2K1AA

Bicelle-embedded integrin alpha(iib) transmembrane segment
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
GALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure of the Integrin {alpha}IIb Transmembrane Segment.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2k1aA00
2K9JA 2M3EA 2KNCA 2K1AA
chains in the Genus database with same CATH superfamily
3HE4A 4U7JA 4W7ZA 2IBZG 3RK2D 4JPZB 1YI2P 1X8YA 1VQ8P 1WMKA 3HD7D 1BGYJ 1OXZA 1OX3A 3D71A 1M1JC 1EQ7A 5CCGC 1KFNA 3KZIE 5AVTB 1Q2NA 2IYPA 2K9YA 2A06E 1IFNA 4HYTB 3SWKA 5KKZB 1X0TA 1URQD 1H89A 1IFDA 1K9MQ 1SQBD 2B9BA 4EIJA 3ZDMA 1Y9BA 4JYBA 3CCVP 2P58A 1S4XA 5EFWB 1GK4A 3SFEC 1BGYG 1EZVI 1UIIA 1Q7YQ 1L4AB 3CX5I 2FY8A 3L71D 1LWUC 2BEQD 3VOPA 3CPWO 4WBAA 1R8EA 3LW5H 3BRVB 1RF1B 3H25A 1KORA 1SP4A 5AW2B 1NJIQ 3MTUE 2H89C 1YJWP 3A5TA 5KLVJ 4QMAA 1NTZK 1N73B 2E74B 1LTTC 2N1TB 1KILB 1OVVA 1IC2A 3G3ZA 3H1JG 1N7LA 1NTKK 1JO5A 5H2FH 2B88A 3O6QA 4H44B 1HWTC 3BVHA 4UB8H 3L70D 4EI2A 3H6PA 5CCGD 2PGDA 4U3FE 2YXRB 5AW0B 1FDIA 1RH5B 5AVRB 3VMXA 1W5CE 2OTKE 3V5BA 3AEGC 1KD1Q 1RF0C 3CI9A 2POHA 1L0LK 3ABVC 3M91A 1NTMK 1QL1A 3VMYA 1NYHA 3SSUA 3Q5PA 2KNCA 1NWQA 4N6JA 3WU2E 2MJZA 1S5LX 3T97A 4I7ZB 1CI6A 3FXEA 1SFCB 2QIWA 4BWNA 2BCCG 2AEFA 1N8RQ 1U57A 1SQXK 3CWBE 3L73G 3AEEC 3BCCE 1LTAC 3V6IA 5TISE 4IOIH 1EXIA 1J1EB 1NTZG 3Q5RA 1ZRTE 1LJ2A 2HLOA 1IFMA 3EQ2A 1HBWA 1PP9G 2ZFCA 1NTKG 3HUSA 1S72P 4UB6E 3B4SA 2JKVA 3A0HE 3CMEP 4IL6X 5CHXA 5AW7B 2IBZE 3UIAA 3L75J 1KC8Q 2LXCB 3A7OA 3TGUD 1S5LH 5KLIC 3PTZA 2P10A 3R4YA 4YXWH 1EDKA 1SQXJ 1K73Q 1JB0J 2XNXA 4HB1A 1YIJP 2WT7A 1NTMG 2FXPA 4GDOA 1GW4A 1SQPK 2WSSH 4WY4B 1JEKA 2QJYC 3SFDC 2PAJA 3CL3D 3AECC 1DX7A 2J5UA 4OWFA 4JQ0D 1T2KC 1URQA 1SQBK 4JF7A 1GW3A 1PFIA 5CJ0A 3F89A 4MN4C 4I6MC 3L75G 2V7QJ 3P8CE 1BGYE 1EZVG 3NXSA 1D7MA 1SQXG 2R44A 3B5NC 1FU1A 1FDOA 1YTZT 3LIEA 1G2CA 2G8YA 4IL6H 2OYHA 1JY2P 1PGQA 5AVVB 1QVFO 5AW1B 2CK3H 2LXBA 4YXDC 2HPCB 3WMM0 4L73A 2YNYA 4Y99B 4HKZH 2Y9YA 4N78D 1BDCA 2DW3A 3WUTA 1YQ4C 1S2EA 1JTHB 4PV1C 2UWJE 3H1JE 2QEXP 2NPSA 5KAIH 1LT9B 3IF4A 1SQPG 3L71J 1LTSC 4H13C 2E5TA 2E43A 4DT0A 3C8VA 3KYQA 3GLMA 2WSEJ 2ZJSE 3A0BE 1BDDA 3TNUA 4XA4A 5KLVE 1G1JA 1LTJB 4PJ0H 1SQBG 2IDBA 5CCHA 1ZP0C 2R32A 4WWIA 1VQLP 1T6AA 2QSIA 1Q82Q 2R3SA 2A06G 2W8ZA 5E79E 5AVZB 5APWA 2QM8A 3B5ND 3L71G 4RKUJ 1K04A 1AV1A 3WUVA 3SWFA 2M5AB 4KT0J 1JY3O 2KS1A 1HJ0A 2IFMA 2RN0A 3AEDC 2AEMA 4WVZA 2FYUD 3L70J 2BCCE 3L4FA 2E76C 5B66H 1AQTA 1KZUB 5KTBA 2I1KA 3H1HD 4N3YB 3V2RA 1S9KE 1M8OB 4JBZA 4DOJA 1LP1A 2IYOA 3JC22 4H0LB 1PP9E 1FZFA 4R4LA 2A45H 2O01H 3Q5SA 3CLQA 4GOEA 1OWAA 1VF5B 2P2UA 1OVUA 3L70G 2QJKB 3LW5J 3P8MC 3MIWA 2G3AA 1VQMP 3AEFC 4H13D 