2K0LA

Nmr structure of the transmembrane domain of the outer membrane protein a from klebsiella pneumoniae in dhpc micelles.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
210
structure length
210
Chain Sequence
b'ARIMKAIFVLNAAPKDNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVEWAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRFGQEDAAPVVAPAPAPAPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein A
publication title Solution state NMR structure and dynamics of KpOmpA, a 210 residue transmembrane domain possessing a high potential for immunological applications.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Membrane protein
total genus 17
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01389 OmpA_membrane OmpA-like transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2k0lA00
2MNHA 2LHFA 1QJPA 2GE4A 2ERVA 3QRAA 2JMMA 2F1VA 4PUXA 2N2MA 1G90A 4RLCA 2F1TA 1THQA 1ORMA 1BXWA 1P4TA 1Q9FA 2X27X 3QRCA 3G7GA 2M07A 1Q9GA 1QJ8A 3C5OA 2N2LA 1MM5A 1QJ9A 1MM4A 2K0LA 2MHLA 3GP6A 2M06A
chains in the Genus database with same CATH superfamily
1OPFA 1S5LO 2MNHA 2Y7SA 4FESA 4O3YA 3UU2A 4CTDA 4E1TA 5JDPA 2GE4A 4O49A 4FZMA 3V8UA 4O3ZA 2IWWA 4LSFA 1MPFA 2R8AA 3LK41 4N75A 4GHBA 3UAQA 2AXTO 2JMMA 2ZLDA 1ZHWA 3SYBA 4LSHA 4O3XB 4RLCA 4GCSA 3LK2A 3AA6A 5T5FA 4FSOA 3AAAB 4K3BA 3TZGA 2ODJA 3AA1B 2PORA 3HOLA 3A0BO 3AAEA 1YS5A 1BXWA 3VZTX 4AYEC 4FQEA 4AYNA 5EE2A 4U9CA 5GV0A 2X27X 3SY9A 3G7GA 2KDYA 4GCQA 5G38A 5IYUA 2XMXA 3VY9X 3NJTA 5DL7A 1QJ8A 4AYID 5KAFO 4G76A 4BUMX 4AKRA 4FRTA 3LK2B 2JQYA 2MHLA 3GP6A 3UPGA 3T24A 2LHFA 4N74A 3AA0B 1QJPA 2Y0LA 5AFUL 4AUIA 2KZ7A 3QRAA 3JTYA 3DWNA 4D5UA 4PR7A 1ZHTA 2R4OA 2XE1A 2X9KA 3KZIO 2WJRA 4O4XA 4AKRB 3POUA 3AA7A 4UB6O 4C69X 5ADXL 1GFOA 1T1LA 2FGQX 3POQA 5G39A 4FUVA 3HWBA 2KXPA 2XTRA 3RBHA 3SY7A 3WI4A 4D65A 8PRNA 4RJWA 5DL6A 4FMSA 5PRNA 3VZWX 4FRXA 2XG6A 2Y0KA 3VE1A 2W81C 3A2SX 1BT9A 4JCHA 3WU2O 2R88A 1IZNA 1QJ9A 2KC0A 1MM5A 1MM4A 3AA7B 1ZHZA 2K0LA 4IL6O 2YNKA 3AA6B 4KR8A 4KR4A 4XNLA 5D5DA 3VY8X 