A;  5KQD A;  2L7H A;  1G8P A;  3D8L A;  3FUT A;  1XNQ M;  2R46 A;  1Z6T A;  2DI0 A;  3RE8 A;  4LFB M;  4XGI A;  2ZTC A;  2OPF A;  2VQE M;  3GLI E;  1I94 M;  4LY6 A;  2XF3 A;  1KYI A;  1HT2 E;  4LGM A;  3TPZ A;  4GMQ A;  4DV2 M;  2DWM A;  3JAM S;  2KEB A;  3B89 A;  3I51 A;  2FFJ A;  3Q8X A;  5EP2 A;  2LXE A;  2OO9 A;  3FTE A;  3HHX A;  4GEW A;  3TL4 X;  4JV5 M;  4X66 M;  1IM2 A;  2EA0 A;  1PJI A;  1DGF A;  3K9P A;  2F5O A;  1QAQ A;  4GHA A;  3KSX A;  1EFU B;  1PJT A;  4R3D A;  4W5W A;  4OVZ B;  2R44 A;  1E9R A;  4X62 M;  4AKI A;  3SHG B;  4F2L A;  4RF1 A;  3HU2 A;  4LG2 A;  3UJN A;  1R4G A;  1JR3 A;  4DR1 M;  1T3T A;  4II7 A;  1WXQ A;  4QHT A;  3SMP A;  2R62 A;  5FTJ A;  4DUY M;  1QDT A;  5C18 A;  2M60 A;  4JI8 M;  1N33 M;  3W67 A;  4WP2 A;  4NRW A;  3SAU A;  5ITQ A;  1DO0 A;  3TWL A;  2MRO B;  1AIP C;  2I7N A;  3L2A A;  5JI3 E;  3M0E A;  4M9Z A;  2ZAN A;  4DV5 M;  1XC8 A;  2E5L M;  1XHB A;  1OFI A;  1SXJ C;  1D0L A;  3PVS A;  3U61 B;  1N34 M;  1UFZ A;  4NSO B;  1ZMW A;  4B7F A;  4QHS A;  2FE8 A;  4JI7 M;  2QHO B;  2XSZ A;  3FUU A;  2C5R A;  3IEC A;  3FD9 A;  4QNM A;  4R7G A;  5ITT A;  2LTU A;  1NJG A;  3MHV C;  1PRB A;  3K8Z A;  2F4V M;  1XB2 B;  2DXI A;  4B08 A;  2C96 A;  1WIV A;  3FRH A;  4GIP A;  4LZJ A;  3GLI B;  4EIW A;  1IXS B;  4AKG A;  4S12 A;  3IHP A;  8CAT A;  2HKJ A;  4WUR A;  1PJQ A;  3KOW E;  4K0K M;  3MK6 A;  3DOA A;  1L2C A;  1N78 A;  5FLX S;  4DV1 M;  3VK8 A;  2BWE A;  3E4R A;  3U6D A;  5EXT A;  1TR8 A;  5IT9 S;  3VKG A;  1YE9 A;  4JI0 M;  2CFO A;  4I4L A;  4PT5 A;  2C98 A;  1JR3 E;  4IBD A;  1V33 A;  1QYR A;  5JI2 E;  2K47 A;  2F5N A;  4FWH A;  1NVM A;  3FTC A;  4LGY A;  2FNA A;  4PDI A;  4CIZ A;  2JZ0 A;  2EJS A;  1KSF X;  3TQS A;  3ZH9 B;  1TTE A;  1OKS A;  3UK6 A;  3I01 M;  3KOY E;  3KXE C;  3U6P A;  2RGO A;  4JYA M;  2QPA A;  3THG A;  3FYC A;  1PGY A;  4G6Z A;  5IWA M;  2Q2E B;  4ITQ A;  4OW0 A;  3SMS A;  2AHM A;  5EP1 A;  2JZ1 A;  3KDS E;  3KP1 E;  1AUA A;  4DV6 M;  3U61 A;  3U6C A;  5IRE B;  1X37 A;  2O5R A;  1RU3 A;  2R4J A;  3HY5 A;  3HHY A;  1XNR M;  1IQP A;  5ITR A;  4LFA M;  5ITX A;  4B7G A;  1OJL A;  4CHT B;  1PJJ A;  3L25 A;  1V34 A;  3FUW A;  3LVW A;  4M9X A;  2V1U A;  4IBJ A;  4IBE