2K0BX

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
molecule tags Signaling protein
source organism Homo sapiens
publication title Conformation and dynamics of the three-helix bundle UBA domain of p62 from experiment and simulation.
pubmed doi rcsb
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k0bX00
1F4IA 2KNVA 3GLFE 2L4EA 3GLIE 1V92A 2JY6B 1JR3E 2WZJA 2LVQD 4GEWA 1VG5A 3GLGE 2MR9A 1T6OA 1DO2A 2OOBA 2DAIA 2DNAA 1T43A 2JZ1A 1G4AE 3IHPA 2EKKA 1VDLA 1WJ7A 1HQYE 1YLAA 2BWEA 1DV0A 2OOAA 1XXHE 2G3QA 4UN2B 1SG9A 1WR1B 1CUKA 1NV8A 1ZMUA 3K9PA 2DAEA 1C7YA 1R4GA 2CP8A 2JY8A 2MJ5B 1TTEA 2DAGA 3E21A 1Q02A 3BBZA 2K9DA 4F2LA 3H4JA 1VEKA 1UFZA 1QZEA 1IXSA 1NV9A 2DAKA 2JNHA 2LTUA 2EKFA 2QSFX 5DFLA 4F1IA 1MN3A 1G3IA 2JP7A 1TR8A 1ZV1A 1XB2B 1WIVA 1G41A 2DAMA 3E46A 2HWJA 4DBGB 2MROB 2LVAA 1GO5A 2LBCA 2LVOC 1VEJA 2JY5A 2ZTCA 1ZMVA 4WP2A 1VEGA 1ZMWA 2MGWA 2HAKA 3F92A 1A5TA 1EFUB 1KYIA 2QHOB 2DHYA 3LCUA 1HT2E 2LVNC 2O25A 1E94E 2JY7A 2QNJA 1WHCA 1OAIA 2L2DA 3IECA 3B89A 1OKSA 1AIPC 1VQ1A 2B3TA 2K0BX 4HEOA 1HT1E 4Q7JA 1Y8GA 2CWBA 3MMPA 2RRUA 1WGNA 2DI0A 2KNAA 1OQYA 2JZ0A 3FRHA 2LVPC 1PGYA 2DENA 2EJSA 1OTRA 2L4FA 2R0IA 1HJPA 4R71A 2BWBA 1IM2A 2DKLA 1P3QQ 2H5XA 3FE3A 1BVSA 2ZTDA 3LCVB 1DO0A 2OO9A 3FRIA 1WGLA 5JI2E 3GLHE 3K9OA 2DZLA 3T6PA 4G3OA 2KHHA 2JUJA 1IFYA 2KNZA
chains in the Genus database with same CATH superfamily
3JR5A 4G4OA 3Q8XA 4PDGA 1L2CA 1X37A 3TWMA 1D0MA 1V92A 3BXWA 3HKPA 2JY6B 4B3TM 1JR3E 2WZJA 4G4QA 4CHTB 3GQ4A 1PM5A 5L8RF 1N78A 1NVMA 2MR9A 1T6OA 1DO2A 1K3WA 2C5RA 1YUBA 4XK8F 4B3RM 1G4AE 1GVNA 2ZAMA 3C3EA 2VQEM 1QAOA 1VDLA 1WJ7A 2ZM6M 1JR3A 3VDUA 3KW6A 3U6MA 4GC5A 2G3QA 3LVWA 2HCBA 2L09A 1NO1A 3HY5A 3ZCBB 5FSWA 3CF2A 1ZMUA 2ZAOA 3IG5A 3LQQA 3L26A 3LVVA 4X65M 1R4GA 3SAWA 4QOZC 1MU5A 2LHGA 4NXMM 2KZUA 1LV7A 2QP9X 3DA1A 4LY6A 4F2LA 4S12A 4DR2M 2V6ZM 4JN6A 2DAKA 2AHMA 2BJVA 2LTUA 2R4EA 5DFLA 3J81S 2Z3XA 3FYCA 2F4VM 5EP1A 3C9PA 1L8QA 2CRUA 1SXJA 1GJTA 3T1YM 1IBKM 4QHTA 1WIVA 1ORYB 4LJAA 4BB9A 2DAMA 4ZPXA 1I4WA 4MGYE 3CTWB 4LZZA 5DYIA 2X8AA 3THGA 4DV6M 3HJSA 4DBGB 3H4MA 3MJ5A 4X64M 2F5OA 1N77A 1QDTA 2YQZA 2EA0A 3SAVA 3U60B 3AFHA 4JI7M 4DR7M 1GO5A 3HU1A 5ITUA 3J7BA 3TE6A 2FNAA 3U6CA 2VDBB 1N32M 4FWDA 4JI1M 2XZFA 3K1JA 2L7IA 4IBCA 5KQDA 4D80A 1NHWC 1HNZM 3MK6A 3SATA 4GH9A 2FE8A 2F5QA 1XNQM 3SAUA 2QBYB 1DGFA 3GPYA 1SXJB 1EE8A 3V76A 3FD9A 4DR6M 3NBXX 3ZC7B 2Z7JA 4JXJA 4DV3M 4LZJA 3B74A 2R18A 2B3TA 3HX3A 2O01F 4GMQA 2APLA 1HNWM 4IBEA 4KT0F 3AV0A 5H37D 2UXDM 1J7KA 2DZNB 3SHGB 2DI0A 1R2YA 3UMMA 1VDDA 1EIJA 2KNAA 2JWSA 3GQ3A 1R6BX 4CGYB 2QBYA 1OTRA 2YR0A 4ITQA 1XMOM 4AKIA 1QAMA 2X4AA 1YE9A 4MGHA 2DKLA 