2K0BX

Nmr structure of the uba domain of p62 (sqstm1)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformation and dynamics of the three-helix bundle UBA domain of p62 from experiment and simulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sequestosome-1
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2008-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2k0bX00
3E46A 1WJ7A 1QZEA 2MJ5B 2H5XA 2K9DA 1OAIA 2DAGA 3GLFE 2DHYA 1OQYA 1VEJA 4R71A 5DFLA 1TTEA 1F4IA 1WIVA 3T6PA 1EFUB 2JUJA 2LVOC 2KNAA 4UN2B 2DNAA 1Y8GA 2JY7A 2DAKA 2DI0A 2K0BX 2BWEA 1G4AE 1ZV1A 2LVPC 2EKFA 2KNVA 2LTUA 3MMPA 2RRUA 1HT1E 3E21A 2B3TA 1AIPC 2DAMA 1VDLA 2DENA 1IFYA 1YLAA 3LCUA 1GO5A 1IXSA 1T43A 3BBZA 3LCVB 1CUKA 5JI2E 2JZ0A 1ZMVA 3FRIA 2KHHA 2L2DA 2WZJA 3K9OA 1NV9A 2BWBA 1G3IA 2MGWA 1ZMUA 1MN3A 1WGNA 1OTRA 2R0IA 2EKKA 1G41A 1VG5A 1OKSA 1WR1B 1WGLA 1PGYA 3GLIE 3B89A 2OO9A 3IHPA 2MR9A 2LBCA 2HWJA 1BVSA 4F1IA 2QSFX 1KYIA 1HJPA 2DZLA 2OOAA 2JZ1A 1DO0A 4F2LA 2LVAA 2JY8A 1SG9A 4HEOA 1ZMWA 3H4JA 2QHOB 1R4GA 4GEWA 2JNHA 2JP7A 2G3QA 4G3OA 2ZTCA 1Q02A 1T6OA 2JY5A 1HQYE 1V92A 1TR8A 3F92A 1VEGA 2EJSA 3FRHA 2DKLA 2DAEA 3GLHE 1VQ1A 1IM2A 1XB2B 1DO2A 2OOBA 1XXHE 1UFZA 2MROB 4Q7JA 3K9PA 3GLGE 2DAIA 1WHCA 1A5TA 1DV0A 2O25A 2L4FA 3FE3A 1VEKA 1P3QQ 2JY6B 2CWBA 2HAKA 2LVQD 1JR3E 1HT2E 1E94E 2CP8A 2QNJA 4DBGB 1C7YA 1NV8A 2LVNC 3IECA 2L4EA 4WP2A 2KNZA 2ZTDA
chains in the Genus database with same CATH superfamily
2R6FA 2G5GX 1QZEA 1JR3A 4LF5M 2XZUA 2XFTA 1QAOA 1OAIA 2DAGA 5H37D 1JQJC 3KP1E 1L8QA 3C9PA 4NC6A 3JAMS 1N75A 2KZUA 1Q3CA 3U60B 4JI0M 2JUJA 4UN2B 3K8ZA 1TH2A 2VDBB 2QQ8A 2LVPC 2BJVA 5EXTA 3L25A 3GRUA 3L27A 3MHVC 4QOZC 5EQTA 3CGWA 3E21A 2YQZA 3PNYA 5FTMA 3ZQJA 3AOEA 5IWAM 4GITA 3LW5F 3A46A 4AQYM 1VDLA 4LRTA 3W68A 1XMOM 4I5SA 1NY5A 1IFYA 1SXJB 2YFQA 1G8PA 1QUSA 5LMUM 4DV3M 1DGHA 3U6MA 5IT9S 3FYDA 3BBZA 1QVRA 3W0FA 4NXMM 2UXBM 1IN4A 5JI2E 4FWGA 3KXEC 2QP9X 2D7GA 4D81A 1NJGA 4LFCM 3VLFB 2MGWA 1ZMUA 2Y20A 2F4VM 1QDRA 2XSZD 4X65M 1IY1A 3U61B 4IBGA 2LXEA 5DYGA 3CTWB 1VG5A 1OKSA 4AI6A 5EJCA 1FJGM 3RGSA 3GLIE 4DV4M 1PM5A 1XWIA 1NNJA 1GJSA 1TGUA 1D0LA 4GIPA 1I94M 4P16A 1GL6A 2CEAA 2OO9A 3U5ZB 2UU9M 1PJIA 4JI7M 1BVSA 5ITYA 4F1IA 1XNQM 2QSFX 4JI8M 1D2NA 1HJPA 2C98A 4LF6M 1DGFA 3TL4X 1D0MA 2DWNA 4OX9M 1IN7A 1Z6TA 3NWLA 2JY8A 3GO8A 1SG9A 1TH4A 5EP4A 4I81A 1SXJA 2YNMD 1G71A 1W5SA 2QHOB 3HGIA 3UZUA 5IREB 4DV1M 3U6PA 3FTEA 4RKUF 3VDPA 2KEBA 5ITRA 2JNHA 1C1KA 1D0KA 1IN5A 3FUVA 1YUBA 3I4YA 1QZMA 4RF0A 3EIHA 3KFUG 1TR8A 1VEGA 2J5YA 2Z8YM 5KO3A 4DUZM 1XC8A 4LFBM 2X4AA 4KODA 2ZAMA 1E9SA 1SXJD 1TDHA 2R62A 4B7HA 5FSWA 2LHCA 3KS8A 2OOBA 1XXHB 1NY6A 4D80A 