2K1AA

Bicelle-embedded integrin alpha(iib) transmembrane segment
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
b'GALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Cell adhesion
source organism Homo sapiens
publication title Structure of the Integrin {alpha}IIb Transmembrane Segment.
pubmed doi rcsb
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2k1aA00
2K9JA 2K1AA 2M3EA 2KNCA
chains in the Genus database with same CATH superfamily
1N7LA 1EDLA 4UB8E 1S5LH 1IJDB 2RN0A 1OW7A 1ZOYC 1NU1E 2G3AA 3HE5A 3L70D 1SFCC 3CX5I 3S4RA 1X0TA 3LW5J 3B5NC 3BASA 3HTKB 2LXBA 1EZVE 5APSA 2KK7A 2N1TA 4EI2A 3L73J 1VQ8P 3L71D 5AVZB 3R4YA 1VQ9P 1LT1A 1R5SA 3CL3D 4C7RA 5AW6B 3CD6P 3H1HD 3H1JD 3RK2B 3VMAA 3R2PA 2XKMA 1FBMA 3H1JJ 3H1LJ 3L75D 4KHXA 1YJNP 4TT3H 1SQQJ 4W7ZA 2KS1B 2NRGA 2IYOA 3HE4B 1BCCD 3NFQA 1GK6A 1S9KE 3KZIE 2QRXA 5AVXB 2BCCE 1PPJD 2GM4A 1JB0J 2KOGA 4N78E 3D6YA 1YQ3C 4RJTA 2W27A 4H13D 5E79E 1FOSF 4C7NA 3AE5C 3RK3B 1N8RQ 4JF7A 3BRVB 1NTMG 4RO0A 2P2UA 2ZVOB 1JY3P 5TISE 1MFZA 1J1EB 1NU1K 1RY3A 5GTIH 3T97B 3WUTA 1VQ6P 1HBWA 1LP1B 5E79H 1PIXA 1QL1A 4BRYA 1KD1Q 5B5EH 2WQYC 1Q2NA 2YXRB 1GW4A 3M9HA 2JJLA 4D6TG 4QMAA 3RBXA 4I2LC 2W6JH 2D2CB 1ZXGA 2KZJA 3P32A 4IOIH 3H1LG 2WPQA 1OVVA 2ZVNB 3V2QA 1A02J 4LGDE 3RGUA 1BGYJ 1GTWA 1SQXE 2ZT9B 3H1ID 4Y28J 1QEXA 4Y99B 1ZMEC 1YI2P 1PGJA 1VQOP 2O01H 1LTTC 3L37A 2JDIH 1ZLLA 3W67A 1NHLA 1ZP0C 2A06E 3HTKA 4L75A 2Q9IA 1R5LA 1FJPA 3SFEC 5AW5B 4I7ZB 1OVUA 3CCJP 2FYUG 1GD2E 4AYCA 3M06A 1N73B 1NTKE 1NTZJ 1IFJA 1NTZE 2JR8A 2B88A 2QJYC 3FGAD 3L72D 1SQVJ 2K88A 1Y47A 2BASA 2KIKA 2LR2A 1SQVD 2P58A 3MIWA 4GDOA 4EIJA 1VQNP 1NO4A 1LT9A 1N2DC 3L35A 1OMIA 2IFNA 4CPGA 1KQGB 3GW6A 1PZQA 3G71P 1VQKP 1JOCA 4B86A 1JMBA 1BE3D 1P84D 2Y0EA 1SQQD 1NJIQ 3BVHA 1RF1B 1SQXD 1ZRTE 1J1DB 1D7MA 1Q90D 2XV5A 3H1IE 1HGVA 3L75J 2E76B 3PLNA 1SQXK 3G9RA 4K3AA 2LXCB 4U3FE 4RESB 3RL0g 1AQ5A 4PJ0H 2K1AA 2KYVA 1KYOH 2G8YA 1IFMA 3NMDA 5H2FH 4OGQB 3RK3E 1CI6B 1W5CE 4H44C 5KJ7A 1VQ4P 1T3UA 2M5AB 4HH2A 3VOPA 2Z5IA 1SQPJ 2ZAEB 1S72P 2KNCB 1HTLC 3VN0A 2WSEJ 1P84I 1OVRA 1NU1J 2FXMA 2ZJSE 1PP9D 3MUDC 4YXWH 2E5TA 1RQUA 1VF5D 3H1JG 5DJTB 5B5EE 1NTMK 2I1JA 2PAJA 2WVRA 3KXDA 3H6PA 2FXOA 2QJKB 3P8CE 1VQMP 3P7KA 4N6JA 1FAVA 1NOHA 1W2BO 3H32A 3RL0D 2BCCD 1ZV8A 1J2JB 2KLVA 2A45H 4PD4E 2Q3IA 1NGMB 3A0HH 4XE5B 1ZW0A 1L0NE 1GL2A 1M7LA 2P7JA 3CX5H 4L76A 5APQA 2R32A 3HUSA 3FWLA 2E74C 1JTHB 2YKOA 3KYQA 4BXLA 1XTGB 3KDPB 2W83C 3H1JE 4H13C 5KLVD 5GTHE 3KZIH 4H44B 1FZFA 5KKZC 5M1BA 5TJHA 3Q1MA 3AEAC 1DD4A 1YYCA 3KPEA 3MHVA 4IL6E 5APXA 4DZOA 2O01J 1N7SA 4PD4H 2XNXA 1PP9J 1JM0A 5APTA 3TGUJ 1NU1D 3L70E 4NPEA 4D6TD 1Y8AA 2OTLP 1KV4A 1IFIA 4IFMA 3UIAA 