2K1FA

Sumo-3 from drosophila melanogaster (dsmt3)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
88
structure length
88
Chain Sequence
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR-derived solution structure of SUMO from Drosophila melanogaster (dSmt3)
doi rcsb
source organism Drosophila melanogaster
molecule tags Unknown function
molecule keywords CG4494-PA
total genus 13
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k1fA00
1TBEA 4I6NB 2LZ6A 1S3SG 1UD7A 1J0GA 2KC2A 3QJZA 1UBIA 2BKFA 4E74A 3QA8A 3ZTDA 1E5WA 3N32A 3ZNHB 3UINB 2FUHB 4ZDVA 1WJNA 1V6EA 4G50A 2LD9A 3IHPC 3V61A 2I1KA 3ZO5B 2ZEQA 1WJ6A 3AI5A 4FULA 4YL8A 4NY0A 1V2YA 5DPTA 1WXMA 4KIKA 1E7UA 1WGYA 5CX3A 3L54A 3LJ3A 3R3MA 3UIPB 1WE7A 2EKEC 2CHWA 2A5UA 2MLBA 2I1JA 2C9WB 3PPAA 1E8XA 3QARA 3VUYA 2C7MB 2M0XA 5LXIB 3ZUNA 2MP2B 2J0JA 2FCSA 2L00B 4MELA 3U8ZA 4KSLC 2LGDA 2WDTB 2ZVOA 4GDLA 4DWFA 1WX7A 2DAFA 4WJNA 5CHWA 4ICUA 2YLMA 3ZNID 2MW5A 4WWNA 3DCGA 3SD5A 3UF8A 1P1AA 2L7RA 3ECIA 5C23A 4BKSD 4CHKA 1F9JA 3CMMB 3QCAA 3GZNI 2KN5A 2N9EB 4NPNA 3QWZB 2G45B 4MGYE 4W9IA 1KJTA 4MSMB 2LGYA 1WM3A 4LCDE 1YQBA 4MM3A 1SIFA 2BYVE 4CYEA 3RULA 2CHXA 4ANVA 2D07B 4FHKA 1JRUA 1V81A 2IZVB 3NHEB 4DK5A 1L2NA 3CSFA 3DVNU 5E6PA 4W9GA 3VDZA 3DPDA 3EECA 3X23A 1T0YA 4MGIE 4HDOA 2Z0EB 2GBJA 1ZGUB 2PPHA 1WZ3A 4IW0A 2LUEA 4IC7B 1WGGA 2KMCA 3K9OB 3O65B 2K8BA 1MG8A 3K9PB 4RM9A 4LJPB 1PQSA 2N1VA 2NS5A 3RT3B 3PV1A 3DVGY 2AEHA 3RD2A 4M0WB 1WMHB 4HCNB 2ASQA 1ISNA 4TKNA 3ZNZB 2O2VB 4ZRIA 5JH5C 3LDZE 4IUMB 1P98A 4DBGA 4BOZB 2N9XA 4B95A 5TR5A 4MGZE 3L10B 1E8ZA 1Q0WB 1WRDB 1UGMA 3V62A 4HDQA 3APCA 3ZDTA 2LVQA 4NNJB 5L83A 2JVCA 3AU4A 3PRZA 3R7QA 2IO1B 2M4NA 3M62B 3A1QA 4HXDA 4TUUA 1YIWA 4KIKB 4XX5A 3T8MA 4AUQC 2L05A 3GOEA 4FN2A 3APFA 1TTNA 4RMAA 5FR6A 2KX0A 2JRHA 1WYWB 1BT0A 5KHOA 3JSVB 4FHJA 2IY1B 4TQ1A 4BKTA 2R2QA 2IO0B 2JT4B 1GC6A 4KDIC 2CR5A 2V1YA 5AEKB 3TL5A 1SE9A 2OJRA 3ZDMC 4FBJB 4F1SA 3A9KA 4MDKE 4DXAB 4PS3A 2DZJA 2WYQA 3CSTA 2MBEA 2WWZA 1V86A 3R66C 2MSED 1V5OA 2MBOA 4HK2A 3B0AA 2RPQA 4NQLB 2LWPA 3MJWA 4PYZA 5DPSA 3RCZA 2N1WA 3SDLC 4HCPB 5IA7A 2LVOA 1VD2A 1NDDA 1TGZB 1ZKHA 3N30A 4ZYNA 3RZFA 1WE6A 3IG3A 3T9LA 1WGHA 3RYTA 4TQ0A 4GN1A 3VTWA 1GJZA 4IG7B 4MJSB 4EUTA 3OJ4B 1AARA 1GNUA 2AL3A 4LDTB 1WJUA 5LXHA 4A3OA 1G6JA 2JZ3B 3VQIA 4EZLA 3WAMA 2L0TA 4FADA 3SHQA 2D10A 1LXDA 2C7HA 2ZPYA 3KUZA 3L08A 5KHQA 2K39A 1YD8U 2M17A 2W9NA 3A4RA 3PTFC 5D6JB 4G3XB 2MQJA 3A33B 4MSQB 4KVGB 4K81A 4TV3A 4DHZB 2ZJDA 3M3JA 4GDKB 2DHZA 2L0FA 4EZKA 2C7NB 2D11A 2KLGA 2NPTB 3QC8B 3QAQA 3CF6E 4DHJB 1NBFC 1WY8A 2KDIA 2UWQA 4GGQA 2GMIC 3KUCB 4KDLB 1UELA 1UZXB 5AZHA 3V6CB 3W1YA 4DHZE 2C60A 2PE9A 3N3KB 3KUDB 4BBNC 3NS8A 5BO4B 2BYEA 3L17A 3IVFA 4AJYB 3NZSA 4I6LB 3DBRI 4XZ4A 2WX0A 1RFAA 1RAXA 4X57B 2WX1A 4EZJA 4NAWB 3H9DA 5CTRC 1VCBA 2DZIA 4MEMA 4DDID 2MBBB 2YVCA 3H6NA 3I3TB 2K25A 3OJ3A 4JLCA 1WGDA 2JZZA 2IO3B 4AJWA 5J18A 5E6OA 3VXWA 3KVFB 1WZ0A 2MBHA 2MCNB 1WR1A 2LASA 3H7PA 1YX6B 2NVUI 3UGBB 1HE8A 2KQ7A 2BPSA 2N7DA 2NCNA 2EMTA 2DAJA 4P7IA 1IPGA 1V80A 1V9JA 2O6VB 2KOXA 1E7VA 2REXA 1Z2MA 5IAAC 3U30A 3ZKJC 4W9KA 4ICVA 2FCNA 3A9KB 2M8SA 2RR9A 3H7SA 2K6QA 4OVVA 3DOWA 3TIXA 4ANUA 2CU1A 4HWIB 3AU5A 4ZRKA 1P3QU 4EOYA 2PE6B 2A4ZA 1LFDA 2PEAA 1D3ZA 2BWES 2JPHA 1M94A 5E6NA 3PSEB 4K7UA 1WIAA 4II2B 4NJ6A 4WQOB 4II3B 1WFYA 3ZIMA 3VUXA 2KC1A 3X0WA 5GMVA 2K1FA 3DVNV 4W9CA 2FNJB 3S2AA 4ASWC 3HM6X 4K7SA 5EDSA 2PJHA 3VFKA 2KANA 1E8YA 4E71A 5AZFA 3VH4B 1XQQA 2GBRA 4GMVA 2XEWA 3Q3FA 2JUOA 3PT2B 3W1SA 2LI5A 1X1MA 3ZW3A 3WALA 4CO7A 2DENB 2K6DB 3W1SC 4E3CA 5JHAA 3TMPB 5JHBA 2FCQA 4FJZA 2KWUB 2NBWB 4JQWC 2CKHB 1L7YA 3ZLZA 3ML8A 4WAAA 1C1YB 1EUVB 1WM2A 3JW0X 2KZRA 3APDA 2MP2A 4KV2A 1OEYA 2HJ8A 3A9JA 4NAWA 4LJOB 2KDEB 1S1QB 2JRIB 3PLVA 4F8CB 5D7GA 4M8NA 2G3QB 4WWOA 5J17A 1RRBA 3DVGX 4GU2A 1YX5B 1WX8A 2XK5B 1GG3A 3ALBA 2IYDB 4JL9A 1WJ4A 2MA9B 3H7PB 4XC2A 2DX5B 2LXAA 2KX3A 2ZZPB 3TJPA 2KD0A 3MTNB 2IY0B 3QIJA 4ANWA 2C5LC 2KFJA 2KTFA 4BVUC 2RGFA 2NBVB 4G0NB 4BKSA 3WA0A 2HD5B 2KKCA 4B6WA 2GOWA 3AXCA 4ZRJA 3IFWB 1WR6E 2LVPA 1OQYA 2J0KA 1ZW7A 2N9PC 1P0RA 2VRRB 3HHMA 5G2NA 3WAOA 3JVZX 3V6EB 4A3PA 2V3SA 3B08A 