4JI1M 5FTNA 4I4LA 3A42A 3GLGE 1WHCA 3FYCA 4JI6M 2JY6B 2UUCM 1QQWA 2HHHM 3GP1A 1NSFA 2LVQD 2X8AA 3FUUA 4RNAA 2DXIA 1PJJA 4G6ZA 4B3TM 1X37A 2LVNC 2R18A 3B74A 3CF0A 4FW9A 2L4EA 4IBBA 3RE8A 4WP2A 4M9SA 4CGYB 2KNZA 3SAWA 3THGA 3FKEA 3GQ4A 2DWMA 4G4QA 3AOGA 5FTJA 3B7QA 2K9DA 5EXSA 3KP0E 3GLFE 2DHYA 3HHXA 1IQPA 3T1YM 3U6DA 4JI2M 1EIJA 4JN6A 1E32A 4KT0F 4DR5M 4DV5M 3T15A 3U6CA 4LJ5A 4WURA 4AZFA 3GRVA 3HU2A 3GLGA 4ANRA 2JA2A 1EFUB 3K1JA 2KNAA 3J27B 4IIWA 2DAKA 2DI0A 2K0BX 4OVZA 2BWEA 1G4AE 1ZV1A 2BNKA 2N35A 4MH0E 1XXHA 4DV6M 4G4RA 2EKFA 2KNVA 2Y21A 3L26A 1ZQ9A 2XLJA 3NBIA 3SFZA 2Z3XA 2EA0A 3IG8A 4LJ4A 3U60A 3UGJA 2CE7A 4IJFA 4Z8XA 3TWLA 2F5QA 2M5ZA 3SHFA 4S12A 2RGHA 2DENA 3U6LA 5DNYA 2LWXA 3I4VA 3ZH9B 3VKGA 2EUCA 3UJNA 4CJ6A 1IXSA 4OW0A 3GLFA 2AHMA 2DWZB 2KXEA 3VDUA 1OFHA 3GLIA 1ZMVA 4DR6M 3QYEA 1OAOC 3FRIA 1HR0M 2FOIC 4P17A 4RF1A 3J81S 4GC9A 3I04M 2Y0TA 2FH0A 3HU1A 1G3IA 3ZCBB 2UUBM 4TUWA 2KZSA 4MGYE 3HZJA 3W0LB 3B9PA 1OTRA 3PVSA 4IBJA 4MGHA 1G41A 5KPZA 4IBIA 2F5SA 4JI5M 3HHWA 2UXDM 4M9ZA 4NSRA 3A98B 3A45A 4QOSA 5ITQA 4LJ6A 4LG2A 4NOOB 4AKIA 3IHPA 2L09A 3K92A 1SXJE 3U6QA 2FE8A 3GQ3A 2UXCM 2K47A 4L78A 4R7GA 1IN6A 5IZ7D 5BR8M 2JZ1A 1DO0A 1IXRC 2ZBKB 3ZC7B 1IBKM 2XEPA 2LVAA 3K2LA 2CHVA 3SARA 1QAQA 2O01F 4GHLA 2LH0A 3L28A 1W5TA 4CIZA 4X64M 1K82A 1ZMWA 4XGIA 5EXXA 3BOSA 3TWMA 3U6EA 2G3QA 2L7HA 3LQRA 1Q02A 1T6OA 4LZZA 3GPYA 3GQ5A 2KRKA 5ITXE 3U6OA 4ITQA 1EE8A 3T38A 3HKPA 3SYLA 2R46A 2XFSA 4LFAM 4Z6YA 3TE6A 2EJSA 2JWSA 2HCBA 1V33A 8CATA 2F5PA 3GLHE 3RFWA 1GVNA 2QENA 1IM2A 1XB2B 3HJQA 4BBAA 1YSYA 2V1UA 4FCTA 3K9PA 4LJ7A 2DAIA 2RGOA 3GPPA 3KSJA 2F5NA 2J7NA 1A5TA 1DV0A 2CHGA 2L4FA 1V34A 1IBMM 4PT5A 1P3QQ 2ZANA 1XHBA 2UUAM 2FS1A 1Z59A 3CF6E 3SHGB 3SASA 4OU7A 4AKHA 1E94E 1HT2E 2L7IA 3I51A 4IBKA 4YHHM 3J7AS 4LZJA 1NV8A 4L4UA 1N36M 1NHGC 2NQ8C 1HNZM 3VKHA 1Z5AA 1LV7A 1MU5A 2H1RA 1L1TA 1XNRM 3J7BA 3HU3A 3KVWA 3E46A 1WJ7A 4DV2M 4NRWA 4K0KM 1IY0A 3DZDA 2MJ5B 3PXGA 1IN8A 3KOZE 2HL7A 5E26A 2OQ4A 4R71A 4G4OA 2CV2A 4LF8M 4DR3M 3VK7A 3OTOM 4B3SM 3SYKA 3KOWE 1PRBA 2I7NA 1S3SA 3RGPA 1WIVA 1OJLA 2WSFF 3T6PA 2VQFM 3SMSA 2LVOC 2HKJA 4LGYA 4B3RM 1ORYB 1PJSA 1Y8GA 2JY7A 5C18A 2OPFA 3U6SA 2G8LA 4LGMA 5GKNA 1Q39A 1WXQA 5KPTA 5KQ8A 4FCWA 2LTUA 4KLNA 1PJTA 4B08A 3QYBA 1N34M 3FD9A 1R6BX 3KDSE 1AIPC 1H6UA 3GLIB 2DAMA 3C3EA 3SAUA 3AL0C 4PDIA 3Q8GA 2Y0QA 5KPRA 5EP1A 4EIWA 1NO1A 1QYRA 2VF8A 1YE9A 3GLHA 2DHRA 4OVZB 5FTKA 3D8LA 1GJTA 5FTLA 2O5RA 4FWDA 2JXNA 4NRVA 4AW4A 1N32M 1RU3A 3KOXE 2V1CA 1GKIA 1MX0A 2BJWA 4GC5A 4W5WA 4BLCA 1L2CA 3LCVB 4DUYM 5L8RF 2JZ0A 3FTDA 5LMNM 4CHTB 3AV0A 2WZJA 3HX3A 3R8FA 4WW0A 2GNOA 5EP2A 5KQDA 1NV9A 2BWBA 2CFOA 2XGNA 2FNAA 