2K1FA

Sumo-3 from drosophila melanogaster (dsmt3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
b'MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG4494-PA
publication title NMR-derived solution structure of SUMO from Drosophila melanogaster (dSmt3)
doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k1fA00
4AOFA 2JZZA 1V5OA 4MSQB 2J0JA 2WX1A 5IA7A 3H7PB 2IBIB 2I1KA 3RUIB 2L8JA 5LXHA 2L3ZA 2IY1B 3A4SC 4GOCA 2NVUI 3CSFA 4K7SA 1C1YB 3R66C 4HK2A 2KWUB 3V6EB 3CMMB 3AULA 2IYDB 3H7PA 2JT4B 4W9KA 4W9GA 5J17A 4IM0A 3ZVVA 2N9XA 4EZKA 1WR1A 3EC8A 3ZLZA 2DHZA 1WX7A 2LUEA 1WXVA 3IG3A 2L00B 1LXDA 4G50A 4GXBA 4BBNC 2ZZPB 4ANVA 3ZRCA 4IC7B 4FJVB 4XX5A 1YX6B 2O6VD 2KTFA 1S3SG 2MP2B 2NBWB 2RR9A 3EHVA 5G2NA 5E6OA 5AEKB 3RYTA 2RPQA 3U8ZA 5D7GA 2MA9B 4MSMB 1IYFA 2O6VB 2MP2A 3DBLI 2FCSA 3A4RA 1J8CA 3VQIA 2GBKA 1LM8B 1OEYA 2MBHA 3T8MA 1CMXB 4DHZB 4WWNA 2CU1A 2K6DB 4DDID 2O6VA 3PRMB 2A4ZA 2N1VA 2AYOB 3KYCD 2JRIB 1QZEA 2EKEC 3KUCB 3C0RB 4IWOA 4IM3A 2C7NB 3U30A 4AJWA 3I3TB 3K9OB 1YQBA 4FBJB 1X1MA 3PS6A 1Q1OA 3APDA 4EZJA 3X0WA 2ZNVB 2KFKB 4J6IA 3AXCA 4FA6A 2KLCA 3ENEA 2OOBB 3A1QB 3DBHI 4B9KA 2KFKA 5CHWA 2L0FA 4URKA 2LZ6A 4WJQA 3MHSD 2C9WB 4GU2A 4CO7A 4W9HA 1GG3A 4OVUA 1WE6A 5HKHA 1WGGA 1UBIA 3B08A 4P7IA 1WY8A 4KV2A 4A3PA 2ZCCA 2ZVNA 3OJ4B 4W9CA 2RGFA 4ZRIA 1WXMA 2KZRA 5LXIB 2LD9A 3TJPA 3PT2B 2BYVE 3WA0A 1VCBA 5J2RA 3VTUA 2GMIC 3QIJA 2IO1B 2KDEB 5TR5A 2V4LA 4NAWA 2KWVB 2KFJA 3UQAA 2REXA 3V6CB 4I6LB 1G6JA 1YX5B 3KH0A 1GC7A 2J7QB 4I6PA 4IM2A 2UYZB 2LXCA 4A3OA 2L7RA 4HLEA 1T0YA 2JWZA 1WRDB 1V9JA 3PTFC 3VTWA 1WIAA 2HE7A 4FLHA 4NPNA 1SGHA 4EZLA 3MJWA 2GBJA 4WWOA 2AEHA 4GDKB 3D32A 2DZKA 2R2QA 1WGRA 4EKUA 2NBUA 2JRHA 2PJHA 2IO0B 2BYFA 2NS5A 2EMTA 1NBFC 4BVUC 3ZDMC 4NQLB 3VXWA 2M8SA 2L76A 4DDGD 2KK8A 4K1RB 1WJ6A 3QARA 1FXTB 3VH4B 2KJ6A 4CHKA 1WZ0A 1U4AA 2LJ5A 1ZGUB 4ANUA 3JVZX 2G3QB 3ML8A 4BOZB 3EECA 3TMPB 1RFAA 4TQ1A 5D2MB 2LGYA 1NI2A 3L13A 1M94A 2XK5B 4NJ6A 4M0WB 2W9NA 1I35A 2D3GA 3H1UA 2FNJB 1ZKHA 2XK5A 3GOEA 4GDLA 2DYMA 1OQYA 3APFA 1BT0A 3GZNI 1GC6A 3O65B 2FCNA 3DDCB 1R4NI 3S2AA 5E6PA 3UINB 4PS7A 4GMVA 2K6QA 2LI5A 2WX0A 4HWIB 3RCZA 3SD5A 4LJOB 1OEYJ 3UF8A 3KUZA 3QAQA 2Z0DB 2HTHA 3ALBA 3H7SA 2MWSB 5BO4B 5JHBA 2V1YA 2DAJA 3EFUA 2Y5BB 3NY5A 3RZWC 4MGYE 4WAAA 3W1SA 2NCNA 2DX5B 3NZSA 3PLVA 2LGDA 3QA8A 3QCAA 1NDDA 1WGHA 2N9PC 3PSEB 2WYQA 2C7HA 3PPAA 5CHFA 5D94A 4JL9A 3UQBA 4FJZA 4BBNF 5IAAC 1UD7A 4KZ0A 2CKHB 1IPGA 4EOYA 2YLMA 3VAWA 3QHTA 3ECIA 4MGIE 1UELA 3ZO5B 1V49A 2N9EB 4ZYNA 3V60A 2KDFB 3H9DA 2C5LC 3ZUNA 2CR5A 1HE8A 4DWFA 3AI5A 3ZDTA 2DZJA 3DVNV 3DBSA 3V61A 1YJ1A 3DVGY 5GMVA 5CTRC 3SHQA 4RM8A 2R2OA 4NNJB 3L10B 1EO6A 4W9DA 4GB9A 2L0TA 3SDLC 4DK5A 1H8CA 1LQBA 3ZNZB 4PS3A 2DENB 1V2YA 5L95C 1L7YA 2NPTB 2QHOA 4GSWA 1EF5A 4TUUA 2LASA 1V6EA 4DBGA 1SE9A 3WAOA 1WJNA 3IHPC 2N1WA 2LVQA 4NJ7A 5J18A 1WX9A 1WX8A 2PE6B 2NPTA 4W9FA 4ZRJA 2KDBA 3VFKA 3L54A 1F9JA 4KDIC 3RZFA 2K8BA 2LRWA 5AZGA 2ZEQA 3RULA 3K9PB 2KOXA 1UGMA 1UH6A 3NS8A 4HDQA 3DCGA 3PVLA 3WANA 3WAPA 5AZFA 2RSUA 2KMAA 3KW5B 3PRZA 3DVGX 4K7WA 3DOWA 1WXAA 4WJOA 1MG8A 2CHWA 4NAWB 2D07B 3NOBA 2MLBA 2KJRA 3CF6E 2PE9A 3N30A 4PS8A 3VUWA 5DPTA 2BF8B 2Z59B 4II2B 3WAMA 2KD0A 1AARA 5G55A 1WGYA 3APCA 3B0AA 2G45B 2MBEA 1Z5SB 3R7QA 2KX0A 1KM7A 2KMCA 3VVWB 3BY4B 3N3KB 3X23A 2BGFA 1WR6E 4MJSA 2GOWA 2C7MB 1S1QB 2LGXA 2WDTB 3PLUA 2LVPA 2KN5A 2O2VB 2WWZA 2IZVB 4FN2A 4LDTD 2RD0A 2KQSA 1WXSA 3VDZA 1L2NA 3QC8B 4K7UA 4M8MA 3A9JA 2MCNB 3PGEA 3QX1A 1EF1A 2N7DA 4G3XB 2O2VA 1RLFA 2GBMA 1WYWB 4MELA 5FR6A 3W1YA 4DXAB 1V5TA 1K8RB 2DYBA 1Q5WB 1TGZB 2FCQA 2HD5B 2GBNA 3H6NA 1UBQA 4I6NB 4GIVA 1E7UA 3DQVA 3ZNGC 3VH3B 1YD8U 4II3B 2BPSA 4BFRA 2KC2A 1E8ZA 3PREA 2CS4A 3IFWB 5JHAA 4FHKA 4HPMB 1Y8RC 4IUMB 2KJHB 4KIKA 2D10A 2IO3B 2YVCA 3TBLD 4PYZA 4GDLB 3KVFB 1KJTA 3VUYA 3L08A 5DPWA 4RMAA 4WJPA 3PV1A 1IP9A 3PHWB 1E8WA 2JXXA 2DZIA 1R4MI 3M3JA 2ASQA 5CHVC 3OLMD 3PZDA 3TIXA 1TZ1A 5C1ZA 1TTNA 3JYUA 3TL5A 1JRUA 3RD2A 2KO3A 2C60A 4A20A 1WF9A 2ZJDA 4F1SA 1V86A 2NR2A 3LJ3A 2J0KA 4MH0E 4X57B 4EFOA 4GN1A 3DPDA 4W9IA 2D2QA 1WMHB 1E8XA 1WI0A 4DHJD 2UWQA 5KHOA 1D3ZA 4JLCA 1OGWA 2AL3A 3CSTA 4IG7B 2PPHA 1EUVB 2B3AA 3DVNU 4TQ0A 1KLVA 3ZIMA 1WMHA 4G11A 4HJKA 2MSED 3UGBB 5DPRA 2LRUA 4AJYB 1I42A 2LWPA 3VUXA 4ASWC 3Q3JA 4KDLB 3ML9A 2VRRB 4TKNA 2JY6A 4E3CA 5L83A 1WJ4A 1P98A 2JVCA 4MM3A 3T9LA 4FHJA 4IWPA 4HCNB 2JF5A 5DPSA 4HCPB 4E74A 1E7VA 1RRBA 3ZNHB 2N7EA 1UZXB 1ZW7A 1WGDA 4KZCA 4B95A 3NZUA 2ZVOA 2MRPA 3ZRFA 2EMSA 2KC1A 2K8HA 3UIOB 4G0NB 1P1AA 4W9LA 1V80A 4E71A 3WALA 2KNBA 2KX3A 1H4RA 4JQWC 3ZKJC 2IO2B 4LCDE 4RM9A 1OTRB 3OJ3A 1WE7A 4B6WA 4EEWA 1V81A 4NY0A 3DBRI 3VHTC 2KWCA 4W9EA 1GUAB 2CHZA 2KVRA 3HK0A 2FAZA 1P0RA 5CX3A 1GJZA 2FCMA 2ZPNA 2KKCA 4HVBA 3ZW3A 3P2BA 2MBQA 3HM6X 4IW0A 3M95A 2BKRB 3LDZE 1YIWA 2ZNVC 4FJYA 2K25A 3L17A 2A5UA 3NHEB 4MDKE 5KHQA 3WIMA 5E6NA 2G4SA 1WFYA 1XT9B 3V62A 4ICUA 3M63B 1VD2A 4BOSC 1LFDA 2KTRB 2PEAA 5DCNA 3TCAA 2FIFA 2MQJA 3N32A 4F7ZA 1WZ3A 2BWFA 2JPHA 3L16A 4N9F4 2KTRA 2KANA 2NBVB 3R7RA 2K1FA 4CYEA 1GNUA 3KYDD 4KSLC 4BKGA 5JH5C 2JZ3B 2KLGA 3JSVB 4WQOB 3SU8X 2KDIA 4MJSB 4AUQC 4HDOA 3A1QA 4BKSD 1C3TA 1E8YA 1XD3B 1SIFA 4XZ4A 3ZTCA 2BKFA 3JSVA 3A33B 4M8NA 2MBOA 1Q0WB 4ANXA 3A9JB 2AWTA 4ANWA 2DYOA 2GBRA 2L05A 2FIDA 4EUTA 4LJPB 4AWJA 1TBEA 4ICVA 1XQQA 3PHXB 5LLIA 4GGQA 1J0GA 3HHMA 4BKSA 2XBBC 1E5WA 5EDSA 4LDTB 3IBEA 3OAWA 2CHXA 4OVVA 3VTVA 5JZEB 4XC2A 2BWES 4HXDA 3KUDB 3M62B 4PYUA 5AZHA 3U7DA 2FUHB 1P3QU 2MW5A 1PQSA 4KIKB 3MTNB 4FULA 2HJ8A 3A9KB 4BKTA 2LXAA 1E90A 4JIOU 4MGKE 4JGHB 2N4FA 3AU5A 5D6JB 1KOTA 1J19A 2K8CA 3A9KA 1WH3A 1WJUA 3L0WB 1RAXA 4FADA 2I1JA 1A5RA 3AU4A 3Q3FA 2LVOA 4ZDVA 2IY0B 3QJZA 4WWPA 4MGZE 2KQ7A 3ZTDA 3QQ8B 4KSKC 4W9JA 4GDKA 2M0XA 2K39A 2KXJA 2KHWB 3BINA 3UIPB 3B1LX 2M4NA 5C23A 2DAFA 4AP4C 2JUOA 2DZMA 4F8CB 2BYEA 3IVFA 3ZNID 4TV3A 3ONSA 3QK0A 4K81A 2MX2A 4WJNA 4IWQA 3HIZA 3QWZB 2MBBB 2V3SA 2M17A 2ZPYA 2OJRA 4MEMA 3RT3B 2AL6A 1Z2MA 3W1SC 2D11A 3HM3A 1P9DU 1ISNA 2G4DB 2M1MA 3PRPB 1WM3A 4DHJB 3R3MA 2Z0EB 4HPLB 2ZCBA 4ZRKA 4KVGB 2J0MA 2XEWA 4YL8A 4NQKE 3JW0X 4DHZE 1WM2A
chains in the Genus database with same CATH superfamily
