2K1FA

Sumo-3 from drosophila melanogaster (dsmt3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG4494-PA
publication title NMR-derived solution structure of SUMO from Drosophila melanogaster (dSmt3)
doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k1fA00
3IVFA 3RD2A 2KJ6A 4X57B 2PE6B 2DYMA 2NBWB 3PRPB 2KDIA 4KDLB 5G2NA 1V81A 5IA7A 2O2VA 2HE7A 3EFUA 4ICUA 3OLMD 3PS6A 4BKSA 5J17A 2MP2B 3ZLZA 3CF6E 4MSMB 3ZNID 3SDLC 2IY1B 3RT3B 2L8JA 1WZ0A 4F1SA 1UD7A 4EZKA 4A3PA 2KDBA 3VH4B 1WGRA 2PEAA 3ZNZB 3W1SC 2EMTA 2LI5A 2NR2A 4BBNC 1NBFC 4G3XB 1SE9A 4GXBA 1P1AA 2N1VA 2WX0A 3M62B 4EZLA 1WXMA 3RZFA 2EMSA 2BYEA 3DVNV 2PPHA 5L95C 4ZRKA 5C1ZA 3B08A 4IM2A 5HKHA 1J0GA 4JLCA 3UQBA 4AUQC 4IW0A 2JUOA 2BYFA 3A4SC 3SD5A 2CHXA 1VD2A 4DHZE 3X23A 1SGHA 2JPHA 3CMMB 4W9EA 2MSED 1WE7A 4ZRJA 3ZO5B 1V2YA 2XK5A 3B0AA 5DPRA 4DDID 5AZGA 3QA8A 2UWQA 3WAOA 2KTFA 3UQAA 1L2NA 4IC7B 1KLVA 1WX7A 4MGIE 2KDEB 1V6EA 4EUTA 4MGZE 5LLIA 3H7PB 2V3SA 4M8NA 4GDLB 3KYDD 1IPGA 2NBVB 2N9PC 2G4SA 4LJOB 3VUXA 3V6EB 1TTNA 2KVRA 2DX5B 2D2QA 1L7YA 4K81A 1OEYA 2CKHB 4K7SA 4XZ4A 4M8MA 3QX1A 1S3SG 4II2B 5E6PA 2KMCA 1G6JA 2K8CA 3JYUA 3LDZE 1FXTB 4HWIB 1OEYJ 1YQBA 3OAWA 4GGQA 2G45B 4DXAB 3UGBB 1LFDA 3NZSA 4ZYNA 5BO4B 4W9JA 2IBIB 2LD9A 3H7SA 4A3OA 2YLMA 2LXCA 2LASA 2O6VB 5AEKB 2JRIB 2WWZA 2LRWA 3A1QA 2FUHB 3GZNI 1M94A 4HPMB 4ZDVA 2HD5B 1WGHA 2K1FA 2WDTB 4A20A 3WANA 2JY6A 2DZMA 4FADA 2K39A 3V60A 3WIMA 5J2RA 4HCPB 4ZRIA 2LXAA 4FA6A 2JXXA 4GIVA 4I6PA 3X0WA 2RD0A 3AXCA 1GC7A 1XD3B 1IYFA 2BPSA 1EF1A 2J0JA 4BFRA 2Y5BB 3JVZX 2IO1B 4WJQA 5C23A 2JF5A 2RSUA 3SHQA 5G55A 4KSLC 2C7NB 3H9DA 2KANA 2DAFA 2CHZA 2IO3B 4B9KA 3PRMB 1P3QU 3JSVB 2KTRA 3HIZA 4FN2A 2KWUB 5AZFA 3L13A 4GB9A 4YL8A 3DOWA 4KZ0A 5EDSA 2LVQA 2FNJB 4LDTB 2N4FA 4ANXA 1PQSA 2Z59B 3T9LA 3ALBA 2ZPNA 2ZVOA 3UF8A 2KLGA 3VFKA 3TIXA 3PPAA 2O6VD 2JRHA 1C3TA 1V49A 2ZNVB 4N9F4 4LJPB 2JVCA 2NPTB 3PGEA 2KC1A 3QCAA 2GBKA 2MBEA 2CR5A 2FCSA 1WXAA 2C9WB 4E71A 4LCDE 2DENB 3P2BA 1UBIA 2MRPA 4IWPA 1S1QB 3ECIA 2N7DA 1KOTA 1J8CA 4ANWA 2L3ZA 4MSQB 3TBLD 3RYTA 4B6WA 2KD0A 3DCGA 3K9PB 4KDIC 3PHXB 1E8XA 3QC8B 5E6OA 1WH3A 3VAWA 3PT2B 5D7GA 4ANUA 4DHJB 4HDQA 2DZKA 2FAZA 2LGXA 2REXA 4MJSA 3Q3JA 4TV3A 3MTNB 3PLVA 2BWES 4LDTD 1C1YB 3SU8X 2BKFA 3U30A 2K8BA 2UYZB 3V6CB 3ZDMC 1WF9A 5CHVC 2D10A 3D32A 4JGHB 4KVGB 1R4MI 3L54A 3AULA 1E8ZA 1U4AA 3DBSA 1WGYA 3JSVA 4K1RB 3A9KA 2L0TA 1RAXA 3VUYA 3A4RA 4F7ZA 1WRDB 2RR9A 3APCA 3VXWA 2MLBA 4WAAA 1RLFA 5CHFA 2V4LA 3QK0A 3ZUNA 2JZZA 2ZPYA 2G4DB 3MHSD 2N1WA 2L05A 4PS8A 2HJ8A 2KFKB 4DWFA 3APDA 4P7IA 1WYWB 4II3B 5AZHA 2MBOA 4WWNA 2WX1A 1ISNA 4HLEA 4DK5A 3KH0A 2MCNB 2C5LC 1WXVA 4NPNA 3A9JB 3NZUA 1H4RA 4DHJD 2MX2A 1YX6B 4EOYA 4BVUC 1WMHA 2MA9B 1MG8A 2M0XA 1WGDA 1RRBA 2A5UA 2KMAA 3RZWC 3NY5A 2FCNA 4I6NB 4KIKB 3LJ3A 1XQQA 4NAWB 4BOSC 4RM9A 4WWPA 1E5WA 2YVCA 2Z0DB 3WALA 3K9OB 1UZXB 3ZW3A 4IUMB 3KW5B 1WY8A 1WR1A 2M17A 5DPSA 3ZRCA 3U8ZA 1BT0A 2R2OA 3ML9A 3O65B 2JWZA 4CHKA 2MP2A 1OGWA 4KV2A 2KDFB 4FJZA 1OQYA 1V9JA 3AU4A 3CSTA 3QIJA 4MEMA 4GDKB 3L16A 2HTHA 5CHWA 1NDDA 1YD8U 5J18A 5GMVA 3APFA 4GOCA 4HDOA 3VDZA 2LZ6A 3ZRFA 5JHBA 4FBJB 2KQ7A 2IO0B 3QJZA 4FULA 4CO7A 4MDKE 1EF5A 2CHWA 2L00B 2M1MA 4NJ6A 3VTUA 3DBRI 4W9FA 4WQOB 2MW5A 2FCMA 5KHOA 2D3GA 2KN5A 3R7QA 2ZEQA 3DBHI 2AYOB 3NHEB 4AP4C 3KUZA 4F8CB 4JL9A 2LJ5A 3UINB 3AU5A 2J7QB 3V61A 3GOEA 2ZZPB 3ONSA 4MGKE 4BKTA 2C7HA 3WAPA 3H7PA 3ZTDA 1LM8B 4HXDA 4CYEA 2O2VB 2OOBB 3QQ8B 4IWQA 4GDLA 3HM6X 4NQKE 3IHPC 4JIOU 2N7EA 3H6NA 4E3CA 1V80A 3KUCB 1LQBA 2GMIC 2KC2A 4EKUA 2L7RA 4I6LB 3VH3B 1WJ4A 2AEHA 3IFWB 4AWJA 1YIWA 1XT9B 3QWZB 2D11A 3PSEB 2DAJA 4K7UA 2R2QA 3ZNHB 1H8CA 2KJHB 2MBBB 4EFOA 3KUDB 4G0NB 1Y8RC 1HE8A 1E90A 4E74A 1F9JA 1WGGA 2O6VA 2KX0A 3A33B 4FLHA 3VQIA 3QAQA 3PV1A 2GBNA 3NOBA 1EO6A 1A5RA 2LWPA 2OJRA 4G50A 4URKA 3W1SA 1QZEA 4TQ1A 2GBRA 1KM7A 2BKRB 1YX5B 3EHVA 5DPTA 4AJYB 3ZVVA 4W9DA 5JZEB 2JZ3B 3VTWA 1ZGUB 5L83A 2LRUA 2MWSB 1WIAA 3IBEA 2GOWA 2DZIA 2XK5B 2KFJA 5LXIB 5D6JB 4XC2A 3DVGX 1TGZB 1WE6A 4PYUA 4WJOA 2N9EB 3HK0A 3NS8A 2CU1A 2D07B 2J0KA 2QHOA 2KQSA 1GNUA 4KSKC 1V86A 3EECA 3KYCD 3RCZA 2J0MA 3M3JA 1UGMA 4GN1A 1K8RB 2KLCA 3B1LX 2M8SA 4ASWC 2KKCA 2LUEA 2BF8B 2GBJA 2MBHA 1UBQA 4BOZB 4DHZB 3U7DA 2XEWA 1WR6E 1UH6A 3BY4B 2NBUA 1Z5SB 1Q5WB 4FJYA 5LXHA 1SIFA 2KWCA 3L17A 1R4NI 3W1YA 4NQLB 2NPTA 1CMXB 1Z2MA 3QARA 3S2AA 4HK2A 1KJTA 4TQ0A 4W9LA 2K25A 3ZKJC 3H1UA 3M63B 2KHWB 3A1QB 3MJWA 4MH0E 4AJWA 4DDGD 4GMVA 4ANVA 3PRZA 4K7WA 2K6QA 4WJPA 1TZ1A 2ASQA 2KJRA 3M95A 2W9NA 3OJ3A 4PS7A 1WXSA 4BBNF 3DDCB 4XX5A 4ICVA 4FHKA 3T8MA 1T0YA 1WM3A 3KVFB 2DHZA 5CTRC 1V5TA 2IY0B 2NS5A 1WJ6A 1WI0A 3PREA 4KZCA 4PS3A 2VRRB 3DQVA 1UELA 5KHQA 2ZCCA 1X1MA 1WJNA 1AARA 3WA0A 4DBGA 3DPDA 4W9IA 2BWFA 1VCBA 1WJUA 3VVWB 4RM8A 2L0FA 3BINA 1V5OA 2KTRB 2C60A 2LGDA 3TJPA 4HVBA 5D94A 2ZJDA 5TR5A 2Z0EB 2I1KA 3R66C 3L10B 5IAAC 3AI5A 2FIDA 4PYZA 4MM3A 2NVUI 3ZTCA 2ZNVC 3VTVA 1EUVB 2RGFA 4FJVB 4W9GA 3UIOB 4TUUA 3RULA 3IG3A 2CS4A 3PVLA 3RUIB 3WAMA 3L08A 2IO2B 1OTRB 2MQJA 3R3MA 5DPWA 2LVPA 4GU2A 3ML8A 4W9CA 1NI2A 4NJ7A 5CX3A 2RPQA 1Q0WB 5JH5C 1GUAB 2DZJA 2KFKA 3CSFA 4WWOA 4WJNA 3VUWA 2DYOA 3V62A 1I42A 2K8HA 2JT4B 3PLUA 3QHTA 1IP9A 2KO3A 1E8WA 1WFYA 2FIFA 3PTFC 3A9JA 3TCAA 1D3ZA 2PJHA 4W9KA 4B95A 4NNJB 2KK8A 1RFAA 3N30A 3ZNGC 2BYVE 3JW0X 1GC6A 2K6DB 3HHMA 1LXDA 4TKNA 3ZIMA 4MJSB 3L0WB 5DCNA 1WM2A 4G11A 3EC8A 2AL6A 4KIKA 2LVOA 1WX9A 4NAWA 3Q3FA 4MGYE 4BKGA 4HJKA 2IZVB 1I35A 2BGFA 4RMAA 1JRUA 2C7MB 4J6IA 2KOXA 3OJ4B 1E8YA 3PZDA 1WX8A 1ZW7A 2PE9A 1GG3A 3DVNU 2KWVB 2LGYA 2G3QB 2ZCBA 4HCNB 3A9KB 2KNBA 1WZ3A 1ZKHA 2ZVNA 4IM3A 3DVGY 3PHWB 4GSWA 3UIPB 2KX3A 3R7RA 3DBLI 4GDKA 4IG7B 4EZJA 2XBBC 4HPLB 4FHJA 4IWOA 2DYBA 3C0RB 4M0WB 3VHTC 2GBMA 2V1YA 2A4ZA 4AOFA 3I3TB 2IYDB 1J19A 1P0RA 4IM0A 2EKEC 2M4NA 3N3KB 1TBEA 1Q1OA 2I1JA 3TL5A 1P9DU 4W9HA 1E7UA 2WYQA 3N32A 3HM3A 4MELA 2NCNA 1WMHB 2KXJA 2L76A 4EEWA 5JHAA 2KZRA 4BKSD 1YJ1A 5E6NA 4NY0A 4OVUA 5FR6A 2AL3A 2AWTA 5D2MB 3ZDTA 1E7VA 2B3AA 2N9XA 1P98A 2MBQA 4JQWC 3ENEA 4OVVA 2FCQA 3TMPB 1GJZA
chains in the Genus database with same CATH superfamily