2KQSA 2HTHA 3JYUA 3BY4B 1WX9A 2ZNVB 3PRPB 5D94A 2NPTA 2LJ5A 3IBEA 3KW5B 4KZ0A 3ENEA 1E90A 2RD0A 2FAZA 4IM0A 1SGHA 4K7WA 2KJRA 1KOTA 4W9DA 2JXXA 2R2OA 1OTRB 4HJKA 1LQBA 3NOBA 3TBLD 4HVBA 3NZUA 2AWTA 3PS6A 4KSKC 3VVWB 2D3GA 2KXJA 2KDFB 4PYUA 3UQAA 4W9JA 4DHJD 1Q5WB 1IYFA 1Q1OA 1U4AA 4GSWA 2KJ6A 5AZGA 4GIVA 2L76A 2CS4A 3A1QB 4NQKE 2DYOA 4IM2A 4WJQA 1NI2A 4GDKA 3PREA 4GB9A 1E8WA 1GC7A 2N7EA 3L16A 4BKGA 1J8CA 2IBIB 2Z59B 3VAWA 1IP9A 1LM8B 3PGEA 4J6IA 2KJHB 3ONSA 3PLUA 3RUIB 3AULA 2KDBA 2JWZA 2AL6A 1R4MI 2DZKA 2O6VA 2KWVB 3ZRFA 1UH6A 3HK0A 4JGHB 3DBLI 3UQBA 1Y8RC 1I35A 2UYZB 2BF8B 3UIOB 3NY5A 4FA6A 2XK5A 1C3TA 1YJ1A 2QHOA 2DYBA 2GBMA 2MBQA 2NR2A 1WMHA 3VTUA 1KLVA 1WGRA 3ZTCA 2IO2B 2O6VD 2ZNVC 3A9JB 4GOCA 5CHFA 2DZMA 4WWPA 2BWFA 4RM8A 3KYDD 2MX2A 1OEYJ 3L0WB 5D2MB 3D32A 3PHXB 2KVRA 2ZPNA 1R4NI 2LGXA 2NBUA 3U7DA 5DPRA 2K8HA 4BBNF 2LXCA 1OGWA 2KFKA 3JSVA 3ZNGC 2ZCCA 5L95C 4PS7A 4N9F4 4MJSA 3DBSA 3ZVVA 1WXVA 2KNBA 3QK0A 2BKRB 4FJYA 2KWCA 1EF1A 2GBKA 2L3ZA 3QQ8B 3KH0A 3QX1A 5DCNA 1EO6A 2EMSA 2DYMA 2M1MA 5CHVC 4HPMB 2KMAA 3V60A 3C0RB 3ML9A 4MH0E 3TCAA 3L13A 5C1ZA 2D2QA 2L8JA 2G4SA 3MHSD 4IWQA 1V5TA 3WIMA 4OVUA 2KHWB 4B9KA 4F7ZA 3OAWA 2RSUA 3H1UA 3P2BA 4DDGD 2ZVNA 3KYCD 2O2VA 4W9HA 2Y5BB 2MWSB 2KK8A 1EF5A 2KFKB 4WJOA 4IWPA 1H8CA 1WI0A 1P9DU 4G11A 1WH3A 2B3AA 4GDLB 1KM7A 2GBNA 4IWOA 1Z5SB 4AP4C 4EKUA 1J19A 1CMXB 2XBBC 3HIZA 3PHWB 2KLCA 3PRMB 3RZWC 4HPLB 4EEWA 3M63B 4AWJA 1I42A 4WJPA 2KTRB 2JY6A 3DBHI 3QHTA 4BOSC 2HE7A 2CHZA 1A5RA 1TZ1A 2Z0DB 5DPWA 5JZEB 1RLFA 1XT9B 3R7RA 4FLHA 3ZRCA 1WXAA 1V49A 4AOFA 3PVLA 2MRPA 3VTVA 3VUWA 3DQVA 3Q3JA 2J7QB 2LRUA 1WF9A 1UBQA 2J0MA 2LRWA 1QZEA 4LDTD 4W9EA 5G55A 2V4LA 1H4RA 3EFUA 4IM3A 2OOBB 3VH3B 4JIOU 4KZCA 3SU8X 3A4SC 3PZDA 4PS8A 4K1RB 1GUAB 3DDCB 3EC8A 3EHVA 3M95A 1K8RB 4W9LA 4GXBA 4URKA 1WXSA 2JF5A 3HM3A 4M8MA 1XD3B 2AYOB 4I6PA 1FXTB 3BINA 2N4FA 2BGFA 2BYFA 3B1LX 5LLIA 2ZCBA 3WANA 2FIDA 4BFRA 4HLEA 4FJVB 2FCMA 2G4DB 5HKHA 2KO3A 3OLMD 2K8CA 4W9FA 4EFOA 4A20A 4NJ7A 2FIFA 3WAPA 5J2RA 3VHTC 2KTRA 4ANXA 4MGKE
