2K0BX

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformation and dynamics of the three-helix bundle UBA domain of p62 from experiment and simulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sequestosome-1
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k0bX00
1VEKA 2K9DA 3GLHE 1G3IA 1WHCA 2DAIA 2JP7A 1VEGA 1UFZA 4UN2B 2LVOC 1IFYA 1WGLA 1HT2E 3FE3A 1IM2A 1G4AE 1WR1B 3IECA 5JI2E 3MMPA 4F2LA 1SG9A 3FRHA 1KYIA 1XB2B 2L4EA 3GLIE 1P3QQ 1WIVA 2B3TA 3B89A 5DFLA 1GO5A 2MROB 3E46A 2JY7A 2OO9A 2EKFA 2KHHA 3LCUA 1DO0A 3K9OA 1TTEA 2HWJA 1IXSA 1G41A 2BWBA 1JR3E 2CWBA 2JUJA 1EFUB 2DAMA 2EJSA 2H5XA 1TR8A 1DV0A 1MN3A 2DZLA 2DNAA 2ZTDA 2R0IA 1VEJA 2QSFX 2QHOB 2DKLA 1ZMWA 4GEWA 3FRIA 3H4JA 3T6PA 1OQYA 2OOAA 1DO2A 1ZMUA 2LTUA 2DHYA 1OKSA 1R4GA 2LVPC 2DAKA 2JZ1A 4G3OA 2G3QA 1HQYE 2DAEA 2CP8A 3F92A 2JY6B 3GLFE 1HT1E 1WJ7A 2QNJA 3E21A 2DAGA 1A5TA 1Q02A 2K0BX 1BVSA 2BWEA 1T6OA 1CUKA 1VDLA 1NV8A 2JY5A 3K9PA 2MGWA 1YLAA 1NV9A 2L2DA 1F4IA 1OAIA 1XXHE 2L4FA 4WP2A 1VG5A 3IHPA 2MJ5B 1ZMVA 2LVNC 2O25A 1HJPA 1C7YA 1VQ1A 2ZTCA 4DBGB 1V92A 1ZV1A 2JNHA 2EKKA 2OOBA 4HEOA 3LCVB 4R71A 2LVQD 1OTRA 1AIPC 2HAKA 2KNAA 2RRUA 3BBZA 1WGNA 1T43A 4Q7JA 2WZJA 2LVAA 3GLGE 2MR9A 1E94E 1PGYA 2JY8A 2JZ0A 2DI0A 2KNVA 1QZEA 1Y8GA 4F1IA 2DENA 2LBCA 2KNZA
chains in the Genus database with same CATH superfamily
2VIIA 3NBXX 2P5TA 4YY3M 1KSFX 1DGGA 5LMNM 3BOSA 1FNNA 2K9DA 4WURA 1WHCA 2DAIA 2HKJA 4JV5M 4NSOB 1QUTA 5E6JA 2Y20A 2FOIC 4IBIA 1IN7A 2UXDM 1WGLA 1HT2E 2R62A 2M5ZA 3U61A 1GL7A 3IG5A 3SBJA 4QNMA 3LVVA 4TUWA 3IECA 1NY5A 3LQQA 4Y28F 2XLJA 3FTCA 1QAOA 4LJ4A 1SG9A 2QZ4A 3L29A 4LRSA 1QZMA 4FCTA 4M0DA 2UXCM 1SXJC 1YE9A 1P3QQ 2DWZB 1D0MA 3SMSA 3CF0A 1H6UA 2B3TA 4AG5A 3OTOM 1L1ZA 2A5YB 1GO5A 3BXWA 5KPZA 2G8LA 3C58A 4M9SA 4JI4M 4DR7M 1Q3BA 1G71A 2KHHA 3LCUA 3HWSA 1DO0A 3K9OA 5FSWA 1GL6A 5ITXE 3JR5A 2DWMA 2XEPA 3PXGA 1JR3A 4HL4A 5JI3E 3FTDA 2X49A 1IXSA 3NBIA 3ZH9B 4CIZA 3L26A 2JUJA 2KXEA 4P17A 3MK6A 3L27A 4IBFA 4LG2A 1J7KA 2APLA 1MN3A 3T1HM 4M9ZA 4B3SM 4DV1M 1IN8A 1D2NA 2V1CA 3A45A 1AUAA 2CUZA 2QPAA 3QYEA 2ZM6M 1Q39A 4DV0M 2V6ZM 3HZJA 2DKLA 1JR3D 3GLGA 3HY5A 2OQ4A 4NL4H 2HCBA 1L8QA 5EP2A 3T6PA 1OQYA 2OOAA 1KFVA 1QQWA 3TQSA 1ZMUA 5BPVA 1N75A 5BR8M 2UUCM 5IREB 1R4GA 2LVPC 2Y0TA 3V76A 3NWLA 1HQCA 4G3OA 4S12A 1HQYE 2YFQA 2I7PA 3VLFB 1DGHA 2K6BA 3KOXE 2XH9A 1W5SA 3HHWA 1K82A 3U6QA 2QNJA 3VK8A 3TE6A 3PNVA 1Q3CA 1SXJD 2QP9X 5KO3A 4G4RA 1Z59A 1T6OA 2LH0A 1CUKA 1GABA 4MH0E 1IQPA 4JI6M 2MGWA 1YLAA 4I81A 1PJTA 1IY2A 2L2DA 3B9PA 1L1TA 4LGYA 1SXJE 4LZZA 3LVWA 1QDRA 3J81S 1K3XA 1QUSA 2L4FA 2WSEF 3HU2A 2C96A 4L78A 4WP2A 5FLXS 4DV5M 2MJ5B 2M60A 3AV0A 