4KLNA 4MGKE 2R6FA 5ITXE 4LF9M 4A3VB 4LJ6A 1NHGC 1YSYA 3IG8A 2RGHA 3LQRA 4QNRA 2Y0TA 5BR8M 3T1HM 1R2ZA 4CISA 2CV0A 3HZJA 1WXQA 3M7GA 4KO8A 1DGHB 3R8FA 3W0LB 2DZLA 3WHKA 3T6PA 1XMQM 1XXHB 3HWSA 5FTMA 5DYGA 3VKGA 4L6V6 1AUAA 2Y0QA 4ANRA 1F4IA 4X62M 4I8OA 3C3DA 3U6SA 2L4EA 3UJNA 1G8PA 1IQPA 2UU9M 4JI8M 4G4NA 3HHXA 2KEBA 2LVQD 3TQSA 1OJLA 3KP0E 1H6UA 1NJFA 5IT9S 4I81A 1QZMA 2DAIA 2FFJA 1T43A 5KQ8A 1JR3D 2JZ1A 5EXXA 2F5PA 3DFZA 1IN8A 2LHCA 3GPPA 3LMMA 1ZAEA 1HQYE 1YLAA 4W5WA 4DV0M 1HR0M 4MB7A 2K47A 2VIIA 4AW4A 2CV2A 1FJGM 4UN2B 1TDZA 3GLGB 1WR1B 1CUKA 1Z5AA 5IREB 2M60A 1IN7A 5ITXA 2M5ZA 4IBFA 1C7YA 1HQCA 2LH0A 2MJ5B 2JY8A 3A42A 1E32A 1GL7A 3I01M 3U61B 2K9DA 1TH4A 3L25A 1IXRC 1UFZA 1ZQ9A 1SXJD 2JNHA 4JI4M 4WURA 4BLCA 3KOYE 1OAOC 1Z6TA 4DR1M 2JP7A 1TR8A 1G71A 4HL4A 3QAUA 3VK7A 1G41A 4AG6A 3NBIA 3E46A 2HWJA 1TH2A 2C98A 1QANA 1D0LA 2BJWA 3ILKA 4RKUF 3C58A 4IBGA 4Z8XA 3QYBA 4LJ8A 2LVOC 1VEJA 2JY5A 2WSEF 4IJEA 4JI0M 1C1KA 2CV1A 2UUCM 5ITQA 1JQJC 3FUUA 2MGWA 3B7ZA 4DV1M 7CATA 3KFUG 3L28A 4I4LA 1UM8A 2QQ8A 2C9OA 4B3SM 4GHLA 3K2LA 2CHGA 3GLFA 3LCUA 2O25A 5EP3A 2FOIC 1IY2A 3SC3A 1KFVA 1WHCA 4RNAA 3ZH9B 2L2DA 2Q2EB 3PNYA 4D82A 1IBMM 2DXIA 1OKSA 3FTEA 1OFHA 3EIEA 4LCBA 3GPUA 4PCZA 1R7RA 1VQ1A 3I04M 2K0BX 4DR4M 1Y8GA 2CFOA 2XGNA 2XSZA 1XWIA 1HNXM 4YHHM 4GHAA 3GRYA 5EQTA 1E9RA 3JAMS 1RU3A 3FRHA 4FCVA 2KDLA 4GITA 5ITRA 3GLFB 4M0DA 3FUVA 2UUAM 4JI2M 4IBIA 8CATA 3U6DA 1Q3CA 2L4FA 1NJGA 2R0IA 1QVRA 3GLHA 5FLXS 1L2BA 1HJPA 1Z59A 2BWBA 5EXTA 5GKNA 1IM2A 2UUBM 4AKHA 4OVZB 2H5XA 3LW5F 2OQ4A 4LFBM 4LGYA 1JB0F 3FTDA 2EO2A 2E5LM 4PDIA 1BVSA 2OO9A 3GRRA 2J7NA 4MM3B 3U6EA 1WGLA 1GLNA 5E26A 1E9SA 5JI2E 1KSFX 2XF3A 5LMUM 3PNVA 2DHRA 3KXEC 4G3OA 4EIWA 2VQFM 5FTJA 2JUJA 3VFDA 1NY6A 3L29A 4REZA 1PJTA 3SYKA 4YY3M 4LJ9A 1N34M 5E6JA 4XBOA 3GLIE 1FNNA 2RKOA 4LF4M 4B7GA 3W0FA 1MX0A 2R62A 3KS8A 3DOAA 3M0EA 1PJJA 2OOBA 4JI5M 2CHVA 3AOEA 4FWHA 4GRIA 4OU7A 3QYEA 3A45A 3IHPA 4AI6A 5BPVA 3B9PA 1Q3BA 2N35A 2BWEA 2VF8A 2P5TA 2OOAA 2R4JA 3J7AS 5F3WA 2DWMA 1XXHE 3GPXA 1IY0A 3KSXA 5EXPA 4LRTA 4G4RA 2QENA 1J09A 2DAEA 3RE8A 4K0KM 3I51A 1OIPA 2CP8A 1XXHA 2EUCA 1QUTA 1TTEA 1Q39A 1GABA 3SMPA 1QUSA 4KODA 4LF5M 5C1BA 2YFQA 3DZDA 1IBLM 3E21A 1Q02A 1S3SA 3VKHA 2Y21A 2I7PA 5FTNA 3M6AA 3H4JA 1VEKA 2KA6B 1LTMA 4Y28F 4CIZA 1L2DA 1QZEA 1IXSA 3KVWA 1N33M 4DV7M 4NOOB 2EKFA 2UXBM 3CGWA 1MN3A 1G3IA 2O5RA 2CUZA 1XB2B 2KW0A 2YNMD 1PJIA 4X66M 4BBAA 2Z4SA 3T38A 4DR3M 2G8LA 4P17A 2LNHC 3D8LA 2R46A 2MROB 1K3XA 2LVAA 1SXJE 2QZ4A 3W67A 4AZFA 4B7HA 4FD2A 4HLQA 3L2AA 2I7NA 3L27A 3HJ8A 2ZANA 3I4VA 3PXGA 2NQ8C 3GLGA 2ZTCA 4WP2A 1ZMVA 4LF6M 1ZMWA 3MHVC 4NSOB 3T15A 2C99A 5EP4A 3GRUA 