chains in the Genus database with same CATH superfamily
4LK0M 1S3SG 1UD7A 1MHXA 2KWDA 3QJZA 1N5XA 1UBIA 2WXQA 2FUHB 4ZDVA 2ZEQA 4FULA 1SE2A 3AE4B 3MJ5A 2LMCA 1FFUA 1WGYA 2EKEC 2I1JA 1E9MA 1XCQL 2M0XA 3MC8A 1TS5A 5IP4D 2J0JA 1RM6C 4A55A 2WXOA 2WDTB 2DAFA 4ZOHC 4ICUA 2MW5A 3QCAA 3GZNI 2QILA 2N9EB 4MSMB 3AN1A 4ANVA 2RDBC 3Q3OC 1TS4A 3DPDA 3EECA 3X23A 1T0YA 4MGIE 1WZ3A 1WGGA 3K9OB 3K9PB 4RM9A 3RT3B 1B9RA 1IBXB 3HRDD 3DVGY 3PV1A 4M0WB 2IDYA 3R2TA 1OQRA 2WXMA 1NYQA 3TEXA 1P98A 4BOZB 4ZHPA 2J42A 1Q0WB 2K0PA 1VRAB 1WRDB 4HDQA 2IGGA 3FAHA 2LVQA 4NNJB 1I4PA 3T8MA 4HXDA 4KIKB 4AUQC 3AMZA 1JWBD 2L05A 1TTNA 1ZDXA 3WCQA 3JSVB 2WDRB 2JT4B 4KDIC 2CR5A 2OJRA 4FBJB 4MDKE 4PS3A 1KF6B 2MBEA 2WWZA 3R66C 2MBOA 2BS2B 2HJ1A 4OZBA 4NQLB 1SB3C 2LWPA 2XNAC 5DPSA 1B1ZA 3SDLC 5IA7A 1NDDA 3N30A 4ZYNA 1ZXHA 2JXTA 1WGHA 1JW9D 1GJZA 4IG7B 3GS2A 4MJSB 1AARA 4LDTB 1E0ZA 3SHQA 4KKJA 1LXDA 1PDXA 2C7HA 1GB1A 2WQYB 2W9NA 1KTKA 2N0SB 3N20C 4N6EB 4K81A 4TV3A 3N1XC 1M4VA 4EZKA 4ZRPA 2DHZA 2L1AA 3TEZA 2KLGA 2NPTB 3ZJUA 1NYRA 4DHJB 4GGQA 1UZXB 4IDIA 3Q8CA 4LNFA 2BYEA 3L17A 3DBRI 4XZ4A 4C4VB 4EZJA 1RFAA 1FNWA 2DZIA 2IGHA 3H6NA 3OJ3A 1WGDA 1L6VA 3VR9B 1BXTA 1QT9A 3P4SB 3KVFB 1WZ0A 2W54A 1YX6B 2QJLA 2BPSA 2DAJA 3HVZA 1YN4A 1SSNA 2WU2B 5IAAC 3VRBB 3A9KB 1J7AA 2RR9A 2K6QA 4OVVA 3TIXA 2CU1A 5I4DA 2OHFA 4EOYA 2PEAA 1D3ZA 1M94A 1WIAA 4II2B 3ZGZA 4WQOB 4YTNB 1WFYA 2XEWA 3MFGA 3Q3FA 3W5UB 2LI5A 5FKAC 1X1MA 4CO7A 1ET6A 3W1SC 2K9XA 2OJWA 2KWUB 2CKHB 4M01A 1F52A 1SJED 4LJOB 1S1QB 2M0AA 4F8CB 1JQ4A 5C2TB 1RRBA 1JWUD 3DVGX 3KWVA 2XK5B 1GG3A 3NVVA 4JL9A 3RN9C 2W3RA 4YT0B 2LXAA 4S0RA 1GB4A 2NBVB 4C4VA 3AE3B 4B6WA 3IFWB 2N9LA 2LVPA 1OQYA 2N9PC 1ZW7A 2VRRB 3JVZX 2V3SA 3B08A 1L0YB 2CJOA 5HFYA 2CU3A 3ENEA 1SGHA 4K7WA 4HJKA 1OTRB 3NOBA 3RNGC 2D3GA 4PYUA 4DHJD 2KAJA 2WXPA 4OW0A 1IYFA 4GSWA 5AZGA 1XXGA 4GIVA 5BMGA 4IM2A 5BYQA 3B9JA 5H8YE 1CK1A 1MPEA 4GDKA 1E8WA 1GC7A 2N7EA 1LM8B 3PGEA 3EFCA 3ONSA 1I7HA 2O6VA 2ACZB 3RNBC 1KRHA 2BT6A 2W55A 1OQQA 3EUB2 3UIOB 1YJ1A 2KT7A 3NVZA 2O6VD 4GOCA 4P16A 4REZA 1Y56A 2MX2A 3IT6B 