2K0BX

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title Conformation and dynamics of the three-helix bundle UBA domain of p62 from experiment and simulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k0bX00
1MN3A 2LVNC 2EKFA 2HAKA 1ZV1A 1JR3E 2DHYA 2K9DA 3BBZA 1SG9A 1HQYE 1WGNA 2QSFX 1WGLA 1OKSA 2KHHA 2JY8A 1AIPC 3GLFE 1T43A 1YLAA 2BWBA 1G3IA 1V92A 2LVAA 2DAIA 1Y8GA 2L4FA 2ZTDA 5DFLA 2DNAA 2LVPC 4G3OA 3LCVB 2JP7A 2QNJA 4WP2A 3MMPA 1G4AE 4R71A 3B89A 2EJSA 1PGYA 1E94E 2OOBA 2JZ0A 2ZTCA 3K9OA 1OTRA 2OOAA 2G3QA 2KNAA 1BVSA 2DAKA 1VEKA 1VQ1A 1IFYA 3K9PA 2KNVA 3T6PA 1WJ7A 2CP8A 2DKLA 3F92A 3FRHA 1NV9A 2KNZA 1T6OA 1WR1B 2K0BX 3FRIA 1GO5A 2MROB 4UN2B 2L2DA 1HT2E 3FE3A 2JY7A 1C7YA 2DZLA 1NV8A 1ZMUA 1VEGA 1DV0A 1OAIA 2JNHA 3IHPA 1KYIA 2O25A 1DO0A 2EKKA 1ZMWA 3E46A 2DI0A 2JZ1A 2L4EA 2DAGA 1VG5A 2B3TA 2DENA 1HT1E 1UFZA 2JY6B 2RRUA 2DAMA 3GLGE 5JI2E 4Q7JA 3LCUA 1WIVA 2MGWA 2DAEA 2JY5A 1A5TA 1IXSA 3H4JA 2JUJA 1Q02A 2OO9A 3GLHE 1VEJA 2MJ5B 4HEOA 1WHCA 2LVQD 1VDLA 1ZMVA 2CWBA 1EFUB 1QZEA 1TR8A 4F1IA 3GLIE 1R4GA 2MR9A 2LBCA 1G41A 1DO2A 2H5XA 2WZJA 4GEWA 1IM2A 1HJPA 3E21A 2HWJA 1TTEA 2BWEA 2LTUA 1CUKA 2R0IA 1OQYA 1XB2B 2QHOB 4F2LA 1XXHE 1F4IA 3IECA 1P3QQ 4DBGB 2LVOC
chains in the Genus database with same CATH superfamily
4FWHA 4LJ6A 3HHZA 3FTEA 4DV0M 2XZFA 4XBOA 2C98A 1E32A 2HAKA 3J7AS 1ZV1A 1JR3E 1Z5CA 2K9DA 3FYCA 2ZANA 4PT5A 1SG9A 2F5NA 4QHTA 1HQYE 4G4NA 4MGZE 3LQRA 1XXHB 1WGLA 4CHTB 3OTOM 3L26A 3K92A 2XFTA 4GC5A 4LRSA 1T43A 4FW9A 4M0WA 3SAVA 5EXPA 1G3IA 1V92A 1OFHA 1GKIA 2V1CA 1IN8A 4DV7M 3KP0E 3TQSA 4LF4M 4NRWA 5E26A 1GJTA 4G4RA 3AOGA 2G8LA 2BJWA 3R9XB 1XC8A 2R44A 3GLFB 2R4JA 4PCZA 4FCTA 3EIHA 4LJ8A 3B89A 4FCWA 1TH4A 4L6V6 1J5EM 3J80S 3K8ZA 4HLQA 1E94E 4BBAA 2JZ0A 1OTRA 1IN6A 4JI8M 2G3QA 2ZM6M 1IBMM 3GPYA 2DAKA 3V76A 4GKJM 3U6CA 2KA6B 1IFYA 3IG5A 1IBKM 1Z59A 4WURA 1WJ7A 4IBBA 4GIPA 2DHRA 1D0LA 3F92A 3KS8A 1NV9A 3SFZA 5BR8M 3A46A 4MGHA 3GQ4A 2KZUA 3KOYE 2K0BX 4M9XA 3I01M 4NC6A 1J09A 2C96A 3U60B 1MJGM 3VK8A 3HU1A 4X66M 1C7YA 2C99A 4I81A 1ZMUA 4B3TM 1OAOC 2A5YB 3SHFA 3L29A 4AQYM 1DV0A 1GL6A 3SBJA 1NY6A 5DNYA 2Z4RA 1KYIA 2O25A 1DO0A 4XGIA 2ZBKB 4DUYM 1QUSA 2R4EA 3RE8A 2L4EA 4B7GA 2DAGA 3KW6A 2QPAA 2W82A 3KOZE 1UFZA 3H4MA 4DUZM 2DAMA 2GQFA 5FTJA 2L09A 4LJ5A 2RKOA 3QYEA 4Q7JA 3U61A 1R2YA 2GNOA 4LJAA 3KXEC 2DAEA 3L27A 3QAUA 1IXSA 1EE8A 3H4JA 3VDPA 2JUJA 4JI3M 1Q02A 3GLIA 5FLXS 2Z3XA 4LF8M 1VEJA 1N78A 2MJ5B 3GLGB 1OIPA 4G4OA 2MH8A 4L16A 1KFVA 1GABA 3KSXA 3J2PB 3UGJA 2K47A 3U6LA 4KHPM 2XGNA 4M9SA 4F1IA 2D7GA 3GLIE 2J7NA 2XF3A 4KT0F 2WSCF 2F5PA 1Z6TA 4R3DA 3U6EA 1XXHA 2N35A 2WZJA 3GQ3A 2QZ4A 