3E7KA 1E79H 2KP8A 2WPSA 2E5YA 2PRRA 3NTNA 4L74A 1AA0A 1H8AA 1NTME 1FAVA 3Q1MA 1L2PA 1PV3A 3RK2C 1RF0A 3U59A 5AW3B 3L74D 1M1JB 4K3AA 3L75E 1KB9H 2K9JB 1IK9A 1EZVE 1SQXE 1HJBA 1MFTA 2P1JA 1EDLA 1Y8AA 2E76D 3TGUJ 1SLQA 4JYCA 1IFPA 3RL0C 4GKGA 2R5DA 1GD2E 2IFNA 5GTIE 1X22A 1VQKP 2Y9ZA 2KZIA 3G6EP 2OYHC 3RK3C 3AEBC 4NPFX 4C7NB 4W80A 3CWBG 3TK1A 2E75B 2BEZF 1L0ND 2FFDA 1OZHA 1NOHA 2CPSA 3TGUG 1PPJD 1NKNA 1PGPA 3KDPB 3GHGB 3RL0g 3A3YB 3CC7P 2KB7P 1N73A 1USEA 2KLVA 2NPSC 1KILA 4ZNCA 1SQBE 4M3LA 1H88A 1E5WA 5KAFE 1KB9D 3RGUA 1FZCB 3H1LD 1SQQD 1KN7A 2OYIB 3JCUH 4YTPC 5CCHC 4Y28J 2ZT9B 1NAYA 2D2CC 1H0TA 3OA7A 1SQVD 2AXTE 2QJPC 1GDTA 3L71E 2KYVA 1A02F 1LNQA 3W68A 5AVXB 1QVGO 5KLVK 3B5NA 2VRSA 1FJPA 2O1JA 5APSA 2AXCA 3RL0D 5CBNA 3NFQA 4LLHA 2A45I 1R5SA 4OGQC 2GUVA 5AVQB 2HODB 4OVNF 1NHLA 1YYCA 3RK3D 2YIUB 3L36A 2H8PD 5AVSB 1BCCD 4NPDA 2M3BA 1QX8A 3I56P 3N7NA 1TU3F 1AVOA 2OQQA 3L70E 3AE4C 1WRGA 2WPQA 5K5GB 1J1DC 3VMAA 3IAOA 1NU1D 3USSA 1FZEA 2FYUJ 2NPSD 3U1CA 1SVFA 3HE5B 1ZN5A 1UIXA 3GF7A 3V2PA 1KB9I 2RH0A 2O3JA 3H1HJ 3CCQP 2YO3A 4DZOA 4NPEA 5CCHD 2FYNB 2ITAA 1GZLA 1VL2A 3N4XA 1VQ9P 2B89A 2D2CD 1JMMA 3HE4B 2Z4EA 4A7PA 5KLVG 4WY4A 2WMMA 3AE6C 3CD6P 2QJYB 3OJAB 2ZVNB 5B5EH 5KKZC 4OGQD 2MKVA 1IZNB 2L91A 1GL2B 5BVZA 3CCUP 1RHZB 1YQ3C 2QM7A 3H1IJ 3L72D 5H2FE 1AQ5A 1R5LA 1OW8A 4UB8E 2JJLA 3L74J 1L4AC 2Y0CA 3M0DC 1FZGA 1JY3P 2QVAA 1JY2N 5CMZA 3TGUE 3U1AA 1KYOH 3D6YA 3CCRP 2NZ2A 3PP5A 3AE3C 1RF1C 2JWDA 3PJSK 3II6A 4C7RA 2FFDC 3GF3A 5GTHH 3MZWB 3G4SP 4PD4H 3RBZA 1JMBA 1VQOP 1ZR2A 4PV1B 2O01J 1LT9A 1QGKB 1N73C 2N1TC 1N7SB 1KILC 2YKQA 4D6TD 2KUBA 1SS1A 4CPGA 4H44C 2XKMA 1LTJA 1L0NJ 1KV4A 1ZLLA 3TDKA 3PRJA 3VTPC 4WB4A 2JDIH 3MD0A 1FOSE 4IFMA 3VN0A 3I55P 1GTWA 3PHLA 2WTYA 3GW6A 1BSNA 2FXMA 2KSEA 1BE3D 4ASVA 2KNCB 1N86A 1OW6A 4N78E 3H1LJ 1SQQJ 1S5LE 3F5HA 2Z5IA 1KYOD 1L4AD 1RE4A 1VDFA 3OW2O 3L37A 5C39A 1EXJA 1PPJG 3PLNA 1RY3A 4I7ZC 1JM0A 3CCEP 1SQVJ 1T8ZA 2IZ1A 4PD4D 1GMJA 2OYOA 2HG5D 3MGNA 2WQYC 2PFXA 2ZVOB 2GA1A 3H1LG 2N9BA 3HRNA 1U7MA 3CXHH 1JOCA 2N1TD 1KILD 3HUSB 4I1LA 1VPCA 1RE3C 1KMIZ 1BCCJ 1SQVG 2M0BA 4H44D 4IL6E 4BXLA 1IK7A 1M57D 2HFED 2FYUE 3RK2B 3C9IA 1OW7A 3SWYA 4WY4C 3HD7B 1JCDA 1NU1J 1ZXGA 5APYA 3H1HE 3D70A 1EC5A 2GUSA 1Y47A 1VQ6P 2J58A 1URQB 2FXOA 5KAIE 2IPPA 1KYOI 2OARA 2W90A 4ZKPA 4BRYA 1OVRA 1Q81Q 2C0WA 1CSBA 1SFCD 2ZYAA 3G9RA 2E42A 1M1KQ 2JP3A 4PD4I 2O1KA 1FJKA 4PJ0E 3K5BA 3CC4P 3LIDA 3VP9A 2OYHB 3M9BA 3AE5C 3NMDA 2SPZA 3CXHD 2XU6A 3A2AA 4EDFA 2WSFH 5APQA 3EWKA 4TT3H 1OFCX 1M90Q 5L8RJ 3GMAA 2M8RA 1YJ9P 1ZOYC 1VQPP 1NGMB 4Y99C 4ASWA 3KPEA 4RO0A 3EFGA 2OGUA 2ZAEB 3GHGA 1MZ9A 3L74E 2WPVB 1MKMA 3L72J 4I2LC 2KK7A 1DD4A 