1X8YA 1LTIC 3PP5A 3A0BE 1LGHB 2E75C 3L73D 3M0DA 1KQSO 1RF0A 2YMKA 1S5LE 3EFFK 1ZN5A 1JTHA 3RK2C 3GHGB 3TDKA 3CMEP 1KILE 1NAYA 2ZYDA 4KJMA 4IL6H 2B9BA 4WVZA 3H1KE 2OYHB 1BE3J 1YITP 2Y9YA 1SQXJ 2K37A 3GG2A 3HD7A 2IBZG 3GLMA 2YMYA 4GOFA 4PV1C 3HD7B 4OVNF 5KKZB 3CCRP 2PGDA 3CCSP 1URQC 1J1DC 3F5HA 1EC5A 2P10A 3PH0A 1FZEA 3L74J 2UWJE 4WB4A 2IBZD 1NKNA 2RMZA 2VRSA 2NPSA 1J1EC 1NTZD 2FXPA 3G3ZA 1S1CX 1PP9E 5B66E 1AVYA 1QGKB 2N1TD 1VF5C 3H1KD 3FXEA 1N73A 2B87B 4U3FJ 2OYIA 1KB9H 2O3JA 1SQBJ 2Y0DA 4C7NB 3Q5PA 2I8DA 1HWTC 1DX7A 4XFJA 3QWOC 1X79B 2R5DA 1NVOA 1OXZA 2W6BA 3L71J 1N7SB 4Z1MH 1IO4A 2Z5HA 3CX5E 1DEEG 5BVZA 3D71A 3CC4P 1FU1A 2IBZI 2P1JA 4D6TE 3TNUB 1VQPP 1Q81Q 1FZGA 2Q1KA 1GL2C 1BGYE 1FJKA 3IF4A 3L72E 4N3YB 2HYNA 2QIWA 2ZXXA 1JMMA 2D2CD 4HKZH 1FDIA 3VP9A 2NPSD 2V7QJ 1JY2O 5AW9B 5KLVE 1M8OB 2AEJA 2M0BA 2OQQA 3USSA 2QJKC 1N73C 3HE5B 2QVAA 3GF3A 1JY2P 3CMAP 1S9KD 1YIJP 1SFCA 2HG5D 5CCGC 1SLQA 1Z56A 1FE6A 3OJAB 2XNDH 2A45I 1AQTA 1RH5B 2BCCG 2IBZE 2RH0A 3B4SA 2AXCA 4L73A 4U7JA 2QM7A 5APWA 3TNUA 3RK3D 3VP8A 1HJBA 2PP6A 2YO2A 5AW0B 2H8PD 4H13B 5AW4B 1YJ9P 1DD3A 2KUBA 3AE7C 2JP3A 4ZNCA 1M90Q 2C9NY 3L73E 5AW3B 1GDTA 4YTPC 1CI6A 1NKZB 2E75B 3VYIA 3H1IJ 2POHA 1CZQA 3CWBD 3EWKA 3RBZA 2IFMA 3H1LD 3CCQP 3RK3C 3JC22 4DT0A 1K9MQ 3AEEC 3D6ZA 1H0TB 1S4XA 2R44A 3L71E 3AE3C 4Y99C 3AEGC 1L4AB 3CXHE 2QM8A 1M1JA 2GUSA 1AA0A 1SFCD 3L74D 5CJ0A 2YKPA 2HFED 1ZR4A 2IZ0A 2Z4EA 1URQB 1SVFA 2JEEA 3A7OA 1ZRTD 1NTKK 3H1KJ 3M9QA 3L72J 1BCCE 2PFXA 2OYIC 2N9BA 3L36A 1SFCB 1OIPA 1QVGO 3L75E 1LTJB 4PJ0E 3P8CD 1H88A 1K04A 4WY4C 5AW7B 2W6AA 3F89A 4LC1A 1JUNA 1DEBA 2C0WA 3OAKA 5APYA 2HPCB 1GL2D 2C0XA 1FDMA 3E1IA 2KS1A 3PTZA 2FYUE 2JWDA 2BEZF 3CWBE 1L0ND 3A5TA 1S2EA 2J58A 3CWBJ 4HYTB 4XA4A 3GHGA 1EXJA 3MP7B 1NTMJ 4L74A 4JYCA 3TK1A 1BE3E 1KMIZ 2OGUA 3HRNA 1NTZG 3AECC 3L74E 1TU3F 1T6AA 2J5UA 3S9OA 4H0LD 1WRGA 1JY3N 1EQ7A 1KFMA 2QEXP 2OARA 2OTJP 1LTJA 4D6TJ 1HVVA 2K9JA 2YIUB 2FYNC 3H1HG 3L70J 5KAIE 4U3FD 3FWNA 2B87A 4TLFA 1GK4A 4DJGA 2Q6QA 2WT7B 5CCGD 1L0LJ 5AVUB 3D70A 1L2PA 1P84E 1URQA 2LKMA 2NPSB 2RKLA 2M3BA 3IR9A 5C39A 3V5BA 1Q82Q 4GIFA 1K05A 1JY3O 2A45G 4O9BA 5AVRB 5AVQB 1CSBA 2I1KA 4JPZB 1U7MA 3RL0C 1A02F 4GODA 1H0TA 1IK9A 2FFDB 3BCCJ 1BCCJ 1YTZT 3AEFC 4PV1B 3A0BH 1GW3A 3AE2C 2ITAA 2IZ1A 3E7KA 1NWQA 1IFPA 1E5WA 1KORA 2AEFA 2O01N 2OTKE 1KILD 2V7QH 1VL2A 2ZYAA 3BATA 3M0DC 1BDDA 1N7SD 1BGYG 1Q86Q 1YQ4C 1PGOA 1SQPD 2WPSA 2WPVB 2KLUA 4DOJA 5GTIE 2R3SA 5KLVG 3ABVC 1IC2A 3P8MC 1RE3A 1PPJG 4EYYQ 3MUDA 1LNQA 2N1TB 3JSVC 2WTYA 1HF9A 1L4AC 1DIPA 1SQBD 2KXPB 1KILC 3V6IA 5CJ4A 5CCHA 5H2FE 3TYYA 4PD4I 1SQQE 2JKVA 2A06D 3B5ND 3H1IG 4WWIA 3MD0A 3MTUE 4WY4A 1QVFO 1G2CB 1XTCC 