3I63C 2JZZA 2J0JA 2WX1A 4HJGE 3H7PB 2IBIB 3RUIB 2L8JA 4GOCA 3AM9A 2NVUI 3CSFA 4K7SA 3R66C 3AULA 1NVID 3TUOA 1WSPA 2LHDA 2JT4B 5IN7A 4W9GA 1UGJA 3ZVVA 2K3UA 2N9XA 5LNK1 4AQ7A 2LUEA 4GXBA 4BBNC 4XX5A 2BVCA 5AEKB 2Q5WD 2MP2A 3MFGA 3A4RA 1C4CA 2LGSA 2GBKA 3T8MA 3GS2A 1V97A 2K6DB 4DDID 2O6VA 3KYCD 2JRIB 1QZEA 4OZAA 4S0RA 3C0RB 4IWOA 3E56A 3EGRA 3AEAB 3K9OB 4FBJB 2Y3AA 1Q1OA 4EZJA 3X0WA 4J6IA 2WGSA 3P42A 1FRDA 4D2KA 2JZPA 2KFKA 4P1CC 5CHWA 4XDCA 4W9HA 1GG3A 4OVUA 1WE6A 3AV8A 4AS1A 3N1YC 3RNEC 2QILA 2V3NA 3OJ4B 4W9CA 4YT0B 4QAYA 3MC8A 4US8A 1ZXHA 1VJKA 5TR5A 2V4LA 2KWVB 2KFJA 3N20C 3DBRB 1GC7A 2UYZB 1N5WA 2JWZA 1V9JA 1YQ3B 4C7ZA 1SIJA 4EZLA 1HTQA 3KQ4A 2DZKA 4M00A 3BWUD 2R2QA 2E3TA 2GLSA 1FMAD 1NEKB 2BYFA 1NBFC 2X38A 3ZDMC 5TSSA 1L5PA 2GB1A 1WJ6A 1FXTB 2DBYA 1FCCC 2KJ6A 1WZ0A 1FM0D 1U4AA 1SJHD 1N63A 3JVZX 2G3QB 3ML8A 3EECA 2LGYA 1WGKA 3L13A 3AE7B 1M94A 2JXTA 3Q8CA 3O13A 2IDYA 2IJ0A 1CK1A 1HZ5A 2XK5A 3LB8C 4GDLA 2JYEA 3O65B 1V1PB 3UF8A 3ZNGC 4YSXB 4LJOB 1VZ7A 2V1YA 1JCKB 3RZWC 4WAAA 3W1SA 2NCNA 2DX5B 1SE3A 5EE3A 3QA8A 3QCAA 1EM7A 3AH7A 2C7HA 3MP9A 2CKHB 2GI9A 1UWXA 1L4DB 3ECIA 3ZO5B 4ZYNA 2KDFB 2C5LC 1HA5A 4DWFA 5GMVA 4WWMA 2G1EA 3L10B 1EO6A 4W9DA 3SDLC 2BBCA 3P4QB 4TMAB 3U2SC 2K5PA 2QHOA 4GSWA 1IUEA 3WAOA 1WX9A 4W9FA 2XN9C 4KDIC 1F9JA 2WQYB 3N1ZC 2K8BA 2ZW1A 5FR3A 1UGMA 2K9XA 2QEJC 3TSSA 3BYTB 3IAS1 3WAPA 2RSUA 2KMAA 3DVGX 3DOWA 4A90A 1UF0A 2D07B 1I4GA 3NOBA 2KJRA 3CF6E 3I5JC 3N30A 4PS8A 4MT5A 3URYA 3KWLA 2Z59B 2NTSA 2J42A 1DOYA 1WGYA 1Z5SB 2QDFA 5GXGB 2I2YA 4A9AA 1WR6E 4MJSA 1S1QB 2WDTB 2O2VB 2KN5A 4OHJA 3A9JA 3QX1A 3RFZB 1RLFA 4MELA 3Q3MC 3AEBB 1MI0A 1WWTA 4DQOC 1Q5WB 1ZP0B 1DYQA 2BS4B 2HD5B 2GBNA 1UBQA 2BPSA 4CQNA 3EUB2 1Y8RC 4KIKA 2KJHB 2D10A 3BYYB 3W5UB 4GDLB 4L2YA 1N61A 4RMAA 4WJPA 3PV1A 1C78A 1E8WA 2JXXA 4ZHPA 1K50A 1TS4A 2PTLA 2AQ2B 3TL5A 1VRAB 1JRUA 3RD2A 2C60A 1HEZE 5IKCM 1I4RA 4EFOA 2J0KA 2WP9B 1K52A 4MH0E 4X57B 3FAHA 2PPHA 2L32A 1KLVA 3ZIMA 4G11A 4RF1A 4OW0A 1I42A 5E6JA 2M56B 4ASWC 3Q3JA 3IT4B 2KWDA 1OQRA 2VRRB 4C7YA 1WJ4A 1P98A 4IWPA 4HCNB 1PFDA 4IKGA 3ZNHB 3NZUA 2PW9A 2EMSA 1J7BA 5IP4D 1P1AA 4E71A 1E9MA 3WALA 3MC9A 3ZKJC 1SSNA 1WE7A 1V81A 4NY0A 1JWMD 1P0RA 5CX3A 1GJZA 4HVBA 3ZW3A 4IW0A 3M95A 3FKYA 1SXTA 5KHQA 2A5UA 3NHEB 1TY0A 4RGTA 1I7HA 3V62A 3NVWA 3FC4A 2N9KA 1MHXA 1VD2A 4YXDB 3R2IA 1T6BX 1FO4A 4F7ZA 2MHJA 3L16A 1GNUA 4MJSB 2RDGA 4JWUC 4YTNB 3A1QA 3JSVA 1Q0WB 3A9JB 3AEEB 4ANWA 1YN4A 2L05A 4EUTA 1FEHA 1XQQA 5LLIA 4GGQA 1EU3A 4BKSA 2L83A 4LDTB 1TZOA 4OVVA 3VTVA 1C77A 5JZEB 4XC2A 5AZHA 1L0YB 1PQSA 4KIKB 4PK1A 2LXAA 1K53A 2VH1A 4JIOU 3RNBC 1J19A 1TJEA 1WJUA 1QOFA 1KFYB 5G5HA 3BK2A 2YEPF 4ZDVA 2KQ7A 2K39A 4REZA 3B1LX 5C23A 4HEA1 3WCQA 2TSSA 4AP4C 1KLGD 2BS3B 2JUOA 3DHGC 5H92C 2BYEA 4NAMA 4XE0A 2FUG1 2MX2A 3SFEB 3QWZB 5AUIA 4KKJA 2BB6A 2V3SA 2OJRA 2AL6A 1ISNA 2G4DB 3PRPB 1C79A 4DHJB 4ARIA 2J0MA 2W54A 2IGHA 4K3BA 3BZDB 2PKOA 5IA7A 2I1KA 2KAJA 3U4EG 4HK2A 2KWUB 3H7PA 4KGTA 4EZKA 3EC8A 4OZCA 3ZLZA 1WX7A 2VZKB 4G50A 4ANVA 4FJVB 2O6VD 2KTFA 2GRIA 2NBWB 2RR9A 5G2NA 4XDDA 2E6XA 3Q3OC 3U8ZA 2LGIA 3GZNB 3PZ7A 1IYFA 3DBLI 2FCSA 1LM8B 2BT6A 2MBHA 4DHZB 3Q8BA 2N1VA 5HHDG 4O1NA 3KUCB 1T0SC 2V0GA 3VR9B 2C7NB 3U30A 3EA6A 1ZXIA 1X1MA 3ZYYX 3APDA 2MJDA 3AXCA 4FA6A 4IDIA 3PO0A 4DXFA 1JMLA 3A1QB 1YNTE 3H8HA 3AE4B 3DBHI 3MHSD 2C9WB 1JWSD 2VH2A 4GU2A 1WY8A 4YSZB 2K0PA 4WQMA 4KV2A 2ZCCA 1JRPA 4L1BA 1UUPA 4KGSA 1MFWA 3WA0A 1VCBA 3VTUA 2GMIC 3ZXRA 4RF0A 1STEA 5AUKA 3V6CB 1XLQA 1G6JA 3AE5B 4PT5A 3T3NA 2J7QB 4I6PA 3AEFB 3GB1A 3U52E 4A3OA 5D3IB 3SEBA 3AEDB 3PTFC 1SGHA 2R61A 2GBJA 1XO3A 2JQRB 1WGRA 3MJ5A 2NBUA 2LMCA 2IO0B 2WDQB 3AE9B 2PVOD 3VXWA 2M8SA 1HXYD 2KK8A 3Q14C 1JWAD 3NZ3A 1QOGA 2EELA 4BOZB 2BS2B 1QOAA 1F0ZA 4TQ1A 4XYCA 1T3QA 1T0QC 3AMZA 3P4PB 2MJEA 2WLBA 1I35A 3H1UA 1D5MC 4M01A 5IO9A 1XXGA 2AQ3B 3GOEA 3L4PA 5G5GA 1BT0A 4HPPA 2FCNA 4ACFA 1N5XA 2OJWA 5BMGA 1J7AA 4RH6A 1P7FA 4HWIB 2BB5A 2WX0A 3QAQA 1L4ZB 2M0AA 1V1PA 1XLNA 2Z0DB 3C19A 2MWSB 2Y5BB 2KDMA 3TEXA 4UDUC 5BMHA 3OG5A 1AYFA 1NDDA 1TYGB 2Y5CA 3ZQ4A 5IAAC 4MH8A 4KZ0A 4C80A 2WU5B 2YLMA 3VAWA 3QHTA 4MGIE 2N9EB 2ONQA 1FFVA 1E0ZA 1HE8A 3ZDTA 1IBXA 3N1XC 3DBSA 1YJ1A 2WDVB 5CTRC 3KLSX 3TEWA 3HVDA 4GB9A 2L0TA 4DK5A 1H8CA 3ZNZB 4PS3A 5L95C 2NPTB 4TUUA 2MEKA 4DBGA 2H89B 2LVQA 3Q8AA 4RNAA 1XCTL 4ZRJA 3L54A 5I4DA 3RPFC 4C4VA 3RULA 5BMIA 1WYGA 3NS8A 3DCGA 3WANA 2D3AA 3PRZA 4WJOA 1MG8A 2CHWA 4L23A 3VUWA 2PE9A 5DPTA 2BF8B 5G55A 1JALA 1GB1A 1TIFA 3VVWB 2ZW0A 3AB5A 5BYQA 2GOWA 2C7MB 2LGXA 3PLUA 1XCQL 3IXSA 4LDTD 4ZOHC 1WXSA 3QC8B 4M8MA 2MCNB 1EF1A 2O2VA 2GBMA 4OZBA 1WYWB 3W1YA 5FR6A 4DXAB 2HJ1A 3SFDB 2FCQA 1D5ZC 4I6NB 1RWSA 1KRHA 4GIVA 4WH4A 3VH3B 4LK0M 3GP7A 2KC2A 2RMMA 2CS4A 3IFWB 4HPMB 4J3OD 1BMLC 3LYYA 2LHEA 2DZIA 3M3JA 2QIEB 2WHIA 3PZDA 1ZUD2 3JYUA 2KO3A 4F1SA 4W9IA 2D2QA 1WMHB 1WI0A 4DHJD 1D3ZA 1ET6A 1OGWA 2DWQA 2B3AA 3DVNU 5DPRA 2LRUA 4AJYB 1MVKA 2DLBA 4MM3B 1HQRD 4HKZE 1A70A 4E3CA 1RM6C 1IBXB 2JVCA 4FHJA 1E7VA 1I4PA 1RRBA 2IGDA 1WGDA 2VZKD 2ZVOA 2G9HD 3ZRFA 3UIOB 1V80A 2IGGA 4K3CA 1H4RA 1PDXA 4LCDE 2D5GA 4EE2A 2KWCA 1GUAB 1SE2A 3T3OA 2FCMA 4C4VB 2MBQA 3HM6X 2NTTA 2K25A 4MDKE 5E6NA 2HTME 1PYWD 2BW2A 4A55A 2KTRB 3TCAA 2FIFA 2MQJA 3P4SB 1FFUA 3N32A 2WU2B 2NBVB 3KYDD 2KN4A 4HRSA 4JX1C 3SU8X 4AUQC 4LLGM 1SBBB 4BKSD 1E8YA 4XZ4A 2CJNA 3Q8FA 4ZYSA 4ANXA 2DYOA 2GBRA 3V05A 1T0RC 4AWJA 1TBEA 4ICVA 3DWGC 1IGDA 3ETRA 3IBEA 2CHXA 3NUHB 4HXDA 2D3CA 3KUDB 3M62B 2MW5A 1FCLA 3MTNB 2HJ8A 4LTUA 1PUTA 1V8CA 1FPYA 4JGHB 5D6JB 3ZJUA 1WH3A 1RAXA 4FADA 3Q3FA 2IY0B 3QJZA 4MGZE 4W9JA 4GDKA 1CQVA 3B2FA 3AE1B 2RDHA 2WXGA 2DZMA 3RNFC 4F8CB 2YEPB 3QK0A 4K81A 1VZ8A 4IWQA 3HIZA 2M17A 2WXNA 4MEMA 1TS5A 2M1MA 2WXFA 4M0WA 4TSSA 3R3MA 2Z0EB 4ZRKA 2KACA 4YL8A 1FXAA 4JWSC 4DHZE 1WM2A 3RNGC 3MHZA 5C2TB 1V5OA 5LXHA 2L3ZA 2KYWA 1ET9A 3V6EB 5JXVA 3CMMB 2UU7A 2IYDB 3ZJVA 5J17A 3N9YC 1WR1A 4IOIE 1WXVA 3IG3A 4XWTA 4FXCA 4IC7B 1YX6B 3EHVA 1HTOA 5E6OA 3RYTA 1D6EC 3FILA 2MA9B 1L6VA 2RDBC 1R4NB 3VQIA 1F2RC 2CU1A 1B1ZA 3PRMB 2A4ZA 4M02A 3P4RB 4IM3A 4AJWA 3NVYA 1YQBA 3P1MA 1OQQA 3PS6A 4XGAB 4YWGG 4LNKA 4RCOA 2OOBB 1YN5A 4B9KA 2L0FA 1E7PB 5HKHA 1WGGA 1UBIA 1ZE3D 3AE6B 3B08A 4KKIA 3R2TA 1K51A 1I4XA 2ZVNA 2RGFA 4ZRIA 1WXMA 2KZRA 3TJPA 2BYVE 5J2RA 3QIJA 2KDEB 1TS2A 4NAWA 2REXA 1YX5B 3KH0A 1JROA 3NRZA 4C00A 2LXCA 4HLEA 4HKQA 4JE3B 1WRDB 2HE7A 4FLHA 4NPNA 3MJWA 4WWOA 2KVZA 4GDKB 3E9SA 3NG0A 1YN3A 3BIID 1FNUA 2PVGC 4DDGD 4K1RB 3QARA 1ENFA 3VH4B 4CHKA 3LXFA 2LJ5A 1ZGUB 4R3DA 4ANUA 2H88B 1RFAA 5D2MB 1BXTA 4M0WB 2W9NA 4NZLB 1RFKA 2FNJB 1ZKHA 3NVVA 3APFA 5D3DA 3Q8EA 3GZNI 2WXLA 1GC6A 1ESFA 3DWMA 3IT6B 4WIPA 3DDCB 3TEYA 4GMVA 2J52A 2K6QA 1OEYJ 2N0SB 3AE8B 1L0VB 2HTHA 3H7SA 5BO4B 5JHBA 4JPSA 3TEZA 3NVZA 2SEBD 3EFUA 3NY5A 4MGYE 1TKYA 3PLVA 1ZDVA 2LGDA 5CHFA 1WGHA 2N9PC 3PSEB 3PPAA 3UQBA 4BBNF 1F1HA 1C4PA 1UD7A 3FILB 4LNIA 1R4MB 3V60A 3H9DA 3ZUNA 2KMMA 2J53A 3AI5A 2DZJA 3V61A 3DVGY 3SHQA 1C9FA 4RM8A 5MPOA 1QILA 1V2YA 1EF5A 1V6EA 3W5VB 1WJNA 5J18A 1WX8A 2PE6B 1MHHE 2NPTA 1I4QA 3RZFA 2LRWA 5AZGA 4A6QA 1L6UA 3K9PB 3CIRB 4N59A 3PVLA 1D5XC 2OEDA 4C56C 2WXPA 5AZFA 1GB4A 4K7WA 1WXAA 4NAWB 1ZPSA 4NJCA 4II2B 3MC0B 1AARA 3APCA 3B0AA 2G45B 1C76A 3R7QA 2KX0A 1KM7A 2KMCA 3BY4B 3N3KB 3DBLB 2KQSA 1L2NA 4K7UA 1SF0A 4G3XB 3CWIA 4LNFA 2DYBA 3H6NA 1TGZB 1E7UA 4ZRQA 2JU6X 2N7JA 3IAM1 1YD8U 4BFRA 5JHAA 1XLOA 4FHKA 2IO3B 2YVCA 3TBLD 2WS3B 1SB3C 1KJTA 3VUYA 2EKIA 1TZ1A 5C1ZA 1DGJA 4A20A 2L52A 1EWYC 1WF9A 1T5XD 1EWCA 4GN1A 1E8XA 2UWQA 5KHOA 2CU3A 4JLCA 2AL3A 3CSTA 5IOIA 1WMHA 4HJKA 2MSED 3KWVA 4N58A 2IPKD 1F2RI 4KDLB 3ML9A 4TKNA 2JY6A 5L83A 2V3PA 4MM3A 3B2GA 3T9LA 1AWDA 1ACCA 2JF5A 4E74A 4HCPB 2N7EA 1ZW7A 1JQ4A 4KZCA 2MRPA 2K8HA 2CJOA 2KNBA 2W3SA 3B9JA 4JQWC 2IO2B 4RM9A 3OJ3A 1N60A 3DBRI 1JW9D 4W9EA 2CHZA 1XF5L 2ZPNA 3P2BA 2BKRB 3UI3A 1VLBA 1AW7A 2Y5PA 2G4SA 2BYTA 4ICUA 2WXOA 3M63B 2J4XA 2LEKA 2LFIA 5DCNA 1WZ3A 2JPHA 2KQ4X 2KTRA 3ZXVA 4KSLC 4BKGA 5JH5C 2FE8A 4YSYB 3VRAB 3R8BA 1C3TA 1SIFA 2N9LA 2BKFA 1DOXA 3A33B 4WAFA 2FIDA 4ITKA 4LJPB 4KX6B 3J9CA 3PHXB 1J0GA 2QSDA 2JYTA 5EDSA 4KGRA 3OAWA 3PZ8A 4WURA 2BWES 4PYUA 2BTEA 4FULA 3A9KB 1I4HA 