3K92A 1IN5A 2FH0A 1QAQA 3KDSE 4R3DA 2DWLA 3U61A 4M9XA 3K8ZA 1KYIA 2FS1A 3J27B 2C96A 1L1ZA 1GJSA 1E94E 2LWXA 1QQWA 2QNJA 2DWZB 3U6QA 2DZOB 1TDHA 2XSZD 1Z5CA 3U60A 1AIPC 4HEOA 3A46A 1D0KA 4RF1A 2CWBA 3HHZA 1MJGM 2WSFF 3AL0C 5ITTA 3PVSA 1SXJC 4IBKA 3RGPA 3U6OA 1IN4A 2JZ0A 3Q8GA 2Z8YM 2LVPC 3VLFB 2HKJA 2V1CA 3HGIA 3A98B 1I94M 1N36M 2KRKA 2K6BA 2DVWB 2L6OA 4R71A 3J80S 4R7GA 4LG2A 4GC9A 4NSRA 3AOEC 3FTFA 4NRWA 1OIZA 3HHWA 2ZTDA 3PFIA 4L4UA 3KOZE 1DO0A 3FRIA 4DR5M 5EXSA 3U6PA 2J7OA 4QOSA 3K9OA 1QDRA 4AQYM 3FKEA 4LJ5A 2KHHA 4L78A 2XEPA 3I4YA 1IFYA 1XHBA 4TUWA 2J5YA 2KNZA 1V33A 2KNVA 5IWAM 3GLFE 4II7A 4RF0A 2F5SA 4OW0A 4DUZM 2XFTA 1TGUA 3HU3A 4QHSA 4MGIE 1IXSB 2OPFA 2XFSA 2R65A 4GKKM 4LGMA 1IN6A 4GEWA 1VG5A 4B3MM 1PRBA 3GLGE 3SMSA 1IY1A 5A2QS 2DNAA 4FCWA 4JI3M 1DGHA 1NNUC 2EKKA 2V1UA 4FWGA 2Y20A 3AKZA 1DV0A 3U6LA 1V34A 1T3TA 4PT5A 3FYDA 3RGSA 4WW0A 3SARA 1QYRA 3TL4X 4Z6YA 1SG9A 2R44A 3EIHA 4LFCM 1NV8A 2F5NA 4CJ6A 5C18A 3HJQA 2JA2A 3FUXA 3K9PA 4IBBA 5IZ7D 3VK8A 5EJCA 3GLIB 1Z5BA 1XNRM 3E9SA 1DGBA 4IJFA 4L16A 3UGJA 3KP1E 1OFIA 1NY5A 1W5SA 2DAGA 3KS4A 4IBDA 4GIPA 3BBZA 3KSJA 3GP1A 1J5EM 1L1TA 2LXEA 3AJIB 4I5SA 4MH0E 1N75A 3HU2A 4XGIA 4JV5M 4JYAM 3B7NA 3J2PB 3D8BA 4LRSA 2QSFX 1NV9A 2H1RA 1DGGA 4B7FA 4NL4H 4F1IA 5KO3A 4DUYM 2CE7A 4FVMA 4L15A 3VDPA 3U5ZB 4GKJM 3SASA 2C9CA 2D7GA 4FCTA 2A5YB 1ZV1A 3SBJA 4NRVA 2VF7A 5JI3E 2KXEA 2ERCA 2D7EA 4AKGA 4D81A 5FTLA 2JXNA 2RGOA 2QPAA 2LBCA 1G59A 3TWLA 2GNOA 3KOXE 3UK6A 4LF8M 4FW9A 4NC6A 3KOWE 1XC8A 3W68A 1VEGA 2QCUA 4DV5M 3WHLA 2HAKA 3F92A 4JI6M 1A5TA 4B08A 3U5ZA 1EFUB 4LJ4A 3TPZA 2Z4RA 3GRVA 3UZUA 2QHOB 2DHYA 1HT2E 3B7QA 2LVNC 3GLHB 2JY7A 4LJ7A 3SHFA 1GL6A 4M0WA 3CF0A 4M9ZA 1TH3A 1OAIA 3SFZA 3IECA 3B89A 4OVZA 1R5LA 1PJSA 3FUTA 5ITYA 4Q7JA 1HT1E 2L7HA 3MMPA 4IIWA 2XH9A 4DV4M 1NNJA 4LFAM 2RRUA 1WGNA 2D7HA 2KRUA 2MH8A 2UXCM 3FUWA 5EP2A 1GKIA 1IXZA 3SYLA 4LF7M 1OQYA 4IBJA 3OTOM 2BNKA 1PGYA 2WSCF 2DENA 3RFWA 2CEAA 3HHYA 1NSFA 2EJSA 2W82A 3BOSA 3E4RA 5DNYA 1D2NA 4G6ZA 2X49A 3NWLA 2G5GX 4M9SA 1PJQA 1TF0B 2CHQA 4KHPM 4PD2A 5FTKA 2HL7A 3FTCA 5KPTA 4NXNM 1P3QQ 2GQFA 2R45A 3FE3A 3LCVB 4QNMA 3JR4A 5LMNM 1K82A 2KZSA 3CF6E 3GO8A 4DV2M 2DWNA 4AG5A 2HHHM 5KPZA 3GLHE 3ZQJA 2XZUA 1W5TA 3GLIA 3TWKA 2XLJA 3QWLA 3GQ5A 4MGZE 4L8RC 4P16A 2ZBKB 4OX9M 5KPRA 3R9XB 3AOGA
chains in the Genus database with same CATH topology