1IM2A 1HJPA 3B7QA 4IJFA 4LFAM 7CATA 1DGGA 1TTEA 4IBCA 3T38A 1IN5A 2C5RA 5JI3E 1OQYA 1XB2B 3U6QA 3C9PA 1QZMA 1XMQM 4LG2A 1XXHE 4IBIA 3UK6A 4DR4M 4AKHA 2FH0A 2LVOC 3SAUA 1PM5A 1ZAEA 4JV5M 2CV0A 2FOIC 1W5SA 2DZNB 3SYLA 2Q2EB 2LVNC 2EKFA 3GLFA 1PRBA 3J27B 2DHYA 5EP1A 3VDUA 3UMMA 3U5ZB 5DYIA 4AG5A 1WGNA 3J81S 1QVRA 1XNRM 1OJLA 4RF0A 1TDHA 3CF0A 2FFJA 2JY8A 1AIPC 3GLFE 5FTMA 2HKJA 4RKUF 2DAIA 4NRVA 3U61B 1Y8GA 1MX0A 2L4FA 3KSJA 5DFLA 4IBFA 4RNAA 5ITQA 1X37A 2UUCM 4JN6A 2F5SA 3U6MA 4NOOB 2L7IA 1GVNA 3FTCA 5E6JA 4WP2A 4RF1A 2QCUA 3GLIB 1L2CA 4DR7M 4DV4M 5BPVA 1NSFA 4R71A 4LY6A 2K6BA 4LJ7A 4OVZB 2UUAM 4DR1M 3ZC7B 3U60A 1E9SA 2ZTCA 3DOAA 1E9RA 2D7HA 3K9OA 3Q8XA 1NY5A 2OOAA 2XFSA 1IN7A 2LWXA 3T1HM 4AKGA 2KNAA 3HU3A 2Y20A 1VEKA 3MK6A 2Z7JA 3FD9A 2C9CA 4JI6M 2VF8A 3VLFB 3K9PA 2KNVA 3GRUA 2CP8A 2YFQA 1N77A 4GH9A 4M0DA 2R62A 3THGA 4DV6M 3RGPA 3WHKA 1PJJA 1QAMA 3E4RA 3FRIA 2O5RA 3K1JA 4DV1M 4M9ZA 2KDLA 4DR5M 1N36M 2XH9A 2MROB 3TE6A 2XLJA 4UN2B 1V33A 3DA1A 1L2BA 1L1TA 1SXJC 1YUBA 4L8RC 5EJCA 3M6AA 4GRIA 1IXRC 2QP9X 1HR0M 3DZDA 2R46A 3W0LB 3R8FA 3IHPA 5IZ7D 3GPUA 4LFBM 1QAOA 2OQ4A 3BXWA 4II7A 2FS1A 3GLGA 4LF5M 2P5TA 1ZMWA 4LCBA 5EXSA 2APLA 3EIEA 3E46A 1IBLM 4FCVA 1I4WA 4JI1M 4YY3M 4G4QA 1G59A 1QANA 1N34M 3U6PA 2RRUA 1D0KA 3W68A 3GLGE 1YE9A 5EP3A 2H1RA 5JI2E 3KS4A 2DZOB 1WIVA 3LCUA 4PD2A 3HKPA 1NHWC 4AKIA 3FUVA 4I8OA 4HL4A 4EIWA 2HHHM 4FVMA 2BJVA 3SHGB 5ITRA 2O01F 1ORYB 4NSRA 2WSEF 5LMUM 1PJSA 2DXIA 2OO9A 1W5TA 2DWMA 2YNMD 3I51A 2ZAMA 4I4LA 3ZCBB 3UZUA 4DR6M 1HQCA 4QNMA 5ITXA 3TWKA 1QZEA 5KQ8A 2NQ8C 5C1BA 3KDSE 5EXXA 2Y21A 4DR3M 2J5YA 4GKKM 3C3EA 4ITQA 1R4GA 3U5ZA 4MM3B 3E9SA 3GLHB 5ITXE 3AV0A 5LMNM 1G41A 5FTNA 4GEWA 2G5GX 3JAMS 1TDZA 2CEAA 3SYKA 4QHSA 8CATA 1K82A 4JI2M 4D82A 1NJFA 4LGYA 1CUKA 3HHYA 2L6OA 2CUZA 2CRUA 2QHOB 5ITTA 2KZSA 4F2LA 1XNQM 1Z5BA 3IECA 4DBGB 1L1ZA 4MGYE 1MN3A 2E5LM 3W67A 2VQEM 4R7GA 2I7NA 1LTMA 4OVZA 1YSYA 2QSFX 4L15A 5ITUA 3GP1A 3FTFA 1R5LA 3SATA 1HNWM 2OPFA 4JI0M 2DWLA 4B08A 2LH0A 3SAWA 1YLAA 2BWBA 3L28A 2LVAA 3L2AA 2EUCA 4DV2M 3D8BA 2DNAA 5KPRA 2LHGA 3NWLA 3L25A 4S12A 2CFOA 2KRUA 2WSFF 1NHGC 2LVPC 2X49A 1IY0A 4LJ4A 1K3WA 3LVWA 4KLNA 2JP7A 5EP2A 2LHCA 2VDBB 3TL4X 5EQTA 2CV1A 1Q3CA 3HWSA 1TGUA 3SARA 2RGOA 1R7RA 3HU2A 3WHLA 4BB9A 1SXJD 3I4VA 3AOEA 1TH2A 4B3RM 3KOWE 3B7NA 3HHXA 2R45A 2OOBA 3KVWA 2QQ8A 1OFIA 1Q3BA 2DWNA 3C3DA 3HGIA 2HL7A 3KOXE 4ZPXA 2X4AA 1MU5A 1BVSA 1TH3A 4CIZA 2DVWB 4OU7A 4ANRA 1DGFA 4GHAA 1IN4A 3LW5F 5IT9S 1VQ1A 4P17A 1L8QA 5DYGA 1N75A 4LZJA 1IXZA 2Y0TA 3K2LA 3MJ5A 3M0EA 2DWZB 5IREB 3FRHA 1JB0F 4GC9A 1J7KA 3VK7A 1G8PA 3NBXX 4IBDA 5FTKA 2V1UA 5GKNA 3U6OA 2VF7A 2CHGA 