1P7FA 3P4PB 1E6EB 2NBUA 3U7DA 2LXCA 1OGWA 2KFKA 3AE8B 4N9F4 1I4QA 2KNBA 4YSXB 2QEJC 4FJYA 3H8HA 2PLPA 3KH0A 1EO6A 2EMSA 3ZXVA 2MJ3A 2M1MA 5CHVC 2KACA 1EWYC 2G4SA 1XO3A 1V5TA 1DYQA 2INPE 3OAWA 2RSUA 1D6EC 1D5XC 3DBLB 3ABVB 1ZXIA 1CZPA 4ZHOA 3TEWA 1H8CA 4G11A 2B3AA 1XLOA 4GDLB 2WDQB 2KLCA 3RZWC 1HXYD 4EEWA 1I42A 4AWJA 4RNAA 3DBHI 1AYFA 3QHTA 3SR6A 3SFEB 5DPWA 1RLFA 3U7ZA 3PVLA 4JE3B 3VTVA 3DQVA 1JROA 2PIAA 1RYJA 1UBQA 2J0MA 5G55A 2GLSA 3VH3B 4KZCA 3SU8X 4XWWA 2D3BA 3EC8A 4W9LA 4KX6B 4URKA 2JF5A 2INNE 4M8MA 4H2AA 3J9CA 1FXTB 2N4FA 3AEFB 1WRIA 4FJVB 1JMLA 2FIFA 3I63C 3VHTC 5J2RA 2KTRA 4ANXA 2DLBA 1C4AA 3B2FA 3ZJVA 3R2IA 2LZ6A 3FKYA 3BK1A 1XLPA 4E74A 2BKFA 3QA8A 3MHZA 1V6EA 2M56B 2I1KA 3AI5A 4YL8A 4NY0A 4KIKA 4YSYB 1SIJA 1WE7A 2CHWA 2MLBA 1TKGA 3BVGA 4M0WA 3P1MA 3U8ZA 5BMHA 1IGCA 3VRAB 3N1ZC 3BIID 2LGDA 2WDVB 3DBRB 5CHWA 2WXHA 5GXGB 3ZNID 1DOXA 4RFBA 3SD5A 2RMMA 1P1AA 3ECIA 2ZW0A 2HDEA 4LNOA 1HA5A 2KN5A 3W2DA 3QWZB 2G45B 4MGYE 4W9IA 5FR3A 1EWCA 4MT5A 1SIFA 2CHXA 2EKIA 3C8YA 2LUMA 2D07B 4FHKA 1STEA 3NHEB 3CSFA 1L4DB 2XN9C 3VDZA 2Z0EB 2GBJA 1ZGUB 2PPHA 2W82A 2LUEA 4IC7B 4A9AA 1E7PB 2K8BA 1MG8A 4ACFA 1YMHE 4LNNA 1ZUD2 1WMHB 2KQ4X 1FPYA 5BMIA 4ZRIA 4DXGA 2N9XA 1K51A 4RGMA 2BS4B 3APCA 3ZDTA 4LNKA 3NRZA 5L83A 3AU4A 3PRZA 3RI7C 3M62B 3A1QA 4TUUA 1N6ZA 4XX5A 1IBXA 3APFA 2ZW1A 1XCTL 5H92C 2I38A 4BKTA 2R2QA 3NVYA 3Q8EA 5AEKB 1V1PA 2FUG1 4DXAB 3I5JC 1QKZA 2RPQA 2VH2A 3RCZA 2N1WA 1D5ZC 1ZKHA 2G1EA 1MG4A 3RZFA 2R61A 1WE6A 3IG3A 3RYTA 4RH6A 4EUTA 2AL3A 1WJUA 1G6JA 2JZ3B 2SEBD 5AUKA 4M02A 3VQIA 2L0TA 4FADA 2D10A 4NZLB 3AE6B 3KUZA 3L08A 2K39A 3PTFC 3A4RA 3AEAB 4G3XB 2MHJA 2KVZA 2MQJA 4MSQB 2D3CA 1F2RI 2C7NB 3NVWA 3QC8B 1TKYA 4KDLB 2GMIC 2C60A 1VZ8A 2PKOA 4XE0A 3IVFA 3IAS1 1RAXA 4NAWB 1MVKA 3EGRA 4IOIE 2MBBB 2OEDA 5J18A 1VJKA 2MCNB 3UGBB 3H7PA 1FRRA 1FRDA 3P4RB 2PMVA 4P7IA 2O6VB 4RGNA 1Z2MA 3U30A 4ICVA 1FO4A 1SE3A 3DOWA 3HVDA 1TY2A 2PE6B 2A4ZA 1ZOYB 3SEBA 4GLSC 4K7UA 4NJ6A 4II3B 4HEA1 3ZIMA 3PZ7A 2JYTA 2KC1A 3Q69A 3X0WA 1FEHA 3RPFC 4K7SA 2PJHA 2WHIA 5EE1A 3P63A 