2LUMA 1KFYB 2KDIA 1V97A 3EFUA 3OLMD 1K52A 3PS6A 4BKSA 1C4AA 2MP2B 3CF6E 1VZ6A 4MSMB 3ZNID 1WZ0A 4A3PA 3WCQA 1WGRA 3ZNZB 2LI5A 1SE9A 3M62B 1WXMA 3RZFA 5C1ZA 3B08A 3BVZA 1N5XA 2JX5A 1L5PA 4AUQC 4IW0A 3A4SC 1VD2A 2WU5B 3W9CB 1V1PA 2BS4B 3X23A 4HROA 4WIPA 3W5UB 1ZP0B 4ZRJA 3B0AA 2XK5A 3WAOA 4IC7B 1IBXB 3KLSX 3SFEB 1EWCA 2KT7A 3H7PB 4US8A 4M8NA 1OFFA 1TYGB 3FILB 3V6EB 2KVRA 2DX5B 2KMCA 3HVZA 3JYUA 3OAWA 4GGQA 5HHDG 5BO4B 3H7SA 2WXQA 1ESFA 2WWZA 2LRWA 3ABVB 1M94A 1NENB 2HD5B 3WANA 1PGXA 2MJDA 2JWUA 3V60A 3R2TA 4FADA 2RDHA 2LXAA 3Q69A 4I6PA 1DOYA 1C9FA 2QIEB 3MP9A 4OZAA 1IYFA 4WJQA 4ZOHC 2JF5A 3MJ5A 5G55A 2KANA 2DAFA 4IDIA 2KTRA 5AZFA 3DOWA 1D5MC 1RM6C 2LVQA 2WXPA 1KTKA 3T9LA 2ZPNA 2O6VD 2JRHA 2KYWA 2ZNVB 1ZOYB 2WXRA 3PGEA 2KC1A 2MBEA 2WQYB 1KOTA 4MT5A 4K3BA 2L3ZA 4ANWA 3RPFC 3K9PB 3Q8AA 3TEXA 3AH7A 4RGTA 1HZ5A 3SEBA 1L4ZB 3PT2B 1CZPA 2DZKA 2FAZA 4MJSA 3Q3JA 1KLUD 4TMAB 4YSXB 2WXKA 2L83A 1JWAD 1HTQA 4KGTA 1E0ZA 4JWUC 3V6CB 1UWMA 2M0AA 3L54A 1E8ZA 3DHHC 2JU6X 2L0TA 3VUYA 4F7ZA 4YSZB 2MLBA 4WAAA 2V4LA 3ZUNA 3DBHB 3RNGC 4M02A 3MHSD 4S17A 2N1WA 4PS8A 3W2DA 4M01A 1YN5A 3GS2A 4II3B 5AZHA 4WWNA 1ISNA 5JXVA 1D4BA 1WXVA 4NPNA 1H4RA 4OVZA 4BVUC 2WNMA 1L6UA 1RRBA 3NY5A 2FCNA 4NAWB 4BOSC 2YVCA 3VRBB 4RCOA 3U8ZA 3ML9A 1F2RC 4FJZA 3BVMA 3FAHA 1V9JA 1TKEA 2PLPA 3N1XC 3L16A 2HTHA 5CHWA 5GMVA 3APFA 4HDOA 2LZ6A 1SB3C 5JHBA 4A8XC 4FBJB 2L52A 4FULA 4CO7A 4CQNA 4DXGA 2L00B 2M1MA 1SE2A 1MHXA 3P42A 5KHOA 2UU7A 4S0RA 2BB5A 3R7QA 4NZLB 4AP4C 3KUZA 4JPSA 2LHDA 1XLNA 2J7QB 4P16A 2ZZPB 3N20C 2V3NA 1LGRA 3ZTDA 2OOBB 1R4NB 4GDLA 1V1OA 3IHPC 3AEGB 1LQBA 2HTME 2GMIC 2L7RA 4I6LB 2AEHA 4AWJA 2NTSA 1XT9B 2W3SA 1FPYA 1PDXA 2KJHB 4EFOA 1TY0A 3KUDB 4USAA 4C7ZA 3AV8A 3A33B 4FLHA 4KGSA 4IKGA 4URKA 2GBRA 5DPTA 1YX5B 4W9DA 1V1PB 1HEZE 3VTWA 5EE1A 2DZIA 2K22A 2XK5B 2KFJA 1K53A 5D6JB 3HK0A 3NS8A 2J0KA 4KSKC 4D2KA 2YEPB 2XN9C 2M8SA 4ASWC 2VH2A 2KKCA 2LUEA 2MBHA 1QOAA 5HI1A 2XEWA 1UH6A 2NBUA 1Z5SB 1SXTA 4NQLB 4ZHOA 1HQRD 2Y5PA 4P1BC 2KACA 3H1UA 2KHWB 4DDGD 1I4HA 2K6QA 4WJPA 2WXIA 3EUB2 2W9NA 4HPPA 1JRPA 1FO4A 1WRIA 3B9JA 1FD6A 4PS3A 1UELA 3DWMA 1TS3A 3BK2A 2N9KA 4DBGA 3RI7C 1BXTA 1NYQA 4NAMA 3BINA 3RNAC 3MFGA 2KTRB 2C60A 3DBLB 5D94A 1YJIA 2I1KA 3R66C 5AUIA 2FIDA 4MM3A 4KGRA 2ZNVC 3VTVA 2RGFA 2WXMA 4JE3B 1N6ZA 3IG3A 4OHJA 5BMGA 1RFKA 2KQ4X 1TY2A 3RUIB 3WAMA 4A9AA 4NJ7A 2KFKA 3CSFA 4WWOA 2N0SB 5HG2A 5BMIA 1SEBD 2DYOA 3DHGC 1I42A 3QHTA 1FRRA 1WFYA 2FIFA 4KKIA 4BZAA 3A9JA 1D3ZA 2PJHA 3RNFC 1RFAA 2VZKD 3PZ7A 1GAQB 2PMVA 3HHMA 1JW9D 1B1ZA 2ACZB 2ONQA 4MJSB 3L0WB 3PZ8A 2LVOA 4BKGA 1FEHA 4C56C 4RMAA 4J6IA 1E8YA 3DVNU 2PE9A 2LGYA 2CJNA 5T8IA 2LFIA 1ZKHA 4IM3A 4ZHPA 2KWDA 1EM7A 2SAKA 4IWOA 4AQ7A 5EE0A 2V1YA 4LNKA 1TBEA 1Q1OA 2I1JA 3TL5A 1Q10A 1ZE3D 1GB1A 5E6NA 1MFWA 4OVUA 2AL3A 2AWTA 1E7VA 2N9XA 5H92C 3R8BA 3MHZA 2MBQA 3ENEA 1GJZA 2GB1A 1SJHD 2KJ6A 3PRPB 2HE7A 4ICUA 1QT9A 3VH4B 2IGHA 5EE3A 3ETRA 2Z8LA 1NBFC 2GLSA 1P1AA 2EMSA 2BYEA 4Q2JA 3TUOA 3SFDB 5HKHA 5HFYA 4JLCA 3Q3MC 2JUOA 2IJ0A 4DHZE 1SGHA 2J52A 4W9EA 2MSED 1WSPA 1WE7A 1V2YA 3AECB 4DDID 3QA8A 1N61A 2KTFA 1L2NA 1KLVA 1WX7A 3AE5B 4ITKA 4MGZE 5LLIA 4OZBA 4GDLB 2NBVB 2N9PC 2G4SA 3OWEB 2D2QA 1YQ3B 4K7SA 4II2B 1S3SG 3NG0A 3VR8B 3LDZE 1FXTB 3Q8FA 1OEYJ 1YQBA 2G45B 3NZSA 4ZYNA 4A3OA 2YLMA 2LXCA 2W55A 3A1QA 3GZNI 4HPMB 5H8YE 2Y5CA 3HUIA 5AUKA 2JY6A 2WU2B 3WIMA 1QILA 5J2RA 3AEEB 2WXJA 2D3CA 4PK1A 1GC7A 1XD3B 2BPSA 4BFRA 2L1AA 2IO1B 3SHQA 4KSLC 2C7NB 2QEJC 3H9DA 1P3QU 1FIQA 2INDC 2N4FA 3NVWA 1PQSA 3ALBA 2ZVOA 3UF8A 3VFKA 4LJPB 2JVCA 5LNK1 3HRDD 3QCAA 2FCSA 2MHJA 1UUPA 1WXAA 4LCDE 2DENB 1S1QB 1YNTE 3GE8C 3URYA 2WXNA 4MSQB 4B6WA 3TBLD 2QJLA 3DCGA 4KDIC 1E8XA 3AB5A 1WH3A 1PFDA 4ANUA 3ZYYX 3IT6B 1YOVB 2PVOD 4TV3A 2PIAA 3MTNB 2BWES 3U30A 4MM3B 4JGHB 4KVGB 1FXAA 3AULA 1UGJA 3KQ4A 3DBSA 3JSVA 1J7AA 3A9KA 2FUG1 3A4RA 1WRDB 2RR9A 3APCA 3QK0A 3IAS1 2KFKB 4DWFA 2QC8A 2MCNB 2D3AA 2ON8A 5C3JB 3A9JB 5BYQA 3AE9B 1YX6B 1DOIA 2MA9B 2J42A 1WGDA 5G5GA 2KMAA 2IDYA 3LJ3A 5EE9A 1ET6A 3GB1A 1C76A 3WALA 3K9OB 1J7BA 3KW5B 4PT5A 2R2OA 1WYGA 3O65B 2JWZA 4KV2A 1SSNA 2CU3A 4DQOC 3AE1B 3QIJA 2GRIA 4XWTA 1TS2A 1YD8U 5FK9C 3VDZA 3ZRFA 2KQ7A 3MC0B 1GOZA 3VTUA 2WHIA 1I4GA 2D3GA 2KN5A 4ACFA 1ACCA 1MHHE 3NHEB 3BZDB 1R4MB 4F8CB 3AU5A 2N7JA 1D6EC 3EGRA 2LMCA 1VLBA 4RFBA 5IN7A 2D3BA 1AYFA 2C7HA 4CYEA 3NJTA 1LM8B 4HXDA 3HM6X 4JIOU 1SF0A 3KUCB 1BUIC 2KC2A 4EKUA 2I2YA 3B2FA 3P63A 3QWZB 3PSEB 4K7UA 2R2QA 2MBBB 4AS1A 4KX6B 1HE8A 2JYEA 2KX0A 3QAQA 3PV1A 2GBNA 3NOBA 2OJRA 1L6VA 4TQ1A 3ZVVA 3NZ3A 4RGNA 1ZGUB 5L83A 2LRUA 2MWSB 1WIAA 2WXHA 4XC2A 3DVGX 4WJOA 2PTLA 4GLSC 3P4PB 2D07B 2KQSA 1V86A 1BMLC 1MG4A 2J0MA 3M3JA 4OW0A 3DBRB 3TSSA 1VZ8A 1UBQA 4BOZB 4DHZB 2NMQA 4FJYA 3FKYA 4ARIA 3P4QB 3W1YA 4BAXA 1CMXB 2INPE 1KJTA 5J17A 3MC8A 4W9LA 3V3XA 4MH0E 3ZKJC 2BBCA 3A1QB 3MJWA 4GMVA 4ANVA 1YN3A 2ASQA 1N62A 3OJ3A 4PS7A 1WXSA 1OQRA 3LXFA 3RNBC 3DDCB 3ZQ4A 4WWMA 4FHKA 5IOIA 1T0YA 3O13A 2DHZA 1F2RI 2IY0B 1VZ7A 4YSYB 1NYRA 2INCC 5KHQA 2ZCCA 1X1MA 1WJNA 3WA0A 3DPDA 2BWFA 4RM8A 2DWQA 3TJPA 3I63C 2L32A 1C78A 1TS5A 3AI5A 1F77A 1SIJA 2NVUI 1SBBB 2WXGA 4RH6A 1L4DB 1EUVB 4FJVB 4W9GA 3UIOB 4TUUA 1RYJA 2LGSA 3PVLA 2IO2B 2MQJA 3R3MA 1ZXIA 1Q0WB 2M56B 4WJNA 2JT4B 1YMHE 4ZRQA 3PLUA 2HJ1A 3B2GA 2KO3A 1E8WA 3PTFC 1QOFA 1FXIA 2XNAC 4W9KA 5D3DA 3N30A 2BYVE 2X8XX 1GC6A 1N63A 2K6DB 1LXDA 4C00A 1UNSA 4G11A 2V3PA 4LNIA 3I9V1 4KIKA 1QF6A 3AE2B 1I7HA 3AMZA 3Q3FA 4ZYSA 1JWMD 3R2IA 2KOXA 2YEPF 3RNCC 1GG3A 2KWVB 1P7FA 3A9KB 3HVDA 3UIPB 4GDKA 1F52A 2XBBC 2GBMA 1J19A 3PO0A 3N3KB 2ZW0A 1P9DU 3NVZA 3HM3A 4MELA 2PKOA 2L76A 4A90A 2G9HD 2KZRA 1YJ1A 1MVKA 3LYYA 4MACA 5FR6A 2B3AA 3AEAB 4KKJA 4O1NA 1P98A 3RD2A 4X57B 1I4RA 4KDLB 5G2NA 1V81A 1XO3A 3RT3B 3GZNB 2L8JA 4F1SA 4EZKA 2PEAA 3W1SC 2EMTA 4YT0B 3ZJUA 4BBNC 1SJED 4GXBA 2BB6A 2N1VA 2WX0A 2X38A 4NJCA 1L0YB 3W5VB 1VJKA 3DVNV 1FMAD 1XLPA 2PPHA 5L95C 4ZRKA 4JX1C 4IM2A 1DGJA 4N59A 2CHXA 5IP4D 1J7CA 2JPHA 3BWUD 3CMMB 2UWQA 2Y3AA 1I4XA 2KDEB 2Q5WD 5TSSA 1KF6B 2WDVB 1HZ6A 4ARCA 3KYDD 1IPGA 3T3NA 3VUXA 1TTNA 1L7YA 1B9RA 2AQ3B 1UF0A 4M8MA 2K5PA 3QX1A 4R3DA 1XCTL 1IGCA 1G6JA 1MJDA 1MPEA 4DXAB 2LD9A 4J3OD 4REZA 2LASA 1D5XC 2JRIB 2JXTA 4H2AA 4ZDVA 1WGHA 1FNWA 4WH4A 2K39A 2JSVX 1JALA 4HCPB 4FA6A 3IT4B 2JXXA 2QCZA 3I57A 4M00A 2CJOA 2OHFA 1FCLA 1N60A 1NVID 1EF1A 2Y5BB 3JVZX 1TT5B 1ZDVA 2CHZA 2EELA 2IO3B 5E6JA 4B9KA 3HIZA 4FN2A 2KWUB 3U7ZA 1KLGD 4GB9A 4YL8A 1WWTA 4LDTB 4ANXA 2Z59B 2KLGA 3RMKC 5FR3A 3MC9A 2GI9A 4N9F4 4K3CA 2GBKA 1EU4A 2CR5A 1VRAB 4E71A 3Q8EA 4IWPA 3ECIA 5D3IB 2FE8A 2RMMA 4DXFA 3RYTA 2KAJA 3NUHB 4UDUC 3AEDB 3EFCA 5E6OA 2BW2A 5D7GA 3GP7A 4DHJB 2K0PA 4HDQA 2LGXA 3AE3B 3SU8X 1C1YB 2BKFA 2UYZB 1JCKB 4LK0M 1XLQA 2V4IB 1WF9A 5CHVC 2D10A 3D32A 1K50A 5BYRA 1U4AA 2G1EA 1WXQA 1RLFA 5CHFA 2G4DB 3BK1A 4OZCA 2L05A 2HJ8A 3APDA 4P7IA 1TZOA 4M0WA 4N6EB 4HLEA 3KH0A 2C5LC 1JROA 1KRHA 3NRZA 1GPXA 1XEEA 2MX2A 1MG8A 2I38A 2A5UA 3RZWC 2JQRB 4KIKB 1XQQA 4WWPA 1E5WA 2Z0DB 4IUMB 1WR1A 3ZRCA 2VZKB 1BT0A 4CHKA 2FBWB 1PGBA 1FM0D 2KDFB 2LHEA 2MEKA 3CSTA 4MEMA 4GDKB 3U4EG 1NDDA 1TJEA 4C80A 2J53A 2IO0B 3QJZA 4A6QA 1N5WA 4MDKE 4NJ6A 4W9FA 1TIFA 4WQOB 2FCMA 4QAYA 4EE2A 1FFVA 4XDDA 1ZUD2 3CIRB 3GOEA 2H89B 1C77A 1NEKB 3WAPA 4IWQA 3TEWA 4NQKE 2PW9A 2N7EA 1QKZA 4E3CA 1UWXA 1WJ4A 2QILA 2D11A 2WGSA 3ZNHB 4G0NB 1Y8RC 1TKGA 4C4VA 4E74A 1STEA 1F9JA 1EU3A 1WGGA 2O6VA 3AE4B 3ZXRA 1EO6A 1A5RA 2BVCA 1QZEA 1D5ZC 1KM7A 2BKRB 5FKAC 4AJYB 5JZEB 2JZ3B 5LXIB 2DLBA 3C19A 2BT6A 1TGZB 1WE6A 1ENFA 1FRDA 4LNOA 2QHOA 1GNUA 3N1YC 3RCZA 4LNFA 2VH1A 1K8RB 4GN1A 2R61A 1ET9A 2GBJA 3TEYA 2OJWA 3H8HA 1F1HA 2KVZA 1R7SA 3BYYB 1C4CA 1SIFA 2KWCA 4HKZE 2NPTA 1Z2MA 3QARA 3S2AA 1A70A 4TQ0A 2K25A 3M63B 1L0VB 1TZ1A 2KJRA 1LO5D 4BBNF 1I4QA 2BTEA 4XGAB 3T8MA 5CTRC 1CK1A 2NS5A 1WJ6A 4L23A 4KZCA 2VRRB 1AARA 4W9IA 1JWSD 1XXGA 1VCBA 3VVWB 3AEBB 2LGDA 4RF0A 4HVBA 5IAAC 4PYZA 3P4SB 2LEKA 4XYCA 2RDGA 2CS4A 4RGMA 5IKCM 1OTRB 4HRSA 2WXOA 2LVPA 3ML8A 5CX3A 2DZJA 3V62A 2K8HA 2K9XA 1K51A 2BYTA 1IP9A 1QOBA 4US9A 3TCAA 4B95A 2J4XA 2KK8A 2TSSA 4NNJB 3ZNGC 3JW0X 4L1BA 3FC4A 3LB8C 4TKNA 5DCNA 1PUTA 3EC8A 2AL6A 1YQ4B 3UI3A 3Q14C 1T5XD 4LLGM 2QMTA 2BGFA 2K3UA 1JRUA 5BYSA 