4L78A 2CHQA 2L7HA 3I4YA 1HT2E 4QOSA 3B9PA 4NL4H 1VEGA 5H37D 1OAIA 2JNHA 2AHMA 3HY5A 3QWLA 2UU9M 2XEPA 4FWDA 2JXNA 3TWLA 3B74A 3M7GA 2Z8YM 4L4UA 4CISA 2JZ1A 2B3TA 2DENA 4DV5M 1T3TA 2J7OA 2Z4SA 4CJ6A 1IY1A 3GLHA 2M5ZA 3I04M 3J7BA 5A2QS 2MGWA 3GO8A 4B3MM 1N32M 2CE7A 4AW4A 4MB7A 2EA0A 4DR2M 2JY5A 2R18A 1A5TA 1FNNA 3AJIB 3HZJA 2EO2A 3HJ8A 4PDIA 3U6SA 3RGSA 3UJNA 4X64M 3GLHE 1PJQA 1L2DA 4K0KM 3W0FA 2LVQD 1GLNA 3D8LA 3C58A 2XSZD 3HX3A 2CWBA 3SMPA 1DGHB 3IG8A 3FUUA 1Z5AA 1EIJA 4A3VB 4Z8XA 1DGBA 3CF6E 4P16A 1G71A 4XK8F 3TPZA 3SASA 1DO2A 2BNKA 2H5XA 4CGYB 4QNRA 5C18A 2HWJA 2R6FA 3BOSA 2QBYB 4NXMM 2BWEA 1NNJA 4FD2A 3AKZA 3GPXA 5KPTA 1IQPA 3GRRA 4MGKE 4MH0E 3PXGA 4LF6M 3LVVA 1R6BX 4KO8A 4REZA 4LGMA 5KQDA 4W5WA 4IBJA 2YR0A 1SXJB 2F5QA 1VDDA 1N33M 4LF9M 4D81A 5KO3A 2LXEA 3BBZA 3HJSA 3KFUG 1UM8A 1K3XA 2ERCA 4LJ9A 3LQQA 5FSWA 2F4VM 4IBGA 5ITYA 1OKSA 1Q39A 2XSZA 3CF2A 2KHHA 1IY2A 4IJEA 3ZQJA 2RGHA 1QYRA 3GRVA 1AUAA 3HHWA 1V34A 2M60A 3A98B 3FYDA 4X65M 1QDRA 2ZTDA 4GITA 1FJGM 3CTWB 4IBEA 1TF0B 3U6DA 4IBKA 5EXTA 1ZQ9A 2D7EA 2KXEA 2V6ZM 3A42A 1R2ZA 4JXJA 4NSOB 4G3OA 3LCVB 3FUXA 3ILKA 2QNJA 2YQZA 3PFIA 3PVSA 2VIIA 2UXDM 3MMPA 3VFDA 3AFHA 1NVMA 1G4AE 2ZAOA 2LNHC 4LRTA 2EJSA 4MGIE 3LMMA 2X8AA 1PGYA 4OW0A 1HNXM 3AL0C 1LV7A 5KPZA 1QUTA 1S3SA 4D80A 3ZH9B 3VKGA 1OIZA 1C1KA 4QOZC 4AG6A 2FE8A 4Y28F 3DFZA 1GJSA 1NNUC 4KODA 3T6PA 3Q8GA 2DKLA 4JYAM 1XHBA 2HCBA 2KNZA 3PNYA 4WW0A 1T6OA 1WR1B 3JR5A 4LZZA 4AZFA 2KRKA 3FKEA 3HJQA 5L8RF 1GO5A 4FWGA 4YHHM 4AI6A 2L2DA 5F3WA 2CV2A 2F5OA 3FE3A 2JY7A 4NXNM 2DZLA 3QYBA 1NV8A 5FTLA 3GRYA 2JWSA 1QAQA 2CHVA 4TUWA 1H6UA 4DV3M 3KP1E 3TWMA 2EKKA 1HNZM 4BLCA 2UXBM 1GL7A 1QQWA 2DI0A 4JI7M 1DGHA 2Y0QA 1VG5A 1PJTA 3RFWA 2UXCM 3T1YM 1HT1E 2I7PA 2JY6B 3SMSA 5EP4A 1JR3D 2QENA 3FTDA 1WXQA 4B7FA 1RU3A 2R65A 2KW0A 4X62M 1D2NA 1QDTA 3GQ5A 2QBYA 1KSFX 4B3SM 4LF7M 3PNVA 3B7ZA 3NBIA 2KEBA 1NJGA 4I5SA 1PJIA 2UUBM 5IWAM 4HEOA 4PDGA 1WHCA 1VDLA 1ZMVA 2JA2A 1EFUB 2FNAA 1SXJA 1TR8A 2XZUA 3CGWA 4B7HA 3GPPA 2MR9A 4LFCM 4GMQA 2LBCA 1JQJC 3JR4A 4IIWA 1I94M 3SC3A 1D0MA 1SXJE 3E21A 1IXSB 1XMOM 4GHLA 3FUWA 3A45A 2LTUA 2R0IA 4G6ZA 3AOEC 2C9OA 4OX9M 4JI5M 1JR3A 1NO1A 2VQFM 4Z6YA 3T15A 3MHVC 3FUTA 3VKHA 1F4IA 1P3QQ 4JI4M 1XWIA
chains in the Genus database with same CATH topology