3PNVA 4I8OA 4PD2A 1R2ZA 1LTMA 2EKKA 2R0IA 2ERCA 1OIZA 7CATA 1DGGA 1PGYA 1WGLA 3TWKA 2KRUA 3GLFB 2ZAOA 3DOAA 1N33M 1NNUC 4AKGA 3HY5A 4D82A 2VIIA 5FLXS 3B89A 3LMMA 2CV1A 2D7EA 4LJAA 4R3DA 3GPXA 2MR9A 2LBCA 1KFVA 4M9XA 5EP3A 2RKOA 2R4JA 4DV0M 5E6JA 2I7PA 2DZLA 1QDTA 5DYIA 4JV5M 4IBDA 3UMMA 2R65A 1IY2A 4LRSA 4NL4H 4LCBA 4MGZE 1Q3BA 2QPAA 4LJ9A 1SXJC 3W67A 2KW0A 4JXJA 4JI4M 1R4GA 4GEWA 1TF0B 4B7GA 3M7GA 5C1BA 2ZM6M 3KS4A 1I4WA 1TH3A 3GRYA 2VF7A 3HHYA 1HQYE 2M60A 3QWLA 2Z4SA 2DVWB 4JYAM 3F92A 1VDDA 2Q2EB 3FRHA 1QANA 3L2AA 1Z5BA 5F3WA 1IXZA 2CHQA 1E9RA 2XF3A 1VQ1A 2XSZA 2GQFA 1HQCA 1XXHE 4Q7JA 4PCZA 3SBJA 3T1HM 3IG5A 3QAUA 3C58A 3FE3A 1R7RA 3LVVA 2QZ4A 2CWBA 3D8BA 4M0DA 3Q8XA 4L16A 2DWLA 2XH9A 2CP8A 2QNJA 4REZA 4ZPXA 4AG5A 3V76A 4KHPM 2YR0A 1IXSB 5ITXA 3IECA 3TPZA 3B7ZA 2VQEM 3CF2A 3BXWA 4AG6A 2Z4RA 3LVWA 3MK6A 4KO8A 3WHLA 2H5XA 4B7FA 2XZFA 3ILKA 4GKJM 5ITUA 2A5YB 2P5TA 1OQYA 1VEJA 1K3XA 1L2BA 4L8RC 4QNMA 4MM3B 4GKKM 4GMQA 5DFLA 1PJQA 4L6V6 1TDZA 1TTEA 3WHKA 1F4IA 1R2YA 4X66M 2DNAA 1UM8A 3VFDA 3SAVA 1L2DA 1GLNA 2E5LM 3B7NA 4QNRA 1JR3D 4HL4A 3KSXA 1J7KA 3FTCA 3J2PB 1Z5CA 1J5EM 1IBLM 3MMPA 4II7A 2RRUA 3PFIA 1HT1E 2KA6B 1N78A 3AOEC 2B3TA 3JR4A 3AFHA 4GH9A 4XBOA 2CV0A 3SC3A 4QHSA 2W82A 4CISA 3HHZA 4DV7M 1MJGM 1OFIA 2X49A 1KSFX 1YLAA 3LCUA 3U61A 4YY3M 3C3DA 1GO5A 4X62M 4PDGA 3AKZA 1T43A 4IBCA 2D7HA 5ITTA 3HWSA 4JI3M 1CUKA 3SMPA 2KDLA 3TQSA 3FUXA 3U5ZA 2LNHC 2KHHA 2L2DA 2V6ZM 3K9OA 3UK6A 3R9XB 4GHAA 2LHGA 4DR1M 4IBFA 1R5LA 3EIEA 1MN3A 3AJIB 1NJFA 1DGHB 1WGNA 4QHTA 4B3MM 3M0EA 1WR1B 3E9SA 2WSEF 4IJEA 1L1ZA 5EXPA 4LY6A 1HNWM 3M6AA 4DR2M 3I01M 1K3WA 4A3VB 2HWJA 3LQQA 4MGIE 2C96A 2DZNB 2L6OA 3DA1A 4HLQA 3FUWA 1KYIA 5A2QS 2QBYA 2OOAA 2CRUA 2R45A 4FCVA 1QUTA 3L29A 4F2LA 2CUZA 4FWHA 4IBEA 4HEOA 4LF7M 2J7OA 2Z7JA 1HNXM 3FUTA 1GL7A 1NVMA 3H4JA 3E4RA 2QCUA 1ZAEA 1JB0F 4M0WA 4DR4M 3KW6A 2JP7A 2FFJA 4G3OA 4BB9A 2ZTCA 2JY5A 3GRRA 1FNNA 3MJ5A 1V92A 3HJSA 3H4MA 4GRIA 4DR7M 1G59A 1GABA 1N77A 3VK8A 4FD2A 2DKLA 3GPUA 2DAEA 3JR5A 4NSOB 2C5RA 4LJ8A 1DGBA 2R4EA 1DO2A 2F5OA 2C9CA 4MB7A 4XK8F 2MROB 1UFZA 3J80S 4G4NA 3FTFA 4Y28F 3HJ8A 1OIPA 2R44A 2MH8A 2DZOB 1T3TA 2O25A 4L15A 3KOYE 1VEKA 2C99A 4LF9M 3DFZA 1NHWC 2K6BA 4MGKE 1J09A 5JI3E 3NBXX 4FVMA 2APLA 1XMQM 2HAKA 1QAMA 1JR3E 5BPVA 2QBYB 2C9OA 3GLHB 1AUAA 2EO2A 4DBGB 1C7YA 3SATA 4NXNM 3GLGB 4LF4M 2ZTDA 2WSCF
chains in the Genus database with same CATH topology