2OHFA 2V4IB 2N4FA 2WXHA 1KOTA 2I1JA 1A5RA 3I57A 4WWPA 4P6VF 5HFYA 1YJIA 3QQ8B 2M0XA 2KXJA 3BINA 1YOVB 2M4NA 1B9RA 2V9HA 2DAFA 1TY2A 4TV3A 3ONSA 4WJNA 1JWUD 4BZAA 2MBBB 2ZPYA 3RT3B 3RNCC 1PGXA 2D11A 3HM3A 3V3XA 1P9DU 1DOIA 3AE2B 1WM3A 3AEGB 2MJ3A 2BQQA 2PMVA 4HPLB 2ZCBA 1TS3A 1NYRA 2INNE 1N62A 2RPVA 2DNFA 4AOFA 4MSQB 3A4SC 2IY1B 4USAA 1LO5D 1C1YB 4W9KA 4IM0A 1CJEA 2DHZA 2L00B 1LXDA 2L1AA 2ZZPB 1SE4A 3ZRCA 1FNVA 1KLUD 1S3SG 2MP2B 2ACZB 2RPQA 5D7GA 1PGAA 4MSMB 2O6VB 1EU4A 2QMTA 1P7EA 1J8CA 1KF6B 1KTKA 1OEYA 1CMXB 4WWNA 2AYOB 1FIQA 1VDVA 2EKEC 1MPEA 3W2DA 2WDRB 3I3TB 1PGBA 2ZNVB 2KFKB 4OVZA 1WRIA 2KLCA 3ENEA 1QLBB 2QJLA 1AN8A 4URKA 2LZ6A 4WJQA 3BVGA 4CO7A 1D4BA 4P16A 4P7IA 2PIAA 3VR8B 1MG4A 5FK9C 4A3PA 4P1BC 5LXIB 4HROA 2LD9A 3Q3NC 3PT2B 1QOBA 4RGOS 2IO1B 1XLPA 2W82A 3UQAA 3C8YA 2SAKA 4I6LB 2XNAC 2INDC 4IM2A 2L7RA 1T0YA 1LGRA 2INPE 1GAQB 3VTWA 1WIAA 2AEHA 3D32A 3AECB 4EKUA 5BYSA 2JRHA 2PJHA 2NS5A 2EMTA 4BVUC 4NQLB 2L76A 2AX5A 1M4VA 3AE3B 5EE9A 3Q6BA 3TMPB 1NI2A 2XK5B 4NJ6A 2D3GA 3GE3C 2DYMA 1OQYA 4BAXA 3S2AA 1R4NI 3UINB 5E6PA 4PS7A 2LJIA 2LI5A 3RCZA 1YJJA 3SD5A 1NI3A 5BYRA 3HVZA 3KUZA 4S17A 2PLPA 4A8XC 3ALBA 4YTMB 2DAJA 3AN1A 2FBWB 2NMQA 3NZSA 1N6ZA 5D94A 2WYQA 4ZHOA 4JL9A 4FJZA 4ZRPA 3Q2AC 4ARCA 1IPGA 3SR6A 4EOYA 5T8IA 1F77A 1UELA 1V49A 2CR5A 3DHHC 4RFBA 3DVNV 2R2OA 4NNJB 1BUIC 2D3BA 2WXRA 1LQBA 1SJED 1UWMA 2ICIA 1FRRA 2DENB 3ZJTA 1L7YA 3RI7C 3Q69A 2LASA 1SE9A 5FKAC 3IHPC 2N1WA 4NJ7A 2KDBA 3VFKA 2W55A 3BVMA 2ZEQA 1VR9A 2KOXA 1V1OA 1UH6A 4HDQA 1XEEA 2WXQA 3KW5B 3NJTA 2M19A 1WXQA 2MLBA 3HRDD 3WAMA 1UNSA 2KD0A 2AQ1B 2MBEA 1NENB 1FD6A 2WNMA 3X23A 1GPXA 2BGFA 2LVPA 2WWZA 4FN2A 2IZVB 2RD0A 2HDEA 4RGNA 3VDZA 3PGEA 2N7DA 4XWWA 2WXMA 3I9V1 1V5TA 3RNAC 1K8RB 2X8XX 4LNNA 1ZDXA 2K22A 1QF6A 1CZPA 3DQVA 4II3B 1E8ZA 3PREA 4IUMB 1QKZA 4PYZA 3KVFB 4N6EB 1ROEA 3L08A 1NYQA 5DPWA 1IP9A 3PHWB 4LNOA 3RN9C 2Z8LA 1R4MI 2ASQA 5CHVC 3OLMD 3TIXA 1HZ6A 1TTNA 2ZJDA 1V86A 1Y56A 2NR2A 3LJ3A 3GE8C 2INCC 3DPDA 3NS1A 1FXIA 3ABVB 4Q2JA 4IG7B 1EUVB 4TQ0A 1QT9A 5HG2A 4GLSC 1YQ4B 5C3JB 3UGBB 2LWPA 3VUXA 3ZGZA 1TKGA 3BVZA 1YMHE 5DPSA 1UZXB 2MH7A 4B95A 1C4AA 2KC1A 4G0NB 4W9LA 2KX3A 5EE1A 3VRBB 1OTRB 2JX5A 4B6WA 4EEWA 4US9A 3VHTC 3W9CB 3HK0A 2KVRA 2FAZA 1OFFA 3RMKC 2KKCA 3LDZE 1YIWA 2ZNVC 4FJYA 3L17A 3WIMA 1WFYA 1XT9B 4RGMA 1RYJA 1IGCA 1ZOYB 2WXKA 4BOSC 1LFDA 2PEAA 2BWFA 4N9F4 1R7SA 3EFCA 2KANA 3R7RA 2K1FA 4CYEA 1KH0A 1GOZA 1MJDA 1TT5B 2JZ3B 2KLGA 3JSVB 2KDIA 4WQOB 4HDOA 2JSVX 1E6EB 1XD3B 3ZTCA 1SEBD 4M8NA 2MBOA 2AWTA 2W3RA 2JWUA 2QC8A 1JWBD 3HHMA 2XBBC 1E5WA 4B0EA 5H8YE 1VZ6A 3U7DA 2FUHB 1P3QU 3HUIA 4BKTA 1E10A 4B0MA 1E90A 4MGKE 3DBHB 3AU5A 3DHIC 1FNWA 2K8CA 3A9KA 3L0WB 1QQRA 2QCZA 3AU4A 3P63A 2LVOA 3ZTDA 1Q10A 4KSKC 2KHWB 3UIPB 2KT7A 1J7CA 2LUMA 5EE0A 4H2AA 1TKEA 4YTPB 3U7ZA 3IVFA 3ZNID 4DXGA 1L0XB 1Z2MA 4MACA 3W1SC 2ON8A 1F52A 2B76B 2WXJA 2WXIA 4KVGB 2XEWA 4NQKE 3JW0X 5HI1A 3BK1A 2I38A 3OWEB
chains in the Genus database with same CATH topology
4AOFA 2JZZA 1V5OA 4MSQB 2J0JA 2WX1A 5IA7A 3H7PB 2IBIB 2I1KA 3RUIB 2L8JA 5LXHA 2L3ZA 2IY1B 3A4SC 4GOCA 2NVUI 3CSFA 4K7SA 1C1YB 3R66C 4HK2A 2KWUB 3V6EB 3CMMB 3AULA 2IYDB 3H7PA 2JT4B 4W9KA 4W9GA 5J17A 4IM0A 3ZVVA 2N9XA 4EZKA 1WR1A 3EC8A 3ZLZA 2DHZA 1WX7A 2LUEA 1WXVA 3IG3A 2L00B 1LXDA 4G50A 4GXBA 4BBNC 2ZZPB 4ANVA 3ZRCA 4IC7B 4FJVB 4XX5A 1YX6B 2O6VD 2KTFA 1S3SG 2MP2B 2NBWB 2RR9A 3EHVA 5G2NA 5E6OA 5AEKB 3RYTA 2RPQA 3U8ZA 5D7GA 2MA9B 4MSMB 1IYFA 2O6VB 2MP2A 3DBLI 2FCSA 3A4RA 1J8CA 3VQIA 2GBKA 1LM8B 1OEYA 2MBHA 3T8MA 1CMXB 4DHZB 4WWNA 2CU1A 2K6DB 4DDID 2O6VA 3PRMB 2A4ZA 2N1VA 2AYOB 3KYCD 2JRIB 1QZEA 2EKEC 3KUCB 3C0RB 4IWOA 4IM3A 2C7NB 3U30A 4AJWA 3I3TB 3K9OB 1YQBA 4FBJB 1X1MA 3PS6A 1Q1OA 3APDA 4EZJA 3X0WA 2ZNVB 2KFKB 4J6IA 3AXCA 4FA6A 2KLCA 3ENEA 2OOBB 3A1QB 3DBHI 4B9KA 2KFKA 5CHWA 2L0FA 4URKA 2LZ6A 4WJQA 3MHSD 2C9WB 4GU2A 4CO7A 4W9HA 1GG3A 4OVUA 1WE6A 5HKHA 1WGGA 1UBIA 3B08A 4P7IA 1WY8A 4KV2A 4A3PA 2ZCCA 2ZVNA 3OJ4B 4W9CA 2RGFA 4ZRIA 1WXMA 2KZRA 5LXIB 2LD9A 3TJPA 3PT2B 2BYVE 3WA0A 1VCBA 5J2RA 3VTUA 2GMIC 3QIJA 2IO1B 2KDEB 5TR5A 2V4LA 4NAWA 2KWVB 2KFJA 3UQAA 2REXA 3V6CB 4I6LB 1G6JA 1YX5B 3KH0A 1GC7A 2J7QB 4I6PA 4IM2A 2UYZB 2LXCA 4A3OA 2L7RA 4HLEA 1T0YA 2JWZA 1WRDB 1V9JA 3PTFC 3VTWA 1WIAA 2HE7A 4FLHA 4NPNA 1SGHA 4EZLA 3MJWA 2GBJA 4WWOA 2AEHA 4GDKB 3D32A 2DZKA 2R2QA 1WGRA 4EKUA 2NBUA 2JRHA 2PJHA 2IO0B 2BYFA 2NS5A 2EMTA 1NBFC 4BVUC 3ZDMC 4NQLB 3VXWA 2M8SA 2L76A 4DDGD 2KK8A 4K1RB 1WJ6A 3QARA 1FXTB 3VH4B 2KJ6A 4CHKA 1WZ0A 1U4AA 2LJ5A 1ZGUB 4ANUA 3JVZX 2G3QB 3ML8A 4BOZB 3EECA 3TMPB 1RFAA 4TQ1A 5D2MB 2LGYA 1NI2A 3L13A 1M94A 2XK5B 4NJ6A 4M0WB 2W9NA 1I35A 2D3GA 3H1UA 2FNJB 1ZKHA 2XK5A 3GOEA 4GDLA 2DYMA 1OQYA 3APFA 1BT0A 3GZNI 1GC6A 3O65B 2FCNA 3DDCB 1R4NI 3S2AA 5E6PA 3UINB 4PS7A 4GMVA 2K6QA 2LI5A 2WX0A 4HWIB 3RCZA 3SD5A 4LJOB 1OEYJ 3UF8A 3KUZA 3QAQA 2Z0DB 2HTHA 3ALBA 3H7SA 2MWSB 5BO4B 5JHBA 2V1YA 2DAJA 3EFUA 2Y5BB 3NY5A 3RZWC 4MGYE 4WAAA 3W1SA 2NCNA 2DX5B 3NZSA 3PLVA 2LGDA 3QA8A 3QCAA 1NDDA 1WGHA 2N9PC 3PSEB 2WYQA 2C7HA 3PPAA 5CHFA 5D94A 4JL9A 3UQBA 4FJZA 4BBNF 5IAAC 1UD7A 4KZ0A 2CKHB 1IPGA 4EOYA 2YLMA 3VAWA 3QHTA 3ECIA 4MGIE 1UELA 3ZO5B 1V49A 2N9EB 4ZYNA 3V60A 2KDFB 3H9DA 2C5LC 3ZUNA 2CR5A 1HE8A 4DWFA 3AI5A 3ZDTA 2DZJA 3DVNV 3DBSA 3V61A 1YJ1A 3DVGY 5GMVA 5CTRC 3SHQA 4RM8A 2R2OA 4NNJB 3L10B 1EO6A 4W9DA 4GB9A 2L0TA 3SDLC 4DK5A 1H8CA 1LQBA 3ZNZB 4PS3A 2DENB 1V2YA 5L95C 1L7YA 2NPTB 2QHOA 4GSWA 1EF5A 4TUUA 2LASA 1V6EA 4DBGA 1SE9A 3WAOA 1WJNA 3IHPC 2N1WA 2LVQA 4NJ7A 5J18A 1WX9A 1WX8A 2PE6B 2NPTA 4W9FA 4ZRJA 2KDBA 3VFKA 3L54A 1F9JA 4KDIC 3RZFA 2K8BA 2LRWA 5AZGA 2ZEQA 3RULA 3K9PB 2KOXA 1UGMA 1UH6A 3NS8A 4HDQA 3DCGA 3PVLA 3WANA 3WAPA 5AZFA 2RSUA 2KMAA 3KW5B 3PRZA 3DVGX 4K7WA 3DOWA 1WXAA 4WJOA 1MG8A 2CHWA 4NAWB 2D07B 3NOBA 2MLBA 2KJRA 3CF6E 2PE9A 3N30A 4PS8A 3VUWA 5DPTA 2BF8B 2Z59B 4II2B 3WAMA 2KD0A 1AARA 5G55A 1WGYA 3APCA 3B0AA 2G45B 2MBEA 1Z5SB 3R7QA 2KX0A 1KM7A 2KMCA 3VVWB 3BY4B 3N3KB 3X23A 2BGFA 1WR6E 4MJSA 2GOWA 2C7MB 1S1QB 2LGXA 2WDTB 3PLUA 2LVPA 2KN5A 2O2VB 2WWZA 2IZVB 4FN2A 4LDTD 2RD0A 2KQSA 1WXSA 3VDZA 1L2NA 3QC8B 4K7UA 4M8MA 3A9JA 2MCNB 3PGEA 3QX1A 1EF1A 2N7DA 4G3XB 2O2VA 1RLFA 2GBMA 1WYWB 4MELA 5FR6A 3W1YA 4DXAB 1V5TA 1K8RB 2DYBA 1Q5WB 1TGZB 2FCQA 2HD5B 2GBNA 3H6NA 1UBQA 4I6NB 4GIVA 1E7UA 3DQVA 3ZNGC 3VH3B 1YD8U 4II3B 2BPSA 4BFRA 2KC2A 1E8ZA 3PREA 2CS4A 3IFWB 5JHAA 4FHKA 4HPMB 1Y8RC 4IUMB 2KJHB 4KIKA 2D10A 2IO3B 2YVCA 3TBLD 4PYZA 4GDLB 3KVFB 1KJTA 3VUYA 3L08A 5DPWA 4RMAA 4WJPA 3PV1A 1IP9A 3PHWB 1E8WA 2JXXA 2DZIA 1R4MI 3M3JA 2ASQA 5CHVC 3OLMD 3PZDA 3TIXA 1TZ1A 5C1ZA 1TTNA 3JYUA 3TL5A 1JRUA 3RD2A 2KO3A 2C60A 4A20A 1WF9A 2ZJDA 4F1SA 1V86A 2NR2A 3LJ3A 2J0KA 4MH0E 4X57B 4EFOA 4GN1A 3DPDA 4W9IA 2D2QA 1WMHB 1E8XA 1WI0A 4DHJD 2UWQA 5KHOA 1D3ZA 4JLCA 1OGWA 2AL3A 3CSTA 4IG7B 2PPHA 1EUVB 2B3AA 3DVNU 4TQ0A 1KLVA 3ZIMA 1WMHA 4G11A 4HJKA 2MSED 3UGBB 5DPRA 2LRUA 4AJYB 1I42A 2LWPA 3VUXA 4ASWC 3Q3JA 4KDLB 3ML9A 2VRRB 4TKNA 2JY6A 4E3CA 5L83A 1WJ4A 1P98A 2JVCA 4MM3A 3T9LA 4FHJA 4IWPA 4HCNB 2JF5A 5DPSA 4HCPB 4E74A 1E7VA 1RRBA 3ZNHB 2N7EA 1UZXB 1ZW7A 1WGDA 4KZCA 4B95A 3NZUA 2ZVOA 2MRPA 3ZRFA 