3OJ4B 3PZDA 1QLBB 1ZW7A 4YWGG 4HCNB 3NVVA 2KNBA 1WZ3A 2ZVNA 2ICIA 3DVGY 1SE3A 3BVGA 4GSWA 2RDBC 2KX3A 1M4VA 1XF5L 4EZJA 1AW7A 4WAFA 4HPLB 2KDMA 1IGDA 4FHJA 3C0RB 4M0WB 3V05A 1DYQA 3VHTC 4AOFA 2IYDB 4IM0A 1Y56A 1IUEA 1E7UA 2WYQA 4MH8A 1JWBD 5JHAA 4BKSD 1TKYA 2IPKD 2AQ2B 1PGAA 3ZDTA 3GE3C 3TMPB 4OVVA 2FCQA 3SD5A 2DBYA 3IVFA 3T3OA 2PE6B 4WQMA 2DYMA 2NBWB 1T0RC 5IA7A 2O2VA 3ZLZA 3RFZB 1CJEA 2IY1B 3SDLC 1UD7A 2KDBA 3VRAB 2MH7A 2NR2A 4G3XB 4EZLA 3U52E 5IO9A 4C7YA 3VR9B 1J0GA 3UQBA 1WGKA 1FFUA 2BYFA 1EWYC 3ZO5B 1P7EA 5DPRA 5AZGA 3UQAA 4MGIE 1V6EA 4EUTA 2QDFA 2V3SA 2WS3B 4LJOB 4K81A 1OEYA 2CKHB 4XZ4A 1HA5A 5E6PA 2K8CA 4HWIB 2MJ3A 3UGBB 1LFDA 2WDRB 1T3QA 4W9JA 2IBIB 4C4VB 2O6VB 3L4PA 5AEKB 2WLBA 3KWVA 2FUHB 4LTUA 1YN4A 2IGDA 2K1FA 1E9MA 2M19A 2HDEA 2WDTB 4A20A 3ZJVA 3N9YC 2DZMA 4ZRIA 3TEZA 4GIVA 3X0WA 1ZDXA 2NTTA 2RD0A 3AXCA 2V9HA 2J0JA 3IAM1 5C23A 2RSUA 1TS4A 3C8YA 1QQRA 3P1MA 3PRMB 3JSVB 3L13A 4KZ0A 5EDSA 1ZPSA 1JMLA 2FNJB 2E6XA 1I4PA 3TIXA 3PPAA 1C3TA 1V49A 3N1ZC 2WXLA 2NPTB 3NVYA 4HJGE 2MJEA 1MI0A 1JWUD 2C9WB 4P6VF 3P2BA 1UBIA 2MRPA 4HEA1 2N7DA 1J8CA 2KD0A 3PHXB 5MPOA 2EKIA 3QC8B 3VAWA 2REXA 3PLVA 4LDTD 1GB4A 2K8BA 2AQ1B 2W82A 3ZDMC 1R4MI 3I5JC 1YJJA 1WGYA 4K1RB 1RAXA 3VXWA 2KN4A 2B76B 2JZZA 2ZPYA 3AE8B 4L2YA 1FNUA 1WYWB 1C4PA 2MBOA 2WX1A 2LJIA 4DK5A 1C79A 3NZUA 3KWLA 2ZW1A 3EA6A 4DHJD 4EOYA 1WMHA 2M0XA 3J9CA 2LGIA 3AM9A 2RPVA 4IOIE 3E56A 4B0MA 4I6NB 4N58A 2SEBD 4RM9A 2E3TA 1RWSA 1UZXB 3ZW3A 4YTMB 1WY8A 2M17A 5DPSA 5I4DA 2MP2A 1OGWA 1V8CA 2WP9B 1OQYA 3AU4A 5J18A 2W54A 4GOCA 1EF5A 2CHWA 3AEFB 3DBRI 3BYTB 2MW5A 4RGOS 2ZEQA 1HXYD 2AYOB 3DBHI 4JWSC 4JL9A 2LJ5A 2W3RA 3BIID 3Q8BA 1VR9A 2JYTA 3UINB 3V61A 1JQ4A 1IBXA 3ONSA 2INNE 4MGKE 4A55A 1E7PB 4BKTA 3H7PA 2O2VB 3QQ8B 1E6EB 3H6NA 3FILA 1V80A 4YTPB 3VH3B 3IFWB 2IGGA 2D5GA 1YIWA 1DOXA 2DAJA 1H8CA 3Q3NC 1T0QC 1E90A 3VQIA 2LWPA 4G50A 3W1SA 3EHVA 4LNNA 4RNAA 3ZJTA 3IBEA 1AWDA 2GOWA 2JZPA 4PYUA 4TSSA 2N9EB 2CU1A 4RF1A 3EECA 1OQQA 3KYCD 1UGMA 2KLCA 3B1LX 3U2SC 2BF8B 4P1CC 1XLOA 1XCQL 3CWIA 3U7DA 2N9LA 1WR6E 3BY4B 1Q5WB 5LXHA 4XWWA 4HKQA 1ZXHA 3L17A 1R4NI 3NS1A 4HK2A 3RN9C 5G5HA 4AJWA 1T0SC 3PRZA 4K7WA 3M95A 4XX5A 4ICVA 3AN1A 3IXSA 1WM3A 3KVFB 2QSDA 1V5TA 1L0XB 3AE6B 1WI0A 3PREA 1HTOA 3DQVA 3ZXVA 5BMHA 1NI3A 1FNVA 2BQQA 1WJUA 4XE0A 2L0FA 3AE7B 1V5OA 3E9SA 2ZJDA 5TR5A 2Z0EB 3L10B 3Q2AC 1KH0A 3Q8CA 3ZTCA 3RULA 3SR6A 3DWGC 3L08A 1T6BX 1QOGA 1FCCC 5DPWA 4GU2A 4W9CA 1NI2A 2RPQA 5JH5C 1GUAB 3VUWA 3OG5A 3Q3OC 4YTNB 5GXGB 3ZGZA 2AX5A 2WXFA 5C2TB 3ZIMA 3Q6BA 1WM2A 4YXDB 3RNEC 1WX9A 4NAWA 2H88B 4MGYE 4HJKA 2IZVB 1I35A 2C7MB 4WURA 1ROEA 1WX8A 2V0GA 2BS2B 2PVGC 2G3QB 2ZCBA 4XDCA 3PHWB 3R7RA 3DBLI 4IG7B 4B0EA 1SE4A 2DYBA 1F0ZA 1AN8A 2A4ZA 3I3TB 2OEDA 1P0RA 1CQVA 2EKEC 2M4NA 2DNFA 2BS3B 2WDQB 4W9HA 3N32A 1E10A 1PYWD 4FXCA 2NCNA 1WMHB 2KXJA 4ZRPA 4EEWA 3DHIC 4NY0A 2KMMA 5D2MB 1VDVA 4JQWC 3P4RB
chains in the Genus database with same CATH topology
3IVFA 3RD2A 2KJ6A 4X57B 2PE6B 2DYMA 2NBWB 3PRPB 2KDIA 4KDLB 5G2NA 1V81A 5IA7A 2O2VA 2HE7A 3EFUA 4ICUA 3OLMD 3PS6A 4BKSA 5J17A 2MP2B 3ZLZA 3CF6E 4MSMB 3ZNID 3SDLC 2IY1B 3RT3B 2L8JA 1WZ0A 4F1SA 1UD7A 4EZKA 4A3PA 2KDBA 3VH4B 1WGRA 2PEAA 3ZNZB 3W1SC 2EMTA 2LI5A 2NR2A 4BBNC 1NBFC 4G3XB 1SE9A 4GXBA 1P1AA 2N1VA 2WX0A 3M62B 4EZLA 1WXMA 3RZFA 2EMSA 2BYEA 3DVNV 2PPHA 5L95C 4ZRKA 5C1ZA 3B08A 4IM2A 5HKHA 1J0GA 4JLCA 3UQBA 4AUQC 4IW0A 2JUOA 2BYFA 3A4SC 3SD5A 2CHXA 1VD2A 4DHZE 3X23A 1SGHA 2JPHA 3CMMB 4W9EA 2MSED 1WE7A 4ZRJA 3ZO5B 1V2YA 2XK5A 3B0AA 5DPRA 4DDID 5AZGA 3QA8A 2UWQA 3WAOA 2KTFA 3UQAA 1L2NA 4IC7B 1KLVA 1WX7A 4MGIE 2KDEB 1V6EA 4EUTA 4MGZE 5LLIA 3H7PB 2V3SA 4M8NA 4GDLB 3KYDD 1IPGA 2NBVB 2N9PC 2G4SA 4LJOB 3VUXA 3V6EB 1TTNA 2KVRA 2DX5B 2D2QA 1L7YA 4K81A 1OEYA 2CKHB 4K7SA 4XZ4A 4M8MA 3QX1A 1S3SG 4II2B 5E6PA 2KMCA 1G6JA 2K8CA 3JYUA 3LDZE 1FXTB 4HWIB 1OEYJ 1YQBA 3OAWA 4GGQA 2G45B 4DXAB 3UGBB 1LFDA 3NZSA 4ZYNA 5BO4B 4W9JA 2IBIB 2LD9A 3H7SA 4A3OA 2YLMA 2LXCA 2LASA 2O6VB 5AEKB 2JRIB 2WWZA 2LRWA 3A1QA 2FUHB 3GZNI 1M94A 4HPMB 4ZDVA 2HD5B 1WGHA 2K1FA 2WDTB 4A20A 3WANA 2JY6A 2DZMA 4FADA 2K39A 3V60A 3WIMA 5J2RA 4HCPB 4ZRIA 2LXAA 4FA6A 2JXXA 4GIVA 4I6PA 3X0WA 2RD0A 3AXCA 1GC7A 1XD3B 1IYFA 2BPSA 1EF1A 2J0JA 4BFRA 2Y5BB 3JVZX 2IO1B 4WJQA 5C23A 2JF5A 2RSUA 3SHQA 5G55A 4KSLC 2C7NB 3H9DA 2KANA 2DAFA 2CHZA 2IO3B 4B9KA 3PRMB 1P3QU 3JSVB 2KTRA 3HIZA 4FN2A 2KWUB 5AZFA 3L13A 4GB9A 4YL8A 3DOWA 4KZ0A 5EDSA 2LVQA 2FNJB 4LDTB 2N4FA 4ANXA 1PQSA 2Z59B 3T9LA 3ALBA 2ZPNA 2ZVOA 3UF8A 2KLGA 3VFKA 3TIXA 3PPAA 2O6VD 2JRHA 1C3TA 1V49A 2ZNVB 4N9F4 4LJPB 2JVCA 2NPTB 3PGEA 2KC1A 3QCAA 2GBKA 2MBEA 2CR5A 2FCSA 1WXAA 2C9WB 4E71A 4LCDE 2DENB 3P2BA 1UBIA 2MRPA 4IWPA 1S1QB 3ECIA 2N7DA 1KOTA 1J8CA 4ANWA 2L3ZA 4MSQB 3TBLD 3RYTA 4B6WA 2KD0A 3DCGA 3K9PB 4KDIC 3PHXB 1E8XA 3QC8B 5E6OA 1WH3A 3VAWA 3PT2B 5D7GA 4ANUA 4DHJB 4HDQA 2DZKA 2FAZA 2LGXA 2REXA 4MJSA 3Q3JA 4TV3A 3MTNB 3PLVA 2BWES 4LDTD 1C1YB 3SU8X 2BKFA 3U30A 2K8BA 2UYZB 3V6CB 3ZDMC 1WF9A 5CHVC 2D10A 3D32A 4JGHB 4KVGB 1R4MI 3L54A 3AULA 1E8ZA 1U4AA 3DBSA 1WGYA 3JSVA 4K1RB 3A9KA 2L0TA 1RAXA 3VUYA 3A4RA 4F7ZA 1WRDB 2RR9A 3APCA 3VXWA 2MLBA 4WAAA 1RLFA 5CHFA 2V4LA 3QK0A 3ZUNA 2JZZA 2ZPYA 2G4DB 3MHSD 2N1WA 2L05A 4PS8A 2HJ8A 2KFKB 4DWFA 3APDA 4P7IA 1WYWB 4II3B 5AZHA 2MBOA 4WWNA 2WX1A 1ISNA 4HLEA 4DK5A 3KH0A 2MCNB 2C5LC 1WXVA 4NPNA 3A9JB 3NZUA 1H4RA 4DHJD 2MX2A 1YX6B 4EOYA 4BVUC 1WMHA 2MA9B 1MG8A 2M0XA 1WGDA 1RRBA 2A5UA 2KMAA 3RZWC 3NY5A 2FCNA 4I6NB 4KIKB 3LJ3A 1XQQA 4NAWB 4BOSC 4RM9A 4WWPA 1E5WA 2YVCA 2Z0DB 3WALA 3K9OB 1UZXB 3ZW3A 4IUMB 3KW5B 1WY8A 1WR1A 2M17A 5DPSA 3ZRCA 3U8ZA 1BT0A 2R2OA 3ML9A 3O65B 2JWZA 4CHKA 2MP2A 1OGWA 4KV2A 2KDFB 4FJZA 1OQYA 1V9JA 3AU4A 3CSTA 3QIJA 4MEMA 4GDKB 3L16A 2HTHA 5CHWA 1NDDA 1YD8U 5J18A 5GMVA 3APFA 4GOCA 4HDOA 3VDZA 2LZ6A 3ZRFA 5JHBA 4FBJB 2KQ7A 2IO0B 3QJZA 4FULA 4CO7A 4MDKE 1EF5A 2CHWA 2L00B 2M1MA 4NJ6A 3VTUA 3DBRI 4W9FA 4WQOB 2MW5A 2FCMA 5KHOA 2D3GA 2KN5A 3R7QA 2ZEQA 3DBHI 2AYOB 3NHEB 4AP4C 3KUZA 4F8CB 4JL9A 2LJ5A 3UINB 3AU5A 2J7QB 3V61A 3GOEA 2ZZPB 3ONSA 4MGKE 4BKTA 2C7HA 3WAPA 3H7PA 3ZTDA 1LM8B 4HXDA 4CYEA 2O2VB 2OOBB 3QQ8B 4IWQA 4GDLA 3HM6X 4NQKE 3IHPC 4JIOU 2N7EA 3H6NA 4E3CA 1V80A 3KUCB 1LQBA 2GMIC 2KC2A 4EKUA 2L7RA 4I6LB 3VH3B 1WJ4A 2AEHA 3IFWB 4AWJA 1YIWA 1XT9B 3QWZB 2D11A 3PSEB 2DAJA 4K7UA 2R2QA 3ZNHB 1H8CA 2KJHB 2MBBB 4EFOA 3KUDB 4G0NB 1Y8RC 1HE8A 1E90A 4E74A 1F9JA 1WGGA 2O6VA 2KX0A 3A33B 4FLHA 3VQIA 3QAQA 3PV1A 2GBNA 3NOBA 1EO6A 1A5RA 2LWPA 2OJRA 4G50A 4URKA 3W1SA 1QZEA 4TQ1A 2GBRA 1KM7A 2BKRB 1YX5B 3EHVA 5DPTA 4AJYB 3ZVVA 4W9DA 5JZEB 2JZ3B 3VTWA 1ZGUB 5L83A 2LRUA 2MWSB 1WIAA 3IBEA 2GOWA 2DZIA 2XK5B 2KFJA 5LXIB 5D6JB 4XC2A 3DVGX 1TGZB 1WE6A 4PYUA 4WJOA 2N9EB 3HK0A 3NS8A 2CU1A 2D07B 2J0KA 2QHOA 2KQSA 1GNUA 4KSKC 1V86A 3EECA 3KYCD 3RCZA 2J0MA 3M3JA 1UGMA 4GN1A 1K8RB 2KLCA 3B1LX 2M8SA 4ASWC 2KKCA 2LUEA 2BF8B 2GBJA 2MBHA 1UBQA 4BOZB 4DHZB 3U7DA 2XEWA 1WR6E 1UH6A 3BY4B 2NBUA 1Z5SB 1Q5WB 4FJYA 5LXHA 1SIFA 2KWCA 3L17A 1R4NI 3W1YA 4NQLB 2NPTA 1CMXB 1Z2MA 3QARA 3S2AA 4HK2A 1KJTA 4TQ0A 4W9LA 2K25A 3ZKJC 3H1UA 3M63B 2KHWB 3A1QB 3MJWA 4MH0E 4AJWA 4DDGD 4GMVA 4ANVA 