3E46A 1WJ7A 1QZEA 2MJ5B 2H5XA 2K9DA 1OAIA 2DAGA 3GLFE 2DHYA 1OQYA 1VEJA 4R71A 5DFLA 1TTEA 1F4IA 1WIVA 3T6PA 1EFUB 2JUJA 2LVOC 2KNAA 4UN2B 2DNAA 1Y8GA 2JY7A 2DAKA 2DI0A 2K0BX 2BWEA 1G4AE 1ZV1A 2LVPC 2EKFA 2KNVA 2LTUA 3MMPA 2RRUA 1HT1E 3E21A 2B3TA 1AIPC 2DAMA 1VDLA 2DENA 1IFYA 1YLAA 3LCUA 1GO5A 1IXSA 1T43A 3BBZA 3LCVB 1CUKA 5JI2E 2JZ0A 1ZMVA 3FRIA 2KHHA 2L2DA 2WZJA 3K9OA 1NV9A 2BWBA 1G3IA 2MGWA 1ZMUA 1MN3A 1WGNA 1OTRA 2R0IA 2EKKA 1G41A 1VG5A 1OKSA 1WR1B 1WGLA 1PGYA 3GLIE 3B89A 2OO9A 3IHPA 2MR9A 2LBCA 2HWJA 1BVSA 4F1IA 2QSFX 1KYIA 1HJPA 2DZLA 2OOAA 2JZ1A 1DO0A 4F2LA 2LVAA 2JY8A 1SG9A 4HEOA 1ZMWA 3H4JA 2QHOB 1R4GA 4GEWA 2JNHA 2JP7A 2G3QA 4G3OA 2ZTCA 1Q02A 1T6OA 2JY5A 1HQYE 1V92A 1TR8A 3F92A 1VEGA 2EJSA 3FRHA 2DKLA 2DAEA 3GLHE 1VQ1A 1IM2A 1XB2B 1DO2A 2OOBA 1XXHE 1UFZA 2MROB 4Q7JA 3K9PA 3GLGE 2DAIA 1WHCA 1A5TA 1DV0A 2O25A 2L4FA 3FE3A 1VEKA 1P3QQ 2JY6B 2CWBA 2HAKA 2LVQD 1JR3E 1HT2E 1E94E 2CP8A 2QNJA 4DBGB 1C7YA 1NV8A 2LVNC 3IECA 2L4EA 4WP2A 2KNZA 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E46 A;  1WJ7 A;  1QZE A;  2MJ5 B;  2H5X A;  2K9D A;  1OAI A;  2DAG A;  3GLF E;  2DHY A;  1OQY A;  1VEJ A;  4R71 A;  5DFL A;  1TTE A;  1F4I A;  1WIV A;  3T6P A;  1EFU B;  2JUJ A;  2LVO C;  2KNA A;  4UN2 B;  2DNA A;  1Y8G A;  2JY7 A;  2DAK A;  2DI0 A;  2K0B X;  2BWE A;  1G4A E;  1ZV1 A;  2LVP C;  2EKF A;  2KNV A;  2LTU A;  3MMP A;  2RRU A;  1HT1 E;  3E21 A;  2B3T A;  1AIP C;  2DAM A;  1VDL A;  2DEN A;  1IFY A;  1YLA A;  3LCU A;  1GO5 A;  1IXS A;  1T43 A;  3BBZ A;  3LCV B;  1CUK A;  5JI2 E;  2JZ0 A;  1ZMV A;  3FRI A;  2KHH A;  2L2D A;  2WZJ A;  3K9O A;  1NV9 A;  2BWB A;  1G3I A;  2MGW A;  1ZMU A;  1MN3 A;  1WGN A;  1OTR A;  2R0I A;  2EKK A;  1G41 A;  1VG5 A;  1OKS A;  1WR1 B;  1WGL A;  1PGY A;  3GLI E;  3B89 A;  2OO9 A;  3IHP A;  2MR9 A;  2LBC A;  2HWJ A;  1BVS A;  4F1I A;  2QSF X;  1KYI A;  1HJP A;  2DZL A;  2OOA A;  2JZ1 A;  1DO0 A;  4F2L A;  2LVA A;  2JY8 A;  1SG9 A;  4HEO A;  1ZMW A;  3H4J A;  2QHO B;  1R4G A;  4GEW A;  2JNH A;  2JP7 A;  2G3Q A;  4G3O A;  2ZTC A;  1Q02 A;  1T6O A;  2JY5 A;  1HQY E;  1V92 A;  1TR8 A;  3F92 A;  1VEG A;  2EJS A;  3FRH A;  2DKL A;  2DAE A;  3GLH E;  1VQ1 A;  1IM2 A;  1XB2 B;  1DO2 A;  2OOB A;  1XXH E;  1UFZ A;  2MRO B;  4Q7J A;  3K9P A;  3GLG E;  2DAI A;  1WHC A;  1A5T A;  1DV0 A;  2O25 A;  2L4F A;  3FE3 A;  1VEK A;  1P3Q Q;  2JY6 B;  2CWB A;  2HAK A;  2LVQ D;  1JR3 E;  1HT2 E;  1E94 E;  2CP8 A;  2QNJ A;  4DBG B;  1C7Y A;  1NV8 A;  2LVN C;  3IEC A;  2L4E A;  4WP2 A;  2KNZ A;  2ZTD A; 
#chains in the Genus database with same CATH topology