3CX5D 2N9YB 3Q5RA 3S1KA 1JCDA 1QX8A 1QLED 3GMAA 1AJYA 2K3RA 3O6QB 2FFDC 1MFTA 1OW6A 3CCLP 2PRRA 1RF1C 4OH8B 3GHGC 1KYOE 2NZ2A 2FYUD 3BCCD 3HUSB 3NXSA 5CMZA 2E42A 3ITKA 4PD4D 1X22A 4WBAA 3L72G 3O8ZA 1X9VA 1VQLP 1RHZB 3AE1C 5AW1B 1MUUA 2QE7H 3MGNA 4YXDC 4LLHA 4WY4B 4YPCA 3IAOA 4GT1A 4JBZA 3SSUA 3CCUP 1NTZK 2CK3H 3LIDA 1VQ7P 2GUVA 1SQVK 2AXTE 3B5NA 3B71A 3JCUE 5GTHH 5AW8B 1L4AD 1IFNA 4ZMDA 3H1KG 2KI7B 1EZVD 1KQLA 1T3JA 3A0HE 4H44D 4NPFX 2CPSA 1KB9I 2K9YA 1OW8A 4HB1A 5APVA 3CCMP 2Y9ZA 5K5GB 3HD7C 4A7PA 1EDIA 1MKMA 4ZKPA 1S3JA 1HH0A 2AEMA 2HR3A 3VTPC 2HPCA 1AVOA 4EOTA 2JO1A 1EDJA 1SS1A 1EZVG 1UIIA 1YTZI 1YBKA 3N4XA 2FYUJ 1PP9G 3RL0B 2SPZA 4JQ0D 1BE3G 1ZR2A 2OYHA 5KAFH 1EDKA 3L70G 4EDFA 1AFOA 1YJWP 4U3FG 3I5CA 1EZVI 1LP1A 2WSCH 1L0LG 1LTBC 1SQQK 1VF5B 2NPSC 3AE4C 3IN6A 1KB9D 1OFCX 1OX3A 4W80A 3V4QA 3ZDMA 3CXHH 3L71G 1OWAA 1FZCA 3FX0A 2KSEA 4MN4C 1KQFB 3U59A 5CBNA 2CPBA 3M0AA 4IL6X 1L4AA 1PGQA 1RE4C 1H8AA 1M56D 3CCEP 3WUVA 5CCHC 2K9JB 1JY2N 1L0LD 2H88C 3L75G 5KLVK 1R8EA 2IX7C 1GMJA 2M3EA 4H0LC 3H1HE 3IFMA 1BCCG 3H1HJ 3EQ2A 5TISH 4AUWA 2KB7P 3WU2E 3HE4A 2J59M 3TGUG 1MV8A 1JNMA 3EFGA 3NTNA 5BU8B 3CPWO 1GU5A 1OZHA 1S5LX 1BGYD 3AE9C 4M3LA 3CC2P 1SQPG 3U1CA 1U7JA 2FBWC 2WSCJ 1NTMD 2N1TC 1IK7A 1NU1G 1WT6A 4R4LA 3TGUD 1PV3A 2QJPC 2XU6A 2Q7CA 3CWBG 1KC8Q 2IPPA 1SQBG 1U57A 3TGUE 3L73G 2QG4A 3WU2H 2FKWB 2L91A 2YIUC 1NAFA 2YXQB 3I56P 3TSIA 1MZ9A 2A06G 1K8AQ 5CHXA 2FYZA 3M9BA 5CCGA 1JO5A 5AVVB 4BRYB 1T2KD 3SWKA 3V2RA 4BWNA 4I6MC 2KP8A 2WMMA 4H0LB 1Y9BA 5KAIH 2O1JA 2KSJA 5BU5A 1FOSE 5AVYB 1NTKG 1KYOI 4KT0J 3BRTB 1LTSC 3HD7D 4JYBA 3U1AA 1L0LE 1LTJC 2Q5UA 2R5BA 1RE3C 1USEA 2H89C 2WSSH 3KHUA 4GKGA 3L4FA 4IFFA 3SWYA 1GU4A 1L0LK 4UB6H 1P84H 2W8ZA 1NH4A 1JCCA 1NYHA 2HLOA 2FYUK 3CXHI 2Q3EA 1VPCA 2HODA 4NPDA 3SFDC 5EFWB 2DW3A 3W68A 3PJSK 3Q5SA 1W2EA 3SWFA 2IYPA 1M1JC 2B89A 1KYOD 2P67A 3BCCE 2L5GB 3C8VA 4UB8H 1FZAA 3AEDC 1AV1A 1FC2C 2MKVA 5CCHD 2YO3A 1DH3A 4C46A 1KFNA 1IFDA 1FDOA 1URQD 2V4HA 2WSFJ 3E1RA 1RE4A 4WY4D 3PHLA 3V2NA 3CXHD 1SQBK 1UIXA 3JCUH 3V2PA 1SQQG 3WMM0 1T2KC 1SQXG 1SQPK 4DCKA 3A3YB 2GA1A 2D2CC 2JWAA 2OYOA 3H1LE 4OWFA 4N78D 1PGPA 1PPJE 2BCCJ 3CI9A 3VMZA 1LWUC 1K73Q 3M91A 2YKQA 1H89A 1L0NK 3AE8C 2H43A 2OYIB 2M8RA 3HUSC 1KILA 2E75D 2ZT9C 3H25A 3KQGA 1HGZA 4W7YA 1BSNA 3RK2D 5AVWB 2E43A 1PL5A 4RKUJ 2XDJA 1VQ5P 2IDBA 2WITA 2ZYGA 2WT7A 2R3CA 5AW2B 1NTME 3B5NB 3Q2YA 3PRJA 4I7ZC 1USDA 3A2AA 1IZNB 3OA7A 5KAFE 4IFDK 1G1JA 2Y0CA 4GOEA 1N86A 4AQRD 1CW5A 2WSEH 3T97A 3QH9A 5CBOA 1FZCB 1LTGC 1FS0E 3C1LA 3OW2O 5KJ7C 3FXDA 5AVTB 5B66H 1FZBA 1KILB 4OGQD 5KLIC 2XZRA 1BDCA 2FY8A 1HJ0A 2E74D 3O6QA 4PV1D 2E76D 3V4WA 1FZCC 3L74G 1T8ZA 3AEBC 3AE6C 3C9IA 3VMYA 