1QVRA 1ZMVA 4LF4M 2O25A 1HJPA 2KDLA 1V92A 3GPPA 2CE7A 3QAUA 3TWLA 2R65A 4X65M 2Y21A 1GVNA 4JI2M 1XNRM 1QANA 3BBZA 2BJWA 4LF6M 1YSYA 3DA1A 2L7HA 3B7ZA 2QENA 4Q7JA 3Q8GA 2WZJA 4KHPM 2KZUA 2J7OA 4DR2M 3KSXA 2GNOA 3GLGE 3U61B 2CV2A 4JI1M 5EXXA 4AI6A 1PGYA 3VKHA 4B7FA 2Z3XA 3SYKA 2W82A 2F5OA 2JZ0A 3GO8A 1I4WA 4A3VB 4AKHA 2DENA 4L16A 1QYRA 2BJVA 2KNZA 3L25A 2RGOA 3EIHA 3R9XB 1Z6TA 4GC9A 4AKIA 1PJQA 4GMQA 4NXMM 1VEGA 4RNAA 4UN2B 4LF8M 1R7RA 1IM2A 3W0LB 1IN6A 3KS8A 4RF1A 4LRTA 1Z5AA 3HJSA 2R44A 2ZAMA 3B74A 2UUBM 2DZNB 3FTEA 3FRHA 1KYIA 4BB9A 4QHTA 4JXJA 3HJ8A 2DWNA 4LJ9A 2XFSA 4LJ7A 4GH9A 4P16A 2JY7A 4B3RM 3KW6A 4LJ5A 2EKFA 2FH0A 4LZJA 2RKOA 2E5LM 4MGKE 3VFDA 3SC3A 4MGZE 4NC6A 2D7GA 4GITA 5FTMA 1PRBA 3EIEA 4IIWA 4NOOB 2K47A 1TH4A 1EFUB 1N34M 2H5XA 4KLNA 1DV0A 4XK8F 1N32M 1TH3A 3GLFB 1DGFA 2WSCF 3Q8XA 3SARA 2ZANA 2D7HA 5IWAM 4IBGA 2QHOB 5KPTA 1MX0A 3UJNA 3L28A 4GEWA 4FWGA 4XBOA 3FRIA 4QNRA 3H4JA 3T38A 3SASA 3CTWB 4QOZC 2R4EA 1XWIA 1DO2A 1JQJC 3KS4A 3CGWA 5EJCA 3UMMA 4IBDA 1D0KA 2O5RA 4CJ6A 3U60B 3I01M 1R5LA 2JZ1A 3M0EA 4X64M 2G3QA 3LMMA 4KT0F 4DV6M 2JA2A 4LF9M 2DAEA 3FUTA 2CP8A 3FUVA 4RKUF 4WW0A 3HU3A 2Q2EB 3AOEA 2JWSA 2MH8A 4JN6A 1X37A 5ITUA 5F3WA 3DFZA 4R3DA 1J5EM 2F5PA 5LMUM 2EO2A 3TWMA 1W5TA 4BLCA 3D8LA 2K0BX 1OIZA 3W68A 1VDLA 4LF7M 4DUZM 1LV7A 1OJLA 4LFAM 3J80S 3A42A 3R8FA 4FD2A 4PDGA 4Z8XA 3TWKA 1OAIA 1UM8A 3J7AS 1EIJA 4PDIA 3SMPA 4FCWA 4DR6M 4IJEA 2FS1A 3AFHA 3IHPA 4DV4M 2CHQA 3GLGB 1NSFA 1L2DA 1E9RA 1NHGC 4DBGB 4L4UA 4NXNM 2JNHA 1XMQM 2EKKA 2OOBA 3GLHB 4HEOA 3LCVB 4HLQA 2LVQD 4FWHA 4JI8M 2Y0QA 4L8RC 1OTRA 3W0FA 1D0LA 2HAKA 2RRUA 4B08A 3VDPA 1WGNA 2VF8A 2XFTA 4FCVA 2AHMA 3HKPA 4LFCM 3T15A 3CF6E 2D7EA 1E94E 3LQRA 2UU9M 1JB0F 4M0WA 4GC5A 3U6LA 3AOEC 4OW0A 2KRUA 1Y8GA 3RGPA 3W67A 4IJFA 2UUAM 3KDSE 3U6OA 2R6FA 3THGA 1V34A 4LJ8A 4OU7A 3A98B 4RF0A 3SAWA 5IZ7D 4B7HA 5KPRA 3GLHE 1G3IA 2JP7A 5H37D 2R45A 1ZAEA 2DWLA 3C9PA 5EXSA 2C9OA 1IFYA 5EP3A 1E9SA 2C98A 4G4QA 3K8ZA 3AJIB 3KOWE 1G4AE 1WR1B 1NHWC 5ITQA 5JI2E 2NQ8C 3GRUA 3HHYA 3UZUA 1XB2B 2YQZA 1SXJA 2QBYB 4ITQA 4JI3M 2CHVA 1XXHA 3B89A 4D81A 4DV2M 4DR5M 1PM5A 2MROB 3E46A 1DGHB 4I8OA 1DGBA 2LHCA 4B3TM 3J2PB 2OO9A 4CGYB 2CV0A 2ERCA 4JI0M 3WHKA 1IBMM 4IBEA 3B7NA 2CFOA 1TTEA 3FUUA 2XZFA 3VKGA 2C5RA 4AG6A 1G41A 2BWBA 1ORYB 2DAMA 1TR8A 1OIPA 3GP1A 1OFHA 2DZLA 3KVWA 4AQYM 1PJIA 5L8RF 2ZTDA 1GJSA 5EP1A 2QSFX 4II7A 1ZMWA 2QCUA 2C9CA 1XMOM 3QWLA 2ZBKB 4D80A 3FUWA 3K92A 3MHVC 3U6EA 1TH2A 1R2YA 3L2AA 1MJGM 2KW0A 4IBKA 3TPZA 4R7GA 2LTUA 3I4YA 3KP0E 3HU1A 4JYAM 3PVSA 1HNWM 1R2ZA 2VQEM 2G5GX 2WSFF 4FWDA 2CHGA 4MGHA 4BBAA 2DAKA 2I7NA 3C3EA 4DV3M 1IXZA 3KP1E 4FW9A 