1F4IA 2KNVA 3GLFE 2L4EA 3GLIE 1V92A 2JY6B 1JR3E 2WZJA 2LVQD 4GEWA 1VG5A 3GLGE 2MR9A 1T6OA 1DO2A 2OOBA 2DAIA 2DNAA 1T43A 2JZ1A 1G4AE 3IHPA 2EKKA 1VDLA 1WJ7A 1HQYE 1YLAA 2BWEA 1DV0A 2OOAA 1XXHE 2G3QA 4UN2B 1SG9A 1WR1B 1CUKA 1NV8A 1ZMUA 3K9PA 2DAEA 1C7YA 1R4GA 2CP8A 2JY8A 2MJ5B 1TTEA 2DAGA 3E21A 1Q02A 3BBZA 2K9DA 4F2LA 3H4JA 1VEKA 1UFZA 1QZEA 1IXSA 1NV9A 2DAKA 2JNHA 2LTUA 2EKFA 2QSFX 5DFLA 4F1IA 1MN3A 1G3IA 2JP7A 1TR8A 1ZV1A 1XB2B 1WIVA 1G41A 2DAMA 3E46A 2HWJA 4DBGB 2MROB 2LVAA 1GO5A 2LBCA 2LVOC 1VEJA 2JY5A 2ZTCA 1ZMVA 4WP2A 1VEGA 1ZMWA 2MGWA 2HAKA 3F92A 1A5TA 1EFUB 1KYIA 2QHOB 2DHYA 3LCUA 1HT2E 2LVNC 2O25A 1E94E 2JY7A 2QNJA 1WHCA 1OAIA 2L2DA 3IECA 3B89A 1OKSA 1AIPC 1VQ1A 2B3TA 2K0BX 4HEOA 1HT1E 4Q7JA 1Y8GA 2CWBA 3MMPA 2RRUA 1WGNA 2DI0A 2KNAA 1OQYA 2JZ0A 3FRHA 2LVPC 1PGYA 2DENA 2EJSA 1OTRA 2L4FA 2R0IA 1HJPA 4R71A 2BWBA 1IM2A 2DKLA 1P3QQ 2H5XA 3FE3A 1BVSA 2ZTDA 3LCVB 1DO0A 2OO9A 3FRIA 1WGLA 5JI2E 3GLHE 3K9OA 2DZLA 3T6PA 4G3OA 2KHHA 2JUJA 1IFYA 2KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4I A;  2KNV A;  3GLF E;  2L4E A;  3GLI E;  1V92 A;  2JY6 B;  1JR3 E;  2WZJ A;  2LVQ D;  4GEW A;  1VG5 A;  3GLG E;  2MR9 A;  1T6O A;  1DO2 A;  2OOB A;  2DAI A;  2DNA A;  1T43 A;  2JZ1 A;  1G4A E;  3IHP A;  2EKK A;  1VDL A;  1WJ7 A;  1HQY E;  1YLA A;  2BWE A;  1DV0 A;  2OOA A;  1XXH E;  2G3Q A;  4UN2 B;  1SG9 A;  1WR1 B;  1CUK A;  1NV8 A;  1ZMU A;  3K9P A;  2DAE A;  1C7Y A;  1R4G A;  2CP8 A;  2JY8 A;  2MJ5 B;  1TTE A;  2DAG A;  3E21 A;  1Q02 A;  3BBZ A;  2K9D A;  4F2L A;  3H4J A;  1VEK A;  1UFZ A;  1QZE A;  1IXS A;  1NV9 A;  2DAK A;  2JNH A;  2LTU A;  2EKF A;  2QSF X;  5DFL A;  4F1I A;  1MN3 A;  1G3I A;  2JP7 A;  1TR8 A;  1ZV1 A;  1XB2 B;  1WIV A;  1G41 A;  2DAM A;  3E46 A;  2HWJ A;  4DBG B;  2MRO B;  2LVA A;  1GO5 A;  2LBC A;  2LVO C;  1VEJ A;  2JY5 A;  2ZTC A;  1ZMV A;  4WP2 A;  1VEG A;  1ZMW A;  2MGW A;  2HAK A;  3F92 A;  1A5T A;  1EFU B;  1KYI A;  2QHO B;  2DHY A;  3LCU A;  1HT2 E;  2LVN C;  2O25 A;  1E94 E;  2JY7 A;  2QNJ A;  1WHC A;  1OAI A;  2L2D A;  3IEC A;  3B89 A;  1OKS A;  1AIP C;  1VQ1 A;  2B3T A;  2K0B X;  4HEO A;  1HT1 E;  4Q7J A;  1Y8G A;  2CWB A;  3MMP A;  2RRU A;  1WGN A;  2DI0 A;  2KNA A;  1OQY A;  2JZ0 A;  3FRH A;  2LVP C;  1PGY A;  2DEN A;  2EJS A;  1OTR A;  2L4F A;  2R0I A;  1HJP A;  4R71 A;  2BWB A;  1IM2 A;  2DKL A;  1P3Q Q;  2H5X A;  3FE3 A;  1BVS A;  2ZTD A;  3LCV B;  1DO0 A;  2OO9 A;  3FRI A;  1WGL A;  5JI2 E;  3GLH E;  3K9O A;  2DZL A;  3T6P A;  4G3O A;  2KHH A;  2JUJ A;  1IFY A;  2KNZ A; 
#chains in the Genus database with same CATH topology