3L73D 2WZ7A 1K05A 1NVOA 3CX5H 4HH2A 1LT9C 5B66E 2XDJA 2B87B 2QE7H 3H1ID 3QWOC 1NTZD 1IJDB 1HUCA 2IZ0A 3Q2YA 2XZRA 1FZCA 4WY4D 3BATA 3Q3DA 2OYIA 5DJTB 1LTJC 3G71P 1P84H 2C9NY 2YKPA 2I8DA 3V4QA 2Q9IA 1BSHA 2WVRA 1FZBA 2Q5UA 2QJPB 3AE8C 5M1BA 3W67A 3H1KD 2R5BA 2P67A 5BU5A 1JCCA 1AFOA 1L0NE 1L0LD 4GODA 4D6TJ 2AEJA 2H7HA 1PPJE 2HODA 3H32B 1L4AA 1YTZI 1M7LA 2CPBA 3EFFK 3M0DA 3CMAP 3CXHI 1LWUB 1RE4C 4OH8B 5CBOA 3C1LA 4GT1A 2JO1A 5AW6B 1Q86Q 4RESB 1RF1A 2QA4P 1NAFA 1N2DC 1KB9E 4H0LC 1LP1B 3CX5D 3H1LE 1SQQE 3KZIH 4HJGH 4D6TG 1BE3J 1J1DB 1JNMA 2O01N 1Q90D 1VF5C 2L5GB 4LGDE 5TJHA 1SQVE 2QJKC 3MUDA 2N1TA 3FWLA 5BU8B 3VP8A 3VYIA 1P84D 5DJUB 3V4WA 1PGJA 1QEXA 3CCMP 1BE3G 3RK3E 3M9QA 1ZV8A 1RQUA 2I1JA 1SQPD 1BCCE 1HVVA 1HF9A 3S4RA 1FE6A 2FYUK 1OMIA 2KSJA 1GL2A 5APXA 4XFJA 4DJGA 5AVUB 2Q3EA 5APUA 1NU1E 2W6JH 1SFCA 3L35A 3JCUE 4B86A 2A06D 3B8EB 4H0LD 5AVWB 5KJ7D 3FX0A 3H1JJ 1FC2C 2E75C 4EOTA 1Z56A 4TLFA 1VF5D 1JY3N 2FFDB 3E1RA 1RE3A 1P84I 1USDA 2R3CA 3GHGC 4IFFA 2WITA 1WT6A 3IFMA 1S1CX 3WU2H 1U7JA 3HTKB 5KLIB 1N7SA 1DEBA 2Q6QA 1LTIC 2JWAA 1FZCC 2W83C 2OYIC 3L72E 1QL2A 2KIKA 2FYUG 4W7YA 1IFIA 2ZT9C 5TISH 1ZR4A 2QG4A 3CCJP 1H0TB 3H1HG 2BCCJ 4DCKA 3L73J 4IFDK 4GIFA 5APVA 2C9LY 4L76A 2J59M 1MFZA 3B5NB 1NTZJ 4ZKUA 4UB6H 2W27A 3P32A 2KOGA 1FZAA 1J2JB 4U3FD 1PP9J 3A0HH 2Y0DA 1NTKJ 2YIUC 3QH9A 2FBWC 2Y0EA 3M9HA 1LGHB 2HPCA 1L0NK 2E75D 3FWNA 2C0XA 3CCSP 3V2NA 4D6TE 3H1KJ 5B5EE 1IO4A 1GU4A 3CCLP 3ITKA 2YXQB 2QRXA 3H1IG 1L0LJ 1JTHA 2Q3IA 3MHVA 1NTMJ 1LT1A 4O9BA 2YO2A 2IX7C 2WSFJ 1NO4A 3L74G 3CC2P 1IFJA 2E74C 3MUDC 1XTGB 3I5CA 1FS0E 3CWBD 4H13B 3PH0A 1SQQK 3VMZA 3BCCD 3S9OA 3V2QA 1XTCC 3H1KG 3O6QB 1BE3E 1NKZB 1ZRTD 4L75A 2FYNC 2ZT9D 1SQVK 1KTMA 1L0LG 1KYOE 3O8ZA 1FBMA 3HD7A 2WWWA 1M56D 2K1AA 2Q7CA 2A45G 3WUUA 5GTHE 3GG2A 1VQ4P 4LC1A 3TSIA 3M0AA 4EYYQ 2P7JA 2M5AA 2IBZD 4PD4E 1FOSF 2HYNA 2W6BA 3E1IA 1K8AQ 4RJTA 1L0NG 1GL2C 2KLUA 3TYYA 3T97B 2KZJA 2K88A 2E76B 3KQGA 1G1IA 1SFCC 3RBXA 2ZXXA 1CI6B 2HR3A 1KILE 2RMZA 3D6ZA 1YHQP 3A0BH 5KJ7A 1SQPJ 2ZYDA 1J1EC 1NU1K 1FDMA 2KXPB 1PL5A 3P8CD 1BGYD 4YPCA 4KHXA 2W6AA 2LR2A 1SQQG 2H88C 1HTLC 5AVYB 1HGVA 1SQBJ 2E74D 1DH3A 2K37A 2YKOA 4AUWA 5E79H 4K35A 3P7KA 1A02J 2WSCJ 1KQLA 2B87A 2N9YB 1JUNA 4ZMDA 1YBKA 2FKWB 1N7SC 4KJMA 3FXDA 2XV5A 2WT7B 1M1JA 5CCGA 2K9JA 2IBZI 1VQ5P 3H1JD 1AVYA 1T2KD 4C46A 1VQ7P 1VQNP 1BCCG 3AE1C 3CXHE 1DIPA 1GL2D 3FGAD 1W2BO 3KHUA 5AW9B 2ZXEB 2KI7B 1ZW0A 2OTJP 5APTA 5AW5B 3RL0B 5KLVD 1AJYA 1PZQA 2BASA 2Q1KA 2JEEA 3AEAC 3H32A 3OAKA 2FYZA 1NU1G 1G2CB 1KQGB 3BASA 3IN6A 1PIXA 1LWUA 4C7NA 1GK6A 3RK3B 3L73E 5AW4B 1EDIA 1EDJA 4R4MA 3H1IE 1NTZE 1MV8A 3AE9C 1KFMA 2PP6A 1MUUA 1RQVA 2WPRA 2RKLA 