2EMSA 2KC1A 2K8HA 3UIOB 4G0NB 1P1AA 4W9LA 1V80A 4E71A 3WALA 2KNBA 2KX3A 1H4RA 4JQWC 3ZKJC 2IO2B 4LCDE 4RM9A 1OTRB 3OJ3A 1WE7A 4B6WA 4EEWA 1V81A 4NY0A 3DBRI 3VHTC 2KWCA 4W9EA 1GUAB 2CHZA 2KVRA 3HK0A 2FAZA 1P0RA 5CX3A 1GJZA 2FCMA 2ZPNA 2KKCA 4HVBA 3ZW3A 3P2BA 2MBQA 3HM6X 4IW0A 3M95A 2BKRB 3LDZE 1YIWA 2ZNVC 4FJYA 2K25A 3L17A 2A5UA 3NHEB 4MDKE 5KHQA 3WIMA 5E6NA 2G4SA 1WFYA 1XT9B 3V62A 4ICUA 3M63B 1VD2A 4BOSC 1LFDA 2KTRB 2PEAA 5DCNA 3TCAA 2FIFA 2MQJA 3N32A 4F7ZA 1WZ3A 2BWFA 2JPHA 3L16A 4N9F4 2KTRA 2KANA 2NBVB 3R7RA 2K1FA 4CYEA 1GNUA 3KYDD 4KSLC 4BKGA 5JH5C 2JZ3B 2KLGA 3JSVB 4WQOB 3SU8X 2KDIA 4MJSB 4AUQC 4HDOA 3A1QA 4BKSD 1C3TA 1E8YA 1XD3B 1SIFA 4XZ4A 3ZTCA 2BKFA 3JSVA 3A33B 4M8NA 2MBOA 1Q0WB 4ANXA 3A9JB 2AWTA 4ANWA 2DYOA 2GBRA 2L05A 2FIDA 4EUTA 4LJPB 4AWJA 1TBEA 4ICVA 1XQQA 3PHXB 5LLIA 4GGQA 1J0GA 3HHMA 4BKSA 2XBBC 1E5WA 5EDSA 4LDTB 3IBEA 3OAWA 2CHXA 4OVVA 3VTVA 5JZEB 4XC2A 2BWES 4HXDA 3KUDB 3M62B 4PYUA 5AZHA 3U7DA 2FUHB 1P3QU 2MW5A 1PQSA 4KIKB 3MTNB 4FULA 2HJ8A 3A9KB 4BKTA 2LXAA 1E90A 4JIOU 4MGKE 4JGHB 2N4FA 3AU5A 5D6JB 1KOTA 1J19A 2K8CA 3A9KA 1WH3A 1WJUA 3L0WB 1RAXA 4FADA 2I1JA 1A5RA 3AU4A 3Q3FA 2LVOA 4ZDVA 2IY0B 3QJZA 4WWPA 4MGZE 2KQ7A 3ZTDA 3QQ8B 4KSKC 4W9JA 4GDKA 2M0XA 2K39A 2KXJA 2KHWB 3BINA 3UIPB 3B1LX 2M4NA 5C23A 2DAFA 4AP4C 2JUOA 2DZMA 4F8CB 2BYEA 3IVFA 3ZNID 4TV3A 3ONSA 3QK0A 4K81A 2MX2A 4WJNA 4IWQA 3HIZA 3QWZB 2MBBB 2V3SA 2M17A 2ZPYA 2OJRA 4MEMA 3RT3B 2AL6A 1Z2MA 3W1SC 2D11A 3HM3A 1P9DU 1ISNA 2G4DB 2M1MA 3PRPB 1WM3A 4DHJB 3R3MA 2Z0EB 4HPLB 2ZCBA 4ZRKA 4KVGB 2J0MA 2XEWA 4YL8A 4NQKE 3JW0X 4DHZE 1WM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AOF A;  2JZZ A;  1V5O A;  4MSQ B;  2J0J A;  2WX1 A;  5IA7 A;  3H7P B;  2IBI B;  2I1K A;  3RUI B;  2L8J A;  5LXH A;  2L3Z A;  2IY1 B;  3A4S C;  4GOC A;  2NVU I;  3CSF A;  4K7S A;  1C1Y B;  3R66 C;  4HK2 A;  2KWU B;  3V6E B;  3CMM B;  3AUL A;  2IYD B;  3H7P A;  2JT4 B;  4W9K A;  4W9G A;  5J17 A;  4IM0 A;  3ZVV A;  2N9X A;  4EZK A;  1WR1 A;  3EC8 A;  3ZLZ A;  2DHZ A;  1WX7 A;  2LUE A;  1WXV A;  3IG3 A;  2L00 B;  1LXD A;  4G50 A;  4GXB A;  4BBN C;  2ZZP B;  4ANV A;  3ZRC A;  4IC7 B;  4FJV B;  4XX5 A;  1YX6 B;  2O6V D;  2KTF A;  1S3S G;  2MP2 B;  2NBW B;  2RR9 A;  3EHV A;  5G2N A;  5E6O A;  5AEK B;  3RYT A;  2RPQ A;  3U8Z A;  5D7G A;  2MA9 B;  4MSM B;  1IYF A;  2O6V B;  2MP2 A;  3DBL I;  2FCS A;  3A4R A;  1J8C A;  3VQI A;  2GBK A;  1LM8 B;  1OEY A;  2MBH A;  3T8M A;  1CMX B;  4DHZ B;  4WWN A;  2CU1 A;  2K6D B;  4DDI D;  2O6V A;  3PRM B;  2A4Z A;  2N1V A;  2AYO B;  3KYC D;  2JRI B;  1QZE A;  2EKE C;  3KUC B;  3C0R B;  4IWO A;  4IM3 A;  2C7N B;  3U30 A;  4AJW A;  3I3T B;  3K9O B;  1YQB A;  4FBJ B;  1X1M A;  3PS6 A;  1Q1O A;  3APD A;  4EZJ A;  3X0W A;  2ZNV B;  2KFK B;  4J6I A;  3AXC A;  4FA6 A;  2KLC A;  3ENE A;  2OOB B;  3A1Q B;  3DBH I;  4B9K A;  2KFK A;  5CHW A;  2L0F A;  4URK A;  2LZ6 A;  4WJQ A;  3MHS D;  2C9W B;  4GU2 A;  4CO7 A;  4W9H A;  1GG3 A;  4OVU A;  1WE6 A;  5HKH A;  1WGG A;  1UBI A;  3B08 A;  4P7I A;  1WY8 A;  4KV2 A;  4A3P A;  2ZCC A;  2ZVN A;  3OJ4 B;  4W9C A;  2RGF A;  4ZRI A;  1WXM A;  2KZR A;  5LXI B;  2LD9 A;  3TJP A;  3PT2 B;  2BYV E;  3WA0 A;  1VCB A;  5J2R A;  3VTU A;  2GMI C;  3QIJ A;  2IO1 B;  2KDE B;  5TR5 A;  2V4L A;  4NAW A;  2KWV B;  2KFJ A;  3UQA A;  2REX A;  3V6C B;  4I6L B;  1G6J A;  1YX5 B;  3KH0 A;  1GC7 A;  2J7Q B;  4I6P A;  4IM2 A;  2UYZ B;  2LXC A;  4A3O A;  2L7R A;  4HLE A;  1T0Y A;  2JWZ A;  1WRD B;  1V9J A;  3PTF C;  3VTW A;  1WIA A;  2HE7 A;  4FLH A;  4NPN A;  1SGH A;  4EZL A;  3MJW A;  2GBJ A;  4WWO A;  2AEH A;  4GDK B;  3D32 A;  2DZK A;  2R2Q A;  1WGR A;  4EKU A;  2NBU A;  2JRH A;  2PJH A;  2IO0 B;  2BYF A;  2NS5 A;  2EMT A;  1NBF C;  4BVU C;  3ZDM C;  4NQL B;  3VXW A;  2M8S A;  2L76 A;  4DDG D;  2KK8 A;  4K1R B;  1WJ6 A;  3QAR A;  1FXT B;  3VH4 B;  2KJ6 A;  4CHK A;  1WZ0 A;  1U4A A;  2LJ5 A;  1ZGU B;  4ANU A;  3JVZ X;  2G3Q B;  3ML8 A;  4BOZ B;  3EEC A;  3TMP B;  1RFA A;  4TQ1 A;  5D2M B;  2LGY A;  1NI2 A;  3L13 A;  1M94 A;  2XK5 B;  4NJ6 A;  4M0W B;  2W9N A;  1I35 A;  2D3G A;  3H1U A;  2FNJ B;  1ZKH A;  2XK5 A;  3GOE A;  4GDL A;  2DYM A;  1OQY A;  3APF A;  1BT0 A;  3GZN I;  1GC6 A;  3O65 B;  2FCN A;  3DDC B;  1R4N I;  3S2A A;  5E6P A;  3UIN B;  4PS7 A;  4GMV A;  2K6Q A;  2LI5 A;  2WX0 A;  4HWI B;  3RCZ A;  3SD5 A;  4LJO B;  1OEY J;  3UF8 A;  3KUZ A;  3QAQ A;  2Z0D B;  2HTH A;  3ALB A;  3H7S A;  2MWS B;  5BO4 B;  5JHB A;  2V1Y A;  2DAJ A;  3EFU A;  2Y5B B;  3NY5 A;  3RZW C;  4MGY E;  4WAA A;  3W1S A;  2NCN A;  2DX5 B;  3NZS A;  3PLV A;  2LGD A;  3QA8 A;  3QCA A;  1NDD A;  1WGH A;  2N9P C;  3PSE B;  2WYQ A;  2C7H A;  3PPA A;  5CHF A;  5D94 A;  4JL9 A;  3UQB A;  4FJZ A;  4BBN F;  5IAA C;  1UD7 A;  4KZ0 A;  2CKH B;  1IPG A;  4EOY A;  2YLM A;  3VAW A;  3QHT A;  3ECI A;  4MGI E;  1UEL A;  3ZO5 B;  1V49 A;  2N9E B;  4ZYN A;  3V60 A;  2KDF B;  3H9D A;  2C5L C;  3ZUN A;  2CR5 A;  1HE8 A;  4DWF A;  3AI5 A;  3ZDT A;  2DZJ A;  3DVN V;  3DBS A;  3V61 A;  1YJ1 A;  3DVG Y;  5GMV A;  5CTR C;  3SHQ A;  4RM8 A;  2R2O A;  4NNJ B;  3L10 B;  1EO6 A;  4W9D A;  4GB9 A;  2L0T A;  3SDL C;  4DK5 A;  1H8C A;  1LQB A;  3ZNZ B;  4PS3 A;  2DEN B;  1V2Y A;  5L95 C;  1L7Y A;  2NPT B;  2QHO A;  4GSW A;  1EF5 A;  4TUU A;  2LAS A;  1V6E A;  4DBG A;  1SE9 A;  3WAO A;  1WJN A;  3IHP C;  2N1W A;  2LVQ A;  4NJ7 A;  5J18 A;  1WX9 A;  1WX8 A;  2PE6 B;  2NPT A;  4W9F A;  4ZRJ A;  2KDB A;  3VFK A;  3L54 A;  1F9J A;  4KDI C;  3RZF A;  2K8B A;  2LRW A;  5AZG A;  2ZEQ A;  3RUL A;  3K9P B;  2KOX A;  1UGM A;  1UH6 A;  3NS8 A;  4HDQ A;  3DCG A;  3PVL A;  3WAN A;  3WAP A;  5AZF A;  2RSU A;  2KMA A;  3KW5 B;  3PRZ A;  3DVG X;  4K7W A;  3DOW A;  1WXA A;  4WJO A;  1MG8 A;  2CHW A;  4NAW B;  2D07 B;  3NOB A;  2MLB A;  2KJR A;  3CF6 E;  2PE9 A;  3N30 A;  4PS8 A;  3VUW A;  5DPT A;  2BF8 B;  2Z59 B;  4II2 B;  3WAM A;  2KD0 A;  1AAR A;  5G55 A;  1WGY A;  3APC A;  3B0A A;  2G45 B;  2MBE A;  1Z5S B;  3R7Q A;  2KX0 A;  1KM7 A;  2KMC A;  3VVW B;  3BY4 B;  3N3K B;  3X23 A;  2BGF A;  1WR6 E;  4MJS A;  2GOW A;  2C7M B;  1S1Q B;  2LGX A;  2WDT B;  3PLU A;  2LVP A;  2KN5 A;  2O2V B;  2WWZ A;  2IZV B;  4FN2 A;  4LDT D;  2RD0 A;  2KQS A;  1WXS A;  3VDZ A;  1L2N A;  3QC8 B;  4K7U A;  4M8M A;  3A9J A;  2MCN B;  3PGE A;  3QX1 A;  1EF1 A;  2N7D A;  4G3X B;  2O2V A;  1RLF A;  2GBM A;  1WYW B;  4MEL A;  5FR6 A;  3W1Y A;  4DXA B;  1V5T A;  1K8R B;  2DYB A;  1Q5W B;  1TGZ B;  2FCQ A;  2HD5 B;  2GBN A;  3H6N A;  1UBQ A;  4I6N B;  4GIV A;  1E7U A;  3DQV A;  3ZNG C;  3VH3 B;  1YD8 U;  4II3 B;  2BPS A;  4BFR A;  2KC2 A;  1E8Z A;  3PRE A;  2CS4 A;  3IFW B;  5JHA A;  4FHK A;  4HPM B;  1Y8R C;  4IUM B;  2KJH B;  4KIK A;  2D10 A;  2IO3 B;  2YVC A;  3TBL D;  4PYZ A;  4GDL B;  3KVF B;  1KJT A;  3VUY A;  3L08 A;  5DPW A;  4RMA A;  4WJP A;  3PV1 A;  1IP9 A;  3PHW B;  1E8W A;  2JXX A;  2DZI A;  1R4M I;  3M3J A;  2ASQ A;  5CHV C;  3OLM D;  3PZD A;  3TIX A;  1TZ1 A;  5C1Z A;  1TTN A;  3JYU A;  3TL5 A;  1JRU A;  3RD2 A;  2KO3 A;  2C60 A;  4A20 A;  1WF9 