 2R6F A;  2G5G X;  1QZE A;  1JR3 A;  4LF5 M;  2XZU A;  2XFT A;  1QAO A;  1OAI A;  2DAG A;  5H37 D;  1JQJ C;  3KP1 E;  1L8Q A;  3C9P A;  4NC6 A;  3JAM S;  1N75 A;  2KZU A;  1Q3C A;  3U60 B;  4JI0 M;  2JUJ A;  4UN2 B;  3K8Z A;  1TH2 A;  2VDB B;  2QQ8 A;  2LVP C;  2BJV A;  5EXT A;  3L25 A;  3GRU A;  3L27 A;  3MHV C;  4QOZ C;  5EQT A;  3CGW A;  3E21 A;  2YQZ A;  3PNY A;  5FTM A;  3ZQJ A;  3AOE A;  5IWA M;  4GIT A;  3LW5 F;  3A46 A;  4AQY M;  1VDL A;  4LRT A;  3W68 A;  1XMO M;  4I5S A;  1NY5 A;  1IFY A;  1SXJ B;  2YFQ A;  1G8P A;  1QUS A;  5LMU M;  4DV3 M;  1DGH A;  3U6M A;  5IT9 S;  3FYD A;  3BBZ A;  1QVR A;  3W0F A;  4NXM M;  2UXB M;  1IN4 A;  5JI2 E;  4FWG A;  3KXE C;  2QP9 X;  2D7G A;  4D81 A;  1NJG A;  4LFC M;  3VLF B;  2MGW A;  1ZMU A;  2Y20 A;  2F4V M;  1QDR A;  2XSZ D;  4X65 M;  1IY1 A;  3U61 B;  4IBG A;  2LXE A;  5DYG A;  3CTW B;  1VG5 A;  1OKS A;  4AI6 A;  5EJC A;  1FJG M;  3RGS A;  3GLI E;  4DV4 M;  1PM5 A;  1XWI A;  1NNJ A;  1GJS A;  1TGU A;  1D0L A;  4GIP A;  1I94 M;  4P16 A;  1GL6 A;  2CEA A;  2OO9 A;  3U5Z B;  2UU9 M;  1PJI A;  4JI7 M;  1BVS A;  5ITY A;  4F1I A;  1XNQ M;  2QSF X;  4JI8 M;  1D2N A;  1HJP A;  2C98 A;  4LF6 M;  1DGF A;  3TL4 X;  1D0M A;  2DWN A;  4OX9 M;  1IN7 A;  1Z6T A;  3NWL A;  2JY8 A;  3GO8 A;  1SG9 A;  1TH4 A;  5EP4 A;  4I81 A;  1SXJ A;  2YNM D;  1G71 A;  1W5S A;  2QHO B;  3HGI A;  3UZU A;  5IRE B;  4DV1 M;  3U6P A;  3FTE A;  4RKU F;  3VDP A;  2KEB A;  5ITR A;  2JNH A;  1C1K A;  1D0K A;  1IN5 A;  3FUV A;  1YUB A;  3I4Y A;  1QZM A;  4RF0 A;  3EIH A;  3KFU G;  1TR8 A;  1VEG A;  2J5Y A;  2Z8Y M;  5KO3 A;  4DUZ M;  1XC8 A;  4LFB M;  2X4A A;  4KOD A;  2ZAM A;  1E9S A;  1SXJ D;  1TDH A;  2R62 A;  4B7H A;  5FSW A;  2LHC A;  3KS8 A;  2OOB A;  1XXH B;  1NY6 A;  4D80 A;  4JI1 M;  5FTN A;  4I4L A;  3A42 A;  3GLG E;  1WHC A;  3FYC A;  4JI6 M;  2JY6 B;  2UUC M;  1QQW A;  2HHH M;  3GP1 A;  1NSF A;  2LVQ D;  2X8A A;  3FUU A;  4RNA A;  2DXI A;  1PJJ A;  4G6Z A;  4B3T M;  1X37 A;  2LVN C;  2R18 A;  3B74 A;  3CF0 A;  4FW9 A;  2L4E A;  4IBB A;  3RE8 A;  4WP2 A;  4M9S A;  4CGY B;  2KNZ A;  3SAW A;  3THG A;  3FKE A;  3GQ4 A;  2DWM A;  4G4Q A;  3AOG A;  5FTJ A;  3B7Q A;  2K9D A;  5EXS A;  3KP0 E;  3GLF E;  2DHY A;  3HHX A;  1IQP A;  3T1Y M;  3U6D A;  4JI2 M;  1EIJ A;  4JN6 A;  1E32 A;  4KT0 F;  4DR5 M;  4DV5 M;  3T15 A;  3U6C A;  4LJ5 A;  4WUR A;  4AZF A;  3GRV A;  3HU2 A;  3GLG A;  4ANR A;  2JA2 A;  1EFU B;  3K1J A;  2KNA A;  3J27 B;  4IIW A;  2DAK A;  2DI0 A;  2K0B X;  4OVZ A;  2BWE A;  1G4A E;  1ZV1 A;  2BNK A;  2N35 A;  4MH0 E;  1XXH A;  4DV6 M;  4G4R A;  2EKF A;  2KNV A;  2Y21 A;  3L26 A;  1ZQ9 A;  2XLJ A;  3NBI A;  3SFZ A;  2Z3X A;  2EA0 A;  3IG8 A;  4LJ4 A;  3U60 A;  3UGJ A;  2CE7 A;  4IJF A;  4Z8X A;  3TWL A;  2F5Q A;  2M5Z A;  3SHF A;  4S12 A;  2RGH A;  2DEN A;  3U6L A;  5DNY A;  2LWX A;  3I4V A;  3ZH9 B;  3VKG A;  2EUC A;  3UJN A;  4CJ6 A;  1IXS A;  4OW0 A;  3GLF