1G2CA 1LT9C 2E5YA 3II6A 4OGQC 3CCVP 3B8EB 3CC7P 2WWWA 2ZXEB 1SQPE 2YNYA 3BCCG 5KJ7D 3VMXA 1KZUB 5APUA 1SQVE 1SQBE 1LJ2A 3WUUA 2WSFH 5L8RJ 1PFIA 1NTKJ 2KNCA 3K5BA 1M1JB 4R4MA 1NTKD 3N7NA 1WMKA 2O1KA 4ASVA 3G4SP 2M5AA 2FYNB 4K35A 1L0NG 1LTAC 2BEQD 1RQVA 1SP4A 3Q3DA 2HODB 4ASWA 2OYHC 4I1LA 3LW5H 5KLIB 1QL2A 1Q7YQ 3LIEA 1EXIA 5AVSB 3CLQA 2QJYB 1SQVG 3GF7A 1N7SC 2FFDA 1HUCA 1VDFA 2QSIA 1L0NJ 2C9LY 1LWUA 3MZWB 2ZT9D 2KZIA 1JEKA 1GZLA 2WPRA 3G6EP 1RF1A 1KN7A 1G1IA 2QA4P 1M57D 2WZ7A 5KLVJ 2H7HA 1KTMA 2E74B 4ZKUA 1GL2B 1E79H 1LT9B 1LWUB 1KB9E 2QJPB 4HJGH 4UB6E 2AXTH 2MJZA 3I55P 1M1KQ 5KTBA 5DJUB 2ZFCA 1RF0C 3H32B 2E76C 1BSHA 2W90A 1YHQP 3TF5A
chains in the Genus database with same CATH topology
2K9JA 2K1AA 2M3EA 2KNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9J A;  2K1A A;  2M3E A;  2KNC A; 
#chains in the Genus database with same CATH topology
 1N7L A;  1EDL A;  4UB8 E;  1S5L H;  1IJD B;  2RN0 A;  1OW7 A;  1ZOY C;  1NU1 E;  2G3A A;  3HE5 A;  3L70 D;  1SFC C;  3CX5 I;  3S4R A;  1X0T A;  3LW5 J;  3B5N C;  3BAS A;  3HTK B;  2LXB A;  1EZV E;  5APS A;  2KK7 A;  2N1T A;  4EI2 A;  3L73 J;  1VQ8 P;  3L71 D;  5AVZ B;  3R4Y A;  1VQ9 P;  1LT1 A;  1R5S A;  3CL3 D;  4C7R A;  5AW6 B;  3CD6 P;  3H1H D;  3H1J D;  3RK2 B;  3VMA A;  3R2P A;  2XKM A;  1FBM A;  3H1J J;  3H1L J;  3L75 D;  4KHX A;  1YJN P;  4TT3 H;  1SQQ J;  4W7Z A;  2KS1 B;  2NRG A;  2IYO A;  3HE4 B;  1BCC D;  3NFQ A;  1GK6 A;  1S9K E;  3KZI E;  2QRX A;  5AVX B;  2BCC E;  1PPJ D;  2GM4 A;  1JB0 J;  2KOG A;  4N78 E;  3D6Y A;  1YQ3 C;  4RJT A;  2W27 A;  4H13 D;  5E79 E;  1FOS F;  4C7N A;  3AE5 C;  3RK3 B;  1N8R Q;  4JF7 A;  3BRV B;  1NTM G;  4RO0 A;  2P2U A;  2ZVO B;  1JY3 P;  5TIS E;  1MFZ A;  1J1E B;  1NU1 K;  1RY3 A;  5GTI H;  3T97 B;  3WUT A;  1VQ6 P;  1HBW A;  1LP1 B;  5E79 H;  1PIX A;  1QL1 A;  4BRY A;  1KD1 Q;  5B5E H;  2WQY C;  1Q2N A;  2YXR B;  1GW4 A;  3M9H A;  2JJL A;  4D6T G;  4QMA A;  3RBX A;  4I2L C;  2W6J H;  2D2C B;  1ZXG A;  2KZJ A;  3P32 A;  4IOI H;  3H1L G;  2WPQ A;  1OVV A;  2ZVN B;  3V2Q A;  1A02 J;  4LGD E;  3RGU A;  1BGY J;  1GTW A;  1SQX E;  2ZT9 B;  3H1I D;  4Y28 J;  1QEX A;  4Y99 B;  1ZME C;  1YI2 P;  1PGJ A;  1VQO P;  2O01 H;  1LTT C;  3L37 A;  2JDI H;  1ZLL A;  3W67 A;  1NHL A;  1ZP0 C;  2A06 E;  3HTK A;  4L75 A;  2Q9I A;  1R5L A;  1FJP A;  3SFE C;  5AW5 B;  4I7Z B;  1OVU A;  3CCJ P;  2FYU G;  1GD2 E;  4AYC A;  3M06 A;  1N73 B;  1NTK E;  1NTZ J;  1IFJ A;  1NTZ E;  2JR8 A;  2B88 A;  2QJY C;  3FGA D;  3L72 D;  1SQV J;  2K88 A;  1Y47 A;  2BAS A;  2KIK A;  2LR2 A;  1SQV D;  2P58 A;  3MIW A;  4GDO A;  4EIJ A;  1VQN P;  1NO4 A;  1LT9 A;  1N2D C;  3L35 