1MN3A 2LVNC 2EKFA 2HAKA 1ZV1A 1JR3E 2DHYA 2K9DA 3BBZA 1SG9A 1HQYE 1WGNA 2QSFX 1WGLA 1OKSA 2KHHA 2JY8A 1AIPC 3GLFE 1T43A 1YLAA 2BWBA 1G3IA 1V92A 2LVAA 2DAIA 1Y8GA 2L4FA 2ZTDA 5DFLA 2DNAA 2LVPC 4G3OA 3LCVB 2JP7A 2QNJA 4WP2A 3MMPA 1G4AE 4R71A 3B89A 2EJSA 1PGYA 1E94E 2OOBA 2JZ0A 2ZTCA 3K9OA 1OTRA 2OOAA 2G3QA 2KNAA 1BVSA 2DAKA 1VEKA 1VQ1A 1IFYA 3K9PA 2KNVA 3T6PA 1WJ7A 2CP8A 2DKLA 3F92A 3FRHA 1NV9A 2KNZA 1T6OA 1WR1B 2K0BX 3FRIA 1GO5A 2MROB 4UN2B 2L2DA 1HT2E 3FE3A 2JY7A 1C7YA 2DZLA 1NV8A 1ZMUA 1VEGA 1DV0A 1OAIA 2JNHA 3IHPA 1KYIA 2O25A 1DO0A 2EKKA 1ZMWA 3E46A 2DI0A 2JZ1A 2L4EA 2DAGA 1VG5A 2B3TA 2DENA 1HT1E 1UFZA 2JY6B 2RRUA 2DAMA 3GLGE 5JI2E 4Q7JA 3LCUA 1WIVA 2MGWA 2DAEA 2JY5A 1A5TA 1IXSA 3H4JA 2JUJA 1Q02A 2OO9A 3GLHE 1VEJA 2MJ5B 4HEOA 1WHCA 2LVQD 1VDLA 1ZMVA 2CWBA 1EFUB 1QZEA 1TR8A 4F1IA 3GLIE 1R4GA 2MR9A 2LBCA 1G41A 1DO2A 2H5XA 2WZJA 4GEWA 1IM2A 1HJPA 3E21A 2HWJA 1TTEA 2BWEA 2LTUA 1CUKA 2R0IA 1OQYA 1XB2B 2QHOB 4F2LA 1XXHE 1F4IA 3IECA 1P3QQ 4DBGB 2LVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MN3 A;  2LVN C;  2EKF A;  2HAK A;  1ZV1 A;  1JR3 E;  2DHY A;  2K9D A;  3BBZ A;  1SG9 A;  1HQY E;  1WGN A;  2QSF X;  1WGL A;  1OKS A;  2KHH A;  2JY8 A;  1AIP C;  3GLF E;  1T43 A;  1YLA A;  2BWB A;  1G3I A;  1V92 A;  2LVA A;  2DAI A;  1Y8G A;  2L4F A;  2ZTD A;  5DFL A;  2DNA A;  2LVP C;  4G3O A;  3LCV B;  2JP7 A;  2QNJ A;  4WP2 A;  3MMP A;  1G4A E;  4R71 A;  3B89 A;  2EJS A;  1PGY A;  1E94 E;  2OOB A;  2JZ0 A;  2ZTC A;  3K9O A;  1OTR A;  2OOA A;  2G3Q A;  2KNA A;  1BVS A;  2DAK A;  1VEK A;  1VQ1 A;  1IFY A;  3K9P A;  2KNV A;  3T6P A;  1WJ7 A;  2CP8 A;  2DKL A;  3F92 A;  3FRH A;  1NV9 A;  2KNZ A;  1T6O A;  1WR1 B;  2K0B X;  3FRI A;  1GO5 A;  2MRO B;  4UN2 B;  2L2D A;  1HT2 E;  3FE3 A;  2JY7 A;  1C7Y A;  2DZL A;  1NV8 A;  1ZMU A;  1VEG A;  1DV0 A;  1OAI A;  2JNH A;  3IHP A;  1KYI A;  2O25 A;  1DO0 A;  2EKK A;  1ZMW A;  3E46 A;  2DI0 A;  2JZ1 A;  2L4E A;  2DAG A;  1VG5 A;  2B3T A;  2DEN A;  1HT1 E;  1UFZ A;  2JY6 B;  2RRU A;  2DAM A;  3GLG E;  5JI2 E;  4Q7J A;  3LCU A;  1WIV A;  2MGW A;  2DAE A;  2JY5 A;  1A5T A;  1IXS A;  3H4J A;  2JUJ A;  1Q02 A;  2OO9 A;  3GLH E;  1VEJ A;  2MJ5 B;  4HEO A;  1WHC A;  2LVQ D;  1VDL A;  1ZMV A;  2CWB A;  1EFU B;  1QZE A;  1TR8 A;  4F1I A;  3GLI E;  1R4G A;  2MR9 A;  2LBC A;  1G41 A;  1DO2 A;  2H5X A;  2WZJ A;  4GEW A;  1IM2 A;  1HJP A;  3E21 A;  2HWJ A;  1TTE A;  2BWE A;  2LTU A;  1CUK A;  2R0I A;  1OQY A;  1XB2 B;  2QHO B;  4F2L A;  1XXH E;  1F4I A;  3IEC A;  1P3Q Q;  4DBG B;  2LVO C; 
#chains in the Genus database with same CATH topology