A;  2AHM A;  2DWZ B;  2KXE A;  3VDU A;  1OFH A;  3GLI A;  1ZMV A;  4DR6 M;  3QYE A;  1OAO C;  3FRI A;  1HR0 M;  2FOI C;  4P17 A;  4RF1 A;  3J81 S;  4GC9 A;  3I04 M;  2Y0T A;  2FH0 A;  3HU1 A;  1G3I A;  3ZCB B;  2UUB M;  4TUW A;  2KZS A;  4MGY E;  3HZJ A;  3W0L B;  3B9P A;  1OTR A;  3PVS A;  4IBJ A;  4MGH A;  1G41 A;  5KPZ A;  4IBI A;  2F5S A;  4JI5 M;  3HHW A;  2UXD M;  4M9Z A;  4NSR A;  3A98 B;  3A45 A;  4QOS A;  5ITQ A;  4LJ6 A;  4LG2 A;  4NOO B;  4AKI A;  3IHP A;  2L09 A;  3K92 A;  1SXJ E;  3U6Q A;  2FE8 A;  3GQ3 A;  2UXC M;  2K47 A;  4L78 A;  4R7G A;  1IN6 A;  5IZ7 D;  5BR8 M;  2JZ1 A;  1DO0 A;  1IXR C;  2ZBK B;  3ZC7 B;  1IBK M;  2XEP A;  2LVA A;  3K2L A;  2CHV A;  3SAR A;  1QAQ A;  2O01 F;  4GHL A;  2LH0 A;  3L28 A;  1W5T A;  4CIZ A;  4X64 M;  1K82 A;  1ZMW A;  4XGI A;  5EXX A;  3BOS A;  3TWM A;  3U6E A;  2G3Q A;  2L7H A;  3LQR A;  1Q02 A;  1T6O A;  4LZZ A;  3GPY A;  3GQ5 A;  2KRK A;  5ITX E;  3U6O A;  4ITQ A;  1EE8 A;  3T38 A;  3HKP A;  3SYL A;  2R46 A;  2XFS A;  4LFA M;  4Z6Y A;  3TE6 A;  2EJS A;  2JWS A;  2HCB A;  1V33 A;  8CAT A;  2F5P A;  3GLH E;  3RFW A;  1GVN A;  2QEN A;  1IM2 A;  1XB2 B;  3HJQ A;  4BBA A;  1YSY A;  2V1U A;  4FCT A;  3K9P A;  4LJ7 A;  2DAI A;  2RGO A;  3GPP A;  3KSJ A;  2F5N A;  2J7N A;  1A5T A;  1DV0 A;  2CHG A;  2L4F A;  1V34 A;  1IBM M;  4PT5 A;  1P3Q Q;  2ZAN A;  1XHB A;  2UUA M;  2FS1 A;  1Z59 A;  3CF6 E;  3SHG B;  3SAS A;  4OU7 A;  4AKH A;  1E94 E;  1HT2 E;  2L7I A;  3I51 A;  4IBK A;  4YHH M;  3J7A S;  4LZJ A;  1NV8 A;  4L4U A;  1N36 M;  1NHG C;  2NQ8 C;  1HNZ M;  3VKH A;  1Z5A A;  1LV7 A;  1MU5 A;  2H1R A;  1L1T A;  1XNR M;  3J7B A;  3HU3 A;  3KVW A;  3E46 A;  1WJ7 A;  4DV2 M;  4NRW A;  4K0K M;  1IY0 A;  3DZD A;  2MJ5 B;  3PXG A;  1IN8 A;  3KOZ E;  2HL7 A;  5E26 A;  2OQ4 A;  4R71 A;  4G4O A;  2CV2 A;  4LF8 M;  4DR3 M;  3VK7 A;  3OTO M;  4B3S M;  3SYK A;  3KOW E;  1PRB A;  2I7N A;  1S3S A;  3RGP A;  1WIV A;  1OJL A;  2WSF F;  3T6P A;  2VQF M;  3SMS A;  2LVO C;  2HKJ A;  4LGY A;  4B3R M;  1ORY B;  1PJS A;  1Y8G A;  2JY7 A;  5C18 A;  2OPF A;  3U6S A;  2G8L A;  4LGM A;  5GKN A;  1Q39 A;  1WXQ A;  5KPT A;  5KQ8 A;  4FCW A;  2LTU A;  4KLN A;  1PJT A;  4B08 A;  3QYB A;  1N34 M;  3FD9 A;  1R6B X;  3KDS E;  1AIP C;  1H6U A;  3GLI B;  2DAM A;  3C3E A;  3SAU A;  3AL0 C;  4PDI A;  3Q8G A;  2Y0Q A;  5KPR A;  5EP1 A;  4EIW A;  1NO1 A;  1QYR A;  2VF8 A;  1YE9 A;  3GLH A;  2DHR A;  4OVZ B;  5FTK A;  3D8L A;  1GJT A;  5FTL A;  2O5R A;  4FWD A;  2JXN A;  4NRV A;  4AW4 A;  1N32 M;  1RU3 A;  3KOX E;  2V1C A;  1GKI A;  1MX0 A;  2BJW A;  4GC5 A;  4W5W A;  4BLC A;  1L2C A;  3LCV B;  4DUY