1SJHD 2YEPB 5AZFA 3Q2AC 3VH4B 2Z8LA 1UWXA 3PT2B 3WALA 2N7JA 1FCCC 1MJDA 1XEEA 4JQWC 3ML8A 4WAAA 2WXJA 1YJJA 2V3NA 1HQRD 3ZYYX 3APDA 2Y5CA 3E56A 3CIRB 4NAWA 2KDEB 4M8NA 1FIQA 5J17A 3FILB 1QF6A 1YX5B 2WXLA 1WJ4A 2MA9B 3H7PB 2DX5B 2GI9A 2LHDA 3MC0B 1UUPA 3MTNB 2C5LC 4RGTA 2RGFA 2D3AA 4G0NB 3WA0A 3RNFC 1QOFA 1TT5B 1YN5A 5G2NA 1L4ZB 1DOYA 3BY4B 1PUTA 3PRPB 2NPTA 4ITKA 1T0SC 2D5GA 2RD0A 4HPPA 2WLBA 1LQBA 3TBLD 3NZUA 3VVWB 2KXJA 3UQAA 3BZDB 4P6VF 2DYOA 1DGJA 1CQVA 1NI2A 3VR8B 3PREA 4BKGA 2Z59B 4US8A 4J6IA 3BYTB 2KJHB 3PLUA 3AULA 2KDBA 4XDCA 3ZRFA 1N61A 2KWVB 1UH6A 3HK0A 3GE8C 1I4XA 3BWUD 2LJIA 4WWMA 2BF8B 3NY5A 4FA6A 2WXGA 2QHOA 1WGRA 3W9CB 1ENFA 3IT4B 2DZMA 2BWFA 5D2MB 2MH7A 2KVRA 2ZPNA 3HUIA 4PS7A 1WWTA 5HI1A 3DBSA 3ZQ4A 4HJGE 5IN7A 3ZVVA 3QK0A 2KWCA 2GBKA 2DWQA 1VZ7A 4P1CC 4N58A 3C0RB 3TCAA 1DOIA 3MHSD 4OVUA 1ZPSA 2KHWB 4F7ZA 3H1UA 3P2BA 4DDGD 2ZVNA 4WURA 1EF5A 1PFDA 1FFVA 4O1NA 1P9DU 2E3TA 1KM7A 4IWOA 1Z5SB 2G9HD 1J19A 2IJ0A 3HIZA 3PHWB 4HPLB 1HZ5A 3EA6A 4FLHA 1IUEA 4MM3B 1V49A 4AOFA 2KDMA 3VUWA 3R8BA 2J7QB 2LRWA 1QZEA 2LEKA 4W9EA 1H4RA 1T0RC 1GUAB 3DDCB 3EHVA 2X8XX 1VLBA 1K8RB 2BYTA 1FNUA 1FM0D 4OZAA 2AYOB 4I6PA 3BINA 3AE2B 2BGFA 5LLIA 2ZCBA 4C00A 1VDVA 4WQMA 4EE2A 2FCMA 2G4DB 3AM9A 2KO3A 2K8CA 1QILA 2WXKA 5BYSA 1ZDVA 1TBEA 1J0GA 1SEBD 3MC9A 4AS1A 2KC2A 3RNAC 3N32A 3ZNHB 3UINB 1WJNA 4G50A 2LD9A 3IHPC 3ZO5B 1V1OA 2NTTA 4ARIA 2VZKD 2M19A 5D3IB 2LGSA 4PT5A 5CX3A 3L54A 3LJ3A 4XGAB 1C78A 3PPAA 2C9WB 3LXFA 3QARA 1V97A 5LXIB 3ZUNA 2MP2B 2FCSA 2L00B 3U4EG 4MELA 2V4IB 4YSZB 1TS3A 2ZVOA 4DWFA 4WJNA 2YLMA 4S17A 3N9YC 3UF8A 5C23A 4BKSD 1NI3A 1C4PA 3CMMB 2HTME 4NPNA 1KJTA 1XF5L 2LGYA 1WM3A 4MM3A 1T0QC 4LNIA 4CYEA 3RULA 1MHHE 2BTEA 1ZP0B 2JYEA 1V81A 2IZVB 2K3UA 1L0VB 3DVNU 2H88B 2VH1A 4IW0A 3UI3A 3O65B 1VR9A 4C56C 1TZOA 1YOVB 2AEHA 1ISNA 4TKNA 3ZNZB 3LDZE 2YEPF 4DBGA 5TR5A 3AE5B 3Q3MC 1E8ZA 2LGIA 1AN8A 3V62A 1EU4A 1F0ZA 2JVCA 2IO1B 2M4NA 1YIWA 3GOEA 4RMAA 5FR6A 2KX0A 2JRHA 1WYWB 1BT0A 5KHOA 4TQ1A 2IY1B 1AW7A 1GC6A 4YTMB 1SE9A 2WYQA 1C79A 3CSTA 2MSED 1F2RC 