A;  5E6J A;  1GLN A;  3GLI A;  2CV2 A;  4LF9 M;  1KFV A;  1IXS A;  2XFS A;  4L15 A;  1XMO M;  4NRV A;  1GKI A;  3J27 B;  3QYE A;  1YLA A;  3UGJ A;  1GJT A;  4B3M M;  4DR7 M;  2ZM6 M;  3IG5 A;  4MGY E;  1QQW A;  2JY8 A;  3QYB A;  1IXR C;  2N35 A;  3WHL A;  2UUB M;  1JR3 D;  4CIS A;  4JI2 M;  4KT0 F;  3SYK A;  2P5T A;  3U6S A;  5FTN A;  3TE6 A;  4BLC A;  4IBK A;  2FOI C;  3HU3 A;  4YHH M;  1IXZ A;  4D81 A;  4A3V B;  1L2D A;  2JY6 B;  2OOA A;  3A42 A;  3EIE A;  3UZU A;  4DR5 M;  2KA6 B;  3KOX E;  2DWZ B;  2FS1 A;  1Q3C A;  3GRU A;  3HGI A;  2LVO C;  4LF7 M;  1K3W A;  2UXB M;  3SYL A;  3Q8G A;  4NL4 H;  3L26 A;  2XSZ D;  1E94 E;  2BNK A;  3A45 A;  2CV0 A;  2VF7 A;  5IZ7 D;  5FTL A;  3GLF A;  2C9C A;  1TDH A;  3AV0 A;  5DFL A;  3VK7 A;  3U6Q A;  4FCW A;  5DYG A;  4P16 A;  4LJ5 A;  1VDL A;  4DR4 M;  3MJ5 A;  2YFQ A;  4L6V 6;  3R8F A;  4LRS A;  1DGH B;  2JA2 A;  3ZCB B;  1R5L A;  1ZAE A;  4FCV A;  1TDZ A;  2LBC A;  4LF6 M;  1QAO A;  1HJP A;  1IY2 A;  1PJS A;  3IG8 A;  1SXJ B;  5GKN A;  5LMN M;  1ZV1 A;  2CEA A;  4AQY M;  2I7P A;  2KRU A;  4XBO A;  1K3X A;  3GPP A;  2HCB A;  4GH9 A;  4KHP M;  3SAT A;  4I5S A;  3GRY A;  4FVM A;  1P3Q Q;  4MGI E;  5EJC A;  2KZU A;  2J5Y A;  2XH9 A;  1GL6 A;  1J09 A;  3LQQ A;  1N75 A;  2YNM D;  3TWM A;  2HHH M;  1YUB A;  1HT1 E;  4B3S M;  5KPT A;  2YQZ A;  2CUZ A;  3DA1 A;  1IBL M;  2LH0 A;  4QOS A;  3AJI B;  4FW9 A;  1Q3B A;  4GHL A;  2H5X A;  3FUX A;  5KO3 A;  1IN7 A;  1OAI A;  2RKO A;  1T6O A;  1WR1 B;  3HHW A;  3GLF E;  1J5E M;  3HJ8 A;  4MB7 A;  3PFI A;  4QOZ C;  2VF8 A;  1JB0 F;  4CJ6 A;  3I04 M;  3F92 A;  4DV3 M;  2LVA A;  2DWL A;  2JY5 A;  4BBA A;  3U6E A;  4IBF A;  2DHR A;  4NXN M;  1HNX M;  1TF0 B;  2DKL A;  5FSW A;  4IJF A;  4DUZ M;  3GQ3 A;  4LF4 M;  2KXE A;  2J7N A;  1IN5 A;  4RKU F;  5EXP A;  1NSF A;  1OIP A;  1GL7 A;  1DGH A;  4DV7 M;  5E26 A;  2DHY A;  3B74 A;  1Q02 A;  4IBG A;  3SAV A;  4M9S A;  1QAN A;  3T1Y M;  1UM8 A;  2LVQ D;  1VDD A;  2UXD M;  3KS4 A;  1SXJ A;  3J81 S;  4LJ4 A;  2QBY A;  3RFW A;  3ZC7 B;  2CRU A;  1BVS A;  3U5Z B;  3CF2 A;  3U60 A;  3FE3 A;  3GLG A;  4AZF A;  1Z5A A;  2DZL A;  3KSJ A;  3VFD A;  2X4A A;  2L4E A;  3L27 A;  4RF0 A;  1NV9 A;  4BB9 A;  5KPZ A;  2RRU A;  3M7G A;  4MH0 E;  3CGW A;  3OTO M;  1HQC A;  3TWK A;  1R2Z A;  2LNH C;  4LCB A;  1VEG A;  4LF8 M;  4F1I A;  2K9D A;  4HEO A;  2XZF A;  1WGL A;  2G3Q A;  4NOO B;  1CUK A;  2KDL A;  3AOE C;  1MJG M;  2DAG A;  2EKF A;  3SC3 A;  2WSE F;  4DV4 M;  1PM5 A;  5FTK A;  4AW4 A;  4M0D A;  1R6B X;  3GLF B;  2CE7 A;  2R4E A;  2D7G A;  1A5T A;  4Z8X A;  1HNZ M;  2LHC A;  4LJ8 A;  1JQJ C;  3BXW A;  4XK8 F;  4GC5 A;  1ZMV A;  2W82 A;  2GQF A;  3VLF B;  3E21 A;  1DGB A;  3GRR A;  4Q7J A;  2HL7 A;  3DFZ A;  2JP7 A;  3HHZ A;  1XMQ M;  3KFU G;  3C9P A;  4AI6 A;  2DAE A;  3C3D A;  2BWB A;  3GPX A;  2XZU A; 
#chains in the Genus database with same CATH homology
 1WHC A;  1C7Y A;  2MGW A;  1E94 E;  4F2L A;  1OQY A;  1VQ1 A;  1QZE A;  1R4G A;  3GLG E;  1MN3 A;  2L2D A;  5DFL A;  2DAM A;  2DNA A;  1T43 A;  1VDL A;  3H4J A;  2CWB A;  2HAK A;  2KHH A;  2QNJ A;  4WP2 A;  1DO0 A;  2MRO B;  1AIP C;  1DO2 A;  3K9O A;  3E46 A;  2LBC A;  2CP8 A;  1HJP A;  1UFZ A;  1ZV1 A;  2K0B X;  1ZMW A;  2MJ5 B;  2QSF X;  2JUJ A;  2MR9 A;  2QHO B;  1F4I A;  1GO5 A;  2DEN A;  3IEC A;  2LTU A;  1VG5 A;  3FRI A;  1P3Q Q;  1XB2 B;  3FRH A;  1WIV A;  3IHP A;  1HT1 E;  2KNA A;  2DAK A;  1G3I A;  2JNH A;  2BWE A;  2H5X A;  2KNZ A;  1TR8 A;  1OAI A;  1XXH E;  2LVN C;  1T6O A;  1WR1 B;  3LCV B;  2KNV A;  1JR3 E;  3GLF E;  5JI2 E;  4G3O A;  1IFY A;  2JY7 A;  3F92 A;  3MMP A;  2LVA A;  2JZ0 A;  4DBG B;  1G41 A;  2EJS A;  1NV8 A;  2EKK A;  1V92 A;  1TTE A;  1HQY E;  2JY5 A;  1OKS A;  1WGN A;  1WJ7 A;  1VEJ A;  2DKL A;  4R71 A;  3T6P A;  1G4A E;  2L4F A;  1PGY A;  2R0I A;  3GLH E;  1SG9 A;  2DHY A;  1Q02 A;  2JZ1 A;  2LVQ D;  2OOB A;  1BVS A;  1Y8G A;  2HWJ A;  3FE3 A;  2B3T A;  2DZL A;  2ZTD A;  2L4E A;  1NV9 A;  2RRU A;  3BBZ A;  2DAI A;  1IXS A;  1VEG A;  2O25 A;  1YLA A;  1OTR A;  4F1I A;  2K9D A;  4HEO A;  1WGL A;  2G3Q A;  2JY8 A;  1CUK A;  2DI0 A;  2DAG A;  2EKF A;  1VEK A;  2ZTC A;  1ZMU A;  3GLI E;  1KYI A;  1HT2 E;  1A5T A;  4UN2 B;  1DV0 A;  3B89 A;  3LCU A;  2JY6 B;  2OOA A;  1ZMV A;  2OO9 A;  4GEW A;  3E21 A;  4Q7J A;  2WZJ A;  1IM2 A;  2JP7 A;  3K9P A;  2DAE A;  2LVP C;  2LVO C;  1EFU B;  2BWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...