 3JR5 A;  4G4O A;  3Q8X A;  4PDG A;  1L2C A;  1X37 A;  3TWM A;  1D0M A;  1V92 A;  3BXW A;  3HKP A;  2JY6 B;  4B3T M;  1JR3 E;  2WZJ A;  4G4Q A;  4CHT B;  3GQ4 A;  1PM5 A;  5L8R F;  1N78 A;  1NVM A;  2MR9 A;  1T6O A;  1DO2 A;  1K3W A;  2C5R A;  1YUB A;  4XK8 F;  4B3R M;  1G4A E;  1GVN A;  2ZAM A;  3C3E A;  2VQE M;  1QAO A;  1VDL A;  1WJ7 A;  2ZM6 M;  1JR3 A;  3VDU A;  3KW6 A;  3U6M A;  4GC5 A;  2G3Q A;  3LVW A;  2HCB A;  2L09 A;  1NO1 A;  3HY5 A;  3ZCB B;  5FSW A;  3CF2 A;  1ZMU A;  2ZAO A;  3IG5 A;  3LQQ A;  3L26 A;  3LVV A;  4X65 M;  1R4G A;  3SAW A;  4QOZ C;  1MU5 A;  2LHG A;  4NXM M;  2KZU A;  1LV7 A;  2QP9 X;  3DA1 A;  4LY6 A;  4F2L A;  4S12 A;  4DR2 M;  2V6Z M;  4JN6 A;  2DAK A;  2AHM A;  2BJV A;  2LTU A;  2R4E A;  5DFL A;  3J81 S;  2Z3X A;  3FYC A;  2F4V M;  5EP1 A;  3C9P A;  1L8Q A;  2CRU A;  1SXJ A;  1GJT A;  3T1Y M;  1IBK M;  4QHT A;  1WIV A;  1ORY B;  4LJA A;  4BB9 A;  2DAM A;  4ZPX A;  1I4W A;  4MGY E;  3CTW B;  4LZZ A;  5DYI A;  2X8A A;  3THG A;  4DV6 M;  3HJS A;  4DBG B;  3H4M A;  3MJ5 A;  4X64 M;  2F5O A;  1N77 A;  1QDT A;  2YQZ A;  2EA0 A;  3SAV A;  3U60 B;  3AFH A;  4JI7 M;  4DR7 M;  1GO5 A;  3HU1 A;  5ITU A;  3J7B A;  3TE6 A;  2FNA A;  3U6C A;  2VDB B;  1N32 M;  4FWD A;  4JI1 M;  2XZF A;  3K1J A;  2L7I A;  4IBC A;  5KQD A;  4D80 A;  1NHW C;  1HNZ M;  3MK6 A;  3SAT A;  4GH9 A;  2FE8 A;  2F5Q A;  1XNQ M;  3SAU A;  2QBY B;  1DGF A;  3GPY A;  1SXJ B;  1EE8 A;  3V76 A;  3FD9 A;  4DR6 M;  3NBX X;  3ZC7 B;  2Z7J A;  4JXJ A;  4DV3 M;  4LZJ A;  3B74 A;  2R18 A;  2B3T A;  3HX3 A;  2O01 F;  4GMQ A;  2APL A;  1HNW M;  4IBE A;  4KT0 F;  3AV0 A;  5H37 D;  2UXD M;  1J7K A;  2DZN B;  3SHG B;  2DI0 A;  1R2Y A;  3UMM A;  1VDD A;  1EIJ A;  2KNA A;  2JWS A;  3GQ3 A;  1R6B X;  4CGY B;  2QBY A;  1OTR A;  2YR0 A;  4ITQ A;  1XMO M;  4AKI A;  1QAM A;  2X4A A;  1YE9 A;  4MGH A;  2DKL A;  4KLN A;  4MGK E;  2R6F A;  5ITX E;  4LF9 M;  4A3V B;  4LJ6 A;  1NHG C;  1YSY A;  3IG8 A;  2RGH A;  3LQR A;  4QNR A;  2Y0T A;  5BR8 M;  3T1H M;  1R2Z A;  4CIS A;  2CV0 A;  3HZJ A;  1WXQ A;  3M7G A;  4KO8 A;  1DGH B;  3R8F A;  3W0L B;  2DZL A;  3WHK A;  3T6P A;  1XMQ M;  1XXH B;  3HWS A;  5FTM A;  5DYG A;  3VKG A;  4L6V 6;  1AUA A;  2Y0Q A;  4ANR A;  1F4I A;  4X62 M;  4I8O A;  3C3D A;  3U6S A;  2L4E A;  3UJN A;  1G8P A;  1IQP A;  2UU9 M;  4JI8 M;  4G4N A;  3HHX A;  2KEB A;  2LVQ D;  3TQS A;  1OJL A;  3KP0 E;  1H6U A;  1NJF A;  5IT9 S;  4I81 A;  1QZM A;  2DAI A;  2FFJ A;  1T43 A;  5KQ8 A;  1JR3 D;  2JZ1 A;  5EXX A;  2F5P A;  3DFZ A;  1IN8 A;  2LHC A;  3GPP A;  3LMM A;  1ZAE A;  1HQY E;  1YLA A;  4W5W A;  4DV0 M;  1HR0 M;  4MB7 A;  2K47 A;  2VII A;  4AW4 A;  2CV2 A;  1FJG M;  4UN2 B;  1TDZ A;  3GLG B;  1WR1 B;  1CUK A;  1Z5A A;  5IRE B;  2M60 A;  1IN7 A;  5ITX A;  2M5Z A;  4IBF A;  1C7Y A;  1HQC A;  2LH0 A;  2MJ5 B;  2JY8 A;  3A42 A;  1E32 A;  1GL7 A;  3I01 M;  3U61 B;  2K9D A;  1TH4 A;  3L25 A;  1IXR C;  1UFZ A;  1ZQ9 A;  1SXJ D;  2JNH