3PRZA 4K7WA 2K6QA 4WJPA 1TZ1A 2ASQA 2KJRA 3M95A 2W9NA 3OJ3A 4PS7A 1WXSA 4BBNF 3DDCB 4XX5A 4ICVA 4FHKA 3T8MA 1T0YA 1WM3A 3KVFB 2DHZA 5CTRC 1V5TA 2IY0B 2NS5A 1WJ6A 1WI0A 3PREA 4KZCA 4PS3A 2VRRB 3DQVA 1UELA 5KHQA 2ZCCA 1X1MA 1WJNA 1AARA 3WA0A 4DBGA 3DPDA 4W9IA 2BWFA 1VCBA 1WJUA 3VVWB 4RM8A 2L0FA 3BINA 1V5OA 2KTRB 2C60A 2LGDA 3TJPA 4HVBA 5D94A 2ZJDA 5TR5A 2Z0EB 2I1KA 3R66C 3L10B 5IAAC 3AI5A 2FIDA 4PYZA 4MM3A 2NVUI 3ZTCA 2ZNVC 3VTVA 1EUVB 2RGFA 4FJVB 4W9GA 3UIOB 4TUUA 3RULA 3IG3A 2CS4A 3PVLA 3RUIB 3WAMA 3L08A 2IO2B 1OTRB 2MQJA 3R3MA 5DPWA 2LVPA 4GU2A 3ML8A 4W9CA 1NI2A 4NJ7A 5CX3A 2RPQA 1Q0WB 5JH5C 1GUAB 2DZJA 2KFKA 3CSFA 4WWOA 4WJNA 3VUWA 2DYOA 3V62A 1I42A 2K8HA 2JT4B 3PLUA 3QHTA 1IP9A 2KO3A 1E8WA 1WFYA 2FIFA 3PTFC 3A9JA 3TCAA 1D3ZA 2PJHA 4W9KA 4B95A 4NNJB 2KK8A 1RFAA 3N30A 3ZNGC 2BYVE 3JW0X 1GC6A 2K6DB 3HHMA 1LXDA 4TKNA 3ZIMA 4MJSB 3L0WB 5DCNA 1WM2A 4G11A 3EC8A 2AL6A 4KIKA 2LVOA 1WX9A 4NAWA 3Q3FA 4MGYE 4BKGA 4HJKA 2IZVB 1I35A 2BGFA 4RMAA 1JRUA 2C7MB 4J6IA 2KOXA 3OJ4B 1E8YA 3PZDA 1WX8A 1ZW7A 2PE9A 1GG3A 3DVNU 2KWVB 2LGYA 2G3QB 2ZCBA 4HCNB 3A9KB 2KNBA 1WZ3A 1ZKHA 2ZVNA 4IM3A 3DVGY 3PHWB 4GSWA 3UIPB 2KX3A 3R7RA 3DBLI 4GDKA 4IG7B 4EZJA 2XBBC 4HPLB 4FHJA 4IWOA 2DYBA 3C0RB 4M0WB 3VHTC 2GBMA 2V1YA 2A4ZA 4AOFA 3I3TB 2IYDB 1J19A 1P0RA 4IM0A 2EKEC 2M4NA 3N3KB 1TBEA 1Q1OA 2I1JA 3TL5A 1P9DU 4W9HA 1E7UA 2WYQA 3N32A 3HM3A 4MELA 2NCNA 1WMHB 2KXJA 2L76A 4EEWA 5JHAA 2KZRA 4BKSD 1YJ1A 5E6NA 4NY0A 4OVUA 5FR6A 2AL3A 2AWTA 5D2MB 3ZDTA 1E7VA 2B3AA 2N9XA 1P98A 2MBQA 4JQWC 3ENEA 4OVVA 2FCQA 3TMPB 1GJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVF A;  3RD2 A;  2KJ6 A;  4X57 B;  2PE6 B;  2DYM A;  2NBW B;  3PRP B;  2KDI A;  4KDL B;  5G2N A;  1V81 A;  5IA7 A;  2O2V A;  2HE7 A;  3EFU A;  4ICU A;  3OLM D;  3PS6 A;  4BKS A;  5J17 A;  2MP2 B;  3ZLZ A;  3CF6 E;  4MSM B;  3ZNI D;  3SDL C;  2IY1 B;  3RT3 B;  2L8J A;  1WZ0 A;  4F1S A;  1UD7 A;  4EZK A;  4A3P A;  2KDB A;  3VH4 B;  1WGR A;  2PEA A;  3ZNZ B;  3W1S C;  2EMT A;  2LI5 A;  2NR2 A;  4BBN C;  1NBF C;  4G3X B;  1SE9 A;  4GXB A;  1P1A A;  2N1V A;  2WX0 A;  3M62 B;  4EZL A;  1WXM A;  3RZF A;  2EMS A;  2BYE A;  3DVN V;  2PPH A;  5L95 C;  4ZRK A;  5C1Z A;  3B08 A;  4IM2 A;  5HKH A;  1J0G A;  4JLC A;  3UQB A;  4AUQ C;  4IW0 A;  2JUO A;  2BYF A;  3A4S C;  3SD5 A;  2CHX A;  1VD2 A;  4DHZ E;  3X23 A;  1SGH A;  2JPH A;  3CMM B;  4W9E A;  2MSE D;  1WE7 A;  4ZRJ A;  3ZO5 B;  1V2Y A;  2XK5 A;  3B0A A;  5DPR A;  4DDI D;  5AZG A;  3QA8 A;  2UWQ A;  3WAO A;  2KTF A;  3UQA A;  1L2N A;  4IC7 B;  1KLV A;  1WX7 A;  4MGI E;  2KDE B;  1V6E A;  4EUT A;  4MGZ E;  5LLI A;  3H7P B;  2V3S A;  4M8N A;  4GDL B;  3KYD D;  1IPG A;  2NBV B;  2N9P C;  2G4S A;  4LJO B;  3VUX A;  3V6E B;  1TTN A;  2KVR A;  2DX5 B;  2D2Q A;  1L7Y A;  4K81 A;  1OEY A;  2CKH B;  4K7S A;  4XZ4 A;  4M8M A;  3QX1 A;  1S3S G;  4II2 B;  5E6P A;  2KMC A;  1G6J A;  2K8C A;  3JYU A;  3LDZ E;  1FXT B;  4HWI B;  1OEY J;  1YQB A;  3OAW A;  4GGQ A;  2G45 B;  4DXA B;  3UGB B;  1LFD A;  3NZS A;  4ZYN A;  5BO4 B;  4W9J A;  2IBI B;  2LD9 A;  3H7S A;  4A3O A;  2YLM A;  2LXC A;  2LAS A;  2O6V B;  5AEK B;  2JRI B;  2WWZ A;  2LRW A;  3A1Q A;  2FUH B;  3GZN I;  1M94 A;  4HPM B;  4ZDV A;  2HD5 B;  1WGH A;  2K1F A;  2WDT B;  4A20 A;  3WAN A;  2JY6 A;  2DZM A;  4FAD A;  2K39 A;  3V60 A;  3WIM A;  5J2R A;  4HCP B;  4ZRI A;  2LXA A;  4FA6 A;  2JXX A;  4GIV A;  4I6P A;  3X0W A;  2RD0 A;  3AXC A;  1GC7 A;  1XD3 B;  1IYF A;  2BPS A;  1EF1 A;  2J0J A;  4BFR A;  2Y5B B;  3JVZ X;  2IO1 B;  4WJQ A;  5C23 A;  2JF5 A;  2RSU A;  3SHQ A;  5G55 A;  4KSL C;  2C7N B;  3H9D A;  2KAN A;  2DAF A;  2CHZ A;  2IO3 B;  4B9K A;  3PRM B;  1P3Q U;  3JSV B;  2KTR A;  3HIZ A;  4FN2 A;  2KWU B;  5AZF A;  3L13 A;  4GB9 A;  4YL8 A;  3DOW A;  4KZ0 A;  5EDS A;  2LVQ A;  2FNJ B;  4LDT B;  2N4F A;  4ANX A;  1PQS A;  2Z59 B;  3T9L A;  3ALB A;  2ZPN A;  2ZVO A;  3UF8 A;  2KLG A;  3VFK A;  3TIX A;  3PPA A;  2O6V D;  2JRH A;  1C3T A;  1V49 A;  2ZNV B;  4N9F 4;  4LJP B;  2JVC A;  2NPT B;  3PGE A;  2KC1 A;  3QCA A;  2GBK A;  2MBE A;  2CR5 A;  2FCS A;  1WXA A;  2C9W B;  4E71 A;  4LCD E;  2DEN B;  3P2B A;  1UBI A;  2MRP A;  4IWP A;  1S1Q B;  3ECI A;  2N7D A;  1KOT A;  1J8C A;  4ANW A;  2L3Z A;  4MSQ B;  3TBL D;  3RYT A;  4B6W A;  2KD0 A;  3DCG A;  3K9P B;  4KDI C;  3PHX B;  1E8X A;  3QC8 B;  5E6O A;  1WH3 A;  3VAW A;  3PT2 B;  5D7G A;  4ANU A;  4DHJ B;  4HDQ A;  2DZK A;  2FAZ A;  2LGX A;  2REX A;  4MJS A;  3Q3J A;  4TV3 A;  3MTN B;  3PLV A;  2BWE S;  4LDT D;  1C1Y B;  3SU8 X;  2BKF A;  3U30 A;  2K8B A;  2UYZ B;  3V6C B;  3ZDM C;  1WF9 A;  5CHV C;  2D10 A;  3D32 A;  4JGH B;  4KVG B;  1R4M I;  3L54 A;  3AUL A;  1E8Z A;  1U4A A;  3DBS A;  1WGY A;  3JSV A;  4K1R B;  3A9K A;  2L0T A;  1RAX A;  3VUY A;  3A4R A;  4F7Z A;  1WRD B;  2RR9 A;  3APC A;  3VXW A;  2MLB A;  4WAA A;  1RLF A;  5CHF A;  2V4L A;  3QK0 A;  3ZUN A;  2JZZ A;  2ZPY A;  2G4D B;  3MHS D;  2N1W A;  2L05 A;  4PS8 A;  2HJ8 A;  2KFK B;  4DWF A;  3APD A;  4P7I A;  1WYW B;  4II3 B;  5AZH A;  2MBO A;  4WWN A;  2WX1 A;  1ISN A;  4HLE A;  4DK5 A;  3KH0 A;  2MCN B;  2C5L C;  1WXV A;  4NPN A;  3A9J B;  3NZU A;  1H4R A;  4DHJ D;  2MX2 A;  1YX6 B;  4EOY A;  4BVU C;  1WMH A;  2MA9 B;  1MG8 A;  2M0X A;  1WGD A;  1RRB A;  2A5U A;  2KMA A;  3RZW C;  3NY5 A;  2FCN A;  4I6N B;  4KIK B;  3LJ3 A;  1XQQ A;  4NAW B;  4BOS C;  4RM9 A;  4WWP A;  1E5W A;  2YVC A;  2Z0D B;  3WAL A;  3K9O B;  1UZX B;  3ZW3 A;  4IUM B;  3KW5 B;  1WY8 A;  1WR1 A;  2M17 A;  5DPS A;  3ZRC A;  3U8Z A;  1BT0 A;  2R2O A;  3ML9 A;  3O65 B;  2JWZ A;  4CHK A;  2MP2 A;  1OGW A;  4KV2 A;  2KDF B;  4FJZ A;  1OQY A;  1V9J A;  3AU4 A;  3CST A;  3QIJ A;  4MEM A;  4GDK B;  3L16 A;  2HTH A;  5CHW A;  1NDD A;  1YD8 U;  5J18 A;  5GMV A;  3APF A;  4GOC A;  4HDO A;  3VDZ A;  2LZ6 A;  3ZRF A;  5JHB A;  4FBJ B;  2KQ7 A;  2IO0 B;  3QJZ A;  4FUL A;  4CO7 A;  4MDK E;  1EF5 A;  2CHW A;  2L00 B;  2M1M A;  4NJ6 A;  3VTU A;  3DBR I;  4W9F A;  4WQO B;  2MW5 A;  2FCM A;  5KHO A;  2D3G A;  2KN5 A;  3R7Q A;  2ZEQ A;  3DBH I;  2AYO B;  3NHE B;  4AP4 C;  3KUZ A;  4F8C B;  4JL9 A;  2LJ5 A;  3UIN B;  3AU5 A;  2J7Q B;  3V61 A;  3GOE A;  2ZZP B;  3ONS A;  4MGK E;  4BKT A;  2C7H A;  3WAP A;  3H7P A;  3ZTD A;  1LM8 B;  4HXD A;  4CYE A;  2O2V B;  2OOB B;  3QQ8 B;  4IWQ A;  4GDL A;  3HM6 X;  4NQK E;  3IHP C;  4JIO U;  2N7E A;  3H6N A;  4E3C A;  1V80 A;  3KUC B;  1LQB A;  2GMI C;  2KC2 A;  4EKU A;  2L7R A;  4I6L B;  3VH3 B;  1WJ4 A;  2AEH A;  3IFW B;  4AWJ A;  1YIW A;  1XT9 B;  3QWZ B;  2D11 A;  3PSE B;  2DAJ A;  4K7U A;  2R2Q A;  3ZNH B;  1H8C A;  2KJH B;  2MBB B;  4EFO A;  3KUD B;  4G0N B;  1Y8R C;  1HE8 A;  1E90 A;  4E74 A;  1F9J A;  1WGG A;  2O6V A;  2KX0 A;  3A33 B;  4FLH A;  3VQI A;  3QAQ A;  3PV1 A;  2GBN A;  3NOB A;  1EO6 A;  1A5R A;  2LWP A;  2OJR A;  4G50 A;  4URK A;  3W1S A;  1QZE A;  4TQ1 A;  2GBR A;  1KM7 A;  2BKR B;  1YX5 B;  3EHV A;  5DPT A;  4AJY B;  3ZVV A;  4W9D A;  5JZE B;  2JZ3 B;  3VTW A;  1ZGU B;  5L83 A;  2LRU A;  2MWS B;  1WIA A;  3IBE A;  2GOW A;  