1V5OA 4HK2A 4HROA 1AWDA 4PYZA 3MJWA 4HCPB 3NZ3A 3I57A 2AQ1B 2LVOA 1VD2A 1TGZB 2GRIA 2K5PA 4TQ0A 4GN1A 4KGSA 1GNUA 2E6XA 1UWMA 4A3OA 4EZLA 3WAMA 4C7ZA 1FD6A 5HG2A 5KHQA 5D6JB 3A33B 4DHZB 2ZJDA 3M3JA 2K22A 4GDKB 2L0FA 1ZE3D 1KH0A 3Q8AA 3CF6E 2KDIA 2UWQA 4DHZE 3KUCB 3V6CB 5AZHA 4WIPA 4BBNC 3N3KB 3KUDB 3NS8A 5BO4B 3NZSA 4C80A 4I6LB 2WX0A 4X57B 1JRPA 5CTRC 4OVZA 1GAQB 4MEMA 2YVCA 1HTQA 4K3BA 2K25A 1JWSD 2JZZA 3OG5A 2FE8A 1WR1A 2LASA 2NVUI 3AEEB 1HE8A 4USAA 1IPGA 2KOXA 1E7VA 5IKCM 4KGRA 2FCNA 2W3SA 4C7YA 5MPOA 3H7SA 2WXRA 4HWIB 4JWSC 4MACA 1NENB 4B0EA 3SFDB 1UNSA 2BWES 2JPHA 3PSEB 1A70A 4TMAB 3VUXA 3C19A 4W9CA 1MI0A 2FNJB 3S2AA 2B76B 3HM6X 5EDSA 4Q2JA 3VFKA 1E8YA 4ARCA 2RDHA 1XQQA 4JX1C 2GBRA 4GMVA 2JQRB 2JUOA 2X38A 1FNVA 3W1SA 3ZW3A 2DENB 2K6DB 2PVOD 3DWGC 1TIFA 5JHBA 2NBWB 4KGTA 3GP7A 3ZLZA 1C1YB 3FC4A 1ROEA 2KZRA 2WXNA 1OEYA 2JRIB 2BB5A 5D7GA 2G3QB 2DNFA 2WNMA 1ACCA 3RFZB 1JALA 1QOGA 1PYWD 4GU2A 2IYDB 3TEYA 4YWGG 4RF0A 2CJNA 2KX3A 4BVUC 2UU7A 3ZXRA 4BKSA 2HD5B 3B2GA 3DHHC 3AXCA 1WR6E 1F1HA 1P0RA 1HZ6A 3V6EB 2WGSA 1C4CA 2IGDA 1C76A 4HKQA 2FAZA 4IM0A 4W9DA 2JXXA 1BMLC 4KSKC 3V3XA 4FXCA 3U2SC 1TS2A 1U4AA 2KJ6A 3AE1B 3A1QB 1C9FA 3Q14C 4WJQA 3BVZA 2WP9B 5TSSA 3L16A 3VAWA 2WXFA 2AL6A 1R4MI 3UQBA 2UYZB 3KWLA 2XK5A 1PGBA 2DYBA 2MBQA 2NR2A 1WMHA 3VTUA 4K3CA 2ZNVC 3A9JB 5CHFA 4WWPA 3CWIA 3KYDD 4RM8A 1FXIA 1EU3A 3D32A 2PTLA 3PHXB 2JX5A 2LGXA 5LNK1 3KLSX 2K8HA 5DPRA 4BBNF 2WXIA 3JSVA 3ZJTA 2ZCCA 5L95C 1EM7A 3P42A 1WXVA 2BB6A 2BKRB 3QQ8B 2AQ3B 2LFIA 1D4BA 2DYMA 4HRSA 3AE7B 1SF0A 1FXAA 1Q10A 3L13A 1KLGD 4YTPB 2L8JA 4IWQA 3WIMA 1L6UA 3NS1A 3KYCD 2O2VA 4W9HA 1BUIC 2Y5BB 2KK8A 1D5MC 3NUHB 4WJOA 3N1YC 2GBNA 4EKUA 4AP4C 2EELA 2XBBC 3AECB 2HE7A 4BZAA 1A5RA 2FBWB 1XT9B 2J53A 4L23A 5E6JA 1LGRA 1WXAA 2GB1A 3NG0A 2MRPA 3T3NA 3Q3JA 2LRUA 4KKIA 4LDTD 1GOZA 3TUOA 1WGKA 3DWMA 5T8IA 1YNTE 2V4LA 3EFUA 1FMAD 4JIOU 1I4GA 3PZDA 1N63A 4NJCA 3M95A 1PGAA 1WXSA 4L1BA 4XYCA 3HM3A 3Q8BA 1KLUD 5AUIA 1XD3B 2BYFA 3B1LX 3WANA 2FIDA 4BFRA 1UF0A 4HLEA 3LYYA 1WXQA 4EFOA 4NJ7A 2J4XA 4MGKE 