1NTKE 4Z1MH 2BCCD 4PV1D 2ZYGA 1W2EA 1KQFB 4U3FJ 1LTGC 3KXDA 3R2PA 2XNDH 2NPSB 1S9KD 1N7SD 3HUSC 3H1KE 2K3RA 3JSVC 1PP9D 1HH0A 1L0LE 1X9VA 1NTKD 5GTIH 2M3EA 3TF5A 2Z5HA 3MP7B 2H43A 3TNUB 1CW5A 3AE7C 1YITP 1DD3A 5AW8B 2D2CB 3L72G 3BRTB 3S1KA 2NRGA 2V7QH 3HD7C 2YMYA 4XE5B 1T3JA 4U3FG 3B71A 1JY2O 1NTMD 3AE2C 3CWBJ 2YMKA 1URQC 3BCCJ 1DEEG 3CX5E 4OGQB 1GU5A 2KS1B 1LTBC 1KQSO 1NH4A 4BRYB 4GOFA 5CJ4A 2OTLP 1S3JA 5KAFH 3L75D 3M06A 1T3UA 1P84E 2WSCH 1EZVD 1PGOA 1SQXD 5KJ7C 1ZMEC 1HGZA 3IR9A 2LKMA 3BCCG 1X79B 2AXTH 2V4HA 3HE5A 1OIPA 1QLED 2GM4A 4AYCA 2JR8A 1YJNP 2WSEH 1SQPE 3HTKA 1CZQA 4AQRD
chains in the Genus database with same CATH topology
2K9JA 2M3EA 2KNCA 2K1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9J A;  2M3E A;  2KNC A;  2K1A A; 
#chains in the Genus database with same CATH topology
 3HE4 A;  4U7J A;  4W7Z A;  2IBZ G;  3RK2 D;  4JPZ B;  1YI2 P;  1X8Y A;  1VQ8 P;  1WMK A;  3HD7 D;  1BGY J;  1OXZ A;  1OX3 A;  3D71 A;  1M1J C;  1EQ7 A;  5CCG C;  1KFN A;  3KZI E;  5AVT B;  1Q2N A;  2IYP A;  2K9Y A;  2A06 E;  1IFN A;  4HYT B;  3SWK A;  5KKZ B;  1X0T A;  1URQ D;  1H89 A;  1IFD A;  1K9M Q;  1SQB D;  2B9B A;  4EIJ A;  3ZDM A;  1Y9B A;  4JYB A;  3CCV P;  2P58 A;  1S4X A;  5EFW B;  1GK4 A;  3SFE C;  1BGY G;  1EZV I;  1UII A;  1Q7Y Q;  1L4A B;  3CX5 I;  2FY8 A;  3L71 D;  1LWU C;  2BEQ D;  3VOP A;  3CPW O;  4WBA A;  1R8E A;  3LW5 H;  3BRV B;  1RF1 B;  3H25 A;  1KOR A;  1SP4 A;  5AW2 B;  1NJI Q;  3MTU E;  2H89 C;  1YJW P;  3A5T A;  5KLV J;  4QMA A;  1NTZ K;  1N73 B;  2E74 B;  1LTT C;  2N1T B;  1KIL B;  1OVV A;  1IC2 A;  3G3Z A;  3H1J G;  1N7L A;  1NTK K;  1JO5 A;  5H2F H;  2B88 A;  3O6Q A;  4H44 B;  1HWT C;  3BVH A;  4UB8 H;  3L70 D;  4EI2 A;  3H6P A;  5CCG D;  2PGD A;  4U3F E;  2YXR B;  5AW0 B;  1FDI A;  1RH5 B;  5AVR B;  3VMX A;  1W5C E;  2OTK E;  3V5B A;  3AEG C;  1KD1 Q;  1RF0 C;  3CI9 A;  2POH A;  1L0L K;  3ABV C;  3M91 A;  1NTM K;  1QL1 A;  3VMY A;  1NYH A;  3SSU A;  3Q5P A;  2KNC A;  1NWQ A;  4N6J A;  3WU2 E;  2MJZ A;  1S5L X;  3T97 A;  4I7Z B;  1CI6 A;  3FXE A;  1SFC B;  2QIW A;  4BWN A;  2BCC G;  2AEF A;  1N8R Q;  1U57 A;  1SQX K;  3CWB E;  3L73 G;  3AEE C;  3BCC E;  1LTA C;  3V6I A;  5TIS E;  4IOI H;  1EXI A;  1J1E B;  1NTZ G;  3Q5R A;  1ZRT E;  1LJ2 A;  2HLO A;  1IFM A;  3EQ2 A;  1HBW A;  1PP9 G;  2ZFC A;  1NTK G;  3HUS A;  1S72 P;  4UB6 E;  3B4S A;  2JKV A;  3A0H E;  3CME P;  4IL6 X;  5CHX A;  5AW7 B;  2IBZ E;  3UIA A;  3L75 J;  1KC8 Q;  2LXC B;  3A7O A;  3TGU D;  1S5L H;  5KLI C;  3PTZ A;  2P10 A;  3R4Y A;  4YXW H;  1EDK A;  1SQX J;  1K73 Q;  1JB0 J;  2XNX A;  4HB1 A;  1YIJ P;  2WT7 A;  1NTM G;  