 4FWH A;  4LJ6 A;  3HHZ A;  3FTE A;  4DV0 M;  2XZF A;  4XBO A;  2C98 A;  1E32 A;  2HAK A;  3J7A S;  1ZV1 A;  1JR3 E;  1Z5C A;  2K9D A;  3FYC A;  2ZAN A;  4PT5 A;  1SG9 A;  2F5N A;  4QHT A;  1HQY E;  4G4N A;  4MGZ E;  3LQR A;  1XXH B;  1WGL A;  4CHT B;  3OTO M;  3L26 A;  3K92 A;  2XFT A;  4GC5 A;  4LRS A;  1T43 A;  4FW9 A;  4M0W A;  3SAV A;  5EXP A;  1G3I A;  1V92 A;  1OFH A;  1GKI A;  2V1C A;  1IN8 A;  4DV7 M;  3KP0 E;  3TQS A;  4LF4 M;  4NRW A;  5E26 A;  1GJT A;  4G4R A;  3AOG A;  2G8L A;  2BJW A;  3R9X B;  1XC8 A;  2R44 A;  3GLF B;  2R4J A;  4PCZ A;  4FCT A;  3EIH A;  4LJ8 A;  3B89 A;  4FCW A;  1TH4 A;  4L6V 6;  1J5E M;  3J80 S;  3K8Z A;  4HLQ A;  1E94 E;  4BBA A;  2JZ0 A;  1OTR A;  1IN6 A;  4JI8 M;  2G3Q A;  2ZM6 M;  1IBM M;  3GPY A;  2DAK A;  3V76 A;  4GKJ M;  3U6C A;  2KA6 B;  1IFY A;  3IG5 A;  1IBK M;  1Z59 A;  4WUR A;  1WJ7 A;  4IBB A;  4GIP A;  2DHR A;  1D0L A;  3F92 A;  3KS8 A;  1NV9 A;  3SFZ A;  5BR8 M;  3A46 A;  4MGH A;  3GQ4 A;  2KZU A;  3KOY E;  2K0B X;  4M9X A;  3I01 M;  4NC6 A;  1J09 A;  2C96 A;  3U60 B;  1MJG M;  3VK8 A;  3HU1 A;  4X66 M;  1C7Y A;  2C99 A;  4I81 A;  1ZMU A;  4B3T M;  1OAO C;  2A5Y B;  3SHF A;  3L29 A;  4AQY M;  1DV0 A;  1GL6 A;  3SBJ A;  1NY6 A;  5DNY A;  2Z4R A;  1KYI A;  2O25 A;  1DO0 A;  4XGI A;  2ZBK B;  4DUY M;  1QUS A;  2R4E A;  3RE8 A;  2L4E A;  4B7G A;  2DAG A;  3KW6 A;  2QPA A;  2W82 A;  3KOZ E;  1UFZ A;  3H4M A;  4DUZ M;  2DAM A;  2GQF A;  5FTJ A;  2L09 A;  4LJ5 A;  2RKO A;  3QYE A;  4Q7J A;  3U61 A;  1R2Y A;  2GNO A;  4LJA A;  3KXE C;  2DAE A;  3L27 A;  3QAU A;  1IXS A;  1EE8 A;  3H4J A;  3VDP A;  2JUJ A;  4JI3 M;  1Q02 A;  3GLI A;  5FLX S;  2Z3X A;  4LF8 M;  1VEJ A;  1N78 A;  2MJ5 B;  3GLG B;  1OIP A;  4G4O A;  2MH8 A;  4L16 A;  1KFV A;  1GAB A;  3KSX A;  3J2P B;  3UGJ A;  2K47 A;  3U6L A;  4KHP M;  2XGN A;  4M9S A;  4F1I A;  2D7G A;  3GLI E;  2J7N A;  2XF3 A;  4KT0 F;  2WSC F;  2F5P A;  1Z6T A;  4R3D A;  3U6E A;  1XXH A;  2N35 A;  2WZJ A;  3GQ3 A;  2QZ4 A;  1IM2 A;  1HJP A;  3B7Q A;  4IJF A;  4LFA M;  7CAT A;  1DGG A;  1TTE A;  4IBC A;  3T38 A;  1IN5 A;  2C5R A;  5JI3 E;  1OQY A;  1XB2 B;  3U6Q A;  3C9P A;  1QZM A;  1XMQ M;  4LG2 A;  1XXH E;  4IBI A;  3UK6 A;  4DR4 M;  4AKH A;  2FH0 A;  2LVO C;  3SAU A;  1PM5 A;  1ZAE A;  4JV5 M;  2CV0 A;  2FOI C;  1W5S A;  2DZN B;  3SYL A;  2Q2E B;  2LVN C;  2EKF A;  3GLF A;  1PRB A;  3J27 B;  2DHY A;  5EP1 A;  3VDU A;  3UMM A;  3U5Z B;  5DYI A;  4AG5 A;  1WGN A;  3J81 S;  1QVR A;  1XNR M;  1OJL A;  4RF0 A;  1TDH A;  3CF0 A;  2FFJ A;  2JY8 A;  1AIP C;  3GLF E;  5FTM A;  2HKJ A;  4RKU F;  2DAI A;  4NRV A;  3U61 B;  1Y8G A;  1MX0 A;  2L4F A;  3KSJ A;  5DFL A;  4IBF A;  4RNA A;  5ITQ A;  1X37 A;  2UUC M;  4JN6 A;  2F5S A;  3U6M A;  4NOO B;  2L7I A;  1GVN A;  3FTC A;  5E6J A;  4WP2 A;  4RF1 A;  2QCU A;  3GLI B;  1L2C A;  4DR7 M;  4DV4 M;  5BPV A;  1NSF A;  4R71 A;  4LY6 A;  2K6B A;  4LJ7 A;  4OVZ B;  2UUA M;  4DR1 M;  3ZC7 B;  3U60 A;  1E9S A;  2ZTC A;  3DOA A;  1E9R