3FYXA 1H6S1 1BH3A 3HOEA 3LK3A 4QQ1A 4AYMC 3AAEB 4B61A 4LSEA 2ERVA 4O3WA 4F4BA 2F1CX 5KAIO 7PRNA 3DA4A 2IWVA 3PF1A 3PGUA 4N59A 2XE5A 4C4VA 4C00A 3BRZA 3PQUA 3PORA 2F1VA 3KVDD 2N2MA 5GTHO 1G90A 4E1SA 4FZLA 2J1NA 4O4UA 4FT6A 4FZNA 1ORMA 3PGSA 5TISO 3JCUO 2K4TA 4AZLA 1GFPA 2XE3A 1HXTA 1Q9FA 3DZMA 3QRCA 3K19A 3SYSA 5B66O 2M07A 6PRNA 4AYDC 1GFMA 2OMFA 3PQSA 2KZ7B 4N58A 3BRYA 1T16A 5AFUK 1OSMA 1ZHXA 3C5OA 5DL8A 2J4UP 4Z3TA 1ZHYA 1GFQA 3DA3A 2XTQA 3AA1A 4RL9A 3NSGA 2M06A 2LFUA 1GFNA 4KRAA 5E79O 4AKMA 2R89A 2YPVA 1HXUA 1PRNA 3A0HO 4K3CA 3SZDA 1PHOA 5ADXK 4D64A 2KXPB 3LK42 4GF4A 4PJ0O 2WVPA 3BS0A 5FVNA 3VE2A 4G75A 3T20A 4PUXA 2XE2A 4AFKA 3O0EA 2F1TA 2ZFGA 3AA0A 1IZNB 1THQA 3VZUX 2Y2XA 4FSPA 2R4PA 2FGRA 3DWOX 3PGRA 4FOZA 2W80C 2O4VA 1E54A 1P4TA 4GCPA 3LK3B 4JFBA 4LSIA 2R4NA 4RLBA 3SZVA 5H2FO 3HW9A 2PRNA 5DL5A 5GTIO 1Q9GA 3T0SA 4C4VB 4RJXA 3EMNX 1HXXA 3PRNA 4XNKA 5B5EO 2QTKA 2R4LA 2N2LA 2WJQA 4UB8O 5G26A 5G3AA 3WI5A 3AAAA 3POXA 2Y0HA
chains in the Genus database with same CATH topology
1OPFA 2MNHA 4O3YA 2Y7SA 4FESA 3UU2A 4E1TA 2GE4A 4O49A 4FZMA 3V8UA 4O3ZA 4LSFA 1MPFA 3LK41 4GHBA 3UAQA 2JMMA 2ZLDA 1ZHWA 3SYBA 4LSHA 4O3XB 4RLCA 4GCSA 3LK2A 3AA6A 5T5FA 4FSOA 3AAAB 3TZGA 2ODJA 3AA1B 2PORA 3HOLA 3AAEA 1YS5A 1BXWA 3VZTX 4AYEC 5GV0A 5EE2A 4U9CA 2X27X 3SY9A 3G7GA 2KDYA 4GCQA 5IYUA 2XMXA 3VY9X 5DL7A 1QJ8A 4AYID 4BUMX 4G76A 4AKRA 4FRTA 3LK2B 2MHLA 3GP6A 3UPGA 3T24A 2LHFA 3AA0B 1QJPA 2Y0LA 5AFUL 4AUIA 2KZ7A 3QRAA 3JTYA 4D5UA 1ZHTA 2XE1A 4O4XA 4AKRB 3POUA 3AA7A 4C69X 5ADXL 1GFOA 2FGQX 3POQA 4FUVA 3HWBA 2KXPA 2XTRA 3RBHA 3SY7A 3WI4A 4D65A 8PRNA 4RJWA 5DL6A 4FMSA 5PRNA 3VZWX 4FRXA 2XG6A 2Y0KA 3VE1A 2W81C 3A2SX 1BT9A 4JCHA 1IZNA 1QJ9A 2KC0A 1MM5A 1MM4A 3AA7B 1ZHZA 2K0LA 4KR8A 2YNKA 3AA6B 4KR4A 4XNLA 5D5DA 3VY8X 3FYXA 1H6S1 1BH3A 3HOEA 3LK3A 4QQ1A 4AYMC 3AAEB 4B61A 4LSEA 2ERVA 4O3WA 4F4BA 7PRNA 3DA4A 4N59A 2XE5A 3PQUA 3PORA 2F1VA 3KVDD 2N2MA 1G90A 4E1SA 4FZLA 2J1NA 4O4UA 4FT6A 4FZNA 1ORMA 2K4TA 4AZLA 1GFPA 2XE3A 1HXTA 1Q9FA 3QRCA 3K19A 2M07A 6PRNA 4AYDC 1GFMA 2OMFA 