2DZI A;  2XK5 B;  2KFJ A;  5LXI B;  5D6J B;  4XC2 A;  3DVG X;  1TGZ B;  1WE6 A;  4PYU A;  4WJO A;  2N9E B;  3HK0 A;  3NS8 A;  2CU1 A;  2D07 B;  2J0K A;  2QHO A;  2KQS A;  1GNU A;  4KSK C;  1V86 A;  3EEC A;  3KYC D;  3RCZ A;  2J0M A;  3M3J A;  1UGM A;  4GN1 A;  1K8R B;  2KLC A;  3B1L X;  2M8S A;  4ASW C;  2KKC A;  2LUE A;  2BF8 B;  2GBJ A;  2MBH A;  1UBQ A;  4BOZ B;  4DHZ B;  3U7D A;  2XEW A;  1WR6 E;  1UH6 A;  3BY4 B;  2NBU A;  1Z5S B;  1Q5W B;  4FJY A;  5LXH A;  1SIF A;  2KWC A;  3L17 A;  1R4N I;  3W1Y A;  4NQL B;  2NPT A;  1CMX B;  1Z2M A;  3QAR A;  3S2A A;  4HK2 A;  1KJT A;  4TQ0 A;  4W9L A;  2K25 A;  3ZKJ C;  3H1U A;  3M63 B;  2KHW B;  3A1Q B;  3MJW A;  4MH0 E;  4AJW A;  4DDG D;  4GMV A;  4ANV A;  3PRZ A;  4K7W A;  2K6Q A;  4WJP A;  1TZ1 A;  2ASQ A;  2KJR A;  3M95 A;  2W9N A;  3OJ3 A;  4PS7 A;  1WXS A;  4BBN F;  3DDC B;  4XX5 A;  4ICV A;  4FHK A;  3T8M A;  1T0Y A;  1WM3 A;  3KVF B;  2DHZ A;  5CTR C;  1V5T A;  2IY0 B;  2NS5 A;  1WJ6 A;  1WI0 A;  3PRE A;  4KZC A;  4PS3 A;  2VRR B;  3DQV A;  1UEL A;  5KHQ A;  2ZCC A;  1X1M A;  1WJN A;  1AAR A;  3WA0 A;  4DBG A;  3DPD A;  4W9I A;  2BWF A;  1VCB A;  1WJU A;  3VVW B;  4RM8 A;  2L0F A;  3BIN A;  1V5O A;  2KTR B;  2C60 A;  2LGD A;  3TJP A;  4HVB A;  5D94 A;  2ZJD A;  5TR5 A;  2Z0E B;  2I1K A;  3R66 C;  3L10 B;  5IAA C;  3AI5 A;  2FID A;  4PYZ A;  4MM3 A;  2NVU I;  3ZTC A;  2ZNV C;  3VTV A;  1EUV B;  2RGF A;  4FJV B;  4W9G A;  3UIO B;  4TUU A;  3RUL A;  3IG3 A;  2CS4 A;  3PVL A;  3RUI B;  3WAM A;  3L08 A;  2IO2 B;  1OTR B;  2MQJ A;  3R3M A;  5DPW A;  2LVP A;  4GU2 A;  3ML8 A;  4W9C A;  1NI2 A;  4NJ7 A;  5CX3 A;  2RPQ A;  1Q0W B;  5JH5 C;  1GUA B;  2DZJ A;  2KFK A;  3CSF A;  4WWO A;  4WJN A;  3VUW A;  2DYO A;  3V62 A;  1I42 A;  2K8H A;  2JT4 B;  3PLU A;  3QHT A;  1IP9 A;  2KO3 A;  1E8W A;  1WFY A;  2FIF A;  3PTF C;  3A9J A;  3TCA A;  1D3Z A;  2PJH A;  4W9K A;  4B95 A;  4NNJ B;  2KK8 A;  1RFA A;  3N30 A;  3ZNG C;  2BYV E;  3JW0 X;  1GC6 A;  2K6D B;  3HHM A;  1LXD A;  4TKN A;  3ZIM A;  4MJS B;  3L0W B;  5DCN A;  1WM2 A;  4G11 A;  3EC8 A;  2AL6 A;  4KIK A;  2LVO A;  1WX9 A;  4NAW A;  3Q3F A;  4MGY E;  4BKG A;  4HJK A;  2IZV B;  1I35 A;  2BGF A;  4RMA A;  1JRU A;  2C7M B;  4J6I A;  2KOX A;  3OJ4 B;  1E8Y A;  3PZD A;  1WX8 A;  1ZW7 A;  2PE9 A;  1GG3 A;  3DVN U;  2KWV B;  2LGY A;  2G3Q B;  2ZCB A;  4HCN B;  3A9K B;  2KNB A;  1WZ3 A;  1ZKH A;  2ZVN A;  4IM3 A;  3DVG Y;  3PHW B;  4GSW A;  3UIP B;  2KX3 A;  3R7R A;  3DBL I;  4GDK A;  4IG7 B;  4EZJ A;  2XBB C;  4HPL B;  4FHJ A;  4IWO A;  2DYB A;  3C0R B;  4M0W B;  3VHT C;  2GBM A;  2V1Y A;  2A4Z A;  4AOF A;  3I3T B;  2IYD B;  1J19 A;  1P0R A;  4IM0 A;  2EKE C;  2M4N A;  3N3K B;  1TBE A;  1Q1O A;  2I1J A;  3TL5 A;  1P9D U;  4W9H A;  1E7U A;  2WYQ A;  3N32 A;  3HM3 A;  4MEL A;  2NCN A;  1WMH B;  2KXJ A;  2L76 A;  4EEW A;  5JHA A;  2KZR A;  4BKS D;  1YJ1 A;  5E6N A;  4NY0 A;  4OVU A;  5FR6 A;  2AL3 A;  2AWT A;  5D2M B;  3ZDT A;  1E7V A;  2B3A A;  2N9X A;  1P98 A;  2MBQ A;  4JQW C;  3ENE A;  4OVV A;  2FCQ A;  3TMP B;  1GJZ A; 
#chains in the Genus database with same CATH topology
 2LUM A;  1KFY B;  2KDI A;  1V97 A;  3EFU A;  3OLM D;  1K52 A;  3PS6 A;  4BKS A;  1C4A A;  2MP2 B;  3CF6 E;  1VZ6 A;  4MSM B;  3ZNI D;  1WZ0 A;  4A3P A;  3WCQ A;  1WGR A;  3ZNZ B;  2LI5 A;  1SE9 A;  3M62 B;  1WXM A;  3RZF A;  5C1Z A;  3B08 A;  3BVZ A;  1N5X A;  2JX5 A;  1L5P A;  4AUQ C;  4IW0 A;  3A4S C;  1VD2 A;  2WU5 B;  3W9C B;  1V1P A;  2BS4 B;  3X23 A;  4HRO A;  4WIP A;  3W5U B;  1ZP0 B;  4ZRJ A;  3B0A A;  2XK5 A;  3WAO A;  4IC7 B;  1IBX B;  3KLS X;  3SFE B;  1EWC A;  2KT7 A;  3H7P B;  4US8 A;  4M8N A;  1OFF A;  1TYG B;  3FIL B;  3V6E B;  2KVR A;  2DX5 B;  2KMC A;  3HVZ A;  3JYU A;  3OAW A;  4GGQ A;  5HHD G;  5BO4 B;  3H7S A;  2WXQ A;  1ESF A;  2WWZ A;  2LRW A;  3ABV B;  1M94 A;  1NEN B;  2HD5 B;  3WAN A;  1PGX A;  2MJD A;  2JWU A;  3V60 A;  3R2T A;  4FAD A;  2RDH A;  2LXA A;  3Q69 A;  4I6P A;  1DOY A;  1C9F A;  2QIE B;  3MP9 A;  4OZA A;  1IYF A;  4WJQ A;  4ZOH C;  2JF5 A;  3MJ5 A;  5G55 A;  2KAN A;  2DAF A;  4IDI A;  2KTR A;  5AZF A;  3DOW A;  1D5M C;  1RM6 C;  2LVQ A;  2WXP A;  1KTK A;  3T9L A;  2ZPN A;  2O6V D;  2JRH A;  2KYW A;  2ZNV B;  1ZOY B;  2WXR A;  3PGE A;  2KC1 A;  2MBE A;  2WQY B;  1KOT A;  4MT5 A;  4K3B A;  2L3Z A;  4ANW A;  3RPF C;  3K9P B;  3Q8A A;  3TEX A;  3AH7 A;  4RGT A;  1HZ5 A;  3SEB A;  1L4Z B;  3PT2 B;  1CZP A;  2DZK A;  2FAZ A;  4MJS A;  3Q3J A;  1KLU D;  4TMA B;  4YSX B;  2WXK A;  2L83 A;  1JWA D;  1HTQ A;  4KGT A;  1E0Z A;  4JWU C;  3V6C B;  1UWM A;  2M0A A;  3L54 A;  1E8Z A;  3DHH C;  2JU6 X;  2L0T A;  3VUY A;  4F7Z A;  4YSZ B;  2MLB A;  4WAA A;  2V4L A;  3ZUN A;  3DBH B;  3RNG C;  4M02 A;  3MHS D;  4S17 A;  2N1W A;  4PS8 A;  3W2D A;  4M01 A;  1YN5 A;  3GS2 A;  4II3 B;  5AZH A;  4WWN A;  1ISN A;  5JXV A;  1D4B A;  1WXV A;  4NPN A;  1H4R A;  4OVZ A;  4BVU C;  2WNM A;  1L6U A;  1RRB A;  3NY5 A;  2FCN A;  4NAW B;  4BOS C;  2YVC A;  3VRB B;  4RCO A;  3U8Z A;  3ML9 A;  1F2R C;  4FJZ A;  3BVM A;  3FAH A;  1V9J A;  1TKE A;  2PLP A;  3N1X C;  3L16 A;  2HTH A;  5CHW A;  5GMV A;  3APF A;  4HDO A;  2LZ6 A;  1SB3 C;  5JHB A;  4A8X C;  4FBJ B;  2L52 A;  4FUL A;  4CO7 A;  4CQN A;  4DXG A;  2L00 B;  2M1M A;  1SE2 A;  1MHX A;  3P42 A;  5KHO A;  2UU7 A;  4S0R A;  2BB5 A;  3R7Q A;  4NZL B;  4AP4 C;  3KUZ A;  4JPS A;  2LHD A;  1XLN A;  2J7Q B;  4P16 A;  2ZZP B;  3N20 C;  2V3N A;  1LGR A;  3ZTD A;  2OOB B;  1R4N B;  4GDL A;  1V1O A;  3IHP C;  3AEG B;  1LQB A;  2HTM E;  2GMI C;  2L7R A;  4I6L B;  2AEH A;  4AWJ A;  2NTS A;  1XT9 B;  2W3S A;  1FPY A;  1PDX A;  2KJH B;  4EFO A;  1TY0 A;  3KUD B;  4USA A;  4C7Z A;  3AV8 A;  3A33 B;  4FLH A;  4KGS A;  4IKG A;  4URK A;  2GBR A;  5DPT A;  1YX5 B;  4W9D A;  1V1P B;  1HEZ E;  3VTW A;  5EE1 A;  2DZI A;  2K22 A;  2XK5 B;  2KFJ A;  1K53 A;  5D6J B;  3HK0 A;  3NS8 A;  2J0K A;  4KSK C;  4D2K A;  2YEP B;  2XN9 C;  2M8S A;  4ASW C;  2VH2 A;  2KKC A;  2LUE A;  2MBH A;  1QOA A;  5HI1 A;  2XEW A;  1UH6 A;  2NBU A;  1Z5S B;  1SXT A;  4NQL B;  4ZHO A;  1HQR D;  2Y5P A;  4P1B C;  2KAC A;  3H1U A;  2KHW B;  4DDG D;  1I4H A;  2K6Q A;  4WJP A;  2WXI A;  3EUB 2;  2W9N A;  4HPP A;  1JRP A;  1FO4 A;  1WRI A;  3B9J A;  1FD6 A;  4PS3 A;  1UEL A;  3DWM A;  1TS3 A;  3BK2 A;  2N9K A;  4DBG A;  3RI7 C;  1BXT A;  1NYQ A;  4NAM A;  3BIN A;  3RNA C;  3MFG A;  2KTR B;  2C60 A;  3DBL B;  5D94 A;  1YJI A;  2I1K A;  3R66 C;  5AUI A;  2FID A;  4MM3 A;  4KGR A;  2ZNV C;  3VTV A;  2RGF A;  2WXM A;  4JE3 B;  1N6Z A;  3IG3 A;  4OHJ A;  5BMG A;  1RFK A;  2KQ4 X;  1TY2 A;  3RUI B;  3WAM A;  4A9A A;  4NJ7 A;  2KFK A;  3CSF A;  4WWO A;  2N0S B;  5HG2 A;  5BMI A;  1SEB D;  2DYO A;  3DHG C;  1I42 A;  3QHT A;  1FRR A;  1WFY A;  2FIF A;  4KKI A;  4BZA A;  3A9J A;  1D3Z A;  2PJH A;  3RNF C;  1RFA A;  2VZK D;  3PZ7 A;  1GAQ B;  2PMV A;  3HHM A;  1JW9 D;  1B1Z A;  2ACZ B;  2ONQ A;  4MJS B;  3L0W B;  3PZ8 A;  2LVO A;  4BKG A;  1FEH A;  4C56 C;  4RMA A;  4J6I A;  1E8Y A;  3DVN U;  2PE9 