A;  2ZJD A;  4F1S A;  1V86 A;  2NR2 A;  3LJ3 A;  2J0K A;  4MH0 E;  4X57 B;  4EFO A;  4GN1 A;  3DPD A;  4W9I A;  2D2Q A;  1WMH B;  1E8X A;  1WI0 A;  4DHJ D;  2UWQ A;  5KHO A;  1D3Z A;  4JLC A;  1OGW A;  2AL3 A;  3CST A;  4IG7 B;  2PPH A;  1EUV B;  2B3A A;  3DVN U;  4TQ0 A;  1KLV A;  3ZIM A;  1WMH A;  4G11 A;  4HJK A;  2MSE D;  3UGB B;  5DPR A;  2LRU A;  4AJY B;  1I42 A;  2LWP A;  3VUX A;  4ASW C;  3Q3J A;  4KDL B;  3ML9 A;  2VRR B;  4TKN A;  2JY6 A;  4E3C A;  5L83 A;  1WJ4 A;  1P98 A;  2JVC A;  4MM3 A;  3T9L A;  4FHJ A;  4IWP A;  4HCN B;  2JF5 A;  5DPS A;  4HCP B;  4E74 A;  1E7V A;  1RRB A;  3ZNH B;  2N7E A;  1UZX B;  1ZW7 A;  1WGD A;  4KZC A;  4B95 A;  3NZU A;  2ZVO A;  2MRP A;  3ZRF A;  2EMS A;  2KC1 A;  2K8H A;  3UIO B;  4G0N B;  1P1A A;  4W9L A;  1V80 A;  4E71 A;  3WAL A;  2KNB A;  2KX3 A;  1H4R A;  4JQW C;  3ZKJ C;  2IO2 B;  4LCD E;  4RM9 A;  1OTR B;  3OJ3 A;  1WE7 A;  4B6W A;  4EEW A;  1V81 A;  4NY0 A;  3DBR I;  3VHT C;  2KWC A;  4W9E A;  1GUA B;  2CHZ A;  2KVR A;  3HK0 A;  2FAZ A;  1P0R A;  5CX3 A;  1GJZ A;  2FCM A;  2ZPN A;  2KKC A;  4HVB A;  3ZW3 A;  3P2B A;  2MBQ A;  3HM6 X;  4IW0 A;  3M95 A;  2BKR B;  3LDZ E;  1YIW A;  2ZNV C;  4FJY A;  2K25 A;  3L17 A;  2A5U A;  3NHE B;  4MDK E;  5KHQ A;  3WIM A;  5E6N A;  2G4S A;  1WFY A;  1XT9 B;  3V62 A;  4ICU A;  3M63 B;  1VD2 A;  4BOS C;  1LFD A;  2KTR B;  2PEA A;  5DCN A;  3TCA A;  2FIF A;  2MQJ A;  3N32 A;  4F7Z A;  1WZ3 A;  2BWF A;  2JPH A;  3L16 A;  4N9F 4;  2KTR A;  2KAN A;  2NBV B;  3R7R A;  2K1F A;  4CYE A;  1GNU A;  3KYD D;  4KSL C;  4BKG A;  5JH5 C;  2JZ3 B;  2KLG A;  3JSV B;  4WQO B;  3SU8 X;  2KDI A;  4MJS B;  4AUQ C;  4HDO A;  3A1Q A;  4BKS D;  1C3T A;  1E8Y A;  1XD3 B;  1SIF A;  4XZ4 A;  3ZTC A;  2BKF A;  3JSV A;  3A33 B;  4M8N A;  2MBO A;  1Q0W B;  4ANX A;  3A9J B;  2AWT A;  4ANW A;  2DYO A;  2GBR A;  2L05 A;  2FID A;  4EUT A;  4LJP B;  4AWJ A;  1TBE A;  4ICV A;  1XQQ A;  3PHX B;  5LLI A;  4GGQ A;  1J0G A;  3HHM A;  4BKS A;  2XBB C;  1E5W A;  5EDS A;  4LDT B;  3IBE A;  3OAW A;  2CHX A;  4OVV A;  3VTV A;  5JZE B;  4XC2 A;  2BWE S;  4HXD A;  3KUD B;  3M62 B;  4PYU A;  5AZH A;  3U7D A;  2FUH B;  1P3Q U;  2MW5 A;  1PQS A;  4KIK B;  3MTN B;  4FUL A;  2HJ8 A;  3A9K B;  4BKT A;  2LXA A;  1E90 A;  4JIO U;  4MGK E;  4JGH B;  2N4F A;  3AU5 A;  5D6J B;  1KOT A;  1J19 A;  2K8C A;  3A9K A;  1WH3 A;  1WJU A;  3L0W B;  1RAX A;  4FAD A;  2I1J A;  1A5R A;  3AU4 A;  3Q3F A;  2LVO A;  4ZDV A;  2IY0 B;  3QJZ A;  4WWP A;  4MGZ E;  2KQ7 A;  3ZTD A;  3QQ8 B;  4KSK C;  4W9J A;  4GDK A;  2M0X A;  2K39 A;  2KXJ A;  2KHW B;  3BIN A;  3UIP B;  3B1L X;  2M4N A;  5C23 A;  2DAF A;  4AP4 C;  2JUO A;  2DZM A;  4F8C B;  2BYE A;  3IVF A;  3ZNI D;  4TV3 A;  3ONS A;  3QK0 A;  4K81 A;  2MX2 A;  4WJN A;  4IWQ A;  3HIZ A;  3QWZ B;  2MBB B;  2V3S A;  2M17 A;  2ZPY A;  2OJR A;  4MEM A;  3RT3 B;  2AL6 A;  1Z2M A;  3W1S C;  2D11 A;  3HM3 A;  1P9D U;  1ISN A;  2G4D B;  2M1M A;  3PRP B;  1WM3 A;  4DHJ B;  3R3M A;  2Z0E B;  4HPL B;  2ZCB A;  4ZRK A;  4KVG B;  2J0M A;  2XEW A;  4YL8 A;  4NQK E;  3JW0 X;  4DHZ E;  1WM2 A; 
#chains in the Genus database with same CATH topology
 3I63 C;  2JZZ A;  2J0J A;  2WX1 A;  4HJG E;  3H7P B;  2IBI B;  3RUI B;  2L8J A;  4GOC A;  3AM9 A;  2NVU I;  3CSF A;  4K7S A;  3R66 C;  3AUL A;  1NVI D;  3TUO A;  1WSP A;  2LHD A;  2JT4 B;  5IN7 A;  4W9G A;  1UGJ A;  3ZVV A;  2K3U A;  2N9X A;  5LNK 1;  4AQ7 A;  2LUE A;  4GXB A;  4BBN C;  4XX5 A;  2BVC A;  5AEK B;  2Q5W D;  2MP2 A;  3MFG A;  3A4R A;  1C4C A;  2LGS A;  2GBK A;  3T8M A;  3GS2 A;  1V97 A;  2K6D B;  4DDI D;  2O6V A;  3KYC D;  2JRI B;  1QZE A;  4OZA A;  4S0R A;  3C0R B;  4IWO A;  3E56 A;  3EGR A;  3AEA B;  3K9O B;  4FBJ B;  2Y3A A;  1Q1O A;  4EZJ A;  3X0W A;  4J6I A;  2WGS A;  3P42 A;  1FRD A;  4D2K A;  2JZP A;  2KFK A;  4P1C C;  5CHW A;  4XDC A;  4W9H A;  1GG3 A;  4OVU A;  1WE6 A;  3AV8 A;  4AS1 A;  3N1Y C;  3RNE C;  2QIL A;  2V3N A;  3OJ4 B;  4W9C A;  4YT0 B;  4QAY A;  3MC8 A;  4US8 A;  1ZXH A;  1VJK A;  5TR5 A;  2V4L A;  2KWV B;  2KFJ A;  3N20 C;  3DBR B;  1GC7 A;  2UYZ B;  1N5W A;  2JWZ A;  1V9J A;  1YQ3 B;  4C7Z A;  1SIJ A;  4EZL A;  1HTQ A;  3KQ4 A;  2DZK A;  4M00 A;  3BWU D;  2R2Q A;  2E3T A;  2GLS A;  1FMA D;  1NEK B;  2BYF A;  1NBF C;  2X38 A;  3ZDM C;  5TSS A;  1L5P A;  2GB1 A;  1WJ6 A;  1FXT B;  2DBY A;  1FCC C;  2KJ6 A;  1WZ0 A;  1FM0 D;  1U4A A;  1SJH D;  1N63 A;  3JVZ X;  2G3Q B;  3ML8 A;  3EEC A;  2LGY A;  1WGK A;  3L13 A;  3AE7 B;  1M94 A;  2JXT A;  3Q8C A;  3O13 A;  2IDY A;  2IJ0 A;  1CK1 A;  1HZ5 A;  2XK5 A;  3LB8 C;  4GDL A;  2JYE A;  3O65 B;  1V1P B;  3UF8 A;  3ZNG C;  4YSX B;  4LJO B;  1VZ7 A;  2V1Y A;  1JCK B;  3RZW C;  4WAA A;  3W1S A;  2NCN A;  2DX5 B;  1SE3 A;  5EE3 A;  3QA8 A;  3QCA A;  1EM7 A;  3AH7 A;  2C7H A;  3MP9 A;  2CKH B;  2GI9 A;  1UWX A;  1L4D B;  3ECI A;  3ZO5 B;  4ZYN A;  2KDF B;  2C5L C;  1HA5 A;  4DWF A;  5GMV A;  4WWM A;  2G1E A;  3L10 B;  1EO6 A;  4W9D A;  3SDL C;  2BBC A;  3P4Q B;  4TMA B;  3U2S C;  2K5P A;  2QHO A;  4GSW A;  1IUE A;  3WAO A;  1WX9 A;  4W9F A;  2XN9 C;  4KDI C;  1F9J A;  2WQY B;  3N1Z C;  2K8B A;  2ZW1 A;  5FR3 A;  1UGM A;  2K9X A;  2QEJ C;  3TSS A;  3BYT B;  3IAS 1;  3WAP A;  2RSU A;  2KMA A;  3DVG X;  3DOW A;  4A90 A;  1UF0 A;  2D07 B;  1I4G A;  3NOB A;  2KJR A;  3CF6 E;  3I5J C;  3N30 A;  4PS8 A;  4MT5 A;  3URY A;  3KWL A;  2Z59 B;  2NTS A;  2J42 A;  1DOY A;  1WGY A;  1Z5S B;  2QDF A;  5GXG B;  2I2Y A;  4A9A A;  1WR6 E;  4MJS A;  1S1Q B;  2WDT B;  2O2V B;  2KN5 A;  4OHJ A;  3A9J A;  3QX1 A;  3RFZ B;  1RLF A;  4MEL A;  3Q3M C;  3AEB B;  1MI0 A;  1WWT A;  4DQO C;  1Q5W B;  1ZP0 B;  1DYQ A;  2BS4 B;  2HD5 B;  2GBN A;  1UBQ A;  2BPS A;  4CQN A;  3EUB 2;  1Y8R C;  4KIK A;  2KJH B;  2D10 A;  3BYY B;  3W5U B;  4GDL B;  4L2Y A;  1N61 A;  4RMA A;  4WJP A;  3PV1 A;  1C78 A;  1E8W A;  2JXX A;  4ZHP A;  1K50 A;  1TS4 A;  2PTL A;  2AQ2 B;  3TL5 A;  1VRA B;  1JRU A;  3RD2 A;  2C60 A;  1HEZ E;  5IKC M;  1I4R A;  4EFO A;  2J0K A;  2WP9 B;  1K52 A;  4MH0 E;  4X57 B;  3FAH A;  2PPH A;  2L32 A;  1KLV A;  3ZIM A;  4G11 A;  4RF1 A;  4OW0 A;  1I42 A;  5E6J A;  2M56 B;  4ASW C;  3Q3J A;  3IT4 B;  2KWD A;  1OQR A;  2VRR B;  4C7Y A;  1WJ4 A;  1P98 A;  4IWP A;  4HCN B;  1PFD A;  4IKG A;  3ZNH B;  3NZU A;  2PW9 A;  2EMS A;  1J7B A;  5IP4 D;  1P1A A;  4E71 A;  1E9M A;  3WAL A;  3MC9 A;  3ZKJ C;  1SSN A;  1WE7 A;  1V81 A;  4NY0 A;  1JWM D;  1P0R A;  5CX3 A;  1GJZ A;  4HVB A;  3ZW3 A;  4IW0 A;  3M95 A;  3FKY A;  1SXT A;  5KHQ A;  2A5U A;  3NHE B;  1TY0 A;  4RGT A;  1I7H A;  3V62 A;  3NVW A;  3FC4 A;  2N9K A;  1MHX A;  1VD2 A;  4YXD B;  3R2I A;  1T6B X;  1FO4 A;  4F7Z A;  2MHJ A;  3L16 A;  1GNU A;  4MJS B;  2RDG A;  4JWU C;  4YTN B;  3A1Q A;  3JSV A;  1Q0W B;  3A9J B;  3AEE B;  4ANW A;  1YN4 A;  2L05 A;  4EUT A;  1FEH A;  1XQQ A;  5LLI A;  4GGQ A;  1EU3 A;  4BKS A;  2L83 A;  4LDT B;  1TZO A;  4OVV A;  3VTV A;  1C77 A;  5JZE B;  4XC2 A;  5AZH A;  1L0Y B;  1PQS A;  4KIK B;  4PK1 A;  2LXA A;  1K53 A;  2VH1 A;  4JIO U;  3RNB C;  