2J5YA 3TL4X 4ZPXA 2F4VM 3F92A 4G6ZA 2JY6B 4GIPA 1EE8A 3GLHA 3IG8A 3C3DA 5C18A 2CV1A 1HT1E 3RE8A 3E21A 5ITTA 1A5TA 1Q02A 3E9SA 4X66M 2KRKA 1ZQ9A 1OFIA 1BVSA 2XGNA 3HJQA 5FTLA 4K0KM 3GLIA 1NV8A 3WHLA 1YUBA 2JY5A 1NV9A 2RGHA 4XGIA 5GKNA 8CATA 3GRYA 4L15A 4B7GA 3GRRA 4DR1M 1FJGM 5KQ8A 3AL0C 4GKJM 3MJ5A 1TGUA 1XXHE 1T3TA 1K3WA 4CHTB 3U5ZA 1WXQA 2FFJA 2EUCA 3KXEC 1VG5A 4MB7A 1XNQM 5ITXA 4D82A 4YHHM 2DZOB 1NO1A 3E4RA 1NJGA 5A2QS 1VQ1A 2ZTCA 1ZV1A 3I51A 4LJAA 2R4JA 1QAQA 4R71A 4CISA 2XSZD 2KEBA 1AIPC 3UGJA 4JI5M 1HNZM 2CEAA 2R18A 2L6OA 3FYDA 1GLNA 3H4MA 3LW5F 4I5SA 2Z7JA 3PFIA 5DYIA 4L6V6 3T1YM 5EXTA 3SAUA 3ZQJA 2MR9A 3DOAA 2R46A 2LHGA 2DHRA 1XHBA 3DZDA 4GKKM 2KZSA 3GRVA 3GPXA 4NRVA 3I04M 5EP4A 2DXIA 2KNVA 1QZEA 4F1IA 1QAMA 4IBJA 4IBBA 2C99A 3KSJA 1VEKA 5EXPA 3U6PA 3GLFA 2FE8A 1VDDA 2LXEA 1UFZA 1RU3A 3GPUA 2F5NA 2LNHC 2LVOC 2Z4RA 1HNXM 3FE3A 5DYGA 1G8PA 3SYLA 3GLIB 4JI7M 3MMPA 1I94M 1MU5A 2VDBB 1IN5A 3U60A 3FTFA 4F2LA 1E32A 1GJTA 2L7IA 4AKGA 2L4EA 3GLIE 3K2LA 1IBKM 1WIVA 3PNYA 1NY6A 5DFLA 5ITYA 3SHFA 1N78A 1G59A 4DR3M 4KODA 1Z5CA 3U6SA 1QDTA 3UK6A 3ZCBB 3JR4A 3M6AA 2HWJA 1JR3E 3J7BA 2CWBA 3FUXA 3QYBA 4AZFA 2EJSA 4NRWA 4NSRA 1IXRC 4LF5M 2N35A 1IY0A 2DNAA 1NJFA 4DV7M 1N33M 5IT9S 1LTMA 4LCBA 2R0IA 1VEJA 3ZC7B 2V1UA 3GQ5A 1IN4A 2BNKA 4LGMA 4OVZB 3CF2A 5DNYA 3U6CA 3HHXA 4W5WA 2JXNA 3GQ3A 2VF7A 3A46A 4LY6A 3U6MA 2DVWB 2DHYA 4QHSA 1NVMA 1IXSB 2H1RA 3FKEA 3VK7A 1OKSA 1L2BA 4GHAA 2HL7A 3FD9A 3KOZE 3GPYA 3U5ZB 3J27B 3GQ4A 3HHZA 2X8AA 4QOSA 1OAOC 2Z8YM 4KO8A 1TDZA 1N36M 1XXHB 2L09A 2QQ8A 2O01F 5FTJA 3GLFE 2EA0A 1WJ7A 4GRIA 2DAGA 1PJSA 1TF0B 4LJ6A 3KFUG 1IY1A 4M9XA 2BWEA 3KOYE 2XF3A 5KQDA 2OPFA 3HGIA 2J7NA 3SHGB 2HHHM 3I4VA 4AW4A 4G4OA 2LWXA 1IBLM 3K9PA 2XZUA 5C1BA 3FYCA 2X4AA 2CRUA 4DUYM 3U6DA 1HR0M 1F4IA 2YR0A 7CATA 1PJJA 3SFZA 2VQFM 1J09A 3RGSA 2XSZA 4I4LA 4EIWA 4PD2A 1NNJA 3SATA 1TDHA 4MGIE 4ANRA 3SAVA 1S3SA 4FVMA 2LVNC 1C7YA 4Z6YA 4OX9M 3AOGA 1C1KA 5ITRA 2QBYA 4MGYE 5FTKA 4G4NA 3HX3A 4X62M 1N77A 2ZAOA 2KNAA 1SXJB 1GKIA 3ILKA 3VDUA 1V33A 3D8BA 1R6BX 4OVZA 3RFWA 4B3MM 1T43A 2YNMD 3B7QA 2F5SA 2Z4SA 2FNAA 5FTNA 3JAMS 2LVAA 3AKZA 1XC8A 4DR4M 4PT5A 4PCZA 2KA6B 2GQFA 4GHLA 4LFBM 5EQTA 4IBCA 2JY8A 4MM3B 2DI0A 2UXBM 3K1JA 1L2CA 1Z5BA 2F5QA 5E26A 4REZA 1NNUC 2LBCA 3M7GA
chains in the Genus database with same CATH topology