2FXP A;  4GDO A;  1GW4 A;  1SQP K;  2WSS H;  4WY4 B;  1JEK A;  2QJY C;  3SFD C;  2PAJ A;  3CL3 D;  3AEC C;  1DX7 A;  2J5U A;  4OWF A;  4JQ0 D;  1T2K C;  1URQ A;  1SQB K;  4JF7 A;  1GW3 A;  1PFI A;  5CJ0 A;  3F89 A;  4MN4 C;  4I6M C;  3L75 G;  2V7Q J;  3P8C E;  1BGY E;  1EZV G;  3NXS A;  1D7M A;  1SQX G;  2R44 A;  3B5N C;  1FU1 A;  1FDO A;  1YTZ T;  3LIE A;  1G2C A;  2G8Y A;  4IL6 H;  2OYH A;  1JY2 P;  1PGQ A;  5AVV B;  1QVF O;  5AW1 B;  2CK3 H;  2LXB A;  4YXD C;  2HPC B;  3WMM 0;  4L73 A;  2YNY A;  4Y99 B;  4HKZ H;  2Y9Y A;  4N78 D;  1BDC A;  2DW3 A;  3WUT A;  1YQ4 C;  1S2E A;  1JTH B;  4PV1 C;  2UWJ E;  3H1J E;  2QEX P;  2NPS A;  5KAI H;  1LT9 B;  3IF4 A;  1SQP G;  3L71 J;  1LTS C;  4H13 C;  2E5T A;  2E43 A;  4DT0 A;  3C8V A;  3KYQ A;  3GLM A;  2WSE J;  2ZJS E;  3A0B E;  1BDD A;  3TNU A;  4XA4 A;  5KLV E;  1G1J A;  1LTJ B;  4PJ0 H;  1SQB G;  2IDB A;  5CCH A;  1ZP0 C;  2R32 A;  4WWI A;  1VQL P;  1T6A A;  2QSI A;  1Q82 Q;  2R3S A;  2A06 G;  2W8Z A;  5E79 E;  5AVZ B;  5APW A;  2QM8 A;  3B5N D;  3L71 G;  4RKU J;  1K04 A;  1AV1 A;  3WUV A;  3SWF A;  2M5A B;  4KT0 J;  1JY3 O;  2KS1 A;  1HJ0 A;  2IFM A;  2RN0 A;  3AED C;  2AEM A;  4WVZ A;  2FYU D;  3L70 J;  2BCC E;  3L4F A;  2E76 C;  5B66 H;  1AQT A;  1KZU B;  5KTB A;  2I1K A;  3H1H D;  4N3Y B;  3V2R A;  1S9K E;  1M8O B;  4JBZ A;  4DOJ A;  1LP1 A;  2IYO A;  3JC2 2;  4H0L B;  1PP9 E;  1FZF A;  4R4L A;  2A45 H;  2O01 H;  3Q5S A;  3CLQ A;  4GOE A;  1OWA A;  1VF5 B;  2P2U A;  1OVU A;  3L70 G;  2QJK B;  3LW5 J;  3P8M C;  3MIW A;  2G3A A;  1VQM P;  3AEF C;  4H13 D;  3E7K A;  1E79 H;  2KP8 A;  2WPS A;  2E5Y A;  2PRR A;  3NTN A;  4L74 A;  1AA0 A;  1H8A A;  1NTM E;  1FAV A;  3Q1M A;  1L2P A;  1PV3 A;  3RK2 C;  1RF0 A;  3U59 A;  5AW3 B;  3L74 D;  1M1J B;  4K3A A;  3L75 E;  1KB9 H;  2K9J B;  1IK9 A;  1EZV E;  1SQX E;  1HJB A;  1MFT A;  2P1J A;  1EDL A;  1Y8A A;  2E76 D;  3TGU J;  1SLQ A;  4JYC A;  1IFP A;  3RL0 C;  4GKG A;  2R5D A;  1GD2 E;  2IFN A;  5GTI E;  1X22 A;  1VQK P;  2Y9Z A;  2KZI A;  3G6E P;  2OYH C;  3RK3 C;  3AEB C;  4NPF X;  4C7N B;  4W80 A;  3CWB G;  3TK1 A;  2E75 B;  2BEZ F;  1L0N D;  2FFD A;  1OZH A;  1NOH A;  2CPS A;  3TGU G;  1PPJ D;  1NKN A;  1PGP A;  3KDP B;  3GHG B;  3RL0 g;  3A3Y B;  3CC7 P;  2KB7 P;  1N73 A;  1USE A;  2KLV A;  2NPS C;  1KIL A;  4ZNC A;  1SQB E;  4M3L A;  1H88 A;  1E5W A;  5KAF E;  1KB9 D;  3RGU A;  1FZC B;  3H1L D;  1SQQ D;  1KN7 A;  2OYI B;  3JCU H;  4YTP C;  5CCH C;  4Y28 J;  2ZT9 B;  1NAY A;  2D2C C;  1H0T A;  3OA7 A;  1SQV D;  2AXT E;  2QJP C;  1GDT A;  3L71 E;  2KYV A;  1A02 F;  1LNQ A;  3W68 A;  5AVX B;  1QVG O;  5KLV K;  3B5N