1J19 A;  1TJE A;  1WJU A;  1QOF A;  1KFY B;  5G5H A;  3BK2 A;  2YEP F;  4ZDV A;  2KQ7 A;  2K39 A;  4REZ A;  3B1L X;  5C23 A;  4HEA 1;  3WCQ A;  2TSS A;  4AP4 C;  1KLG D;  2BS3 B;  2JUO A;  3DHG C;  5H92 C;  2BYE A;  4NAM A;  4XE0 A;  2FUG 1;  2MX2 A;  3SFE B;  3QWZ B;  5AUI A;  4KKJ A;  2BB6 A;  2V3S A;  2OJR A;  2AL6 A;  1ISN A;  2G4D B;  3PRP B;  1C79 A;  4DHJ B;  4ARI A;  2J0M A;  2W54 A;  2IGH A;  4K3B A;  3BZD B;  2PKO A;  5IA7 A;  2I1K A;  2KAJ A;  3U4E G;  4HK2 A;  2KWU B;  3H7P A;  4KGT A;  4EZK A;  3EC8 A;  4OZC A;  3ZLZ A;  1WX7 A;  2VZK B;  4G50 A;  4ANV A;  4FJV B;  2O6V D;  2KTF A;  2GRI A;  2NBW B;  2RR9 A;  5G2N A;  4XDD A;  2E6X A;  3Q3O C;  3U8Z A;  2LGI A;  3GZN B;  3PZ7 A;  1IYF A;  3DBL I;  2FCS A;  1LM8 B;  2BT6 A;  2MBH A;  4DHZ B;  3Q8B A;  2N1V A;  5HHD G;  4O1N A;  3KUC B;  1T0S C;  2V0G A;  3VR9 B;  2C7N B;  3U30 A;  3EA6 A;  1ZXI A;  1X1M A;  3ZYY X;  3APD A;  2MJD A;  3AXC A;  4FA6 A;  4IDI A;  3PO0 A;  4DXF A;  1JML A;  3A1Q B;  1YNT E;  3H8H A;  3AE4 B;  3DBH I;  3MHS D;  2C9W B;  1JWS D;  2VH2 A;  4GU2 A;  1WY8 A;  4YSZ B;  2K0P A;  4WQM A;  4KV2 A;  2ZCC A;  1JRP A;  4L1B A;  1UUP A;  4KGS A;  1MFW A;  3WA0 A;  1VCB A;  3VTU A;  2GMI C;  3ZXR A;  4RF0 A;  1STE A;  5AUK A;  3V6C B;  1XLQ A;  1G6J A;  3AE5 B;  4PT5 A;  3T3N A;  2J7Q B;  4I6P A;  3AEF B;  3GB1 A;  3U52 E;  4A3O A;  5D3I B;  3SEB A;  3AED B;  3PTF C;  1SGH A;  2R61 A;  2GBJ A;  1XO3 A;  2JQR B;  1WGR A;  3MJ5 A;  2NBU A;  2LMC A;  2IO0 B;  2WDQ B;  3AE9 B;  2PVO D;  3VXW A;  2M8S A;  1HXY D;  2KK8 A;  3Q14 C;  1JWA D;  3NZ3 A;  1QOG A;  2EEL A;  4BOZ B;  2BS2 B;  1QOA A;  1F0Z A;  4TQ1 A;  4XYC A;  1T3Q A;  1T0Q C;  3AMZ A;  3P4P B;  2MJE A;  2WLB A;  1I35 A;  3H1U A;  1D5M C;  4M01 A;  5IO9 A;  1XXG A;  2AQ3 B;  3GOE A;  3L4P A;  5G5G A;  1BT0 A;  4HPP A;  2FCN A;  4ACF A;  1N5X A;  2OJW A;  5BMG A;  1J7A A;  4RH6 A;  1P7F A;  4HWI B;  2BB5 A;  2WX0 A;  3QAQ A;  1L4Z B;  2M0A A;  1V1P A;  1XLN A;  2Z0D B;  3C19 A;  2MWS B;  2Y5B B;  2KDM A;  3TEX A;  4UDU C;  5BMH A;  3OG5 A;  1AYF A;  1NDD A;  1TYG B;  2Y5C A;  3ZQ4 A;  5IAA C;  4MH8 A;  4KZ0 A;  4C80 A;  2WU5 B;  2YLM A;  3VAW A;  3QHT A;  4MGI E;  2N9E B;  2ONQ A;  1FFV A;  1E0Z A;  1HE8 A;  3ZDT A;  1IBX A;  3N1X C;  3DBS A;  1YJ1 A;  2WDV B;  5CTR C;  3KLS X;  3TEW A;  3HVD A;  4GB9 A;  2L0T A;  4DK5 A;  1H8C A;  3ZNZ B;  4PS3 A;  5L95 C;  2NPT B;  4TUU A;  2MEK A;  4DBG A;  2H89 B;  2LVQ A;  3Q8A A;  4RNA A;  1XCT L;  4ZRJ A;  3L54 A;  5I4D A;  3RPF C;  4C4V A;  3RUL A;  5BMI A;  1WYG A;  3NS8 A;  3DCG A;  3WAN A;  2D3A A;  3PRZ A;  4WJO A;  1MG8 A;  2CHW A;  4L23 A;  3VUW A;  2PE9 A;  5DPT A;  2BF8 B;  5G55 A;  1JAL A;  1GB1 A;  1TIF A;  3VVW B;  2ZW0 A;  3AB5 A;  5BYQ A;  2GOW A;  2C7M B;  2LGX A;  3PLU A;  1XCQ L;  3IXS A;  4LDT D;  4ZOH C;  1WXS A;  3QC8 B;  4M8M A;  2MCN B;  1EF1 A;  2O2V A;  2GBM A;  4OZB A;  1WYW B;  3W1Y A;  5FR6 A;  4DXA B;  2HJ1 A;  3SFD B;  2FCQ A;  1D5Z C;  4I6N B;  1RWS A;  1KRH A;  4GIV A;  4WH4 A;  3VH3 B;  4LK0 M;  3GP7 A;  2KC2 A;  2RMM A;  2CS4 A;  3IFW B;  4HPM B;  4J3O D;  1BML C;  3LYY A;  2LHE A;  2DZI A;  3M3J A;  2QIE B;  2WHI A;  3PZD A;  1ZUD 2;  3JYU A;  2KO3 A;  4F1S A;  4W9I A;  2D2Q A;  1WMH B;  1WI0 A;  4DHJ D;  1D3Z A;  1ET6 A;  1OGW A;  2DWQ A;  2B3A A;  3DVN U;  5DPR A;  2LRU A;  4AJY B;  1MVK A;  2DLB A;  4MM3 B;  1HQR D;  4HKZ E;  1A70 A;  4E3C A;  1RM6 C;  1IBX B;  2JVC A;  4FHJ A;  1E7V A;  1I4P A;  1RRB A;  2IGD A;  1WGD A;  2VZK D;  2ZVO A;  2G9H D;  3ZRF A;  3UIO B;  1V80 A;  2IGG A;  4K3C A;  1H4R A;  1PDX A;  4LCD E;  2D5G A;  4EE2 A;  2KWC A;  1GUA B;  1SE2 A;  3T3O A;  2FCM A;  4C4V B;  2MBQ A;  3HM6 X;  2NTT A;  2K25 A;  4MDK E;  5E6N A;  2HTM E;  1PYW D;  2BW2 A;  4A55 A;  2KTR B;  3TCA A;  2FIF A;  2MQJ A;  3P4S B;  1FFU A;  3N32 A;  2WU2 B;  2NBV B;  3KYD D;  2KN4 A;  4HRS A;  4JX1 C;  3SU8 X;  4AUQ C;  4LLG M;  1SBB B;  4BKS D;  1E8Y A;  4XZ4 A;  2CJN A;  3Q8F A;  4ZYS A;  4ANX A;  2DYO A;  2GBR A;  3V05 A;  1T0R C;  4AWJ A;  1TBE A;  4ICV A;  3DWG C;  1IGD A;  3ETR A;  3IBE A;  2CHX A;  3NUH B;  4HXD A;  2D3C A;  3KUD B;  3M62 B;  2MW5 A;  1FCL A;  3MTN B;  2HJ8 A;  4LTU A;  1PUT A;  1V8C A;  1FPY A;  4JGH B;  5D6J B;  3ZJU A;  1WH3 A;  1RAX A;  4FAD A;  3Q3F A;  2IY0 B;  3QJZ A;  4MGZ E;  4W9J A;  4GDK A;  1CQV A;  3B2F A;  3AE1 B;  2RDH A;  2WXG A;  2DZM A;  3RNF C;  4F8C B;  2YEP B;  3QK0 A;  4K81 A;  1VZ8 A;  4IWQ A;  3HIZ A;  2M17 A;  2WXN A;  4MEM A;  1TS5 A;  2M1M A;  2WXF A;  4M0W A;  4TSS A;  3R3M A;  2Z0E B;  4ZRK A;  2KAC A;  4YL8 A;  1FXA A;  4JWS C;  4DHZ E;  1WM2 A;  3RNG C;  3MHZ A;  5C2T B;  1V5O A;  5LXH A;  2L3Z A;  2KYW A;  1ET9 A;  3V6E B;  5JXV A;  3CMM B;  2UU7 A;  2IYD B;  3ZJV A;  5J17 A;  3N9Y C;  1WR1 A;  4IOI E;  1WXV A;  3IG3 A;  4XWT A;  4FXC A;  4IC7 B;  1YX6 B;  3EHV A;  1HTO A;  5E6O A;  3RYT A;  1D6E C;  3FIL A;  2MA9 B;  1L6V A;  2RDB C;  1R4N B;  3VQI A;  1F2R C;  2CU1 A;  1B1Z A;  3PRM B;  2A4Z A;  4M02 A;  3P4R B;  4IM3 A;  4AJW A;  3NVY A;  1YQB A;  3P1M A;  1OQQ A;  3PS6 A;  4XGA B;  4YWG G;  4LNK A;  4RCO A;  2OOB B;  1YN5 A;  4B9K A;  2L0F A;  1E7P B;  5HKH A;  1WGG A;  1UBI A;  1ZE3 D;  3AE6 B;  3B08 A;  4KKI A;  3R2T A;  1K51 A;  1I4X A;  2ZVN A;  2RGF A;  4ZRI A;  1WXM A;  2KZR A;  3TJP A;  2BYV E;  5J2R A;  3QIJ A;  2KDE B;  1TS2 A;  4NAW A;  2REX A;  1YX5 B;  3KH0 A;  1JRO A;  3NRZ A;  4C00 A;  2LXC A;  4HLE A;  4HKQ A;  4JE3 B;  1WRD B;  2HE7 A;  4FLH A;  4NPN A;  3MJW A;  4WWO A;  2KVZ A;  4GDK B;  3E9S A;  3NG0 A;  1YN3 A;  3BII D;  1FNU A;  2PVG C;  4DDG D;  4K1R B;  3QAR A;  1ENF A;  3VH4 B;  4CHK A;  3LXF A;  2LJ5 A;  1ZGU B;  4R3D A;  4ANU A;  2H88 B;  1RFA A;  5D2M B;  1BXT A;  4M0W B;  2W9N A;  4NZL B;  1RFK A;  2FNJ B;  1ZKH A;  3NVV A;  3APF A;  5D3D A;  3Q8E A;  3GZN I;  2WXL A;  1GC6 A;  1ESF A;  3DWM A;  3IT6 B;  4WIP A;  3DDC B;  3TEY A;  4GMV A;  2J52 A;  2K6Q A;  1OEY J;  2N0S B;  3AE8 B;  1L0V B;  2HTH A;  3H7S A;  5BO4 B;  5JHB A;  4JPS A;  3TEZ A;  3NVZ A;  2SEB D;  3EFU A;  3NY5 A;  4MGY E;  1TKY A;  3PLV A;  1ZDV A;  2LGD A;  5CHF A;  1WGH A;  2N9P C;  3PSE B;  3PPA A;  3UQB A;  4BBN F;  1F1H A;  1C4P A;  1UD7 A;  3FIL B;  4LNI A;  1R4M B;  3V60 A;  3H9D A;  3ZUN A;  2KMM A;  2J53 A;  3AI5 A;  2DZJ A;  3V61 A;  3DVG Y;  3SHQ A;  1C9F A;  4RM8 A;  5MPO A;  1QIL A;  1V2Y A;  1EF5 A;  1V6E A;  3W5V B;  1WJN A;  5J18 A;  1WX8 A;  2PE6 B;  1MHH E;  2NPT A;  1I4Q A;  3RZF A;  2LRW A;  5AZG A;  4A6Q A;  1L6U A;  3K9P B;  3CIR B;  4N59 A;  3PVL A;  1D5X C;  2OED A;  4C56 C;  2WXP A;  5AZF A;  1GB4 A;  4K7W A;  1WXA A;  4NAW B;  1ZPS A;  4NJC A;  4II2 B;  3MC0 B;  1AAR A;  3APC A;  3B0A A;  2G45 B;  1C76 A;  3R7Q A;  2KX0 A;  1KM7 A;  2KMC A;  3BY4 B;  3N3K B;  3DBL B;  2KQS A;  1L2N A;  4K7U A;  1SF0 A;  4G3X B;  3CWI A;  4LNF A;  2DYB A;  3H6N A;  1TGZ B;  1E7U A;  4ZRQ A;  2JU6 X;  2N7J A;  3IAM 1;  1YD8 U;  4BFR A;  5JHA A;  1XLO A;  4FHK A;  2IO3 B;  2YVC A;  3TBL D;  2WS3 