1VEKA 2K9DA 3GLHE 1G3IA 1WHCA 2DAIA 2JP7A 1VEGA 1UFZA 4UN2B 2LVOC 1IFYA 1WGLA 1HT2E 3FE3A 1IM2A 1G4AE 1WR1B 3IECA 5JI2E 3MMPA 4F2LA 1SG9A 3FRHA 1KYIA 1XB2B 2L4EA 3GLIE 1P3QQ 1WIVA 2B3TA 3B89A 5DFLA 1GO5A 2MROB 3E46A 2JY7A 2OO9A 2EKFA 2KHHA 3LCUA 1DO0A 3K9OA 1TTEA 2HWJA 1IXSA 1G41A 2BWBA 1JR3E 2CWBA 2JUJA 1EFUB 2DAMA 2EJSA 2H5XA 1TR8A 1DV0A 1MN3A 2DZLA 2DNAA 2ZTDA 2R0IA 1VEJA 2QSFX 2QHOB 2DKLA 1ZMWA 4GEWA 3FRIA 3H4JA 3T6PA 1OQYA 2OOAA 1DO2A 1ZMUA 2LTUA 2DHYA 1OKSA 1R4GA 2LVPC 2DAKA 2JZ1A 4G3OA 2G3QA 1HQYE 2DAEA 2CP8A 3F92A 2JY6B 3GLFE 1HT1E 1WJ7A 2QNJA 3E21A 2DAGA 1A5TA 1Q02A 2K0BX 1BVSA 2BWEA 1T6OA 1CUKA 1VDLA 1NV8A 2JY5A 3K9PA 2MGWA 1YLAA 1NV9A 2L2DA 1F4IA 1OAIA 1XXHE 2L4FA 4WP2A 1VG5A 3IHPA 2MJ5B 1ZMVA 2LVNC 2O25A 1HJPA 1C7YA 1VQ1A 2ZTCA 4DBGB 1V92A 1ZV1A 2JNHA 2EKKA 2OOBA 4HEOA 3LCVB 4R71A 2LVQD 1OTRA 1AIPC 2HAKA 2KNAA 2RRUA 3BBZA 1WGNA 1T43A 4Q7JA 2WZJA 2LVAA 3GLGE 2MR9A 1E94E 1PGYA 2JY8A 2JZ0A 2DI0A 2KNVA 1QZEA 1Y8GA 4F1IA 2DENA 2LBCA 2KNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEK A;  2K9D A;  3GLH E;  1G3I A;  1WHC A;  2DAI A;  2JP7 A;  1VEG A;  1UFZ A;  4UN2 B;  2LVO C;  1IFY A;  1WGL A;  1HT2 E;  3FE3 A;  1IM2 A;  1G4A E;  1WR1 B;  3IEC A;  5JI2 E;  3MMP A;  4F2L A;  1SG9 A;  3FRH A;  1KYI A;  1XB2 B;  2L4E A;  3GLI E;  1P3Q Q;  1WIV A;  2B3T A;  3B89 A;  5DFL A;  1GO5 A;  2MRO B;  3E46 A;  2JY7 A;  2OO9 A;  2EKF A;  2KHH A;  3LCU A;  1DO0 A;  3K9O A;  1TTE A;  2HWJ A;  1IXS A;  1G41 A;  2BWB A;  1JR3 E;  2CWB A;  2JUJ A;  1EFU B;  2DAM A;  2EJS A;  2H5X A;  1TR8 A;  1DV0 A;  1MN3 A;  2DZL A;  2DNA A;  2ZTD A;  2R0I A;  1VEJ A;  2QSF X;  2QHO B;  2DKL A;  1ZMW A;  4GEW A;  3FRI A;  3H4J A;  3T6P A;  1OQY A;  2OOA A;  1DO2 A;  1ZMU A;  2LTU A;  2DHY A;  1OKS A;  1R4G A;  2LVP C;  2DAK A;  2JZ1 A;  4G3O A;  2G3Q A;  1HQY E;  2DAE A;  2CP8 A;  3F92 A;  2JY6 B;  3GLF E;  1HT1 E;  1WJ7 A;  2QNJ A;  3E21 A;  2DAG A;  1A5T A;  1Q02 A;  2K0B X;  1BVS A;  2BWE A;  1T6O A;  1CUK A;  1VDL A;  1NV8 A;  2JY5 A;  3K9P A;  2MGW A;  1YLA A;  1NV9 A;  2L2D A;  1F4I A;  1OAI A;  1XXH E;  2L4F A;  4WP2 A;  1VG5 A;  3IHP A;  2MJ5 B;  1ZMV A;  2LVN C;  2O25 A;  1HJP A;  1C7Y A;  1VQ1 A;  2ZTC A;  4DBG B;  1V92 A;  1ZV1 A;  2JNH A;  2EKK A;  2OOB A;  4HEO A;  3LCV B;  4R71 A;  2LVQ D;  1OTR A;  1AIP C;  2HAK A;  2KNA A;  2RRU A;  3BBZ A;  1WGN A;  1T43 A;  4Q7J A;  2WZJ A;  2LVA A;  3GLG E;  2MR9 A;  1E94 E;  1PGY A;  2JY8 A;  2JZ0 A;  2DI0 A;  2KNV A;  1QZE A;  1Y8G A;  4F1I A;  2DEN A;  2LBC A;  2KNZ A; 
#chains in the Genus database with same CATH topology