M;  5L8R F;  2JZ0 A;  3FTD A;  5LMN M;  4CHT B;  3AV0 A;  2WZJ A;  3HX3 A;  3R8F A;  4WW0 A;  2GNO A;  5EP2 A;  5KQD A;  1NV9 A;  2BWB A;  2CFO A;  2XGN A;  2FNA A;  3PNV A;  4I8O A;  4PD2 A;  1R2Z A;  1LTM A;  2EKK A;  2R0I A;  2ERC A;  1OIZ A;  7CAT A;  1DGG A;  1PGY A;  1WGL A;  3TWK A;  2KRU A;  3GLF B;  2ZAO A;  3DOA A;  1N33 M;  1NNU C;  4AKG A;  3HY5 A;  4D82 A;  2VII A;  5FLX S;  3B89 A;  3LMM A;  2CV1 A;  2D7E A;  4LJA A;  4R3D A;  3GPX A;  2MR9 A;  2LBC A;  1KFV A;  4M9X A;  5EP3 A;  2RKO A;  2R4J A;  4DV0 M;  5E6J A;  2I7P A;  2DZL A;  1QDT A;  5DYI A;  4JV5 M;  4IBD A;  3UMM A;  2R65 A;  1IY2 A;  4LRS A;  4NL4 H;  4LCB A;  4MGZ E;  1Q3B A;  2QPA A;  4LJ9 A;  1SXJ C;  3W67 A;  2KW0 A;  4JXJ A;  4JI4 M;  1R4G A;  4GEW A;  1TF0 B;  4B7G A;  3M7G A;  5C1B A;  2ZM6 M;  3KS4 A;  1I4W A;  1TH3 A;  3GRY A;  2VF7 A;  3HHY A;  1HQY E;  2M60 A;  3QWL A;  2Z4S A;  2DVW B;  4JYA M;  3F92 A;  1VDD A;  2Q2E B;  3FRH A;  1QAN A;  3L2A A;  1Z5B A;  5F3W A;  1IXZ A;  2CHQ A;  1E9R A;  2XF3 A;  1VQ1 A;  2XSZ A;  2GQF A;  1HQC A;  1XXH E;  4Q7J A;  4PCZ A;  3SBJ A;  3T1H M;  3IG5 A;  3QAU A;  3C58 A;  3FE3 A;  1R7R A;  3LVV A;  2QZ4 A;  2CWB A;  3D8B A;  4M0D A;  3Q8X A;  4L16 A;  2DWL A;  2XH9 A;  2CP8 A;  2QNJ A;  4REZ A;  4ZPX A;  4AG5 A;  3V76 A;  4KHP M;  2YR0 A;  1IXS B;  5ITX A;  3IEC A;  3TPZ A;  3B7Z A;  2VQE M;  3CF2 A;  3BXW A;  4AG6 A;  2Z4R A;  3LVW A;  3MK6 A;  4KO8 A;  3WHL A;  2H5X A;  4B7F A;  2XZF A;  3ILK A;  4GKJ M;  5ITU A;  2A5Y B;  2P5T A;  1OQY A;  1VEJ A;  1K3X A;  1L2B A;  4L8R C;  4QNM A;  4MM3 B;  4GKK M;  4GMQ A;  5DFL A;  1PJQ A;  4L6V 6;  1TDZ A;  1TTE A;  3WHK A;  1F4I A;  1R2Y A;  4X66 M;  2DNA A;  1UM8 A;  3VFD A;  3SAV A;  1L2D A;  1GLN A;  2E5L M;  3B7N A;  4QNR A;  1JR3 D;  4HL4 A;  3KSX A;  1J7K A;  3FTC A;  3J2P B;  1Z5C A;  1J5E M;  1IBL M;  3MMP A;  4II7 A;  2RRU A;  3PFI A;  1HT1 E;  2KA6 B;  1N78 A;  3AOE C;  2B3T A;  3JR4 A;  3AFH A;  4GH9 A;  4XBO A;  2CV0 A;  3SC3 A;  4QHS A;  2W82 A;  4CIS A;  3HHZ A;  4DV7 M;  1MJG M;  1OFI A;  2X49 A;  1KSF X;  1YLA A;  3LCU A;  3U61 A;  4YY3 M;  3C3D A;  1GO5 A;  4X62 M;  4PDG A;  3AKZ A;  1T43 A;  4IBC A;  2D7H A;  5ITT A;  3HWS A;  4JI3 M;  1CUK A;  3SMP A;  2KDL A;  3TQS A;  3FUX A;  3U5Z A;  2LNH C;  2KHH A;  2L2D A;  2V6Z M;  3K9O A;  3UK6 A;  3R9X B;  4GHA A;  2LHG A;  4DR1 M;  4IBF A;  1R5L A;  3EIE A;  1MN3 A;  3AJI B;  1NJF A;  1DGH B;  1WGN A;  4QHT A;  4B3M M;  3M0E A;  1WR1 B;  3E9S A;  2WSE F;  4IJE A;  1L1Z A;  5EXP A;  4LY6 A;  1HNW M;  3M6A A;  4DR2 M;  3I01 M;  1K3W A;  4A3V B;  2HWJ A;  3LQQ A;  4MGI E;  2C96 A;  