A;  2LGY A;  2CJN A;  5T8I A;  2LFI A;  1ZKH A;  4IM3 A;  4ZHP A;  2KWD A;  1EM7 A;  2SAK A;  4IWO A;  4AQ7 A;  5EE0 A;  2V1Y A;  4LNK A;  1TBE A;  1Q1O A;  2I1J A;  3TL5 A;  1Q10 A;  1ZE3 D;  1GB1 A;  5E6N A;  1MFW A;  4OVU A;  2AL3 A;  2AWT A;  1E7V A;  2N9X A;  5H92 C;  3R8B A;  3MHZ A;  2MBQ A;  3ENE A;  1GJZ A;  2GB1 A;  1SJH D;  2KJ6 A;  3PRP B;  2HE7 A;  4ICU A;  1QT9 A;  3VH4 B;  2IGH A;  5EE3 A;  3ETR A;  2Z8L A;  1NBF C;  2GLS A;  1P1A A;  2EMS A;  2BYE A;  4Q2J A;  3TUO A;  3SFD B;  5HKH A;  5HFY A;  4JLC A;  3Q3M C;  2JUO A;  2IJ0 A;  4DHZ E;  1SGH A;  2J52 A;  4W9E A;  2MSE D;  1WSP A;  1WE7 A;  1V2Y A;  3AEC B;  4DDI D;  3QA8 A;  1N61 A;  2KTF A;  1L2N A;  1KLV A;  1WX7 A;  3AE5 B;  4ITK A;  4MGZ E;  5LLI A;  4OZB A;  4GDL B;  2NBV B;  2N9P C;  2G4S A;  3OWE B;  2D2Q A;  1YQ3 B;  4K7S A;  4II2 B;  1S3S G;  3NG0 A;  3VR8 B;  3LDZ E;  1FXT B;  3Q8F A;  1OEY J;  1YQB A;  2G45 B;  3NZS A;  4ZYN A;  4A3O A;  2YLM A;  2LXC A;  2W55 A;  3A1Q A;  3GZN I;  4HPM B;  5H8Y E;  2Y5C A;  3HUI A;  5AUK A;  2JY6 A;  2WU2 B;  3WIM A;  1QIL A;  5J2R A;  3AEE B;  2WXJ A;  2D3C A;  4PK1 A;  1GC7 A;  1XD3 B;  2BPS A;  4BFR A;  2L1A A;  2IO1 B;  3SHQ A;  4KSL C;  2C7N B;  2QEJ C;  3H9D A;  1P3Q U;  1FIQ A;  2IND C;  2N4F A;  3NVW A;  1PQS A;  3ALB A;  2ZVO A;  3UF8 A;  3VFK A;  4LJP B;  2JVC A;  5LNK 1;  3HRD D;  3QCA A;  2FCS A;  2MHJ A;  1UUP A;  1WXA A;  4LCD E;  2DEN B;  1S1Q B;  1YNT E;  3GE8 C;  3URY A;  2WXN A;  4MSQ B;  4B6W A;  3TBL D;  2QJL A;  3DCG A;  4KDI C;  1E8X A;  3AB5 A;  1WH3 A;  1PFD A;  4ANU A;  3ZYY X;  3IT6 B;  1YOV B;  2PVO D;  4TV3 A;  2PIA A;  3MTN B;  2BWE S;  3U30 A;  4MM3 B;  4JGH B;  4KVG B;  1FXA A;  3AUL A;  1UGJ A;  3KQ4 A;  3DBS A;  3JSV A;  1J7A A;  3A9K A;  2FUG 1;  3A4R A;  1WRD B;  2RR9 A;  3APC A;  3QK0 A;  3IAS 1;  2KFK B;  4DWF A;  2QC8 A;  2MCN B;  2D3A A;  2ON8 A;  5C3J B;  3A9J B;  5BYQ A;  3AE9 B;  1YX6 B;  1DOI A;  2MA9 B;  2J42 A;  1WGD A;  5G5G A;  2KMA A;  2IDY A;  3LJ3 A;  5EE9 A;  1ET6 A;  3GB1 A;  1C76 A;  3WAL A;  3K9O B;  1J7B A;  3KW5 B;  4PT5 A;  2R2O A;  1WYG A;  3O65 B;  2JWZ A;  4KV2 A;  1SSN A;  2CU3 A;  4DQO C;  3AE1 B;  3QIJ A;  2GRI A;  4XWT A;  1TS2 A;  1YD8 U;  5FK9 C;  3VDZ A;  3ZRF A;  2KQ7 A;  3MC0 B;  1GOZ A;  3VTU A;  2WHI A;  1I4G A;  2D3G A;  2KN5 A;  4ACF A;  1ACC A;  1MHH E;  3NHE B;  3BZD B;  1R4M B;  4F8C B;  3AU5 A;  2N7J A;  1D6E C;  3EGR A;  2LMC A;  1VLB A;  4RFB A;  5IN7 A;  2D3B A;  1AYF A;  2C7H A;  4CYE A;  3NJT A;  1LM8 B;  4HXD A;  3HM6 X;  4JIO U;  1SF0 A;  3KUC B;  1BUI C;  2KC2 A;  4EKU A;  2I2Y A;  3B2F A;  3P63 A;  3QWZ B;  3PSE B;  4K7U A;  2R2Q A;  2MBB B;  4AS1 A;  4KX6 B;  1HE8 A;  2JYE A;  2KX0 A;  3QAQ A;  3PV1 A;  2GBN A;  3NOB A;  2OJR A;  1L6V A;  4TQ1 A;  3ZVV A;  3NZ3 A;  4RGN A;  1ZGU B;  5L83 A;  2LRU A;  2MWS B;  1WIA A;  2WXH A;  4XC2 A;  3DVG X;  4WJO A;  2PTL A;  4GLS C;  3P4P B;  2D07 B;  2KQS A;  1V86 A;  1BML C;  1MG4 A;  2J0M A;  3M3J A;  4OW0 A;  3DBR B;  3TSS A;  1VZ8 A;  1UBQ A;  4BOZ B;  4DHZ B;  2NMQ A;  4FJY A;  3FKY A;  4ARI A;  3P4Q B;  3W1Y A;  4BAX A;  1CMX B;  2INP E;  1KJT A;  5J17 A;  3MC8 A;  4W9L A;  3V3X A;  4MH0 E;  3ZKJ C;  2BBC A;  3A1Q B;  3MJW A;  4GMV A;  4ANV A;  1YN3 A;  2ASQ A;  1N62 A;  3OJ3 A;  4PS7 A;  1WXS A;  1OQR A;  3LXF A;  3RNB C;  3DDC B;  3ZQ4 A;  4WWM A;  4FHK A;  5IOI A;  1T0Y A;  3O13 A;  2DHZ A;  1F2R I;  2IY0 B;  1VZ7 A;  4YSY B;  1NYR A;  2INC C;  5KHQ A;  2ZCC A;  1X1M A;  1WJN A;  3WA0 A;  3DPD A;  2BWF A;  4RM8 A;  2DWQ A;  3TJP A;  3I63 C;  2L32 A;  1C78 A;  1TS5 A;  3AI5 A;  1F77 A;  1SIJ A;  2NVU I;  1SBB B;  2WXG A;  4RH6 A;  1L4D B;  1EUV B;  4FJV B;  4W9G A;  3UIO B;  4TUU A;  1RYJ A;  2LGS A;  3PVL A;  2IO2 B;  2MQJ A;  3R3M A;  1ZXI A;  1Q0W B;  2M56 B;  4WJN A;  2JT4 B;  1YMH E;  4ZRQ A;  3PLU A;  2HJ1 A;  3B2G A;  2KO3 A;  1E8W A;  3PTF C;  1QOF A;  1FXI A;  2XNA C;  4W9K A;  5D3D A;  3N30 A;  2BYV E;  2X8X X;  1GC6 A;  1N63 A;  2K6D B;  1LXD A;  4C00 A;  1UNS A;  4G11 A;  2V3P A;  4LNI A;  3I9V 1;  4KIK A;  1QF6 A;  3AE2 B;  1I7H A;  3AMZ A;  3Q3F A;  4ZYS A;  1JWM D;  3R2I A;  2KOX A;  2YEP F;  3RNC C;  1GG3 A;  2KWV B;  1P7F A;  3A9K B;  3HVD A;  3UIP B;  4GDK A;  1F52 A;  2XBB C;  2GBM A;  1J19 A;  3PO0 A;  3N3K B;  2ZW0 A;  1P9D U;  3NVZ A;  3HM3 A;  4MEL A;  2PKO A;  2L76 A;  4A90 A;  2G9H D;  2KZR A;  1YJ1 A;  1MVK A;  3LYY A;  4MAC A;  5FR6 A;  2B3A A;  3AEA B;  4KKJ A;  4O1N A;  1P98 A;  3RD2 A;  4X57 B;  1I4R A;  4KDL B;  5G2N A;  1V81 A;  1XO3 A;  3RT3 B;  3GZN B;  2L8J A;  4F1S A;  4EZK A;  2PEA A;  3W1S C;  2EMT A;  4YT0 B;  3ZJU A;  4BBN C;  1SJE D;  4GXB A;  2BB6 A;  2N1V A;  2WX0 A;  2X38 A;  4NJC A;  1L0Y B;  3W5V B;  1VJK A;  3DVN V;  1FMA D;  1XLP A;  2PPH A;  5L95 C;  4ZRK A;  4JX1 C;  4IM2 A;  1DGJ A;  4N59 A;  2CHX A;  5IP4 D;  1J7C A;  2JPH A;  3BWU D;  3CMM B;  2UWQ A;  2Y3A A;  1I4X A;  2KDE B;  2Q5W D;  5TSS A;  1KF6 B;  2WDV B;  1HZ6 A;  4ARC A;  3KYD D;  1IPG A;  3T3N A;  3VUX A;  1TTN A;  1L7Y A;  1B9R A;  2AQ3 B;  1UF0 A;  4M8M A;  2K5P A;  3QX1 A;  4R3D A;  1XCT L;  1IGC A;  1G6J A;  1MJD A;  1MPE A;  4DXA B;  2LD9 A;  4J3O D;  4REZ A;  2LAS A;  1D5X C;  2JRI B;  2JXT A;  4H2A A;  4ZDV A;  1WGH A;  1FNW A;  4WH4 A;  2K39 A;  2JSV X;  1JAL A;  4HCP B;  4FA6 A;  3IT4 B;  2JXX A;  2QCZ A;  3I57 A;  4M00 A;  2CJO A;  2OHF A;  1FCL A;  1N60 A;  1NVI D;  1EF1 A;  2Y5B B;  3JVZ X;  1TT5 B;  1ZDV A;  2CHZ A;  2EEL A;  2IO3 B;  5E6J A;  4B9K A;  3HIZ A;  4FN2 A;  2KWU B;  3U7Z A;  1KLG D;  4GB9 A;  4YL8 A;  1WWT A;  4LDT B;  4ANX A;  2Z59 B;  2KLG A;  3RMK C;  5FR3 A;  3MC9 A;  2GI9 A;  4N9F 4;  4K3C A;  2GBK A;  1EU4 A;  2CR5 A;  1VRA B;  4E71 A;  3Q8E A;  4IWP A;  3ECI A;  5D3I B;  2FE8 A;  2RMM A;  4DXF A;  3RYT A;  2KAJ A;  3NUH B;  4UDU C;  3AED B;  3EFC A;  5E6O A;  2BW2 A;  5D7G A;  3GP7 A;  4DHJ B;  2K0P A;  4HDQ A;  2LGX A;  3AE3 B;  3SU8 X;  1C1Y B;  2BKF A;  2UYZ B;  1JCK B;  4LK0 M;  1XLQ A;  2V4I B;  1WF9 A;  5CHV C;  2D10 A;  3D32 A;  1K50 A;  5BYR A;  1U4A A;  2G1E A;  1WXQ A;  1RLF A;  5CHF A;  2G4D B;  3BK1 A;  4OZC A;  2L05 A;  2HJ8 A;  3APD A;  4P7I A;  1TZO A;  4M0W A;  4N6E B;  4HLE A;  3KH0 A;  2C5L C;  1JRO A;  1KRH A;  3NRZ A;  1GPX A;  1XEE A;  2MX2 A;  1MG8 A;  2I38 A;  2A5U A;  3RZW C;  2JQR B;  4KIK B;  1XQQ A;  4WWP A;  1E5W A;  2Z0D B;  4IUM B;  1WR1 A;  3ZRC A;  2VZK B;  1BT0 A;  4CHK A;  2FBW B;  1PGB A;  1FM0 D;  2KDF B;  2LHE A;  2MEK A;  3CST A;  4MEM A;  4GDK B;  3U4E G;  1NDD A;  1TJE A;  4C80 A;  2J53 A;  2IO0 B;  3QJZ A;  4A6Q A;  1N5W A;  4MDK E;  4NJ6 A;  4W9F A;  1TIF A;  4WQO B;  2FCM A;  4QAY A;  4EE2 A;  1FFV A;  4XDD A;  1ZUD 2;  3CIR B;  3GOE A;  2H89 B;  1C77 A;  1NEK B;  3WAP A;  4IWQ A;  3TEW A;  4NQK E;  2PW9 A;  2N7E A;  1QKZ A;  4E3C A;  1UWX A;  1WJ4 A;  2QIL A;  2D11 A;  2WGS A;  3ZNH B;  4G0N B;  1Y8R C;  1TKG A;  4C4V A;  4E74 A;  1STE A;  1F9J A;  1EU3 A;  1WGG A;  2O6V A;  3AE4 B;  3ZXR A;  1EO6 A;  1A5R A;  