B;  1SB3 C;  1KJT A;  3VUY A;  2EKI A;  1TZ1 A;  5C1Z A;  1DGJ A;  4A20 A;  2L52 A;  1EWY C;  1WF9 A;  1T5X D;  1EWC A;  4GN1 A;  1E8X A;  2UWQ A;  5KHO A;  2CU3 A;  4JLC A;  2AL3 A;  3CST A;  5IOI A;  1WMH A;  4HJK A;  2MSE D;  3KWV A;  4N58 A;  2IPK D;  1F2R I;  4KDL B;  3ML9 A;  4TKN A;  2JY6 A;  5L83 A;  2V3P A;  4MM3 A;  3B2G A;  3T9L A;  1AWD A;  1ACC A;  2JF5 A;  4E74 A;  4HCP B;  2N7E A;  1ZW7 A;  1JQ4 A;  4KZC A;  2MRP A;  2K8H A;  2CJO A;  2KNB A;  2W3S A;  3B9J A;  4JQW C;  2IO2 B;  4RM9 A;  3OJ3 A;  1N60 A;  3DBR I;  1JW9 D;  4W9E A;  2CHZ A;  1XF5 L;  2ZPN A;  3P2B A;  2BKR B;  3UI3 A;  1VLB A;  1AW7 A;  2Y5P A;  2G4S A;  2BYT A;  4ICU A;  2WXO A;  3M63 B;  2J4X A;  2LEK A;  2LFI A;  5DCN A;  1WZ3 A;  2JPH A;  2KQ4 X;  2KTR A;  3ZXV A;  4KSL C;  4BKG A;  5JH5 C;  2FE8 A;  4YSY B;  3VRA B;  3R8B A;  1C3T A;  1SIF A;  2N9L A;  2BKF A;  1DOX A;  3A33 B;  4WAF A;  2FID A;  4ITK A;  4LJP B;  4KX6 B;  3J9C A;  3PHX B;  1J0G A;  2QSD A;  2JYT A;  5EDS A;  4KGR A;  3OAW A;  3PZ8 A;  4WUR A;  2BWE S;  4PYU A;  2BTE A;  4FUL A;  3A9K B;  1I4H A;  2OHF A;  2V4I B;  2N4F A;  2WXH A;  1KOT A;  2I1J A;  1A5R A;  3I57 A;  4WWP A;  4P6V F;  5HFY A;  1YJI A;  3QQ8 B;  2M0X A;  2KXJ A;  3BIN A;  1YOV B;  2M4N A;  1B9R A;  2V9H A;  2DAF A;  1TY2 A;  4TV3 A;  3ONS A;  4WJN A;  1JWU D;  4BZA A;  2MBB B;  2ZPY A;  3RT3 B;  3RNC C;  1PGX A;  2D11 A;  3HM3 A;  3V3X A;  1P9D U;  1DOI A;  3AE2 B;  1WM3 A;  3AEG B;  2MJ3 A;  2BQQ A;  2PMV A;  4HPL B;  2ZCB A;  1TS3 A;  1NYR A;  2INN E;  1N62 A;  2RPV A;  2DNF A;  4AOF A;  4MSQ B;  3A4S C;  2IY1 B;  4USA A;  1LO5 D;  1C1Y B;  4W9K A;  4IM0 A;  1CJE A;  2DHZ A;  2L00 B;  1LXD A;  2L1A A;  2ZZP B;  1SE4 A;  3ZRC A;  1FNV A;  1KLU D;  1S3S G;  2MP2 B;  2ACZ B;  2RPQ A;  5D7G A;  1PGA A;  4MSM B;  2O6V B;  1EU4 A;  2QMT A;  1P7E A;  1J8C A;  1KF6 B;  1KTK A;  1OEY A;  1CMX B;  4WWN A;  2AYO B;  1FIQ A;  1VDV A;  2EKE C;  1MPE A;  3W2D A;  2WDR B;  3I3T B;  1PGB A;  2ZNV B;  2KFK B;  4OVZ A;  1WRI A;  2KLC A;  3ENE A;  1QLB B;  2QJL A;  1AN8 A;  4URK A;  2LZ6 A;  4WJQ A;  3BVG A;  4CO7 A;  1D4B A;  4P16 A;  4P7I A;  2PIA A;  3VR8 B;  1MG4 A;  5FK9 C;  4A3P A;  4P1B C;  5LXI B;  4HRO A;  2LD9 A;  3Q3N C;  3PT2 B;  1QOB A;  4RGO S;  2IO1 B;  1XLP A;  2W82 A;  3UQA A;  3C8Y A;  2SAK A;  4I6L B;  2XNA C;  2IND C;  4IM2 A;  2L7R A;  1T0Y A;  1LGR A;  2INP E;  1GAQ B;  3VTW A;  1WIA A;  2AEH A;  3D32 A;  3AEC B;  4EKU A;  5BYS A;  2JRH A;  2PJH A;  2NS5 A;  2EMT A;  4BVU C;  4NQL B;  2L76 A;  2AX5 A;  1M4V A;  3AE3 B;  5EE9 A;  3Q6B A;  3TMP B;  1NI2 A;  2XK5 B;  4NJ6 A;  2D3G A;  3GE3 C;  2DYM A;  1OQY A;  4BAX A;  3S2A A;  1R4N I;  3UIN B;  5E6P A;  4PS7 A;  2LJI A;  2LI5 A;  3RCZ A;  1YJJ A;  3SD5 A;  1NI3 A;  5BYR A;  3HVZ A;  3KUZ A;  4S17 A;  2PLP A;  4A8X C;  3ALB A;  4YTM B;  2DAJ A;  3AN1 A;  2FBW B;  2NMQ A;  3NZS A;  1N6Z A;  5D94 A;  2WYQ A;  4ZHO A;  4JL9 A;  4FJZ A;  4ZRP A;  3Q2A C;  4ARC A;  1IPG A;  3SR6 A;  4EOY A;  5T8I A;  1F77 A;  1UEL A;  1V49 A;  2CR5 A;  3DHH C;  4RFB A;  3DVN V;  2R2O A;  4NNJ B;  1BUI C;  2D3B A;  2WXR A;  1LQB A;  1SJE D;  1UWM A;  2ICI A;  1FRR A;  2DEN B;  3ZJT A;  1L7Y A;  3RI7 C;  3Q69 A;  2LAS A;  1SE9 A;  5FKA C;  3IHP C;  2N1W A;  4NJ7 A;  2KDB A;  3VFK A;  2W55 A;  3BVM A;  2ZEQ A;  1VR9 A;  2KOX A;  1V1O A;  1UH6 A;  4HDQ A;  1XEE A;  2WXQ A;  3KW5 B;  3NJT A;  2M19 A;  1WXQ A;  2MLB A;  3HRD D;  3WAM A;  1UNS A;  2KD0 A;  2AQ1 B;  2MBE A;  1NEN B;  1FD6 A;  2WNM A;  3X23 A;  1GPX A;  2BGF A;  2LVP A;  2WWZ A;  4FN2 A;  2IZV B;  2RD0 A;  2HDE A;  4RGN A;  3VDZ A;  3PGE A;  2N7D A;  4XWW A;  2WXM A;  3I9V 1;  1V5T A;  3RNA C;  1K8R B;  2X8X X;  4LNN A;  1ZDX A;  2K22 A;  1QF6 A;  1CZP A;  3DQV A;  4II3 B;  1E8Z A;  3PRE A;  4IUM B;  1QKZ A;  4PYZ A;  3KVF B;  4N6E B;  1ROE A;  3L08 A;  1NYQ A;  5DPW A;  1IP9 A;  3PHW B;  4LNO A;  3RN9 C;  2Z8L A;  1R4M I;  2ASQ A;  5CHV C;  3OLM D;  3TIX A;  1HZ6 A;  1TTN A;  2ZJD A;  1V86 A;  1Y56 A;  2NR2 A;  3LJ3 A;  3GE8 C;  2INC C;  3DPD A;  3NS1 A;  1FXI A;  3ABV B;  4Q2J A;  4IG7 B;  1EUV B;  4TQ0 A;  1QT9 A;  5HG2 A;  4GLS C;  1YQ4 B;  5C3J B;  3UGB B;  2LWP A;  3VUX A;  3ZGZ A;  1TKG A;  3BVZ A;  1YMH E;  5DPS A;  1UZX B;  2MH7 A;  4B95 A;  1C4A A;  2KC1 A;  4G0N B;  4W9L A;  2KX3 A;  5EE1 A;  3VRB B;  1OTR B;  2JX5 A;  4B6W A;  4EEW A;  4US9 A;  3VHT C;  3W9C B;  3HK0 A;  2KVR A;  2FAZ A;  1OFF A;  3RMK C;  2KKC A;  3LDZ E;  1YIW A;  2ZNV C;  4FJY A;  3L17 A;  3WIM A;  1WFY A;  1XT9 B;  4RGM A;  1RYJ A;  1IGC A;  1ZOY B;  2WXK A;  4BOS C;  1LFD A;  2PEA A;  2BWF A;  4N9F 4;  1R7S A;  3EFC A;  2KAN A;  3R7R A;  2K1F A;  4CYE A;  1KH0 A;  1GOZ A;  1MJD A;  1TT5 B;  2JZ3 B;  2KLG A;  3JSV B;  2KDI A;  4WQO B;  4HDO A;  2JSV X;  1E6E B;  1XD3 B;  3ZTC A;  1SEB D;  4M8N A;  2MBO A;  2AWT A;  2W3R A;  2JWU A;  2QC8 A;  1JWB D;  3HHM A;  2XBB C;  1E5W A;  4B0E A;  5H8Y E;  1VZ6 A;  3U7D A;  2FUH B;  1P3Q U;  3HUI A;  4BKT A;  1E10 A;  4B0M A;  1E90 A;  4MGK E;  3DBH B;  3AU5 A;  3DHI C;  1FNW A;  2K8C A;  3A9K A;  3L0W B;  1QQR A;  2QCZ A;  3AU4 A;  3P63 A;  2LVO A;  3ZTD A;  1Q10 A;  4KSK C;  2KHW B;  3UIP B;  2KT7 A;  1J7C A;  2LUM A;  5EE0 A;  4H2A A;  1TKE A;  4YTP B;  3U7Z A;  3IVF A;  3ZNI D;  4DXG A;  1L0X B;  1Z2M A;  4MAC A;  3W1S C;  2ON8 A;  1F52 A;  2B76 B;  2WXJ A;  2WXI A;  4KVG B;  2XEW A;  4NQK E;  3JW0 X;  5HI1 A;  3BK1 A;  2I38 A;  3OWE B; 
#chains in the Genus database with same CATH homology
 4AOF A;  2JZZ A;  1V5O A;  4MSQ B;  2J0J A;  2WX1 A;  5IA7 A;  3H7P B;  2IBI B;  2I1K A;  3RUI B;  2L8J A;  5LXH A;  2L3Z A;  2IY1 B;  3A4S C;  4GOC A;  2NVU I;  3CSF A;  4K7S A;  1C1Y B;  3R66 C;  4HK2 A;  2KWU B;  3V6E B;  3CMM B;  3AUL A;  2IYD B;  3H7P A;  2JT4 B;  4W9K A;  4W9G A;  5J17 A;  4IM0 A;  3ZVV A;  2N9X A;  4EZK A;  1WR1 A;  3EC8 A;  3ZLZ A;  2DHZ A;  1WX7 A;  2LUE A;  1WXV A;  3IG3 A;  2L00 B;  1LXD A;  4G50 A;  4GXB A;  4BBN C;  2ZZP B;  4ANV A;  3ZRC A;  4IC7 B;  4FJV B;  4XX5 A;  1YX6 B;  2O6V D;  2KTF A;  1S3S G;  2MP2 B;  2NBW B;  2RR9 A;  3EHV A;  5G2N A;  5E6O A;  5AEK B;  3RYT A;  2RPQ A;  3U8Z A;  5D7G A;  2MA9 B;  4MSM B;  1IYF A;  2O6V B;  2MP2 A;  3DBL I;  2FCS A;  3A4R A;  1J8C A;  3VQI A;  2GBK A;  1LM8 B;  1OEY A;  2MBH A;  3T8M A;  1CMX B;  4DHZ B;  4WWN A;  2CU1 A;  2K6D B;  4DDI D;  2O6V A;  3PRM B;  2A4Z A;  2N1V A;  2AYO B;  3KYC D;  2JRI B;  1QZE A;  2EKE C;  3KUC B;  3C0R B;  4IWO A;  4IM3 A;  2C7N B;  3U30 A;  4AJW A;  3I3T B;  3K9O B;  1YQB A;  4FBJ B;  1X1M A;  3PS6 A;  1Q1O A;  3APD A;  4EZJ A;  3X0W A;  2ZNV B;  2KFK B;  4J6I A;  3AXC A;  4FA6 A;  2KLC A;  3ENE A;  2OOB B;  3A1Q B;  3DBH I;  4B9K A;  2KFK A;  5CHW A;  2L0F A;  4URK A;  2LZ6 A;  4WJQ A;  3MHS D;  2C9W B;  4GU2 A;  4CO7 A;  4W9H A;  1GG3 A;  4OVU A;  1WE6 A;  5HKH A;  1WGG A;  1UBI A;  3B08 A;  4P7I A;  1WY8 A;  4KV2 A;  4A3P A;  2ZCC A;  2ZVN A;  3OJ4 B;  4W9C A;  2RGF A;  4ZRI A;  1WXM A;  2KZR A;  5LXI B;  2LD9 A;  3TJP A;  