A;  1OMI A;  2IFN A;  4CPG A;  1KQG B;  3GW6 A;  1PZQ A;  3G71 P;  1VQK P;  1JOC A;  4B86 A;  1JMB A;  1BE3 D;  1P84 D;  2Y0E A;  1SQQ D;  1NJI Q;  3BVH A;  1RF1 B;  1SQX D;  1ZRT E;  1J1D B;  1D7M A;  1Q90 D;  2XV5 A;  3H1I E;  1HGV A;  3L75 J;  2E76 B;  3PLN A;  1SQX K;  3G9R A;  4K3A A;  2LXC B;  4U3F E;  4RES B;  3RL0 g;  1AQ5 A;  4PJ0 H;  2K1A A;  2KYV A;  1KYO H;  2G8Y A;  1IFM A;  3NMD A;  5H2F H;  4OGQ B;  3RK3 E;  1CI6 B;  1W5C E;  4H44 C;  5KJ7 A;  1VQ4 P;  1T3U A;  2M5A B;  4HH2 A;  3VOP A;  2Z5I A;  1SQP J;  2ZAE B;  1S72 P;  2KNC B;  1HTL C;  3VN0 A;  2WSE J;  1P84 I;  1OVR A;  1NU1 J;  2FXM A;  2ZJS E;  1PP9 D;  3MUD C;  4YXW H;  2E5T A;  1RQU A;  1VF5 D;  3H1J G;  5DJT B;  5B5E E;  1NTM K;  2I1J A;  2PAJ A;  2WVR A;  3KXD A;  3H6P A;  2FXO A;  2QJK B;  3P8C E;  1VQM P;  3P7K A;  4N6J A;  1FAV A;  1NOH A;  1W2B O;  3H32 A;  3RL0 D;  2BCC D;  1ZV8 A;  1J2J B;  2KLV A;  2A45 H;  4PD4 E;  2Q3I A;  1NGM B;  3A0H H;  4XE5 B;  1ZW0 A;  1L0N E;  1GL2 A;  1M7L A;  2P7J A;  3CX5 H;  4L76 A;  5APQ A;  2R32 A;  3HUS A;  3FWL A;  2E74 C;  1JTH B;  2YKO A;  3KYQ A;  4BXL A;  1XTG B;  3KDP B;  2W83 C;  3H1J E;  4H13 C;  5KLV D;  5GTH E;  3KZI H;  4H44 B;  1FZF A;  5KKZ C;  5M1B A;  5TJH A;  3Q1M A;  3AEA C;  1DD4 A;  1YYC A;  3KPE A;  3MHV A;  4IL6 E;  5APX A;  4DZO A;  2O01 J;  1N7S A;  4PD4 H;  2XNX A;  1PP9 J;  1JM0 A;  5APT A;  3TGU J;  1NU1 D;  3L70 E;  4NPE A;  4D6T D;  1Y8A A;  2OTL P;  1KV4 A;  1IFI A;  4IFM A;  3UIA A;  1X8Y A;  1LTI C;  3PP5 A;  3A0B E;  1LGH B;  2E75 C;  3L73 D;  3M0D A;  1KQS O;  1RF0 A;  2YMK A;  1S5L E;  3EFF K;  1ZN5 A;  1JTH A;  3RK2 C;  3GHG B;  3TDK A;  3CME P;  1KIL E;  1NAY A;  2ZYD A;  4KJM A;  4IL6 H;  2B9B A;  4WVZ A;  3H1K E;  2OYH B;  1BE3 J;  1YIT P;  2Y9Y A;  1SQX J;  2K37 A;  3GG2 A;  3HD7 A;  2IBZ G;  3GLM A;  2YMY A;  4GOF A;  4PV1 C;  3HD7 B;  4OVN F;  5KKZ B;  3CCR P;  2PGD A;  3CCS P;  1URQ C;  1J1D C;  3F5H A;  1EC5 A;  2P10 A;  3PH0 A;  1FZE A;  3L74 J;  2UWJ E;  4WB4 A;  2IBZ D;  1NKN A;  2RMZ A;  2VRS A;  2NPS A;  1J1E C;  1NTZ D;  2FXP A;  3G3Z A;  1S1C X;  1PP9 E;  5B66 E;  1AVY A;  1QGK B;  2N1T D;  1VF5 C;  3H1K D;  3FXE A;  1N73 A;  2B87 B;  4U3F J;  2OYI A;  1KB9 H;  2O3J A;  1SQB J;  2Y0D A;  4C7N B;  3Q5P A;  2I8D A;  1HWT C;  1DX7 A;  4XFJ A;  3QWO C;  1X79 B;  2R5D A;  1NVO A;  1OXZ A;  2W6B A;  3L71 J;  1N7S B;  4Z1M H;  1IO4 A;  2Z5H A;  3CX5 E;  1DEE G;  5BVZ A;  3D71 A;  3CC4 P;  1FU1 A;  2IBZ I;  2P1J A;  4D6T E;  3TNU B;  1VQP P;  1Q81 Q;  1FZG A;  2Q1K A;  1GL2 C;  1BGY E;  1FJK A;  3IF4 A;  3L72 E;  4N3Y B;  2HYN A;  2QIW A;  2ZXX A;  1JMM A;  