2DZN B;  2L6O A;  3DA1 A;  4HLQ A;  3FUW A;  1KYI A;  5A2Q S;  2QBY A;  2OOA A;  2CRU A;  2R45 A;  4FCV A;  1QUT A;  3L29 A;  4F2L A;  2CUZ A;  4FWH A;  4IBE A;  4HEO A;  4LF7 M;  2J7O A;  2Z7J A;  1HNX M;  3FUT A;  1GL7 A;  1NVM A;  3H4J A;  3E4R A;  2QCU A;  1ZAE A;  1JB0 F;  4M0W A;  4DR4 M;  3KW6 A;  2JP7 A;  2FFJ A;  4G3O A;  4BB9 A;  2ZTC A;  2JY5 A;  3GRR A;  1FNN A;  3MJ5 A;  1V92 A;  3HJS A;  3H4M A;  4GRI A;  4DR7 M;  1G59 A;  1GAB A;  1N77 A;  3VK8 A;  4FD2 A;  2DKL A;  3GPU A;  2DAE A;  3JR5 A;  4NSO B;  2C5R A;  4LJ8 A;  1DGB A;  2R4E A;  1DO2 A;  2F5O A;  2C9C A;  4MB7 A;  4XK8 F;  2MRO B;  1UFZ A;  3J80 S;  4G4N A;  3FTF A;  4Y28 F;  3HJ8 A;  1OIP A;  2R44 A;  2MH8 A;  2DZO B;  1T3T A;  2O25 A;  4L15 A;  3KOY E;  1VEK A;  2C99 A;  4LF9 M;  3DFZ A;  1NHW C;  2K6B A;  4MGK E;  1J09 A;  5JI3 E;  3NBX X;  4FVM A;  2APL A;  1XMQ M;  2HAK A;  1QAM A;  1JR3 E;  5BPV A;  2QBY B;  2C9O A;  3GLH B;  1AUA A;  2EO2 A;  4DBG B;  1C7Y A;  3SAT A;  4NXN M;  3GLG B;  4LF4 M;  2ZTD A;  2WSC F; 
#chains in the Genus database with same CATH homology
 3E46 A;  1WJ7 A;  1QZE A;  2MJ5 B;  2H5X A;  2K9D A;  1OAI A;  2DAG A;  3GLF E;  2DHY A;  1OQY A;  1VEJ A;  4R71 A;  5DFL A;  1TTE A;  1F4I A;  1WIV A;  3T6P A;  1EFU B;  2JUJ A;  2LVO C;  2KNA A;  4UN2 B;  2DNA A;  1Y8G A;  2JY7 A;  2DAK A;  2DI0 A;  2K0B X;  2BWE A;  1G4A E;  1ZV1 A;  2LVP C;  2EKF A;  2KNV A;  2LTU A;  3MMP A;  2RRU A;  1HT1 E;  3E21 A;  2B3T A;  1AIP C;  2DAM A;  1VDL A;  2DEN A;  1IFY A;  1YLA A;  3LCU A;  1GO5 A;  1IXS A;  1T43 A;  3BBZ A;  3LCV B;  1CUK A;  5JI2 E;  2JZ0 A;  1ZMV A;  3FRI A;  2KHH A;  2L2D A;  2WZJ A;  3K9O A;  1NV9 A;  2BWB A;  1G3I A;  2MGW A;  1ZMU A;  1MN3 A;  1WGN A;  1OTR A;  2R0I A;  2EKK A;  1G41 A;  1VG5 A;  1OKS A;  1WR1 B;  1WGL A;  1PGY A;  3GLI E;  3B89 A;  2OO9 A;  3IHP A;  2MR9 A;  2LBC A;  2HWJ A;  1BVS A;  4F1I A;  2QSF X;  1KYI A;  1HJP A;  2DZL A;  2OOA A;  2JZ1 A;  1DO0 A;  4F2L A;  2LVA A;  2JY8 A;  1SG9 A;  4HEO A;  1ZMW A;  3H4J A;  2QHO B;  1R4G A;  4GEW A;  2JNH A;  2JP7 A;  2G3Q A;  4G3O A;  2ZTC A;  1Q02 A;  1T6O A;  2JY5 A;  1HQY E;  1V92 A;  1TR8 A;  3F92 A;  1VEG A;  2EJS A;  3FRH A;  2DKL A;  2DAE A;  3GLH E;  1VQ1 A;  1IM2 A;  1XB2 B;  1DO2 A;  2OOB A;  1XXH E;  1UFZ A;  2MRO B;  4Q7J A;  3K9P A;  3GLG E;  2DAI A;  1WHC A;  1A5T A;  1DV0 A;  2O25 A;  2L4F A;  3FE3 A;  1VEK A;  1P3Q Q;  2JY6 B;  2CWB A;  2HAK A;  2LVQ D;  1JR3 E;  1HT2 E;  1E94 E;  2CP8 A;  2QNJ A;  4DBG B;  1C7Y A;  1NV8 A;  2LVN C;  3IEC A;  2L4E A;  4WP2 A;  2KNZ A;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...