3PQSA 2KZ7B 4N58A 5AFUK 1OSMA 1ZHXA 3C5OA 5DL8A 2J4UP 4Z3TA 1ZHYA 1GFQA 3DA3A 2XTQA 3AA1A 4RL9A 3NSGA 2M06A 2LFUA 1GFNA 4KRAA 4AKMA 2YPVA 1HXUA 1PRNA 3SZDA 1PHOA 5ADXK 4D64A 2KXPB 3LK42 4GF4A 5FVNA 3VE2A 4G75A 3T20A 4PUXA 2XE2A 4AFKA 3O0EA 2F1TA 2ZFGA 3AA0A 1IZNB 1THQA 3VZUX 2Y2XA 4FSPA 4FOZA 2FGRA 3SYSA 4JFBA 5JDPA 2W80C 2O4VA 1E54A 1P4TA 4GCPA 3LK3B 4LSIA 4RLBA 3SZVA 4AYNA 3HW9A 2PRNA 5DL5A 1Q9GA 3T0SA 4RJXA 3EMNX 1HXXA 3PRNA 4XNKA 2QTKA 2N2LA 3WI5A 5G26A 3AAAA 3POXA 2Y0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNH A;  2LHF A;  1QJP A;  2GE4 A;  2ERV A;  3QRA A;  2JMM A;  2F1V A;  4PUX A;  2N2M A;  1G90 A;  4RLC A;  2F1T A;  1THQ A;  1ORM A;  1BXW A;  1P4T A;  1Q9F A;  2X27 X;  3QRC A;  3G7G A;  2M07 A;  1Q9G A;  1QJ8 A;  3C5O A;  2N2L A;  1MM5 A;  1QJ9 A;  1MM4 A;  2K0L A;  2MHL A;  3GP6 A;  2M06 A; 
#chains in the Genus database with same CATH topology
 1OPF A;  1S5L O;  2MNH A;  2Y7S A;  4FES A;  4O3Y A;  3UU2 A;  4CTD A;  4E1T A;  5JDP A;  2GE4 A;  4O49 A;  4FZM A;  3V8U A;  4O3Z A;  2IWW A;  4LSF A;  1MPF A;  2R8A A;  3LK4 1;  4N75 A;  4GHB A;  3UAQ A;  2AXT O;  2JMM A;  2ZLD A;  1ZHW A;  3SYB A;  4LSH A;  4O3X B;  4RLC A;  4GCS A;  3LK2 A;  3AA6 A;  5T5F A;  4FSO A;  3AAA B;  4K3B A;  3TZG A;  2ODJ A;  3AA1 B;  2POR A;  3HOL A;  3A0B O;  3AAE A;  1YS5 A;  1BXW A;  3VZT X;  4AYE C;  4FQE A;  4AYN A;  5EE2 A;  4U9C A;  5GV0 A;  2X27 X;  3SY9 A;  3G7G A;  2KDY A;  4GCQ A;  5G38 A;  5IYU A;  2XMX A;  3VY9 X;  3NJT A;  5DL7 A;  1QJ8 A;  4AYI D;  5KAF O;  4G76 A;  4BUM X;  4AKR A;  4FRT A;  3LK2 B;  2JQY A;  2MHL A;  3GP6 A;  3UPG A;  3T24 A;  2LHF A;  4N74 A;  3AA0 B;  1QJP A;  2Y0L A;  5AFU L;  4AUI A;  2KZ7 A;  3QRA A;  3JTY A;  3DWN A;  4D5U A;  4PR7 A;  1ZHT A;  2R4O A;  2XE1 A;  2X9K A;  3KZI O;  2WJR A;  4O4X A;  4AKR B;  3POU A;  3AA7 A;  4UB6 O;  4C69 X;  5ADX L;  1GFO A;  1T1L A;  2FGQ X;  3POQ A;  5G39 A;  4FUV A;  3HWB A;  2KXP A;  2XTR A;  3RBH A;  3SY7 A;  3WI4 A;  4D65 A;  8PRN A;  4RJW A;  5DL6 A;  4FMS A;  5PRN A;  3VZW X;  4FRX A;  2XG6 A;  2Y0K A;  3VE1 A;  2W81 C;  3A2S X;  1BT9 A;  4JCH A;  3WU2 O;  2R88 A;  1IZN A;  1QJ9 A;  2KC0 A;  1MM5 A;  1MM4 A;  3AA7 B;  1ZHZ A;  2K0L A;  4IL6 O;  2YNK A;  3AA6 B;  4KR8 A;  4KR4 A;  4XNL A;  5D5D A;  3VY8 X;  3FYX A;  1H6S 1;  1BH3 A;  3HOE A;  3LK3 A;  4QQ1 A;  4AYM C;  3AAE B;  4B61 A;  4LSE A;  2ERV A;  4O3W A;  4F4B A;  2F1C X;  5KAI O;  7PRN A;  3DA4 A;  2IWV A;  3PF1 A;  3PGU A;  4N59 A;  2XE5 A;  4C4V A;  4C00 A;  3BRZ A;  3PQU A;  3POR A;  2F1V A;  3KVD D;  2N2M A;  5GTH O;  1G90 A;  4E1S A;  4FZL A;  2J1N A;  4O4U A;  4FT6 A;  4FZN A;  1ORM A;  3PGS A;  5TIS O;  3JCU O;  2K4T A;  4AZL A;  1GFP A;  2XE3 A;  1HXT A;  1Q9F A;  3DZM A;  3QRC A;  3K19 A;  3SYS A;  5B66 O;  2M07 A;  6PRN A;  4AYD C;  1GFM A;  2OMF A;  3PQS A;  2KZ7 B;  4N58 A;  3BRY A;  1T16 A;  5AFU K;  1OSM A;  1ZHX A;  3C5O A;  5DL8 A;  2J4U P;  4Z3T A;  1ZHY A;  1GFQ A;  3DA3 A;  2XTQ A;  3AA1 A;  4RL9 A;  3NSG A;  2M06 A;  2LFU A;  1GFN A;  4KRA A;  5E79 O;  4AKM A;  2R89 A;  2YPV A;  1HXU A;  1PRN A;  3A0H O;  4K3C A;  3SZD A;  1PHO A;  5ADX K;  4D64 A;  2KXP B;  3LK4 2;  4GF4 A;  4PJ0 O;  2WVP A;  3BS0 A;  5FVN A;  3VE2 A;  4G75 A;  3T20 A;  4PUX A;  2XE2 A;  4AFK A;  3O0E A;  2F1T A;  2ZFG A;  3AA0 A;  1IZN B;  1THQ A;  3VZU X;  2Y2X A;  4FSP A;  2R4P A;  2FGR A;  3DWO X;  3PGR A;  4FOZ A;  2W80 C;  2O4V A;  1E54 A;  1P4T A;  4GCP A;  3LK3 B;  4JFB A;  4LSI A;  2R4N A;  4RLB A;  3SZV A;  5H2F O;  3HW9 A;  2PRN A;  5DL5 A;  5GTI O;  1Q9G A;  3T0S A;  4C4V B;  4RJX A;  3EMN X;  1HXX A;  3PRN A;  4XNK A;  5B5E O;  2QTK A;  2R4L A;  2N2L A;  2WJQ A;  4UB8 O;  5G26 A;  5G3A A;  3WI5 A;  3AAA A;  3POX A;  2Y0H A; 
#chains in the Genus database with same CATH homology