2D2C D;  4HKZ H;  1FDI A;  3VP9 A;  2NPS D;  2V7Q J;  1JY2 O;  5AW9 B;  5KLV E;  1M8O B;  2AEJ A;  2M0B A;  2OQQ A;  3USS A;  2QJK C;  1N73 C;  3HE5 B;  2QVA A;  3GF3 A;  1JY2 P;  3CMA P;  1S9K D;  1YIJ P;  1SFC A;  2HG5 D;  5CCG C;  1SLQ A;  1Z56 A;  1FE6 A;  3OJA B;  2XND H;  2A45 I;  1AQT A;  1RH5 B;  2BCC G;  2IBZ E;  2RH0 A;  3B4S A;  2AXC A;  4L73 A;  4U7J A;  2QM7 A;  5APW A;  3TNU A;  3RK3 D;  3VP8 A;  1HJB A;  2PP6 A;  2YO2 A;  5AW0 B;  2H8P D;  4H13 B;  5AW4 B;  1YJ9 P;  1DD3 A;  2KUB A;  3AE7 C;  2JP3 A;  4ZNC A;  1M90 Q;  2C9N Y;  3L73 E;  5AW3 B;  1GDT A;  4YTP C;  1CI6 A;  1NKZ B;  2E75 B;  3VYI A;  3H1I J;  2POH A;  1CZQ A;  3CWB D;  3EWK A;  3RBZ A;  2IFM A;  3H1L D;  3CCQ P;  3RK3 C;  3JC2 2;  4DT0 A;  1K9M Q;  3AEE C;  3D6Z A;  1H0T B;  1S4X A;  2R44 A;  3L71 E;  3AE3 C;  4Y99 C;  3AEG C;  1L4A B;  3CXH E;  2QM8 A;  1M1J A;  2GUS A;  1AA0 A;  1SFC D;  3L74 D;  5CJ0 A;  2YKP A;  2HFE D;  1ZR4 A;  2IZ0 A;  2Z4E A;  1URQ B;  1SVF A;  2JEE A;  3A7O A;  1ZRT D;  1NTK K;  3H1K J;  3M9Q A;  3L72 J;  1BCC E;  2PFX A;  2OYI C;  2N9B A;  3L36 A;  1SFC B;  1OIP A;  1QVG O;  3L75 E;  1LTJ B;  4PJ0 E;  3P8C D;  1H88 A;  1K04 A;  4WY4 C;  5AW7 B;  2W6A A;  3F89 A;  4LC1 A;  1JUN A;  1DEB A;  2C0W A;  3OAK A;  5APY A;  2HPC B;  1GL2 D;  2C0X A;  1FDM A;  3E1I A;  2KS1 A;  3PTZ A;  2FYU E;  2JWD A;  2BEZ F;  3CWB E;  1L0N D;  3A5T A;  1S2E A;  2J58 A;  3CWB J;  4HYT B;  4XA4 A;  3GHG A;  1EXJ A;  3MP7 B;  1NTM J;  4L74 A;  4JYC A;  3TK1 A;  1BE3 E;  1KMI Z;  2OGU A;  3HRN A;  1NTZ G;  3AEC C;  3L74 E;  1TU3 F;  1T6A A;  2J5U A;  3S9O A;  4H0L D;  1WRG A;  1JY3 N;  1EQ7 A;  1KFM A;  2QEX P;  2OAR A;  2OTJ P;  1LTJ A;  4D6T J;  1HVV A;  2K9J A;  2YIU B;  2FYN C;  3H1H G;  3L70 J;  5KAI E;  4U3F D;  3FWN A;  2B87 A;  4TLF A;  1GK4 A;  4DJG A;  2Q6Q A;  2WT7 B;  5CCG D;  1L0L J;  5AVU B;  3D70 A;  1L2P A;  1P84 E;  1URQ A;  2LKM A;  2NPS B;  2RKL A;  2M3B A;  3IR9 A;  5C39 A;  3V5B A;  1Q82 Q;  4GIF A;  1K05 A;  1JY3 O;  2A45 G;  4O9B A;  5AVR B;  5AVQ B;  1CSB A;  2I1K A;  4JPZ B;  1U7M A;  3RL0 C;  1A02 F;  4GOD A;  1H0T A;  1IK9 A;  2FFD B;  3BCC J;  1BCC J;  1YTZ T;  3AEF C;  4PV1 B;  3A0B H;  1GW3 A;  3AE2 C;  2ITA A;  2IZ1 A;  3E7K A;  1NWQ A;  1IFP A;  1E5W A;  1KOR A;  2AEF A;  2O01 N;  2OTK E;  1KIL D;  2V7Q H;  1VL2 A;  2ZYA A;  3BAT A;  3M0D C;  1BDD A;  1N7S D;  1BGY G;  1Q86 Q;  1YQ4 C;  1PGO A;  1SQP D;  2WPS A;  2WPV B;  2KLU A;  4DOJ A;  5GTI E;  2R3S A;  5KLV G;  3ABV C;  1IC2 A;  3P8M C;  1RE3 A;  1PPJ G;  4EYY Q;  3MUD A;  1LNQ A;  2N1T B;  3JSV C;  2WTY A;  1HF9 A;  1L4A C;  1DIP A;  1SQB D;  2KXP B;  