 2VII A;  3NBX X;  2P5T A;  4YY3 M;  1KSF X;  1DGG A;  5LMN M;  3BOS A;  1FNN A;  2K9D A;  4WUR A;  1WHC A;  2DAI A;  2HKJ A;  4JV5 M;  4NSO B;  1QUT A;  5E6J A;  2Y20 A;  2FOI C;  4IBI A;  1IN7 A;  2UXD M;  1WGL A;  1HT2 E;  2R62 A;  2M5Z A;  3U61 A;  1GL7 A;  3IG5 A;  3SBJ A;  4QNM A;  3LVV A;  4TUW A;  3IEC A;  1NY5 A;  3LQQ A;  4Y28 F;  2XLJ A;  3FTC A;  1QAO A;  4LJ4 A;  1SG9 A;  2QZ4 A;  3L29 A;  4LRS A;  1QZM A;  4FCT A;  4M0D A;  2UXC M;  1SXJ C;  1YE9 A;  1P3Q Q;  2DWZ B;  1D0M A;  3SMS A;  3CF0 A;  1H6U A;  2B3T A;  4AG5 A;  3OTO M;  1L1Z A;  2A5Y B;  1GO5 A;  3BXW A;  5KPZ A;  2G8L A;  3C58 A;  4M9S A;  4JI4 M;  4DR7 M;  1Q3B A;  1G71 A;  2KHH A;  3LCU A;  3HWS A;  1DO0 A;  3K9O A;  5FSW A;  1GL6 A;  5ITX E;  3JR5 A;  2DWM A;  2XEP A;  3PXG A;  1JR3 A;  4HL4 A;  5JI3 E;  3FTD A;  2X49 A;  1IXS A;  3NBI A;  3ZH9 B;  4CIZ A;  3L26 A;  2JUJ A;  2KXE A;  4P17 A;  3MK6 A;  3L27 A;  4IBF A;  4LG2 A;  1J7K A;  2APL A;  1MN3 A;  3T1H M;  4M9Z A;  4B3S M;  4DV1 M;  1IN8 A;  1D2N A;  2V1C A;  3A45 A;  1AUA A;  2CUZ A;  2QPA A;  3QYE A;  2ZM6 M;  1Q39 A;  4DV0 M;  2V6Z M;  3HZJ A;  2DKL A;  1JR3 D;  3GLG A;  3HY5 A;  2OQ4 A;  4NL4 H;  2HCB A;  1L8Q A;  5EP2 A;  3T6P A;  1OQY A;  2OOA A;  1KFV A;  1QQW A;  3TQS A;  1ZMU A;  5BPV A;  1N75 A;  5BR8 M;  2UUC M;  5IRE B;  1R4G A;  2LVP C;  2Y0T A;  3V76 A;  3NWL A;  1HQC A;  4G3O A;  4S12 A;  1HQY E;  2YFQ A;  2I7P A;  3VLF B;  1DGH A;  2K6B A;  3KOX E;  2XH9 A;  1W5S A;  3HHW A;  1K82 A;  3U6Q A;  2QNJ A;  3VK8 A;  3TE6 A;  3PNV A;  1Q3C A;  1SXJ D;  2QP9 X;  5KO3 A;  4G4R A;  1Z59 A;  1T6O A;  2LH0 A;  1CUK A;  1GAB A;  4MH0 E;  1IQP A;  4JI6 M;  2MGW A;  1YLA A;  4I81 A;  1PJT A;  1IY2 A;  2L2D A;  3B9P A;  1L1T A;  4LGY A;  1SXJ E;  4LZZ A;  3LVW A;  1QDR A;  3J81 S;  1K3X A;  1QUS A;  2L4F A;  2WSE F;  3HU2 A;  2C96 A;  4L78 A;  4WP2 A;  5FLX S;  4DV5 M;  2MJ5 B;  2M60 A;  3AV0 A;  1QVR A;  1ZMV A;  4LF4 M;  2O25 A;  1HJP A;  2KDL A;  1V92 A;  3GPP A;  2CE7 A;  3QAU A;  3TWL A;  2R65 A;  4X65 M;  2Y21 A;  1GVN A;  4JI2 M;  1XNR M;  1QAN A;  3BBZ A;  2BJW A;  4LF6 M;  1YSY A;  3DA1 A;  2L7H A;  3B7Z A;  2QEN A;  4Q7J A;  3Q8G A;  2WZJ A;  4KHP M;  2KZU A;  2J7O A;  4DR2 M;  3KSX A;  2GNO A;  3GLG E;  3U61 B;  2CV2 A;  4JI1 M;  5EXX A;  4AI6 A;  1PGY A;  3VKH A;  4B7F A;  2Z3X A;  3SYK A;  2W82 A;  2F5O A;  2JZ0 A;  3GO8 A;  1I4W A;  4A3V B;  4AKH A;  2DEN A;  4L16 A;  1QYR A;  2BJV A;  2KNZ A;  3L25 A;  2RGO A;  3EIH A;  3R9X B;  1Z6T A;  4GC9 A;  4AKI A;  1PJQ A;  4GMQ A;  4NXM M;  1VEG A;  4RNA A;  4UN2 B;  4LF8 M;  1R7R A;  1IM2 A;  3W0L B;  1IN6 A;  3KS8 A;  4RF1 A;  4LRT A;  1Z5A A;  3HJS A;  2R44 A;  2ZAM A;  3B74 A;  2UUB M;  2DZN B;  3FTE A;  3FRH A;  1KYI A;  4BB9 A;  4QHT A;  4JXJ A;  3HJ8 A;  2DWN A;  4LJ9 A;  2XFS A;  4LJ7 A;  4GH9 A;  4P16 A;  2JY7 A;  4B3R M;  3KW6 A;  4LJ5 A;  2EKF A;  2FH0 A;  4LZJ A;  2RKO A;  2E5L M;  4MGK E;  3VFD A;  3SC3 A;  4MGZ E;  