2BVC A;  1QZE A;  1D5Z C;  1KM7 A;  2BKR B;  5FKA C;  4AJY B;  5JZE B;  2JZ3 B;  5LXI B;  2DLB A;  3C19 A;  2BT6 A;  1TGZ B;  1WE6 A;  1ENF A;  1FRD A;  4LNO A;  2QHO A;  1GNU A;  3N1Y C;  3RCZ A;  4LNF A;  2VH1 A;  1K8R B;  4GN1 A;  2R61 A;  1ET9 A;  2GBJ A;  3TEY A;  2OJW A;  3H8H A;  1F1H A;  2KVZ A;  1R7S A;  3BYY B;  1C4C A;  1SIF A;  2KWC A;  4HKZ E;  2NPT A;  1Z2M A;  3QAR A;  3S2A A;  1A70 A;  4TQ0 A;  2K25 A;  3M63 B;  1L0V B;  1TZ1 A;  2KJR A;  1LO5 D;  4BBN F;  1I4Q A;  2BTE A;  4XGA B;  3T8M A;  5CTR C;  1CK1 A;  2NS5 A;  1WJ6 A;  4L23 A;  4KZC A;  2VRR B;  1AAR A;  4W9I A;  1JWS D;  1XXG A;  1VCB A;  3VVW B;  3AEB B;  2LGD A;  4RF0 A;  4HVB A;  5IAA C;  4PYZ A;  3P4S B;  2LEK A;  4XYC A;  2RDG A;  2CS4 A;  4RGM A;  5IKC M;  1OTR B;  4HRS A;  2WXO A;  2LVP A;  3ML8 A;  5CX3 A;  2DZJ A;  3V62 A;  2K8H A;  2K9X A;  1K51 A;  2BYT A;  1IP9 A;  1QOB A;  4US9 A;  3TCA A;  4B95 A;  2J4X A;  2KK8 A;  2TSS A;  4NNJ B;  3ZNG C;  3JW0 X;  4L1B A;  3FC4 A;  3LB8 C;  4TKN A;  5DCN A;  1PUT A;  3EC8 A;  2AL6 A;  1YQ4 B;  3UI3 A;  3Q14 C;  1T5X D;  4LLG M;  2QMT A;  2BGF A;  2K3U A;  1JRU A;  5BYS A;  3OJ4 B;  3PZD A;  1QLB B;  1ZW7 A;  4YWG G;  4HCN B;  3NVV A;  2KNB A;  1WZ3 A;  2ZVN A;  2ICI A;  3DVG Y;  1SE3 A;  3BVG A;  4GSW A;  2RDB C;  2KX3 A;  1M4V A;  1XF5 L;  4EZJ A;  1AW7 A;  4WAF A;  4HPL B;  2KDM A;  1IGD A;  4FHJ A;  3C0R B;  4M0W B;  3V05 A;  1DYQ A;  3VHT C;  4AOF A;  2IYD B;  4IM0 A;  1Y56 A;  1IUE A;  1E7U A;  2WYQ A;  4MH8 A;  1JWB D;  5JHA A;  4BKS D;  1TKY A;  2IPK D;  2AQ2 B;  1PGA A;  3ZDT A;  3GE3 C;  3TMP B;  4OVV A;  2FCQ A;  3SD5 A;  2DBY A;  3IVF A;  3T3O A;  2PE6 B;  4WQM A;  2DYM A;  2NBW B;  1T0R C;  5IA7 A;  2O2V A;  3ZLZ A;  3RFZ B;  1CJE A;  2IY1 B;  3SDL C;  1UD7 A;  2KDB A;  3VRA B;  2MH7 A;  2NR2 A;  4G3X B;  4EZL A;  3U52 E;  5IO9 A;  4C7Y A;  3VR9 B;  1J0G A;  3UQB A;  1WGK A;  1FFU A;  2BYF A;  1EWY C;  3ZO5 B;  1P7E A;  5DPR A;  5AZG A;  3UQA A;  4MGI E;  1V6E A;  4EUT A;  2QDF A;  2V3S A;  2WS3 B;  4LJO B;  4K81 A;  1OEY A;  2CKH B;  4XZ4 A;  1HA5 A;  5E6P A;  2K8C A;  4HWI B;  2MJ3 A;  3UGB B;  1LFD A;  2WDR B;  1T3Q A;  4W9J A;  2IBI B;  4C4V B;  2O6V B;  3L4P A;  5AEK B;  2WLB A;  3KWV A;  2FUH B;  4LTU A;  1YN4 A;  2IGD A;  2K1F A;  1E9M A;  2M19 A;  2HDE A;  2WDT B;  4A20 A;  3ZJV A;  3N9Y C;  2DZM A;  4ZRI A;  3TEZ A;  4GIV A;  3X0W A;  1ZDX A;  2NTT A;  2RD0 A;  3AXC A;  2V9H A;  2J0J A;  3IAM 1;  5C23 A;  2RSU A;  1TS4 A;  3C8Y A;  1QQR A;  3P1M A;  3PRM B;  3JSV B;  3L13 A;  4KZ0 A;  5EDS A;  1ZPS A;  1JML A;  2FNJ B;  2E6X A;  1I4P A;  3TIX A;  3PPA A;  1C3T A;  1V49 A;  3N1Z C;  2WXL A;  2NPT B;  3NVY A;  4HJG E;  2MJE A;  1MI0 A;  1JWU D;  2C9W B;  4P6V F;  3P2B A;  1UBI A;  2MRP A;  4HEA 1;  2N7D A;  1J8C A;  2KD0 A;  3PHX B;  5MPO A;  2EKI A;  3QC8 B;  3VAW A;  2REX A;  3PLV A;  4LDT D;  1GB4 A;  2K8B A;  2AQ1 B;  2W82 A;  3ZDM C;  1R4M I;  3I5J C;  1YJJ A;  1WGY A;  4K1R B;  1RAX A;  3VXW A;  2KN4 A;  2B76 B;  2JZZ A;  2ZPY A;  3AE8 B;  4L2Y A;  1FNU A;  1WYW B;  1C4P A;  2MBO A;  2WX1 A;  2LJI A;  4DK5 A;  1C79 A;  3NZU A;  3KWL A;  2ZW1 A;  3EA6 A;  4DHJ D;  4EOY A;  1WMH A;  2M0X A;  3J9C A;  2LGI A;  3AM9 A;  2RPV A;  4IOI E;  3E56 A;  4B0M A;  4I6N B;  4N58 A;  2SEB D;  4RM9 A;  2E3T A;  1RWS A;  1UZX B;  3ZW3 A;  4YTM B;  1WY8 A;  2M17 A;  5DPS A;  5I4D A;  2MP2 A;  1OGW A;  1V8C A;  2WP9 B;  1OQY A;  3AU4 A;  5J18 A;  2W54 A;  4GOC A;  1EF5 A;  2CHW A;  3AEF B;  3DBR I;  3BYT B;  2MW5 A;  4RGO S;  2ZEQ A;  1HXY D;  2AYO B;  3DBH I;  4JWS C;  4JL9 A;  2LJ5 A;  2W3R A;  3BII D;  3Q8B A;  1VR9 A;  2JYT A;  3UIN B;  3V61 A;  1JQ4 A;  1IBX A;  3ONS A;  2INN E;  4MGK E;  4A55 A;  1E7P B;  4BKT A;  3H7P A;  2O2V B;  3QQ8 B;  1E6E B;  3H6N A;  3FIL A;  1V80 A;  4YTP B;  3VH3 B;  3IFW B;  2IGG A;  2D5G A;  1YIW A;  1DOX A;  2DAJ A;  1H8C A;  3Q3N C;  1T0Q C;  1E90 A;  3VQI A;  2LWP A;  4G50 A;  3W1S A;  3EHV A;  4LNN A;  4RNA A;  3ZJT A;  3IBE A;  1AWD A;  2GOW A;  2JZP A;  4PYU A;  4TSS A;  2N9E B;  2CU1 A;  4RF1 A;  3EEC A;  1OQQ A;  3KYC D;  1UGM A;  2KLC A;  3B1L X;  3U2S C;  2BF8 B;  4P1C C;  1XLO A;  1XCQ L;  3CWI A;  3U7D A;  2N9L A;  1WR6 E;  3BY4 B;  1Q5W B;  5LXH A;  4XWW A;  4HKQ A;  1ZXH A;  3L17 A;  1R4N I;  3NS1 A;  4HK2 A;  3RN9 C;  5G5H A;  4AJW A;  1T0S C;  3PRZ A;  4K7W A;  3M95 A;  4XX5 A;  4ICV A;  3AN1 A;  3IXS A;  1WM3 A;  3KVF B;  2QSD A;  1V5T A;  1L0X B;  3AE6 B;  1WI0 A;  3PRE A;  1HTO A;  3DQV A;  3ZXV A;  5BMH A;  1NI3 A;  1FNV A;  2BQQ A;  1WJU A;  4XE0 A;  2L0F A;  3AE7 B;  1V5O A;  3E9S A;  2ZJD A;  5TR5 A;  2Z0E B;  3L10 B;  3Q2A C;  1KH0 A;  3Q8C A;  3ZTC A;  3RUL A;  3SR6 A;  3DWG C;  3L08 A;  1T6B X;  1QOG A;  1FCC C;  5DPW A;  4GU2 A;  4W9C A;  1NI2 A;  2RPQ A;  5JH5 C;  1GUA B;  3VUW A;  3OG5 A;  3Q3O C;  4YTN B;  5GXG B;  3ZGZ A;  2AX5 A;  2WXF A;  5C2T B;  3ZIM A;  3Q6B A;  1WM2 A;  4YXD B;  3RNE C;  1WX9 A;  4NAW A;  2H88 B;  4MGY E;  4HJK A;  2IZV B;  1I35 A;  2C7M B;  4WUR A;  1ROE A;  1WX8 A;  2V0G A;  2BS2 B;  2PVG C;  2G3Q B;  2ZCB A;  4XDC A;  3PHW B;  3R7R A;  3DBL I;  4IG7 B;  4B0E A;  1SE4 A;  2DYB A;  1F0Z A;  1AN8 A;  2A4Z A;  3I3T B;  2OED A;  1P0R A;  1CQV A;  2EKE C;  2M4N A;  2DNF A;  2BS3 B;  2WDQ B;  4W9H A;  3N32 A;  1E10 A;  1PYW D;  4FXC A;  2NCN A;  1WMH B;  2KXJ A;  4ZRP A;  4EEW A;  3DHI C;  4NY0 A;  2KMM A;  5D2M B;  1VDV A;  4JQW C;  3P4R B; 
#chains in the Genus database with same CATH homology
 3IVF A;  3RD2 A;  2KJ6 A;  4X57 B;  2PE6 B;  2DYM A;  2NBW B;  3PRP B;  2KDI A;  4KDL B;  5G2N A;  1V81 A;  5IA7 A;  2O2V A;  2HE7 A;  3EFU A;  4ICU A;  3OLM D;  3PS6 A;  4BKS A;  5J17 A;  2MP2 B;  3ZLZ A;  3CF6 E;  4MSM B;  3ZNI D;  3SDL C;  2IY1 B;  3RT3 B;  2L8J A;  1WZ0 A;  4F1S A;  1UD7 A;  4EZK A;  4A3P A;  2KDB A;  3VH4 B;  1WGR A;  2PEA A;  3ZNZ B;  3W1S C;  2EMT A;  2LI5 A;  2NR2 A;  4BBN C;  1NBF C;  4G3X B;  1SE9 A;  4GXB A;  1P1A A;  2N1V A;  2WX0 A;  3M62 B;  4EZL A;  1WXM A;  3RZF A;  2EMS A;  2BYE A;  3DVN V;  2PPH A;  5L95 C;  4ZRK A;  5C1Z A;  3B08 A;  4IM2 A;  5HKH A;  1J0G A;  4JLC A;  3UQB A;  4AUQ C;  4IW0 A;  2JUO A;  2BYF A;  3A4S C;  3SD5 A;  2CHX A;  1VD2 A;  4DHZ E;  3X23 A;  1SGH A;  2JPH A;  3CMM B;  4W9E A;  2MSE D;  1WE7 A;  4ZRJ A;  3ZO5 B;  1V2Y A;  2XK5 A;  3B0A A;  5DPR A;  4DDI D;  5AZG A;  3QA8 A;  2UWQ A;  3WAO A;  2KTF A;  3UQA A;  1L2N A;  4IC7 B;  1KLV A;  1WX7 A;  4MGI E;  2KDE B;  1V6E A;  4EUT A;  4MGZ E;  5LLI A;  3H7P B;  2V3S A;  4M8N A;  4GDL B;  3KYD D;  1IPG A;  2NBV B;  2N9P C;  2G4S A;  4LJO B;  3VUX A;  3V6E B;  1TTN A;  2KVR A;  2DX5 B;  2D2Q A;  1L7Y A;  4K81 A;  1OEY A;  2CKH B;  4K7S A;  4XZ4 A;  4M8M A;  3QX1 A;  1S3S G;  4II2 B;  5E6P A;  2KMC A;  1G6J A;  2K8C A;  3JYU A;  3LDZ E;  1FXT B;  4HWI B;  1OEY J;  1YQB A;  3OAW A;  4GGQ A;  2G45 B;  4DXA B;  3UGB B;  1LFD A;  3NZS A;  4ZYN A;  5BO4 B;  4W9J A;  2IBI B;  2LD9 A;  3H7S A;  4A3O A;  2YLM A;  2LXC A;  2LAS A;  2O6V B;  5AEK B;  