1KIL C;  3V6I A;  5CJ4 A;  5CCH A;  5H2F E;  3TYY A;  4PD4 I;  1SQQ E;  2JKV A;  2A06 D;  3B5N D;  3H1I G;  4WWI A;  3MD0 A;  3MTU E;  4WY4 A;  1QVF O;  1G2C B;  1XTC C;  3CX5 D;  2N9Y B;  3Q5R A;  3S1K A;  1JCD A;  1QX8 A;  1QLE D;  3GMA A;  1AJY A;  2K3R A;  3O6Q B;  2FFD C;  1MFT A;  1OW6 A;  3CCL P;  2PRR A;  1RF1 C;  4OH8 B;  3GHG C;  1KYO E;  2NZ2 A;  2FYU D;  3BCC D;  3HUS B;  3NXS A;  5CMZ A;  2E42 A;  3ITK A;  4PD4 D;  1X22 A;  4WBA A;  3L72 G;  3O8Z A;  1X9V A;  1VQL P;  1RHZ B;  3AE1 C;  5AW1 B;  1MUU A;  2QE7 H;  3MGN A;  4YXD C;  4LLH A;  4WY4 B;  4YPC A;  3IAO A;  4GT1 A;  4JBZ A;  3SSU A;  3CCU P;  1NTZ K;  2CK3 H;  3LID A;  1VQ7 P;  2GUV A;  1SQV K;  2AXT E;  3B5N A;  3B71 A;  3JCU E;  5GTH H;  5AW8 B;  1L4A D;  1IFN A;  4ZMD A;  3H1K G;  2KI7 B;  1EZV D;  1KQL A;  1T3J A;  3A0H E;  4H44 D;  4NPF X;  2CPS A;  1KB9 I;  2K9Y A;  1OW8 A;  4HB1 A;  5APV A;  3CCM P;  2Y9Z A;  5K5G B;  3HD7 C;  4A7P A;  1EDI A;  1MKM A;  4ZKP A;  1S3J A;  1HH0 A;  2AEM A;  2HR3 A;  3VTP C;  2HPC A;  1AVO A;  4EOT A;  2JO1 A;  1EDJ A;  1SS1 A;  1EZV G;  1UII A;  1YTZ I;  1YBK A;  3N4X A;  2FYU J;  1PP9 G;  3RL0 B;  2SPZ A;  4JQ0 D;  1BE3 G;  1ZR2 A;  2OYH A;  5KAF H;  1EDK A;  3L70 G;  4EDF A;  1AFO A;  1YJW P;  4U3F G;  3I5C A;  1EZV I;  1LP1 A;  2WSC H;  1L0L G;  1LTB C;  1SQQ K;  1VF5 B;  2NPS C;  3AE4 C;  3IN6 A;  1KB9 D;  1OFC X;  1OX3 A;  4W80 A;  3V4Q A;  3ZDM A;  3CXH H;  3L71 G;  1OWA A;  1FZC A;  3FX0 A;  2KSE A;  4MN4 C;  1KQF B;  3U59 A;  5CBN A;  2CPB A;  3M0A A;  4IL6 X;  1L4A A;  1PGQ A;  1RE4 C;  1H8A A;  1M56 D;  3CCE P;  3WUV A;  5CCH C;  2K9J B;  1JY2 N;  1L0L D;  2H88 C;  3L75 G;  5KLV K;  1R8E A;  2IX7 C;  1GMJ A;  2M3E A;  4H0L C;  3H1H E;  3IFM A;  1BCC G;  3H1H J;  3EQ2 A;  5TIS H;  4AUW A;  2KB7 P;  3WU2 E;  3HE4 A;  2J59 M;  3TGU G;  1MV8 A;  1JNM A;  3EFG A;  3NTN A;  5BU8 B;  3CPW O;  1GU5 A;  1OZH A;  1S5L X;  1BGY D;  3AE9 C;  4M3L A;  3CC2 P;  1SQP G;  3U1C A;  1U7J A;  2FBW C;  2WSC J;  1NTM D;  2N1T C;  1IK7 A;  1NU1 G;  1WT6 A;  4R4L A;  3TGU D;  1PV3 A;  2QJP C;  2XU6 A;  2Q7C A;  3CWB G;  1KC8 Q;  2IPP A;  1SQB G;  1U57 A;  3TGU E;  3L73 G;  2QG4 A;  3WU2 H;  2FKW B;  2L91 A;  2YIU C;  1NAF A;  2YXQ B;  3I56 P;  3TSI A;  1MZ9 A;  2A06 G;  1K8A Q;  5CHX A;  2FYZ A;  3M9B A;  5CCG A;  1JO5 A;  5AVV B;  4BRY B;  1T2K D;  3SWK A;  3V2R A;  4BWN A;  4I6M C;  2KP8 A;  2WMM A;  4H0L B;  1Y9B A;  5KAI H;  2O1J A;  2KSJ A;  5BU5 A;  1FOS E;  5AVY B;  1NTK G;  1KYO I;  4KT0 J;  3BRT B;  1LTS C;  3HD7 D;  4JYB A;  3U1A A;  1L0L E;  1LTJ C;  2Q5U A;  2R5B A;  1RE3 C;  1USE A;  2H89 C;  2WSS H;  3KHU A;  