4NC6 A;  2D7G A;  4GIT A;  5FTM A;  1PRB A;  3EIE A;  4IIW A;  4NOO B;  2K47 A;  1TH4 A;  1EFU B;  1N34 M;  2H5X A;  4KLN A;  1DV0 A;  4XK8 F;  1N32 M;  1TH3 A;  3GLF B;  1DGF A;  2WSC F;  3Q8X A;  3SAR A;  2ZAN A;  2D7H A;  5IWA M;  4IBG A;  2QHO B;  5KPT A;  1MX0 A;  3UJN A;  3L28 A;  4GEW A;  4FWG A;  4XBO A;  3FRI A;  4QNR A;  3H4J A;  3T38 A;  3SAS A;  3CTW B;  4QOZ C;  2R4E A;  1XWI A;  1DO2 A;  1JQJ C;  3KS4 A;  3CGW A;  5EJC A;  3UMM A;  4IBD A;  1D0K A;  2O5R A;  4CJ6 A;  3U60 B;  3I01 M;  1R5L A;  2JZ1 A;  3M0E A;  4X64 M;  2G3Q A;  3LMM A;  4KT0 F;  4DV6 M;  2JA2 A;  4LF9 M;  2DAE A;  3FUT A;  2CP8 A;  3FUV A;  4RKU F;  4WW0 A;  3HU3 A;  2Q2E B;  3AOE A;  2JWS A;  2MH8 A;  4JN6 A;  1X37 A;  5ITU A;  5F3W A;  3DFZ A;  4R3D A;  1J5E M;  2F5P A;  5LMU M;  2EO2 A;  3TWM A;  1W5T A;  4BLC A;  3D8L A;  2K0B X;  1OIZ A;  3W68 A;  1VDL A;  4LF7 M;  4DUZ M;  1LV7 A;  1OJL A;  4LFA M;  3J80 S;  3A42 A;  3R8F A;  4FD2 A;  4PDG A;  4Z8X A;  3TWK A;  1OAI A;  1UM8 A;  3J7A S;  1EIJ A;  4PDI A;  3SMP A;  4FCW A;  4DR6 M;  4IJE A;  2FS1 A;  3AFH A;  3IHP A;  4DV4 M;  2CHQ A;  3GLG B;  1NSF A;  1L2D A;  1E9R A;  1NHG C;  4DBG B;  4L4U A;  4NXN M;  2JNH A;  1XMQ M;  2EKK A;  2OOB A;  3GLH B;  4HEO A;  3LCV B;  4HLQ A;  2LVQ D;  4FWH A;  4JI8 M;  2Y0Q A;  4L8R C;  1OTR A;  3W0F A;  1D0L A;  2HAK A;  2RRU A;  4B08 A;  3VDP A;  1WGN A;  2VF8 A;  2XFT A;  4FCV A;  2AHM A;  3HKP A;  4LFC M;  3T15 A;  3CF6 E;  2D7E A;  1E94 E;  3LQR A;  2UU9 M;  1JB0 F;  4M0W A;  4GC5 A;  3U6L A;  3AOE C;  4OW0 A;  2KRU A;  1Y8G A;  3RGP A;  3W67 A;  4IJF A;  2UUA M;  3KDS E;  3U6O A;  2R6F A;  3THG A;  1V34 A;  4LJ8 A;  4OU7 A;  3A98 B;  4RF0 A;  3SAW A;  5IZ7 D;  4B7H A;  5KPR A;  3GLH E;  1G3I A;  2JP7 A;  5H37 D;  2R45 A;  1ZAE A;  2DWL A;  3C9P A;  5EXS A;  2C9O A;  1IFY A;  5EP3 A;  1E9S A;  2C98 A;  4G4Q A;  3K8Z A;  3AJI B;  3KOW E;  1G4A E;  1WR1 B;  1NHW C;  5ITQ A;  5JI2 E;  2NQ8 C;  3GRU A;  3HHY A;  3UZU A;  1XB2 B;  2YQZ A;  1SXJ A;  2QBY B;  4ITQ A;  4JI3 M;  2CHV A;  1XXH A;  3B89 A;  4D81 A;  4DV2 M;  4DR5 M;  1PM5 A;  2MRO B;  3E46 A;  1DGH B;  4I8O A;  1DGB A;  2LHC A;  4B3T M;  3J2P B;  2OO9 A;  4CGY B;  2CV0 A;  2ERC A;  4JI0 M;  3WHK A;  1IBM M;  4IBE A;  3B7N A;  2CFO A;  1TTE A;  3FUU A;  2XZF A;  3VKG A;  2C5R A;  4AG6 A;  1G41 A;  2BWB A;  1ORY B;  2DAM A;  1TR8 A;  1OIP A;  3GP1 A;  1OFH A;  2DZL A;  3KVW A;  4AQY M;  1PJI A;  5L8R F;  2ZTD A;  1GJS A;  5EP1 A;  2QSF X;  4II7 A;  1ZMW A;  2QCU A;  2C9C A;  1XMO M;  3QWL A;  2ZBK B;  4D80 A;  3FUW A;  3K92 A;  3MHV C;  3U6E A;  1TH2 A;  1R2Y A;  