A;  4JI4 M;  4WUR A;  4BLC A;  3KOY E;  1OAO C;  1Z6T A;  4DR1 M;  2JP7 A;  1TR8 A;  1G71 A;  4HL4 A;  3QAU A;  3VK7 A;  1G41 A;  4AG6 A;  3NBI A;  3E46 A;  2HWJ A;  1TH2 A;  2C98 A;  1QAN A;  1D0L A;  2BJW A;  3ILK A;  4RKU F;  3C58 A;  4IBG A;  4Z8X A;  3QYB A;  4LJ8 A;  2LVO C;  1VEJ A;  2JY5 A;  2WSE F;  4IJE A;  4JI0 M;  1C1K A;  2CV1 A;  2UUC M;  5ITQ A;  1JQJ C;  3FUU A;  2MGW A;  3B7Z A;  4DV1 M;  7CAT A;  3KFU G;  3L28 A;  4I4L A;  1UM8 A;  2QQ8 A;  2C9O A;  4B3S M;  4GHL A;  3K2L A;  2CHG A;  3GLF A;  3LCU A;  2O25 A;  5EP3 A;  2FOI C;  1IY2 A;  3SC3 A;  1KFV A;  1WHC A;  4RNA A;  3ZH9 B;  2L2D A;  2Q2E B;  3PNY A;  4D82 A;  1IBM M;  2DXI A;  1OKS A;  3FTE A;  1OFH A;  3EIE A;  4LCB A;  3GPU A;  4PCZ A;  1R7R A;  1VQ1 A;  3I04 M;  2K0B X;  4DR4 M;  1Y8G A;  2CFO A;  2XGN A;  2XSZ A;  1XWI A;  1HNX M;  4YHH M;  4GHA A;  3GRY A;  5EQT A;  1E9R A;  3JAM S;  1RU3 A;  3FRH A;  4FCV A;  2KDL A;  4GIT A;  5ITR A;  3GLF B;  4M0D A;  3FUV A;  2UUA M;  4JI2 M;  4IBI A;  8CAT A;  3U6D A;  1Q3C A;  2L4F A;  1NJG A;  2R0I A;  1QVR A;  3GLH A;  5FLX S;  1L2B A;  1HJP A;  1Z59 A;  2BWB A;  5EXT A;  5GKN A;  1IM2 A;  2UUB M;  4AKH A;  4OVZ B;  2H5X A;  3LW5 F;  2OQ4 A;  4LFB M;  4LGY A;  1JB0 F;  3FTD A;  2EO2 A;  2E5L M;  4PDI A;  1BVS A;  2OO9 A;  3GRR A;  2J7N A;  4MM3 B;  3U6E A;  1WGL A;  1GLN A;  5E26 A;  1E9S A;  5JI2 E;  1KSF X;  2XF3 A;  5LMU M;  3PNV A;  2DHR A;  3KXE C;  4G3O A;  4EIW A;  2VQF M;  5FTJ A;  2JUJ A;  3VFD A;  1NY6 A;  3L29 A;  4REZ A;  1PJT A;  3SYK A;  4YY3 M;  4LJ9 A;  1N34 M;  5E6J A;  4XBO A;  3GLI E;  1FNN A;  2RKO A;  4LF4 M;  4B7G A;  3W0F A;  1MX0 A;  2R62 A;  3KS8 A;  3DOA A;  3M0E A;  1PJJ A;  2OOB A;  4JI5 M;  2CHV A;  3AOE A;  4FWH A;  4GRI A;  4OU7 A;  3QYE A;  3A45 A;  3IHP A;  4AI6 A;  5BPV A;  3B9P A;  1Q3B A;  2N35 A;  2BWE A;  2VF8 A;  2P5T A;  2OOA A;  2R4J A;  3J7A S;  5F3W A;  2DWM A;  1XXH E;  3GPX A;  1IY0 A;  3KSX A;  5EXP A;  4LRT A;  4G4R A;  2QEN A;  1J09 A;  2DAE A;  3RE8 A;  4K0K M;  3I51 A;  1OIP A;  2CP8 A;  1XXH A;  2EUC A;  1QUT A;  1TTE A;  1Q39 A;  1GAB A;  3SMP A;  1QUS A;  4KOD A;  4LF5 M;  5C1B A;  2YFQ A;  3DZD A;  1IBL M;  3E21 A;  1Q02 A;  1S3S A;  3VKH A;  2Y21 A;  2I7P A;  5FTN A;  3M6A A;  3H4J A;  1VEK A;  2KA6 B;  1LTM A;  4Y28 F;  4CIZ A;  1L2D A;  1QZE A;  1IXS A;  3KVW A;  1N33 M;  4DV7 M;  4NOO B;  2EKF A;  2UXB M;  3CGW A;  1MN3 A;  1G3I A;  2O5R A;  2CUZ A;  1XB2 B;  2KW0 A;  2YNM D;  1PJI A;  4X66 M;  4BBA A;  2Z4S A;  3T38 A;  4DR3 M;  2G8L A;  4P17 A;  2LNH C;  3D8L A;  2R46 A;  2MRO B;  1K3X A;  2LVA A;  1SXJ E;  2QZ4 A;  