4GKG A;  3L4F A;  4IFF A;  3SWY A;  1GU4 A;  1L0L K;  4UB6 H;  1P84 H;  2W8Z A;  1NH4 A;  1JCC A;  1NYH A;  2HLO A;  2FYU K;  3CXH I;  2Q3E A;  1VPC A;  2HOD A;  4NPD A;  3SFD C;  5EFW B;  2DW3 A;  3W68 A;  3PJS K;  3Q5S A;  1W2E A;  3SWF A;  2IYP A;  1M1J C;  2B89 A;  1KYO D;  2P67 A;  3BCC E;  2L5G B;  3C8V A;  4UB8 H;  1FZA A;  3AED C;  1AV1 A;  1FC2 C;  2MKV A;  5CCH D;  2YO3 A;  1DH3 A;  4C46 A;  1KFN A;  1IFD A;  1FDO A;  1URQ D;  2V4H A;  2WSF J;  3E1R A;  1RE4 A;  4WY4 D;  3PHL A;  3V2N A;  3CXH D;  1SQB K;  1UIX A;  3JCU H;  3V2P A;  1SQQ G;  3WMM 0;  1T2K C;  1SQX G;  1SQP K;  4DCK A;  3A3Y B;  2GA1 A;  2D2C C;  2JWA A;  2OYO A;  3H1L E;  4OWF A;  4N78 D;  1PGP A;  1PPJ E;  2BCC J;  3CI9 A;  3VMZ A;  1LWU C;  1K73 Q;  3M91 A;  2YKQ A;  1H89 A;  1L0N K;  3AE8 C;  2H43 A;  2OYI B;  2M8R A;  3HUS C;  1KIL A;  2E75 D;  2ZT9 C;  3H25 A;  3KQG A;  1HGZ A;  4W7Y A;  1BSN A;  3RK2 D;  5AVW B;  2E43 A;  1PL5 A;  4RKU J;  2XDJ A;  1VQ5 P;  2IDB A;  2WIT A;  2ZYG A;  2WT7 A;  2R3C A;  5AW2 B;  1NTM E;  3B5N B;  3Q2Y A;  3PRJ A;  4I7Z C;  1USD A;  3A2A A;  1IZN B;  3OA7 A;  5KAF E;  4IFD K;  1G1J A;  2Y0C A;  4GOE A;  1N86 A;  4AQR D;  1CW5 A;  2WSE H;  3T97 A;  3QH9 A;  5CBO A;  1FZC B;  1LTG C;  1FS0 E;  3C1L A;  3OW2 O;  5KJ7 C;  3FXD A;  5AVT B;  5B66 H;  1FZB A;  1KIL B;  4OGQ D;  5KLI C;  2XZR A;  1BDC A;  2FY8 A;  1HJ0 A;  2E74 D;  3O6Q A;  4PV1 D;  2E76 D;  3V4W A;  1FZC C;  3L74 G;  1T8Z A;  3AEB C;  3AE6 C;  3C9I A;  3VMY A;  1G2C A;  1LT9 C;  2E5Y A;  3II6 A;  4OGQ C;  3CCV P;  3B8E B;  3CC7 P;  2WWW A;  2ZXE B;  1SQP E;  2YNY A;  3BCC G;  5KJ7 D;  3VMX A;  1KZU B;  5APU A;  1SQV E;  1SQB E;  1LJ2 A;  3WUU A;  2WSF H;  5L8R J;  1PFI A;  1NTK J;  2KNC A;  3K5B A;  1M1J B;  4R4M A;  1NTK D;  3N7N A;  1WMK A;  2O1K A;  4ASV A;  3G4S P;  2M5A A;  2FYN B;  4K35 A;  1L0N G;  1LTA C;  2BEQ D;  1RQV A;  1SP4 A;  3Q3D A;  2HOD B;  4ASW A;  2OYH C;  4I1L A;  3LW5 H;  5KLI B;  1QL2 A;  1Q7Y Q;  3LIE A;  1EXI A;  5AVS B;  3CLQ A;  2QJY B;  1SQV G;  3GF7 A;  1N7S C;  2FFD A;  1HUC A;  1VDF A;  2QSI A;  1L0N J;  2C9L Y;  1LWU A;  3MZW B;  2ZT9 D;  2KZI A;  1JEK A;  1GZL A;  2WPR A;  3G6E P;  1RF1 A;  1KN7 A;  1G1I A;  2QA4 P;  1M57 D;  2WZ7 A;  5KLV J;  2H7H A;  1KTM A;  2E74 B;  4ZKU A;  1GL2 B;  1E79 H;  1LT9 B;  1LWU B;  1KB9 E;  2QJP B;  4HJG H;  4UB6 E;  2AXT H;  2MJZ A;  3I55 P;  1M1K Q;  5KTB A;  5DJU B;  2ZFC A;  1RF0 C;  3H32 B;  2E76 C;  1BSH A;  2W90 A;  1YHQ P;  3TF5 A; 
#chains in the Genus database with same CATH homology
 2K9J A;  2K1A A;  2M3E A;  2KNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...