3L2A A;  1MJG M;  2KW0 A;  4IBK A;  3TPZ A;  4R7G A;  2LTU A;  3I4Y A;  3KP0 E;  3HU1 A;  4JYA M;  3PVS A;  1HNW M;  1R2Z A;  2VQE M;  2G5G X;  2WSF F;  4FWD A;  2CHG A;  4MGH A;  4BBA A;  2DAK A;  2I7N A;  3C3E A;  4DV3 M;  1IXZ A;  3KP1 E;  4FW9 A;  2J5Y A;  3TL4 X;  4ZPX A;  2F4V M;  3F92 A;  4G6Z A;  2JY6 B;  4GIP A;  1EE8 A;  3GLH A;  3IG8 A;  3C3D A;  5C18 A;  2CV1 A;  1HT1 E;  3RE8 A;  3E21 A;  5ITT A;  1A5T A;  1Q02 A;  3E9S A;  4X66 M;  2KRK A;  1ZQ9 A;  1OFI A;  1BVS A;  2XGN A;  3HJQ A;  5FTL A;  4K0K M;  3GLI A;  1NV8 A;  3WHL A;  1YUB A;  2JY5 A;  1NV9 A;  2RGH A;  4XGI A;  5GKN A;  8CAT A;  3GRY A;  4L15 A;  4B7G A;  3GRR A;  4DR1 M;  1FJG M;  5KQ8 A;  3AL0 C;  4GKJ M;  3MJ5 A;  1TGU A;  1XXH E;  1T3T A;  1K3W A;  4CHT B;  3U5Z A;  1WXQ A;  2FFJ A;  2EUC A;  3KXE C;  1VG5 A;  4MB7 A;  1XNQ M;  5ITX A;  4D82 A;  4YHH M;  2DZO B;  1NO1 A;  3E4R A;  1NJG A;  5A2Q S;  1VQ1 A;  2ZTC A;  1ZV1 A;  3I51 A;  4LJA A;  2R4J A;  1QAQ A;  4R71 A;  4CIS A;  2XSZ D;  2KEB A;  1AIP C;  3UGJ A;  4JI5 M;  1HNZ M;  2CEA A;  2R18 A;  2L6O A;  3FYD A;  1GLN A;  3H4M A;  3LW5 F;  4I5S A;  2Z7J A;  3PFI A;  5DYI A;  4L6V 6;  3T1Y M;  5EXT A;  3SAU A;  3ZQJ A;  2MR9 A;  3DOA A;  2R46 A;  2LHG A;  2DHR A;  1XHB A;  3DZD A;  4GKK M;  2KZS A;  3GRV A;  3GPX A;  4NRV A;  3I04 M;  5EP4 A;  2DXI A;  2KNV A;  1QZE A;  4F1I A;  1QAM A;  4IBJ A;  4IBB A;  2C99 A;  3KSJ A;  1VEK A;  5EXP A;  3U6P A;  3GLF A;  2FE8 A;  1VDD A;  2LXE A;  1UFZ A;  1RU3 A;  3GPU A;  2F5N A;  2LNH C;  2LVO C;  2Z4R A;  1HNX M;  3FE3 A;  5DYG A;  1G8P A;  3SYL A;  3GLI B;  4JI7 M;  3MMP A;  1I94 M;  1MU5 A;  2VDB B;  1IN5 A;  3U60 A;  3FTF A;  4F2L A;  1E32 A;  1GJT A;  2L7I A;  4AKG A;  2L4E A;  3GLI E;  3K2L A;  1IBK M;  1WIV A;  3PNY A;  1NY6 A;  5DFL A;  5ITY A;  3SHF A;  1N78 A;  1G59 A;  4DR3 M;  4KOD A;  1Z5C A;  3U6S A;  1QDT A;  3UK6 A;  3ZCB B;  3JR4 A;  3M6A A;  2HWJ A;  1JR3 E;  3J7B A;  2CWB A;  3FUX A;  3QYB A;  4AZF A;  2EJS A;  4NRW A;  4NSR A;  1IXR C;  4LF5 M;  2N35 A;  1IY0 A;  2DNA A;  1NJF A;  4DV7 M;  1N33 M;  5IT9 S;  1LTM A;  4LCB A;  2R0I A;  1VEJ A;  3ZC7 B;  2V1U A;  3GQ5 A;  1IN4 A;  2BNK A;  4LGM A;  4OVZ B;  3CF2 A;  5DNY A;  3U6C A;  3HHX A;  4W5W A;  2JXN A;  3GQ3 A;  2VF7 A;  3A46 A;  4LY6 A;  3U6M A;  2DVW B;  2DHY A;  4QHS A;  1NVM A;  1IXS B;  2H1R A;  3FKE A;  3VK7 A;  1OKS A;  1L2B A;  4GHA A;  2HL7 A;  3FD9 A;  3KOZ E;  3GPY A;  3U5Z B;  3J27 B;  3GQ4 A;  3HHZ A;  2X8A A;  4QOS A;  1OAO C;  2Z8Y M;  4KO8 A;  1TDZ A;  1N36 M;  1XXH B;  2L09 A;  2QQ8 A;  2O01 F;  5FTJ A;  3GLF E;  2EA0 A;  1WJ7 A;  