3PT2 B;  2BYV E;  3WA0 A;  1VCB A;  5J2R A;  3VTU A;  2GMI C;  3QIJ A;  2IO1 B;  2KDE B;  5TR5 A;  2V4L A;  4NAW A;  2KWV B;  2KFJ A;  3UQA A;  2REX A;  3V6C B;  4I6L B;  1G6J A;  1YX5 B;  3KH0 A;  1GC7 A;  2J7Q B;  4I6P A;  4IM2 A;  2UYZ B;  2LXC A;  4A3O A;  2L7R A;  4HLE A;  1T0Y A;  2JWZ A;  1WRD B;  1V9J A;  3PTF C;  3VTW A;  1WIA A;  2HE7 A;  4FLH A;  4NPN A;  1SGH A;  4EZL A;  3MJW A;  2GBJ A;  4WWO A;  2AEH A;  4GDK B;  3D32 A;  2DZK A;  2R2Q A;  1WGR A;  4EKU A;  2NBU A;  2JRH A;  2PJH A;  2IO0 B;  2BYF A;  2NS5 A;  2EMT A;  1NBF C;  4BVU C;  3ZDM C;  4NQL B;  3VXW A;  2M8S A;  2L76 A;  4DDG D;  2KK8 A;  4K1R B;  1WJ6 A;  3QAR A;  1FXT B;  3VH4 B;  2KJ6 A;  4CHK A;  1WZ0 A;  1U4A A;  2LJ5 A;  1ZGU B;  4ANU A;  3JVZ X;  2G3Q B;  3ML8 A;  4BOZ B;  3EEC A;  3TMP B;  1RFA A;  4TQ1 A;  5D2M B;  2LGY A;  1NI2 A;  3L13 A;  1M94 A;  2XK5 B;  4NJ6 A;  4M0W B;  2W9N A;  1I35 A;  2D3G A;  3H1U A;  2FNJ B;  1ZKH A;  2XK5 A;  3GOE A;  4GDL A;  2DYM A;  1OQY A;  3APF A;  1BT0 A;  3GZN I;  1GC6 A;  3O65 B;  2FCN A;  3DDC B;  1R4N I;  3S2A A;  5E6P A;  3UIN B;  4PS7 A;  4GMV A;  2K6Q A;  2LI5 A;  2WX0 A;  4HWI B;  3RCZ A;  3SD5 A;  4LJO B;  1OEY J;  3UF8 A;  3KUZ A;  3QAQ A;  2Z0D B;  2HTH A;  3ALB A;  3H7S A;  2MWS B;  5BO4 B;  5JHB A;  2V1Y A;  2DAJ A;  3EFU A;  2Y5B B;  3NY5 A;  3RZW C;  4MGY E;  4WAA A;  3W1S A;  2NCN A;  2DX5 B;  3NZS A;  3PLV A;  2LGD A;  3QA8 A;  3QCA A;  1NDD A;  1WGH A;  2N9P C;  3PSE B;  2WYQ A;  2C7H A;  3PPA A;  5CHF A;  5D94 A;  4JL9 A;  3UQB A;  4FJZ A;  4BBN F;  5IAA C;  1UD7 A;  4KZ0 A;  2CKH B;  1IPG A;  4EOY A;  2YLM A;  3VAW A;  3QHT A;  3ECI A;  4MGI E;  1UEL A;  3ZO5 B;  1V49 A;  2N9E B;  4ZYN A;  3V60 A;  2KDF B;  3H9D A;  2C5L C;  3ZUN A;  2CR5 A;  1HE8 A;  4DWF A;  3AI5 A;  3ZDT A;  2DZJ A;  3DVN V;  3DBS A;  3V61 A;  1YJ1 A;  3DVG Y;  5GMV A;  5CTR C;  3SHQ A;  4RM8 A;  2R2O A;  4NNJ B;  3L10 B;  1EO6 A;  4W9D A;  4GB9 A;  2L0T A;  3SDL C;  4DK5 A;  1H8C A;  1LQB A;  3ZNZ B;  4PS3 A;  2DEN B;  1V2Y A;  5L95 C;  1L7Y A;  2NPT B;  2QHO A;  4GSW A;  1EF5 A;  4TUU A;  2LAS A;  1V6E A;  4DBG A;  1SE9 A;  3WAO A;  1WJN A;  3IHP C;  2N1W A;  2LVQ A;  4NJ7 A;  5J18 A;  1WX9 A;  1WX8 A;  2PE6 B;  2NPT A;  4W9F A;  4ZRJ A;  2KDB A;  3VFK A;  3L54 A;  1F9J A;  4KDI C;  3RZF A;  2K8B A;  2LRW A;  5AZG A;  2ZEQ A;  3RUL A;  3K9P B;  2KOX A;  1UGM A;  1UH6 A;  3NS8 A;  4HDQ A;  3DCG A;  3PVL A;  3WAN A;  3WAP A;  5AZF A;  2RSU A;  2KMA A;  3KW5 B;  3PRZ A;  3DVG X;  4K7W A;  3DOW A;  1WXA A;  4WJO A;  1MG8 A;  2CHW A;  4NAW B;  2D07 B;  3NOB A;  2MLB A;  2KJR A;  3CF6 E;  2PE9 A;  3N30 A;  4PS8 A;  3VUW A;  5DPT A;  2BF8 B;  2Z59 B;  4II2 B;  3WAM A;  2KD0 A;  1AAR A;  5G55 A;  1WGY A;  3APC A;  3B0A A;  2G45 B;  2MBE A;  1Z5S B;  3R7Q A;  2KX0 A;  1KM7 A;  2KMC A;  3VVW B;  3BY4 B;  3N3K B;  3X23 A;  2BGF A;  1WR6 E;  4MJS A;  2GOW A;  2C7M B;  1S1Q B;  2LGX A;  2WDT B;  3PLU A;  2LVP A;  2KN5 A;  2O2V B;  2WWZ A;  2IZV B;  4FN2 A;  4LDT D;  2RD0 A;  2KQS A;  1WXS A;  3VDZ A;  1L2N A;  3QC8 B;  4K7U A;  4M8M A;  3A9J A;  2MCN B;  3PGE A;  3QX1 A;  1EF1 A;  2N7D A;  4G3X B;  2O2V A;  1RLF A;  2GBM A;  1WYW B;  4MEL A;  5FR6 A;  3W1Y A;  4DXA B;  1V5T A;  1K8R B;  2DYB A;  1Q5W B;  1TGZ B;  2FCQ A;  2HD5 B;  2GBN A;  3H6N A;  1UBQ A;  4I6N B;  4GIV A;  1E7U A;  3DQV A;  3ZNG C;  3VH3 B;  1YD8 U;  4II3 B;  2BPS A;  4BFR A;  2KC2 A;  1E8Z A;  3PRE A;  2CS4 A;  3IFW B;  5JHA A;  4FHK A;  4HPM B;  1Y8R C;  4IUM B;  2KJH B;  4KIK A;  2D10 A;  2IO3 B;  2YVC A;  3TBL D;  4PYZ A;  4GDL B;  3KVF B;  1KJT A;  3VUY A;  3L08 A;  5DPW A;  4RMA A;  4WJP A;  3PV1 A;  1IP9 A;  3PHW B;  1E8W A;  2JXX A;  2DZI A;  1R4M I;  3M3J A;  2ASQ A;  5CHV C;  3OLM D;  3PZD A;  3TIX A;  1TZ1 A;  5C1Z A;  1TTN A;  3JYU A;  3TL5 A;  1JRU A;  3RD2 A;  2KO3 A;  2C60 A;  4A20 A;  1WF9 A;  2ZJD A;  4F1S A;  1V86 A;  2NR2 A;  3LJ3 A;  2J0K A;  4MH0 E;  4X57 B;  4EFO A;  4GN1 A;  3DPD A;  4W9I A;  2D2Q A;  1WMH B;  1E8X A;  1WI0 A;  4DHJ D;  2UWQ A;  5KHO A;  1D3Z A;  4JLC A;  1OGW A;  2AL3 A;  3CST A;  4IG7 B;  2PPH A;  1EUV B;  2B3A A;  3DVN U;  4TQ0 A;  1KLV A;  3ZIM A;  1WMH A;  4G11 A;  4HJK A;  2MSE D;  3UGB B;  5DPR A;  2LRU A;  4AJY B;  1I42 A;  2LWP A;  3VUX A;  4ASW C;  3Q3J A;  4KDL B;  3ML9 A;  2VRR B;  4TKN A;  2JY6 A;  4E3C A;  5L83 A;  1WJ4 A;  1P98 A;  2JVC A;  4MM3 A;  3T9L A;  4FHJ A;  4IWP A;  4HCN B;  2JF5 A;  5DPS A;  4HCP B;  4E74 A;  1E7V A;  1RRB A;  3ZNH B;  2N7E A;  1UZX B;  1ZW7 A;  1WGD A;  4KZC A;  4B95 A;  3NZU A;  2ZVO A;  2MRP A;  3ZRF A;  2EMS A;  2KC1 A;  2K8H A;  3UIO B;  4G0N B;  1P1A A;  4W9L A;  1V80 A;  4E71 A;  3WAL A;  2KNB A;  2KX3 A;  1H4R A;  4JQW C;  3ZKJ C;  2IO2 B;  4LCD E;  4RM9 A;  1OTR B;  3OJ3 A;  1WE7 A;  4B6W A;  4EEW A;  1V81 A;  4NY0 A;  3DBR I;  3VHT C;  2KWC A;  4W9E A;  1GUA B;  2CHZ A;  2KVR A;  3HK0 A;  2FAZ A;  1P0R A;  5CX3 A;  1GJZ A;  2FCM A;  2ZPN A;  2KKC A;  4HVB A;  3ZW3 A;  3P2B A;  2MBQ A;  3HM6 X;  4IW0 A;  3M95 A;  2BKR B;  3LDZ E;  1YIW A;  2ZNV C;  4FJY A;  2K25 A;  3L17 A;  2A5U A;  3NHE B;  4MDK E;  5KHQ A;  3WIM A;  5E6N A;  2G4S A;  1WFY A;  1XT9 B;  3V62 A;  4ICU A;  3M63 B;  1VD2 A;  4BOS C;  1LFD A;  2KTR B;  2PEA A;  5DCN A;  3TCA A;  2FIF A;  2MQJ A;  3N32 A;  4F7Z A;  1WZ3 A;  2BWF A;  2JPH A;  3L16 A;  4N9F 4;  2KTR A;  2KAN A;  2NBV B;  3R7R A;  2K1F A;  4CYE A;  1GNU A;  3KYD D;  4KSL C;  4BKG A;  5JH5 C;  2JZ3 B;  2KLG A;  3JSV B;  4WQO B;  3SU8 X;  2KDI A;  4MJS B;  4AUQ C;  4HDO A;  3A1Q A;  4BKS D;  1C3T A;  1E8Y A;  1XD3 B;  1SIF A;  4XZ4 A;  3ZTC A;  2BKF A;  3JSV A;  3A33 B;  4M8N A;  2MBO A;  1Q0W B;  4ANX A;  3A9J B;  2AWT A;  4ANW A;  2DYO A;  2GBR A;  2L05 A;  2FID A;  4EUT A;  4LJP B;  4AWJ A;  1TBE A;  4ICV A;  1XQQ A;  3PHX B;  5LLI A;  4GGQ A;  1J0G A;  3HHM A;  4BKS A;  2XBB C;  1E5W A;  5EDS A;  4LDT B;  3IBE A;  3OAW A;  2CHX A;  4OVV A;  3VTV A;  5JZE B;  4XC2 A;  2BWE S;  4HXD A;  3KUD B;  3M62 B;  4PYU A;  5AZH A;  3U7D A;  2FUH B;  1P3Q U;  2MW5 A;  1PQS A;  4KIK B;  3MTN B;  4FUL A;  2HJ8 A;  3A9K B;  4BKT A;  2LXA A;  1E90 A;  4JIO U;  4MGK E;  4JGH B;  2N4F A;  3AU5 A;  5D6J B;  1KOT A;  1J19 A;  2K8C A;  3A9K A;  1WH3 A;  1WJU A;  3L0W B;  1RAX A;  4FAD A;  2I1J A;  1A5R A;  3AU4 A;  3Q3F A;  2LVO A;  4ZDV A;  2IY0 B;  3QJZ A;  4WWP A;  4MGZ E;  2KQ7 A;  3ZTD A;  3QQ8 B;  4KSK C;  4W9J A;  4GDK A;  2M0X A;  2K39 A;  2KXJ A;  2KHW B;  3BIN A;  3UIP B;  3B1L X;  2M4N A;  5C23 A;  2DAF A;  4AP4 C;  2JUO A;  2DZM A;  4F8C B;  2BYE A;  3IVF A;  3ZNI D;  4TV3 A;  3ONS A;  3QK0 A;  4K81 A;  2MX2 A;  4WJN A;  4IWQ A;  3HIZ A;  3QWZ B;  2MBB B;  2V3S A;  2M17 A;  2ZPY A;  2OJR A;  4MEM A;  3RT3 B;  2AL6 A;  1Z2M A;  3W1S C;  2D11 A;  3HM3 A;  1P9D U;  1ISN A;  2G4D B;  2M1M A;  3PRP B;  1WM3 A;  4DHJ B;  3R3M A;  2Z0E B;  4HPL B;  2ZCB A;  4ZRK A;  4KVG B;  2J0M A;  2XEW A;  4YL8 A;  4NQK E;  3JW0 X;  4DHZ E;  1WM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...