3W67 A;  4AZF A;  4B7H A;  4FD2 A;  4HLQ A;  3L2A A;  2I7N A;  3L27 A;  3HJ8 A;  2ZAN A;  3I4V A;  3PXG A;  2NQ8 C;  3GLG A;  2ZTC A;  4WP2 A;  1ZMV A;  4LF6 M;  1ZMW A;  3MHV C;  4NSO B;  3T15 A;  2C99 A;  5EP4 A;  3GRU A;  3K92 A;  1IN5 A;  2FH0 A;  1QAQ A;  3KDS E;  4R3D A;  2DWL A;  3U61 A;  4M9X A;  3K8Z A;  1KYI A;  2FS1 A;  3J27 B;  2C96 A;  1L1Z A;  1GJS A;  1E94 E;  2LWX A;  1QQW A;  2QNJ A;  2DWZ B;  3U6Q A;  2DZO B;  1TDH A;  2XSZ D;  1Z5C A;  3U60 A;  1AIP C;  4HEO A;  3A46 A;  1D0K A;  4RF1 A;  2CWB A;  3HHZ A;  1MJG M;  2WSF F;  3AL0 C;  5ITT A;  3PVS A;  1SXJ C;  4IBK A;  3RGP A;  3U6O A;  1IN4 A;  2JZ0 A;  3Q8G A;  2Z8Y M;  2LVP C;  3VLF B;  2HKJ A;  2V1C A;  3HGI A;  3A98 B;  1I94 M;  1N36 M;  2KRK A;  2K6B A;  2DVW B;  2L6O A;  4R71 A;  3J80 S;  4R7G A;  4LG2 A;  4GC9 A;  4NSR A;  3AOE C;  3FTF A;  4NRW A;  1OIZ A;  3HHW A;  2ZTD A;  3PFI A;  4L4U A;  3KOZ E;  1DO0 A;  3FRI A;  4DR5 M;  5EXS A;  3U6P A;  2J7O A;  4QOS A;  3K9O A;  1QDR A;  4AQY M;  3FKE A;  4LJ5 A;  2KHH A;  4L78 A;  2XEP A;  3I4Y A;  1IFY A;  1XHB A;  4TUW A;  2J5Y A;  2KNZ A;  1V33 A;  2KNV A;  5IWA M;  3GLF E;  4II7 A;  4RF0 A;  2F5S A;  4OW0 A;  4DUZ M;  2XFT A;  1TGU A;  3HU3 A;  4QHS A;  4MGI E;  1IXS B;  2OPF A;  2XFS A;  2R65 A;  4GKK M;  4LGM A;  1IN6 A;  4GEW A;  1VG5 A;  4B3M M;  1PRB A;  3GLG E;  3SMS A;  1IY1 A;  5A2Q S;  2DNA A;  4FCW A;  4JI3 M;  1DGH A;  1NNU C;  2EKK A;  2V1U A;  4FWG A;  2Y20 A;  3AKZ A;  1DV0 A;  3U6L A;  1V34 A;  1T3T A;  4PT5 A;  3FYD A;  3RGS A;  4WW0 A;  3SAR A;  1QYR A;  3TL4 X;  4Z6Y A;  1SG9 A;  2R44 A;  3EIH A;  4LFC M;  1NV8 A;  2F5N A;  4CJ6 A;  5C18 A;  3HJQ A;  2JA2 A;  3FUX A;  3K9P A;  4IBB A;  5IZ7 D;  3VK8 A;  5EJC A;  3GLI B;  1Z5B A;  1XNR M;  3E9S A;  1DGB A;  4IJF A;  4L16 A;  3UGJ A;  3KP1 E;  1OFI A;  1NY5 A;  1W5S A;  2DAG A;  3KS4 A;  4IBD A;  4GIP A;  3BBZ A;  3KSJ A;  3GP1 A;  1J5E M;  1L1T A;  2LXE A;  3AJI B;  4I5S A;  4MH0 E;  1N75 A;  3HU2 A;  4XGI A;  4JV5 M;  4JYA M;  3B7N A;  3J2P B;  3D8B A;  4LRS A;  2QSF X;  1NV9 A;  2H1R A;  1DGG A;  4B7F A;  4NL4 H;  4F1I A;  5KO3 A;  4DUY M;  2CE7 A;  4FVM A;  4L15 A;  3VDP A;  3U5Z B;  4GKJ M;  3SAS A;  2C9C A;  2D7G A;  4FCT A;  2A5Y B;  1ZV1 A;  3SBJ A;  4NRV A;  2VF7 A;  5JI3 E;  2KXE A;  2ERC A;  2D7E A;  4AKG A;  4D81 A;  5FTL A;  2JXN A;  2RGO A;  2QPA A;  2LBC A;  1G59 A;  3TWL A;  2GNO A;  3KOX E;  3UK6 A;  4LF8 M;  4FW9 A;  4NC6 A;  3KOW E;  1XC8 A;  3W68 A;  1VEG A;  2QCU A;  4DV5 M;  3WHL A;  2HAK A;  3F92 A;  4JI6 M;  1A5T A;  4B08 A;  3U5Z A;  1EFU B;  4LJ4 A;  3TPZ A;  2Z4R A;  3GRV A;  