2JRI B;  2WWZ A;  2LRW A;  3A1Q A;  2FUH B;  3GZN I;  1M94 A;  4HPM B;  4ZDV A;  2HD5 B;  1WGH A;  2K1F A;  2WDT B;  4A20 A;  3WAN A;  2JY6 A;  2DZM A;  4FAD A;  2K39 A;  3V60 A;  3WIM A;  5J2R A;  4HCP B;  4ZRI A;  2LXA A;  4FA6 A;  2JXX A;  4GIV A;  4I6P A;  3X0W A;  2RD0 A;  3AXC A;  1GC7 A;  1XD3 B;  1IYF A;  2BPS A;  1EF1 A;  2J0J A;  4BFR A;  2Y5B B;  3JVZ X;  2IO1 B;  4WJQ A;  5C23 A;  2JF5 A;  2RSU A;  3SHQ A;  5G55 A;  4KSL C;  2C7N B;  3H9D A;  2KAN A;  2DAF A;  2CHZ A;  2IO3 B;  4B9K A;  3PRM B;  1P3Q U;  3JSV B;  2KTR A;  3HIZ A;  4FN2 A;  2KWU B;  5AZF A;  3L13 A;  4GB9 A;  4YL8 A;  3DOW A;  4KZ0 A;  5EDS A;  2LVQ A;  2FNJ B;  4LDT B;  2N4F A;  4ANX A;  1PQS A;  2Z59 B;  3T9L A;  3ALB A;  2ZPN A;  2ZVO A;  3UF8 A;  2KLG A;  3VFK A;  3TIX A;  3PPA A;  2O6V D;  2JRH A;  1C3T A;  1V49 A;  2ZNV B;  4N9F 4;  4LJP B;  2JVC A;  2NPT B;  3PGE A;  2KC1 A;  3QCA A;  2GBK A;  2MBE A;  2CR5 A;  2FCS A;  1WXA A;  2C9W B;  4E71 A;  4LCD E;  2DEN B;  3P2B A;  1UBI A;  2MRP A;  4IWP A;  1S1Q B;  3ECI A;  2N7D A;  1KOT A;  1J8C A;  4ANW A;  2L3Z A;  4MSQ B;  3TBL D;  3RYT A;  4B6W A;  2KD0 A;  3DCG A;  3K9P B;  4KDI C;  3PHX B;  1E8X A;  3QC8 B;  5E6O A;  1WH3 A;  3VAW A;  3PT2 B;  5D7G A;  4ANU A;  4DHJ B;  4HDQ A;  2DZK A;  2FAZ A;  2LGX A;  2REX A;  4MJS A;  3Q3J A;  4TV3 A;  3MTN B;  3PLV A;  2BWE S;  4LDT D;  1C1Y B;  3SU8 X;  2BKF A;  3U30 A;  2K8B A;  2UYZ B;  3V6C B;  3ZDM C;  1WF9 A;  5CHV C;  2D10 A;  3D32 A;  4JGH B;  4KVG B;  1R4M I;  3L54 A;  3AUL A;  1E8Z A;  1U4A A;  3DBS A;  1WGY A;  3JSV A;  4K1R B;  3A9K A;  2L0T A;  1RAX A;  3VUY A;  3A4R A;  4F7Z A;  1WRD B;  2RR9 A;  3APC A;  3VXW A;  2MLB A;  4WAA A;  1RLF A;  5CHF A;  2V4L A;  3QK0 A;  3ZUN A;  2JZZ A;  2ZPY A;  2G4D B;  3MHS D;  2N1W A;  2L05 A;  4PS8 A;  2HJ8 A;  2KFK B;  4DWF A;  3APD A;  4P7I A;  1WYW B;  4II3 B;  5AZH A;  2MBO A;  4WWN A;  2WX1 A;  1ISN A;  4HLE A;  4DK5 A;  3KH0 A;  2MCN B;  2C5L C;  1WXV A;  4NPN A;  3A9J B;  3NZU A;  1H4R A;  4DHJ D;  2MX2 A;  1YX6 B;  4EOY A;  4BVU C;  1WMH A;  2MA9 B;  1MG8 A;  2M0X A;  1WGD A;  1RRB A;  2A5U A;  2KMA A;  3RZW C;  3NY5 A;  2FCN A;  4I6N B;  4KIK B;  3LJ3 A;  1XQQ A;  4NAW B;  4BOS C;  4RM9 A;  4WWP A;  1E5W A;  2YVC A;  2Z0D B;  3WAL A;  3K9O B;  1UZX B;  3ZW3 A;  4IUM B;  3KW5 B;  1WY8 A;  1WR1 A;  2M17 A;  5DPS A;  3ZRC A;  3U8Z A;  1BT0 A;  2R2O A;  3ML9 A;  3O65 B;  2JWZ A;  4CHK A;  2MP2 A;  1OGW A;  4KV2 A;  2KDF B;  4FJZ A;  1OQY A;  1V9J A;  3AU4 A;  3CST A;  3QIJ A;  4MEM A;  4GDK B;  3L16 A;  2HTH A;  5CHW A;  1NDD A;  1YD8 U;  5J18 A;  5GMV A;  3APF A;  4GOC A;  4HDO A;  3VDZ A;  2LZ6 A;  3ZRF A;  5JHB A;  4FBJ B;  2KQ7 A;  2IO0 B;  3QJZ A;  4FUL A;  4CO7 A;  4MDK E;  1EF5 A;  2CHW A;  2L00 B;  2M1M A;  4NJ6 A;  3VTU A;  3DBR I;  4W9F A;  4WQO B;  2MW5 A;  2FCM A;  5KHO A;  2D3G A;  2KN5 A;  3R7Q A;  2ZEQ A;  3DBH I;  2AYO B;  3NHE B;  4AP4 C;  3KUZ A;  4F8C B;  4JL9 A;  2LJ5 A;  3UIN B;  3AU5 A;  2J7Q B;  3V61 A;  3GOE A;  2ZZP B;  3ONS A;  4MGK E;  4BKT A;  2C7H A;  3WAP A;  3H7P A;  3ZTD A;  1LM8 B;  4HXD A;  4CYE A;  2O2V B;  2OOB B;  3QQ8 B;  4IWQ A;  4GDL A;  3HM6 X;  4NQK E;  3IHP C;  4JIO U;  2N7E A;  3H6N A;  4E3C A;  1V80 A;  3KUC B;  1LQB A;  2GMI C;  2KC2 A;  4EKU A;  2L7R A;  4I6L B;  3VH3 B;  1WJ4 A;  2AEH A;  3IFW B;  4AWJ A;  1YIW A;  1XT9 B;  3QWZ B;  2D11 A;  3PSE B;  2DAJ A;  4K7U A;  2R2Q A;  3ZNH B;  1H8C A;  2KJH B;  2MBB B;  4EFO A;  3KUD B;  4G0N B;  1Y8R C;  1HE8 A;  1E90 A;  4E74 A;  1F9J A;  1WGG A;  2O6V A;  2KX0 A;  3A33 B;  4FLH A;  3VQI A;  3QAQ A;  3PV1 A;  2GBN A;  3NOB A;  1EO6 A;  1A5R A;  2LWP A;  2OJR A;  4G50 A;  4URK A;  3W1S A;  1QZE A;  4TQ1 A;  2GBR A;  1KM7 A;  2BKR B;  1YX5 B;  3EHV A;  5DPT A;  4AJY B;  3ZVV A;  4W9D A;  5JZE B;  2JZ3 B;  3VTW A;  1ZGU B;  5L83 A;  2LRU A;  2MWS B;  1WIA A;  3IBE A;  2GOW A;  2DZI A;  2XK5 B;  2KFJ A;  5LXI B;  5D6J B;  4XC2 A;  3DVG X;  1TGZ B;  1WE6 A;  4PYU A;  4WJO A;  2N9E B;  3HK0 A;  3NS8 A;  2CU1 A;  2D07 B;  2J0K A;  2QHO A;  2KQS A;  1GNU A;  4KSK C;  1V86 A;  3EEC A;  3KYC D;  3RCZ A;  2J0M A;  3M3J A;  1UGM A;  4GN1 A;  1K8R B;  2KLC A;  3B1L X;  2M8S A;  4ASW C;  2KKC A;  2LUE A;  2BF8 B;  2GBJ A;  2MBH A;  1UBQ A;  4BOZ B;  4DHZ B;  3U7D A;  2XEW A;  1WR6 E;  1UH6 A;  3BY4 B;  2NBU A;  1Z5S B;  1Q5W B;  4FJY A;  5LXH A;  1SIF A;  2KWC A;  3L17 A;  1R4N I;  3W1Y A;  4NQL B;  2NPT A;  1CMX B;  1Z2M A;  3QAR A;  3S2A A;  4HK2 A;  1KJT A;  4TQ0 A;  4W9L A;  2K25 A;  3ZKJ C;  3H1U A;  3M63 B;  2KHW B;  3A1Q B;  3MJW A;  4MH0 E;  4AJW A;  4DDG D;  4GMV A;  4ANV A;  3PRZ A;  4K7W A;  2K6Q A;  4WJP A;  1TZ1 A;  2ASQ A;  2KJR A;  3M95 A;  2W9N A;  3OJ3 A;  4PS7 A;  1WXS A;  4BBN F;  3DDC B;  4XX5 A;  4ICV A;  4FHK A;  3T8M A;  1T0Y A;  1WM3 A;  3KVF B;  2DHZ A;  5CTR C;  1V5T A;  2IY0 B;  2NS5 A;  1WJ6 A;  1WI0 A;  3PRE A;  4KZC A;  4PS3 A;  2VRR B;  3DQV A;  1UEL A;  5KHQ A;  2ZCC A;  1X1M A;  1WJN A;  1AAR A;  3WA0 A;  4DBG A;  3DPD A;  4W9I A;  2BWF A;  1VCB A;  1WJU A;  3VVW B;  4RM8 A;  2L0F A;  3BIN A;  1V5O A;  2KTR B;  2C60 A;  2LGD A;  3TJP A;  4HVB A;  5D94 A;  2ZJD A;  5TR5 A;  2Z0E B;  2I1K A;  3R66 C;  3L10 B;  5IAA C;  3AI5 A;  2FID A;  4PYZ A;  4MM3 A;  2NVU I;  3ZTC A;  2ZNV C;  3VTV A;  1EUV B;  2RGF A;  4FJV B;  4W9G A;  3UIO B;  4TUU A;  3RUL A;  3IG3 A;  2CS4 A;  3PVL A;  3RUI B;  3WAM A;  3L08 A;  2IO2 B;  1OTR B;  2MQJ A;  3R3M A;  5DPW A;  2LVP A;  4GU2 A;  3ML8 A;  4W9C A;  1NI2 A;  4NJ7 A;  5CX3 A;  2RPQ A;  1Q0W B;  5JH5 C;  1GUA B;  2DZJ A;  2KFK A;  3CSF A;  4WWO A;  4WJN A;  3VUW A;  2DYO A;  3V62 A;  1I42 A;  2K8H A;  2JT4 B;  3PLU A;  3QHT A;  1IP9 A;  2KO3 A;  1E8W A;  1WFY A;  2FIF A;  3PTF C;  3A9J A;  3TCA A;  1D3Z A;  2PJH A;  4W9K A;  4B95 A;  4NNJ B;  2KK8 A;  1RFA A;  3N30 A;  3ZNG C;  2BYV E;  3JW0 X;  1GC6 A;  2K6D B;  3HHM A;  1LXD A;  4TKN A;  3ZIM A;  4MJS B;  3L0W B;  5DCN A;  1WM2 A;  4G11 A;  3EC8 A;  2AL6 A;  4KIK A;  2LVO A;  1WX9 A;  4NAW A;  3Q3F A;  4MGY E;  4BKG A;  4HJK A;  2IZV B;  1I35 A;  2BGF A;  4RMA A;  1JRU A;  2C7M B;  4J6I A;  2KOX A;  3OJ4 B;  1E8Y A;  3PZD A;  1WX8 A;  1ZW7 A;  2PE9 A;  1GG3 A;  3DVN U;  2KWV B;  2LGY A;  2G3Q B;  2ZCB A;  4HCN B;  3A9K B;  2KNB A;  1WZ3 A;  1ZKH A;  2ZVN A;  4IM3 A;  3DVG Y;  3PHW B;  4GSW A;  3UIP B;  2KX3 A;  3R7R A;  3DBL I;  4GDK A;  4IG7 B;  4EZJ A;  2XBB C;  4HPL B;  4FHJ A;  4IWO A;  2DYB A;  3C0R B;  4M0W B;  3VHT C;  2GBM A;  2V1Y A;  2A4Z A;  4AOF A;  3I3T B;  2IYD B;  1J19 A;  1P0R A;  4IM0 A;  2EKE C;  2M4N A;  3N3K B;  1TBE A;  1Q1O A;  2I1J A;  3TL5 A;  1P9D U;  4W9H A;  1E7U A;  2WYQ A;  3N32 A;  3HM3 A;  4MEL A;  2NCN A;  1WMH B;  2KXJ A;  2L76 A;  4EEW A;  5JHA A;  2KZR A;  4BKS D;  1YJ1 A;  5E6N A;  4NY0 A;  4OVU A;  5FR6 A;  2AL3 A;  2AWT A;  5D2M B;  3ZDT A;  1E7V A;  2B3A A;  2N9X A;  1P98 A;  2MBQ A;  4JQW C;  3ENE A;  4OVV A;  2FCQ A;  3TMP B;  1GJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...