A;  2D7H A;  3K9O A;  3Q8X A;  1NY5 A;  2OOA A;  2XFS A;  1IN7 A;  2LWX A;  3T1H M;  4AKG A;  2KNA A;  3HU3 A;  2Y20 A;  1VEK A;  3MK6 A;  2Z7J A;  3FD9 A;  2C9C A;  4JI6 M;  2VF8 A;  3VLF B;  3K9P A;  2KNV A;  3GRU A;  2CP8 A;  2YFQ A;  1N77 A;  4GH9 A;  4M0D A;  2R62 A;  3THG A;  4DV6 M;  3RGP A;  3WHK A;  1PJJ A;  1QAM A;  3E4R A;  3FRI A;  2O5R A;  3K1J A;  4DV1 M;  4M9Z A;  2KDL A;  4DR5 M;  1N36 M;  2XH9 A;  2MRO B;  3TE6 A;  2XLJ A;  4UN2 B;  1V33 A;  3DA1 A;  1L2B A;  1L1T A;  1SXJ C;  1YUB A;  4L8R C;  5EJC A;  3M6A A;  4GRI A;  1IXR C;  2QP9 X;  1HR0 M;  3DZD A;  2R46 A;  3W0L B;  3R8F A;  3IHP A;  5IZ7 D;  3GPU A;  4LFB M;  1QAO A;  2OQ4 A;  3BXW A;  4II7 A;  2FS1 A;  3GLG A;  4LF5 M;  2P5T A;  1ZMW A;  4LCB A;  5EXS A;  2APL A;  3EIE A;  3E46 A;  1IBL M;  4FCV A;  1I4W A;  4JI1 M;  4YY3 M;  4G4Q A;  1G59 A;  1QAN A;  1N34 M;  3U6P A;  2RRU A;  1D0K A;  3W68 A;  3GLG E;  1YE9 A;  5EP3 A;  2H1R A;  5JI2 E;  3KS4 A;  2DZO B;  1WIV A;  3LCU A;  4PD2 A;  3HKP A;  1NHW C;  4AKI A;  3FUV A;  4I8O A;  4HL4 A;  4EIW A;  2HHH M;  4FVM A;  2BJV A;  3SHG B;  5ITR A;  2O01 F;  1ORY B;  4NSR A;  2WSE F;  5LMU M;  1PJS A;  2DXI A;  2OO9 A;  1W5T A;  2DWM A;  2YNM D;  3I51 A;  2ZAM A;  4I4L A;  3ZCB B;  3UZU A;  4DR6 M;  1HQC A;  4QNM A;  5ITX A;  3TWK A;  1QZE A;  5KQ8 A;  2NQ8 C;  5C1B A;  3KDS E;  5EXX A;  2Y21 A;  4DR3 M;  2J5Y A;  4GKK M;  3C3E A;  4ITQ A;  1R4G A;  3U5Z A;  4MM3 B;  3E9S A;  3GLH B;  5ITX E;  3AV0 A;  5LMN M;  1G41 A;  5FTN A;  4GEW A;  2G5G X;  3JAM S;  1TDZ A;  2CEA A;  3SYK A;  4QHS A;  8CAT A;  1K82 A;  4JI2 M;  4D82 A;  1NJF A;  4LGY A;  1CUK A;  3HHY A;  2L6O A;  2CUZ A;  2CRU A;  2QHO B;  5ITT A;  2KZS A;  4F2L A;  1XNQ M;  1Z5B A;  3IEC A;  4DBG B;  1L1Z A;  4MGY E;  1MN3 A;  2E5L M;  3W67 A;  2VQE M;  4R7G A;  2I7N A;  1LTM A;  4OVZ A;  1YSY A;  2QSF X;  4L15 A;  5ITU A;  3GP1 A;  3FTF A;  1R5L A;  3SAT A;  1HNW M;  2OPF A;  4JI0 M;  2DWL A;  4B08 A;  2LH0 A;  3SAW A;  1YLA A;  2BWB A;  3L28 A;  2LVA A;  3L2A A;  2EUC A;  4DV2 M;  3D8B A;  2DNA A;  5KPR A;  2LHG A;  3NWL A;  3L25 A;  4S12 A;  2CFO A;  2KRU A;  2WSF F;  1NHG C;  2LVP C;  2X49 A;  1IY0 A;  4LJ4 A;  1K3W A;  3LVW A;  4KLN A;  2JP7 A;  5EP2 A;  2LHC A;  2VDB B;  3TL4 X;  5EQT A;  2CV1 A;  1Q3C A;  3HWS A;  1TGU A;  3SAR A;  2RGO A;  1R7R A;  3HU2 A;  3WHL A;  4BB9 A;  1SXJ D;  3I4V A;  3AOE A;  1TH2 A;  4B3R M;  3KOW E;  3B7N A;  3HHX A;  2R45 A;  2OOB A;  3KVW A;  2QQ8 A;  1OFI A;  1Q3B A;  2DWN A;  3C3D A;  3HGI A;  2HL7 A;  3KOX E;  4ZPX A;  2X4A A;  1MU5 A;  1BVS A;  1TH3 A;  4CIZ A;  2DVW