A;  2VRS A;  1FJP A;  2O1J A;  5APS A;  2AXC A;  3RL0 D;  5CBN A;  3NFQ A;  4LLH A;  2A45 I;  1R5S A;  4OGQ C;  2GUV A;  5AVQ B;  2HOD B;  4OVN F;  1NHL A;  1YYC A;  3RK3 D;  2YIU B;  3L36 A;  2H8P D;  5AVS B;  1BCC D;  4NPD A;  2M3B A;  1QX8 A;  3I56 P;  3N7N A;  1TU3 F;  1AVO A;  2OQQ A;  3L70 E;  3AE4 C;  1WRG A;  2WPQ A;  5K5G B;  1J1D C;  3VMA A;  3IAO A;  1NU1 D;  3USS A;  1FZE A;  2FYU J;  2NPS D;  3U1C A;  1SVF A;  3HE5 B;  1ZN5 A;  1UIX A;  3GF7 A;  3V2P A;  1KB9 I;  2RH0 A;  2O3J A;  3H1H J;  3CCQ P;  2YO3 A;  4DZO A;  4NPE A;  5CCH D;  2FYN B;  2ITA A;  1GZL A;  1VL2 A;  3N4X A;  1VQ9 P;  2B89 A;  2D2C D;  1JMM A;  3HE4 B;  2Z4E A;  4A7P A;  5KLV G;  4WY4 A;  2WMM A;  3AE6 C;  3CD6 P;  2QJY B;  3OJA B;  2ZVN B;  5B5E H;  5KKZ C;  4OGQ D;  2MKV A;  1IZN B;  2L91 A;  1GL2 B;  5BVZ A;  3CCU P;  1RHZ B;  1YQ3 C;  2QM7 A;  3H1I J;  3L72 D;  5H2F E;  1AQ5 A;  1R5L A;  1OW8 A;  4UB8 E;  2JJL A;  3L74 J;  1L4A C;  2Y0C A;  3M0D C;  1FZG A;  1JY3 P;  2QVA A;  1JY2 N;  5CMZ A;  3TGU E;  3U1A A;  1KYO H;  3D6Y A;  3CCR P;  2NZ2 A;  3PP5 A;  3AE3 C;  1RF1 C;  2JWD A;  3PJS K;  3II6 A;  4C7R A;  2FFD C;  3GF3 A;  5GTH H;  3MZW B;  3G4S P;  4PD4 H;  3RBZ A;  1JMB A;  1VQO P;  1ZR2 A;  4PV1 B;  2O01 J;  1LT9 A;  1QGK B;  1N73 C;  2N1T C;  1N7S B;  1KIL C;  2YKQ A;  4D6T D;  2KUB A;  1SS1 A;  4CPG A;  4H44 C;  2XKM A;  1LTJ A;  1L0N J;  1KV4 A;  1ZLL A;  3TDK A;  3PRJ A;  3VTP C;  4WB4 A;  2JDI H;  3MD0 A;  1FOS E;  4IFM A;  3VN0 A;  3I55 P;  1GTW A;  3PHL A;  2WTY A;  3GW6 A;  1BSN A;  2FXM A;  2KSE A;  1BE3 D;  4ASV A;  2KNC B;  1N86 A;  1OW6 A;  4N78 E;  3H1L J;  1SQQ J;  1S5L E;  3F5H A;  2Z5I A;  1KYO D;  1L4A D;  1RE4 A;  1VDF A;  3OW2 O;  3L37 A;  5C39 A;  1EXJ A;  1PPJ G;  3PLN A;  1RY3 A;  4I7Z C;  1JM0 A;  3CCE P;  1SQV J;  1T8Z A;  2IZ1 A;  4PD4 D;  1GMJ A;  2OYO A;  2HG5 D;  3MGN A;  2WQY C;  2PFX A;  2ZVO B;  2GA1 A;  3H1L G;  2N9B A;  3HRN A;  1U7M A;  3CXH H;  1JOC A;  2N1T D;  1KIL D;  3HUS B;  4I1L A;  1VPC A;  1RE3 C;  1KMI Z;  1BCC J;  1SQV G;  2M0B A;  4H44 D;  4IL6 E;  4BXL A;  1IK7 A;  1M57 D;  2HFE D;  2FYU E;  3RK2 B;  3C9I A;  1OW7 A;  3SWY A;  4WY4 C;  3HD7 B;  1JCD A;  1NU1 J;  1ZXG A;  5APY A;  3H1H E;  3D70 A;  1EC5 A;  2GUS A;  1Y47 A;  1VQ6 P;  2J58 A;  1URQ B;  2FXO A;  5KAI E;  2IPP A;  1KYO I;  2OAR A;  2W90 A;  4ZKP A;  4BRY A;  1OVR A;  1Q81 Q;  2C0W A;  1CSB A;  1SFC D;  2ZYA A;  3G9R A;  2E42 A;  1M1K Q;  2JP3 A;  4PD4 I;  2O1K A;  1FJK A;  4PJ0 E;  3K5B A;  3CC4 P;  3LID A;  3VP9 A;  2OYH B;  3M9B A;  3AE5 C;  3NMD A;  2SPZ A;  3CXH D;  2XU6 A;  3A2A A;  4EDF A;  2WSF H;  5APQ A;  3EWK A;  4TT3 H;  1OFC X;  1M90 Q;  5L8R J;  3GMA A;  2M8R A;  1YJ9 P;  1ZOY C;  1VQP P;  1NGM B;  4Y99 C;  4ASW A;  3KPE A;  4RO0 A;  3EFG A;  2OGU A;  2ZAE B;  3GHG A;  1MZ9 A;  3L74 E;  2WPV B;  1MKM A;  3L72 J;  4I2L C;  2KK7 A;  1DD4 A;  3L73 D;  2WZ7 A;  1K05 A;  1NVO A;  3CX5 H;  4HH2 A;  1LT9 C;  5B66 E;  2XDJ A;  2B87 B;  2QE7 H;  3H1I D;  3QWO C;  1NTZ D;  1IJD B;  1HUC A;  2IZ0 A;  3Q2Y A;  2XZR A;  1FZC A;  4WY4 D;  3BAT A;  3Q3D A;  2OYI A;  5DJT B;  1LTJ C;  3G71 P;  1P84 H;  2C9N Y;  2YKP A;  2I8D A;  3V4Q A;  2Q9I A;  1BSH A;  2WVR A;  1FZB A;  2Q5U A;  2QJP B;  3AE8 C;  5M1B A;  3W67 A;  3H1K D;  2R5B A;  2P67 A;  5BU5 A;  1JCC A;  1AFO A;  1L0N E;  1L0L D;  4GOD A;  4D6T J;  2AEJ A;  2H7H A;  1PPJ E;  2HOD A;  3H32 B;  1L4A A;  1YTZ I;  1M7L A;  2CPB A;  3EFF K;  3M0D A;  3CMA P;  3CXH I;  1LWU B;  1RE4 C;  4OH8 B;  5CBO A;  3C1L A;  4GT1 A;  2JO1 A;  5AW6 B;  1Q86 Q;  4RES B;  1RF1 A;  2QA4 P;  1NAF A;  1N2D C;  1KB9 E;  4H0L C;  1LP1 B;  3CX5 D;  3H1L E;  1SQQ E;  3KZI H;  4HJG H;  4D6T G;  1BE3 J;  1J1D B;  1JNM A;  2O01 N;  1Q90 D;  1VF5 C;  2L5G B;  4LGD E;  5TJH A;  1SQV E;  2QJK C;  3MUD A;  2N1T A;  3FWL A;  5BU8 B;  3VP8 A;  3VYI A;  1P84 D;  5DJU B;  3V4W A;  1PGJ A;  1QEX A;  3CCM P;  1BE3 G;  3RK3 E;  3M9Q A;  1ZV8 A;  1RQU A;  2I1J A;  1SQP D;  1BCC E;  1HVV A;  1HF9 A;  3S4R A;  1FE6 A;  2FYU K;  1OMI A;  2KSJ A;  1GL2 A;  5APX A;  4XFJ A;  4DJG A;  5AVU B;  2Q3E A;  5APU A;  1NU1 E;  2W6J H;  1SFC A;  3L35 A;  3JCU E;  4B86 A;  2A06 D;  3B8E B;  4H0L D;  5AVW B;  5KJ7 D;  3FX0 A;  3H1J J;  1FC2 C;  2E75 C;  4EOT A;  1Z56 A;  4TLF A;  1VF5 D;  1JY3 N;  2FFD B;  3E1R A;  1RE3 A;  1P84 I;  1USD A;  2R3C A;  3GHG C;  4IFF A;  2WIT A;  1WT6 A;  3IFM A;  1S1C X;  3WU2 H;  1U7J A;  3HTK B;  5KLI B;  1N7S A;  1DEB A;  2Q6Q A;  1LTI C;  2JWA A;  1FZC C;  2W83 C;  2OYI C;  3L72 E;  1QL2 A;  2KIK A;  2FYU G;  4W7Y A;  1IFI A;  2ZT9 C;  5TIS H;  1ZR4 A;  2QG4 A;  3CCJ P;  1H0T B;  3H1H G;  2BCC J;  4DCK A;  3L73 J;  4IFD K;  4GIF A;  5APV A;  2C9L Y;  4L76 A;  2J59 M;  1MFZ A;  3B5N B;  1NTZ J;  4ZKU A;  4UB6 H;  2W27 A;  3P32 A;  2KOG A;  1FZA A;  1J2J B;  4U3F D;  1PP9 J;  3A0H H;  2Y0D A;  1NTK J;  2YIU C;  3QH9 A;  2FBW C;  2Y0E A;  3M9H A;  1LGH B;  2HPC A;  1L0N K;  2E75 D;  3FWN A;  2C0X A;  3CCS P;  3V2N A;  4D6T E;  3H1K J;  5B5E E;  1IO4 A;  1GU4 A;  3CCL P;  3ITK A;  2YXQ B;  2QRX A;  3H1I G;  1L0L J;  1JTH A;  2Q3I A;  3MHV A;  1NTM J;  1LT1 A;  4O9B A;  2YO2 A;  2IX7 C;  2WSF J;  1NO4 A;  3L74 G;  3CC2 P;  1IFJ A;  2E74 C;  3MUD C;  1XTG B;  3I5C A;  1FS0 E;  3CWB D;  