3UZU A;  2QHO B;  2DHY A;  1HT2 E;  3B7Q A;  2LVN C;  3GLH B;  2JY7 A;  4LJ7 A;  3SHF A;  1GL6 A;  4M0W A;  3CF0 A;  4M9Z A;  1TH3 A;  1OAI A;  3SFZ A;  3IEC A;  3B89 A;  4OVZ A;  1R5L A;  1PJS A;  3FUT A;  5ITY A;  4Q7J A;  1HT1 E;  2L7H A;  3MMP A;  4IIW A;  2XH9 A;  4DV4 M;  1NNJ A;  4LFA M;  2RRU A;  1WGN A;  2D7H A;  2KRU A;  2MH8 A;  2UXC M;  3FUW A;  5EP2 A;  1GKI A;  1IXZ A;  3SYL A;  4LF7 M;  1OQY A;  4IBJ A;  3OTO M;  2BNK A;  1PGY A;  2WSC F;  2DEN A;  3RFW A;  2CEA A;  3HHY A;  1NSF A;  2EJS A;  2W82 A;  3BOS A;  3E4R A;  5DNY A;  1D2N A;  4G6Z A;  2X49 A;  3NWL A;  2G5G X;  4M9S A;  1PJQ A;  1TF0 B;  2CHQ A;  4KHP M;  4PD2 A;  5FTK A;  2HL7 A;  3FTC A;  5KPT A;  4NXN M;  1P3Q Q;  2GQF A;  2R45 A;  3FE3 A;  3LCV B;  4QNM A;  3JR4 A;  5LMN M;  1K82 A;  2KZS A;  3CF6 E;  3GO8 A;  4DV2 M;  2DWN A;  4AG5 A;  2HHH M;  5KPZ A;  3GLH E;  3ZQJ A;  2XZU A;  1W5T A;  3GLI A;  3TWK A;  2XLJ A;  3QWL A;  3GQ5 A;  4MGZ E;  4L8R C;  4P16 A;  2ZBK B;  4OX9 M;  5KPR A;  3R9X B;  3AOG A; 
#chains in the Genus database with same CATH homology
 1F4I A;  2KNV A;  3GLF E;  2L4E A;  3GLI E;  1V92 A;  2JY6 B;  1JR3 E;  2WZJ A;  2LVQ D;  4GEW A;  1VG5 A;  3GLG E;  2MR9 A;  1T6O A;  1DO2 A;  2OOB A;  2DAI A;  2DNA A;  1T43 A;  2JZ1 A;  1G4A E;  3IHP A;  2EKK A;  1VDL A;  1WJ7 A;  1HQY E;  1YLA A;  2BWE A;  1DV0 A;  2OOA A;  1XXH E;  2G3Q A;  4UN2 B;  1SG9 A;  1WR1 B;  1CUK A;  1NV8 A;  1ZMU A;  3K9P A;  2DAE A;  1C7Y A;  1R4G A;  2CP8 A;  2JY8 A;  2MJ5 B;  1TTE A;  2DAG A;  3E21 A;  1Q02 A;  3BBZ A;  2K9D A;  4F2L A;  3H4J A;  1VEK A;  1UFZ A;  1QZE A;  1IXS A;  1NV9 A;  2DAK A;  2JNH A;  2LTU A;  2EKF A;  2QSF X;  5DFL A;  4F1I A;  1MN3 A;  1G3I A;  2JP7 A;  1TR8 A;  1ZV1 A;  1XB2 B;  1WIV A;  1G41 A;  2DAM A;  3E46 A;  2HWJ A;  4DBG B;  2MRO B;  2LVA A;  1GO5 A;  2LBC A;  2LVO C;  1VEJ A;  2JY5 A;  2ZTC A;  1ZMV A;  4WP2 A;  1VEG A;  1ZMW A;  2MGW A;  2HAK A;  3F92 A;  1A5T A;  1EFU B;  1KYI A;  2QHO B;  2DHY A;  3LCU A;  1HT2 E;  2LVN C;  2O25 A;  1E94 E;  2JY7 A;  2QNJ A;  1WHC A;  1OAI A;  2L2D A;  3IEC A;  3B89 A;  1OKS A;  1AIP C;  1VQ1 A;  2B3T A;  2K0B X;  4HEO A;  1HT1 E;  4Q7J A;  1Y8G A;  2CWB A;  3MMP A;  2RRU A;  1WGN A;  2DI0 A;  2KNA A;  1OQY A;  2JZ0 A;  3FRH A;  2LVP C;  1PGY A;  2DEN A;  2EJS A;  1OTR A;  2L4F A;  2R0I A;  1HJP A;  4R71 A;  2BWB A;  1IM2 A;  2DKL A;  1P3Q Q;  2H5X A;  3FE3 A;  1BVS A;  2ZTD A;  3LCV B;  1DO0 A;  2OO9 A;  3FRI A;  1WGL A;  5JI2 E;  3GLH E;  3K9O A;  2DZL A;  3T6P A;  4G3O A;  2KHH A;  2JUJ A;  1IFY A;  2KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...