B;  4OU7 A;  4ANR A;  1DGF A;  4GHA A;  1IN4 A;  3LW5 F;  5IT9 S;  1VQ1 A;  4P17 A;  1L8Q A;  5DYG A;  1N75 A;  4LZJ A;  1IXZ A;  2Y0T A;  3K2L A;  3MJ5 A;  3M0E A;  2DWZ B;  5IRE B;  3FRH A;  1JB0 F;  4GC9 A;  1J7K A;  3VK7 A;  1G8P A;  3NBX X;  4IBD A;  5FTK A;  2V1U A;  5GKN A;  3U6O A;  2VF7 A;  2CHG A;  4L78 A;  2CHQ A;  2L7H A;  3I4Y A;  1HT2 E;  4QOS A;  3B9P A;  4NL4 H;  1VEG A;  5H37 D;  1OAI A;  2JNH A;  2AHM A;  3HY5 A;  3QWL A;  2UU9 M;  2XEP A;  4FWD A;  2JXN A;  3TWL A;  3B74 A;  3M7G A;  2Z8Y M;  4L4U A;  4CIS A;  2JZ1 A;  2B3T A;  2DEN A;  4DV5 M;  1T3T A;  2J7O A;  2Z4S A;  4CJ6 A;  1IY1 A;  3GLH A;  2M5Z A;  3I04 M;  3J7B A;  5A2Q S;  2MGW A;  3GO8 A;  4B3M M;  1N32 M;  2CE7 A;  4AW4 A;  4MB7 A;  2EA0 A;  4DR2 M;  2JY5 A;  2R18 A;  1A5T A;  1FNN A;  3AJI B;  3HZJ A;  2EO2 A;  3HJ8 A;  4PDI A;  3U6S A;  3RGS A;  3UJN A;  4X64 M;  3GLH E;  1PJQ A;  1L2D A;  4K0K M;  3W0F A;  2LVQ D;  1GLN A;  3D8L A;  3C58 A;  2XSZ D;  3HX3 A;  2CWB A;  3SMP A;  1DGH B;  3IG8 A;  3FUU A;  1Z5A A;  1EIJ A;  4A3V B;  4Z8X A;  1DGB A;  3CF6 E;  4P16 A;  1G71 A;  4XK8 F;  3TPZ A;  3SAS A;  1DO2 A;  2BNK A;  2H5X A;  4CGY B;  4QNR A;  5C18 A;  2HWJ A;  2R6F A;  3BOS A;  2QBY B;  4NXM M;  2BWE A;  1NNJ A;  4FD2 A;  3AKZ A;  3GPX A;  5KPT A;  1IQP A;  3GRR A;  4MGK E;  4MH0 E;  3PXG A;  4LF6 M;  3LVV A;  1R6B X;  4KO8 A;  4REZ A;  4LGM A;  5KQD A;  4W5W A;  4IBJ A;  2YR0 A;  1SXJ B;  2F5Q A;  1VDD A;  1N33 M;  4LF9 M;  4D81 A;  5KO3 A;  2LXE A;  3BBZ A;  3HJS A;  3KFU G;  1UM8 A;  1K3X A;  2ERC A;  4LJ9 A;  3LQQ A;  5FSW A;  2F4V M;  4IBG A;  5ITY A;  1OKS A;  1Q39 A;  2XSZ A;  3CF2 A;  2KHH A;  1IY2 A;  4IJE A;  3ZQJ A;  2RGH A;  1QYR A;  3GRV A;  1AUA A;  3HHW A;  1V34 A;  2M60 A;  3A98 B;  3FYD A;  4X65 M;  1QDR A;  2ZTD A;  4GIT A;  1FJG M;  3CTW B;  4IBE A;  1TF0 B;  3U6D A;  4IBK A;  5EXT A;  1ZQ9 A;  2D7E A;  2KXE A;  2V6Z M;  3A42 A;  1R2Z A;  4JXJ A;  4NSO B;  4G3O A;  3LCV B;  3FUX A;  3ILK A;  2QNJ A;  2YQZ A;  3PFI A;  3PVS A;  2VII A;  2UXD M;  3MMP A;  3VFD A;  3AFH A;  1NVM A;  1G4A E;  2ZAO A;  2LNH C;  4LRT A;  2EJS A;  4MGI E;  3LMM A;  2X8A A;  1PGY A;  4OW0 A;  1HNX M;  3AL0 C;  1LV7 A;  5KPZ A;  1QUT A;  1S3S A;  4D80 A;  3ZH9 B;  3VKG A;  1OIZ A;  1C1K A;  4QOZ C;  4AG6 A;  2FE8 A;  4Y28 F;  3DFZ A;  1GJS A;  1NNU C;  4KOD A;  3T6P A;  3Q8G A;  2DKL A;  4JYA M;  1XHB A;  2HCB A;  2KNZ A;  3PNY A;  4WW0 A;  1T6O A;  1WR1 B;  3JR5 A;  4LZZ A;  4AZF A;  2KRK A;  3FKE A;  3HJQ A;  5L8R F;  1GO5 A;  4FWG A;  4YHH M;  4AI6 A;  2L2D A;  5F3W A;  2CV2 A;  2F5O A;  3FE3 A;  2JY7 