4GRI A;  2DAG A;  1PJS A;  1TF0 B;  4LJ6 A;  3KFU G;  1IY1 A;  4M9X A;  2BWE A;  3KOY E;  2XF3 A;  5KQD A;  2OPF A;  3HGI A;  2J7N A;  3SHG B;  2HHH M;  3I4V A;  4AW4 A;  4G4O A;  2LWX A;  1IBL M;  3K9P A;  2XZU A;  5C1B A;  3FYC A;  2X4A A;  2CRU A;  4DUY M;  3U6D A;  1HR0 M;  1F4I A;  2YR0 A;  7CAT A;  1PJJ A;  3SFZ A;  2VQF M;  1J09 A;  3RGS A;  2XSZ A;  4I4L A;  4EIW A;  4PD2 A;  1NNJ A;  3SAT A;  1TDH A;  4MGI E;  4ANR A;  3SAV A;  1S3S A;  4FVM A;  2LVN C;  1C7Y A;  4Z6Y A;  4OX9 M;  3AOG A;  1C1K A;  5ITR A;  2QBY A;  4MGY E;  5FTK A;  4G4N A;  3HX3 A;  4X62 M;  1N77 A;  2ZAO A;  2KNA A;  1SXJ B;  1GKI A;  3ILK A;  3VDU A;  1V33 A;  3D8B A;  1R6B X;  4OVZ A;  3RFW A;  4B3M M;  1T43 A;  2YNM D;  3B7Q A;  2F5S A;  2Z4S A;  2FNA A;  5FTN A;  3JAM S;  2LVA A;  3AKZ A;  1XC8 A;  4DR4 M;  4PT5 A;  4PCZ A;  2KA6 B;  2GQF A;  4GHL A;  4LFB M;  5EQT A;  4IBC A;  2JY8 A;  4MM3 B;  2DI0 A;  2UXB M;  3K1J A;  1L2C A;  1Z5B A;  2F5Q A;  5E26 A;  4REZ A;  1NNU C;  2LBC A;  3M7G A; 
#chains in the Genus database with same CATH homology
 1VEK A;  2K9D A;  3GLH E;  1G3I A;  1WHC A;  2DAI A;  2JP7 A;  1VEG A;  1UFZ A;  4UN2 B;  2LVO C;  1IFY A;  1WGL A;  1HT2 E;  3FE3 A;  1IM2 A;  1G4A E;  1WR1 B;  3IEC A;  5JI2 E;  3MMP A;  4F2L A;  1SG9 A;  3FRH A;  1KYI A;  1XB2 B;  2L4E A;  3GLI E;  1P3Q Q;  1WIV A;  2B3T A;  3B89 A;  5DFL A;  1GO5 A;  2MRO B;  3E46 A;  2JY7 A;  2OO9 A;  2EKF A;  2KHH A;  3LCU A;  1DO0 A;  3K9O A;  1TTE A;  2HWJ A;  1IXS A;  1G41 A;  2BWB A;  1JR3 E;  2CWB A;  2JUJ A;  1EFU B;  2DAM A;  2EJS A;  2H5X A;  1TR8 A;  1DV0 A;  1MN3 A;  2DZL A;  2DNA A;  2ZTD A;  2R0I A;  1VEJ A;  2QSF X;  2QHO B;  2DKL A;  1ZMW A;  4GEW A;  3FRI A;  3H4J A;  3T6P A;  1OQY A;  2OOA A;  1DO2 A;  1ZMU A;  2LTU A;  2DHY A;  1OKS A;  1R4G A;  2LVP C;  2DAK A;  2JZ1 A;  4G3O A;  2G3Q A;  1HQY E;  2DAE A;  2CP8 A;  3F92 A;  2JY6 B;  3GLF E;  1HT1 E;  1WJ7 A;  2QNJ A;  3E21 A;  2DAG A;  1A5T A;  1Q02 A;  2K0B X;  1BVS A;  2BWE A;  1T6O A;  1CUK A;  1VDL A;  1NV8 A;  2JY5 A;  3K9P A;  2MGW A;  1YLA A;  1NV9 A;  2L2D A;  1F4I A;  1OAI A;  1XXH E;  2L4F A;  4WP2 A;  1VG5 A;  3IHP A;  2MJ5 B;  1ZMV A;  2LVN C;  2O25 A;  1HJP A;  1C7Y A;  1VQ1 A;  2ZTC A;  4DBG B;  1V92 A;  1ZV1 A;  2JNH A;  2EKK A;  2OOB A;  4HEO A;  3LCV B;  4R71 A;  2LVQ D;  1OTR A;  1AIP C;  2HAK A;  2KNA A;  2RRU A;  3BBZ A;  1WGN A;  1T43 A;  4Q7J A;  2WZJ A;  2LVA A;  3GLG E;  2MR9 A;  1E94 E;  1PGY A;  2JY8 A;  2JZ0 A;  2DI0 A;  2KNV A;  1QZE A;  1Y8G A;  4F1I A;  2DEN A;  2LBC A;  2KNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...