4H13 B;  3PH0 A;  1SQQ K;  3VMZ A;  3BCC D;  3S9O A;  3V2Q A;  1XTC C;  3H1K G;  3O6Q B;  1BE3 E;  1NKZ B;  1ZRT D;  4L75 A;  2FYN C;  2ZT9 D;  1SQV K;  1KTM A;  1L0L G;  1KYO E;  3O8Z A;  1FBM A;  3HD7 A;  2WWW A;  1M56 D;  2K1A A;  2Q7C A;  2A45 G;  3WUU A;  5GTH E;  3GG2 A;  1VQ4 P;  4LC1 A;  3TSI A;  3M0A A;  4EYY Q;  2P7J A;  2M5A A;  2IBZ D;  4PD4 E;  1FOS F;  2HYN A;  2W6B A;  3E1I A;  1K8A Q;  4RJT A;  1L0N G;  1GL2 C;  2KLU A;  3TYY A;  3T97 B;  2KZJ A;  2K88 A;  2E76 B;  3KQG A;  1G1I A;  1SFC C;  3RBX A;  2ZXX A;  1CI6 B;  2HR3 A;  1KIL E;  2RMZ A;  3D6Z A;  1YHQ P;  3A0B H;  5KJ7 A;  1SQP J;  2ZYD A;  1J1E C;  1NU1 K;  1FDM A;  2KXP B;  1PL5 A;  3P8C D;  1BGY D;  4YPC A;  4KHX A;  2W6A A;  2LR2 A;  1SQQ G;  2H88 C;  1HTL C;  5AVY B;  1HGV A;  1SQB J;  2E74 D;  1DH3 A;  2K37 A;  2YKO A;  4AUW A;  5E79 H;  4K35 A;  3P7K A;  1A02 J;  2WSC J;  1KQL A;  2B87 A;  2N9Y B;  1JUN A;  4ZMD A;  1YBK A;  2FKW B;  1N7S C;  4KJM A;  3FXD A;  2XV5 A;  2WT7 B;  1M1J A;  5CCG A;  2K9J A;  2IBZ I;  1VQ5 P;  3H1J D;  1AVY A;  1T2K D;  4C46 A;  1VQ7 P;  1VQN P;  1BCC G;  3AE1 C;  3CXH E;  1DIP A;  1GL2 D;  3FGA D;  1W2B O;  3KHU A;  5AW9 B;  2ZXE B;  2KI7 B;  1ZW0 A;  2OTJ P;  5APT A;  5AW5 B;  3RL0 B;  5KLV D;  1AJY A;  1PZQ A;  2BAS A;  2Q1K A;  2JEE A;  3AEA C;  3H32 A;  3OAK A;  2FYZ A;  1NU1 G;  1G2C B;  1KQG B;  3BAS A;  3IN6 A;  1PIX A;  1LWU A;  4C7N A;  1GK6 A;  3RK3 B;  3L73 E;  5AW4 B;  1EDI A;  1EDJ A;  4R4M A;  3H1I E;  1NTZ E;  1MV8 A;  3AE9 C;  1KFM A;  2PP6 A;  1MUU A;  1RQV A;  2WPR A;  2RKL A;  1NTK E;  4Z1M H;  2BCC D;  4PV1 D;  2ZYG A;  1W2E A;  1KQF B;  4U3F J;  1LTG C;  3KXD A;  3R2P A;  2XND H;  2NPS B;  1S9K D;  1N7S D;  3HUS C;  3H1K E;  2K3R A;  3JSV C;  1PP9 D;  1HH0 A;  1L0L E;  1X9V A;  1NTK D;  5GTI H;  2M3E A;  3TF5 A;  2Z5H A;  3MP7 B;  2H43 A;  3TNU B;  1CW5 A;  3AE7 C;  1YIT P;  1DD3 A;  5AW8 B;  2D2C B;  3L72 G;  3BRT B;  3S1K A;  2NRG A;  2V7Q H;  3HD7 C;  2YMY A;  4XE5 B;  1T3J A;  4U3F G;  3B71 A;  1JY2 O;  1NTM D;  3AE2 C;  3CWB J;  2YMK A;  1URQ C;  3BCC J;  1DEE G;  3CX5 E;  4OGQ B;  1GU5 A;  2KS1 B;  1LTB C;  1KQS O;  1NH4 A;  4BRY B;  4GOF A;  5CJ4 A;  2OTL P;  1S3J A;  5KAF H;  3L75 D;  3M06 A;  1T3U A;  1P84 E;  2WSC H;  1EZV D;  1PGO A;  1SQX D;  5KJ7 C;  1ZME C;  1HGZ A;  3IR9 A;  2LKM A;  3BCC G;  1X79 B;  2AXT H;  2V4H A;  3HE5 A;  1OIP A;  1QLE D;  2GM4 A;  4AYC A;  2JR8 A;  1YJN P;  2WSE H;  1SQP E;  3HTK A;  1CZQ A;  4AQR D; 
#chains in the Genus database with same CATH homology
 2K9J A;  2M3E A;  2KNC A;  2K1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...