A;  4NXN M;  2DZL A;  3QYB A;  1NV8 A;  5FTL A;  3GRY A;  2JWS A;  1QAQ A;  2CHV A;  4TUW A;  1H6U A;  4DV3 M;  3KP1 E;  3TWM A;  2EKK A;  1HNZ M;  4BLC A;  2UXB M;  1GL7 A;  1QQW A;  2DI0 A;  4JI7 M;  1DGH A;  2Y0Q A;  1VG5 A;  1PJT A;  3RFW A;  2UXC M;  3T1Y M;  1HT1 E;  2I7P A;  2JY6 B;  3SMS A;  5EP4 A;  1JR3 D;  2QEN A;  3FTD A;  1WXQ A;  4B7F A;  1RU3 A;  2R65 A;  2KW0 A;  4X62 M;  1D2N A;  1QDT A;  3GQ5 A;  2QBY A;  1KSF X;  4B3S M;  4LF7 M;  3PNV A;  3B7Z A;  3NBI A;  2KEB A;  1NJG A;  4I5S A;  1PJI A;  2UUB M;  5IWA M;  4HEO A;  4PDG A;  1WHC A;  1VDL A;  1ZMV A;  2JA2 A;  1EFU B;  2FNA A;  1SXJ A;  1TR8 A;  2XZU A;  3CGW A;  4B7H A;  3GPP A;  2MR9 A;  4LFC M;  4GMQ A;  2LBC A;  1JQJ C;  3JR4 A;  4IIW A;  1I94 M;  3SC3 A;  1D0M A;  1SXJ E;  3E21 A;  1IXS B;  1XMO M;  4GHL A;  3FUW A;  3A45 A;  2LTU A;  2R0I A;  4G6Z A;  3AOE C;  2C9O A;  4OX9 M;  4JI5 M;  1JR3 A;  1NO1 A;  2VQF M;  4Z6Y A;  3T15 A;  3MHV C;  3FUT A;  3VKH A;  1F4I A;  1P3Q Q;  4JI4 M;  1XWI A; 
#chains in the Genus database with same CATH homology
 1MN3 A;  2LVN C;  2EKF A;  2HAK A;  1ZV1 A;  1JR3 E;  2DHY A;  2K9D A;  3BBZ A;  1SG9 A;  1HQY E;  1WGN A;  2QSF X;  1WGL A;  1OKS A;  2KHH A;  2JY8 A;  1AIP C;  3GLF E;  1T43 A;  1YLA A;  2BWB A;  1G3I A;  1V92 A;  2LVA A;  2DAI A;  1Y8G A;  2L4F A;  2ZTD A;  5DFL A;  2DNA A;  2LVP C;  4G3O A;  3LCV B;  2JP7 A;  2QNJ A;  4WP2 A;  3MMP A;  1G4A E;  4R71 A;  3B89 A;  2EJS A;  1PGY A;  1E94 E;  2OOB A;  2JZ0 A;  2ZTC A;  3K9O A;  1OTR A;  2OOA A;  2G3Q A;  2KNA A;  1BVS A;  2DAK A;  1VEK A;  1VQ1 A;  1IFY A;  3K9P A;  2KNV A;  3T6P A;  1WJ7 A;  2CP8 A;  2DKL A;  3F92 A;  3FRH A;  1NV9 A;  2KNZ A;  1T6O A;  1WR1 B;  2K0B X;  3FRI A;  1GO5 A;  2MRO B;  4UN2 B;  2L2D A;  1HT2 E;  3FE3 A;  2JY7 A;  1C7Y A;  2DZL A;  1NV8 A;  1ZMU A;  1VEG A;  1DV0 A;  1OAI A;  2JNH A;  3IHP A;  1KYI A;  2O25 A;  1DO0 A;  2EKK A;  1ZMW A;  3E46 A;  2DI0 A;  2JZ1 A;  2L4E A;  2DAG A;  1VG5 A;  2B3T A;  2DEN A;  1HT1 E;  1UFZ A;  2JY6 B;  2RRU A;  2DAM A;  3GLG E;  5JI2 E;  4Q7J A;  3LCU A;  1WIV A;  2MGW A;  2DAE A;  2JY5 A;  1A5T A;  1IXS A;  3H4J A;  2JUJ A;  1Q02 A;  2OO9 A;  3GLH E;  1VEJ A;  2MJ5 B;  4HEO A;  1WHC A;  2LVQ D;  1VDL A;  1ZMV A;  2CWB A;  1EFU B;  1QZE A;  1TR8 A;  4F1I A;  3GLI E;  1R4G A;  2MR9 A;  2LBC A;  1G41 A;  1DO2 A;  2H5X A;  2WZJ A;  4GEW A;  1IM2 A;  1HJP A;  3E21 A;  2HWJ A;  1TTE A;  2BWE A;  2LTU A;  1CUK A;  2R0I A;  1OQY A;  1XB2 B;  2QHO B;  4F2L A;  1XXH E;  1F4I A;  3IEC A;  1P3Q Q;  4DBG B;  2LVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...