 1OPF A;  2MNH A;  4O3Y A;  2Y7S A;  4FES A;  3UU2 A;  4E1T A;  2GE4 A;  4O49 A;  4FZM A;  3V8U A;  4O3Z A;  4LSF A;  1MPF A;  3LK4 1;  4GHB A;  3UAQ A;  2JMM A;  2ZLD A;  1ZHW A;  3SYB A;  4LSH A;  4O3X B;  4RLC A;  4GCS A;  3LK2 A;  3AA6 A;  5T5F A;  4FSO A;  3AAA B;  3TZG A;  2ODJ A;  3AA1 B;  2POR A;  3HOL A;  3AAE A;  1YS5 A;  1BXW A;  3VZT X;  4AYE C;  5GV0 A;  5EE2 A;  4U9C A;  2X27 X;  3SY9 A;  3G7G A;  2KDY A;  4GCQ A;  5IYU A;  2XMX A;  3VY9 X;  5DL7 A;  1QJ8 A;  4AYI D;  4BUM X;  4G76 A;  4AKR A;  4FRT A;  3LK2 B;  2MHL A;  3GP6 A;  3UPG A;  3T24 A;  2LHF A;  3AA0 B;  1QJP A;  2Y0L A;  5AFU L;  4AUI A;  2KZ7 A;  3QRA A;  3JTY A;  4D5U A;  1ZHT A;  2XE1 A;  4O4X A;  4AKR B;  3POU A;  3AA7 A;  4C69 X;  5ADX L;  1GFO A;  2FGQ X;  3POQ A;  4FUV A;  3HWB A;  2KXP A;  2XTR A;  3RBH A;  3SY7 A;  3WI4 A;  4D65 A;  8PRN A;  4RJW A;  5DL6 A;  4FMS A;  5PRN A;  3VZW X;  4FRX A;  2XG6 A;  2Y0K A;  3VE1 A;  2W81 C;  3A2S X;  1BT9 A;  4JCH A;  1IZN A;  1QJ9 A;  2KC0 A;  1MM5 A;  1MM4 A;  3AA7 B;  1ZHZ A;  2K0L A;  4KR8 A;  2YNK A;  3AA6 B;  4KR4 A;  4XNL A;  5D5D A;  3VY8 X;  3FYX A;  1H6S 1;  1BH3 A;  3HOE A;  3LK3 A;  4QQ1 A;  4AYM C;  3AAE B;  4B61 A;  4LSE A;  2ERV A;  4O3W A;  4F4B A;  7PRN A;  3DA4 A;  4N59 A;  2XE5 A;  3PQU A;  3POR A;  2F1V A;  3KVD D;  2N2M A;  1G90 A;  4E1S A;  4FZL A;  2J1N A;  4O4U A;  4FT6 A;  4FZN A;  1ORM A;  2K4T A;  4AZL A;  1GFP A;  2XE3 A;  1HXT A;  1Q9F A;  3QRC A;  3K19 A;  2M07 A;  6PRN A;  4AYD C;  1GFM A;  2OMF A;  3PQS A;  2KZ7 B;  4N58 A;  5AFU K;  1OSM A;  1ZHX A;  3C5O A;  5DL8 A;  2J4U P;  4Z3T A;  1ZHY A;  1GFQ A;  3DA3 A;  2XTQ A;  3AA1 A;  4RL9 A;  3NSG A;  2M06 A;  2LFU A;  1GFN A;  4KRA A;  4AKM A;  2YPV A;  1HXU A;  1PRN A;  3SZD A;  1PHO A;  5ADX K;  4D64 A;  2KXP B;  3LK4 2;  4GF4 A;  5FVN A;  3VE2 A;  4G75 A;  3T20 A;  4PUX A;  2XE2 A;  4AFK A;  3O0E A;  2F1T A;  2ZFG A;  3AA0 A;  1IZN B;  1THQ A;  3VZU X;  2Y2X A;  4FSP A;  4FOZ A;  2FGR A;  3SYS A;  4JFB A;  5JDP A;  2W80 C;  2O4V A;  1E54 A;  1P4T A;  4GCP A;  3LK3 B;  4LSI A;  4RLB A;  3SZV A;  4AYN A;  3HW9 A;  2PRN A;  5DL5 A;  1Q9G A;  3T0S A;  4RJX A;  3EMN X;  1HXX A;  3PRN A;  4XNK A;  2QTK A;  2N2L A;  3WI5 A;  5G26 A;  3AAA A;  3POX A;  2Y0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...