4I6NB 3ZTDA 1E5WA 2TSSA 1I4RA 2BW2A 3V61A 1WJ6A 1T6BX 1V2YA 5DPTA 1WXMA 2Y3AA 1E7UA 3FILA 3R3MA 3UIPB 2A5UA 1E8XA 1NVID 2MJEA 1N62A 3VUYA 4AQ7A 2C7MB 4R3DA 1K53A 4KSLC 1YQ3B 4ZRQA 2ONQA 4GDLA 1WX7A 5FK9C 2V0GA 4WWNA 3IXSA 1CJEA 3DCGA 2L7RA 4CHKA 1YJIA 1F9JA 3NJTA 1JCKB 4D2KA 4LCDE 1YQBA 2BYVE 2L32A 1IGDA 1R4MB 4TSSA 1JRUA 4DK5A 1L2NA 3AEBB 5E6PA 2RPVA 4W9GA 4HDOA 2V9HA 4HKZE 2KMCA 4OZCA 1TYGB 4LJPB 1PQSA 2N1VA 2NS5A 3DHGC 1P7EA 1JWMD 3RD2A 2BS3B 1QQRA 2ASQA 4HCNB 3W5VB 2O2VB 4A90A 5JH5C 4IUMB 4B95A 1N60A 4MGZE 3L10B 3GE3C 1YQ4B 1UGMA 4A6QA 4A8XC 1V1PB 3R7QA 4MH8A 4FN2A 4NAMA 1YN3A 3AEGB 3AH7A 3Q3NC 4FHJA 2IO0B 4US9A 2V1YA 3TL5A 2NMQA 1R7SA 3ZDMC 4F1SA 3A9KA 3E9SA 2DZJA 2SAKA 1V86A 1E10A 4UDUC 3B0AA 3OWEB 3RMKC 2QMTA 3T9LA 2MEKA 3ETRA 5G5HA 3VTWA 1TJEA 2Q5WD 3OJ4B 5LXHA 1KFYB 2ZPYA 1C77A 2IPKD 1YD8U 2M17A 1L5PA 2JWUA 4KVGB 2KN4A 4RCOA 2ICIA 2D11A 1WYGA 4RGOS 1ESFA 3QAQA 1NBFC 1WY8A 3TSSA 1UELA 3W1YA 1WSPA 1V8CA 2PE9A 3GZNB 1HEZE 2L83A 2Y5PA 4QAYA 4AJYB 4PK1A 2BQQA 2QSDA 2PW9A 2QCZA 2LHEA 2QC8A 2WX1A 3H9DA 1VCBA 4J3OD 4DDID 1RWSA 3I3TB 4JLCA 2DBYA 2IO3B 4AJWA 5E6OA 5IO9A 4YXDB 3VXWA 2MBHA 4JWUC 2WS3B 2KQ7A 5IOIA 4XWTA 2N7DA 2NCNA 2EMTA 2KYWA 1V80A 1V9JA 2AX5A 3U52E 2REXA 3ZKJC 4W9KA 2AQ2B 2JSVX 1T3QA 2M8SA 4DXFA 1VZ6A 4ANUA 3AU5A 4ZRKA 1P3QU 1LFDA 3AB5A 2J52A 5E6NA 1XLNA 5GMVA 2K1FA 3DVNV 4ASWC 4E71A 2KANA 2N9KA 1K50A 3T3OA 1I4HA 3BVMA 1OFFA 4E3CA 1SXTA 4B0MA 5JHAA 4WAFA 3TMPB 2FCQA 4FJZA 4L2YA 1L7YA 4JPSA 3RNEC 1EUVB 1WM2A 3JW0X 5EE3A 2V3PA 2MP2A 4KV2A 2HJ8A 3A9JA 4BAXA 2JU6X 4OHJA 3PLVA 2VZKB 1SE4A 1L0XB 4WWOA 1TY0A 4WH4A 5G5GA 2QDFA 1WX8A 3ALBA 4XC2A 1JWAD 3LB8C 2ZZPB 3TJPA 4RF1A 2KD0A 2IY0B 3QIJA 4ANWA 1LO5D 2KFJA 1UGJA 2KTFA 3URYA 2KKCA 2GOWA 1N5WA 4ZRJA 3MP9A 1ET9A 2J0KA 4LLGM 3HHMA 3WAOA 4A3PA 4CQNA 2KQSA 2HTHA 3JYUA 5EE9A 1WX9A 2ZNVB 2WU5B 5D94A 4KZ0A 2LJ5A 3IBEA 3KW5B 1HTOA 1E90A 2KJRA 1KOTA 2INCC 2R2OA 1QOBA 4HVBA 5BYRA 4N59A 3PS6A 2AWTA 4LTUA 1J7CA 2KDFB 1TKEA 2BVCA 4W9JA 1Q5WB 3AV8A 1Q1OA 4DQOC 3GB1A 3DBHB 2L76A 2CS4A 4XDDA 4NQKE 2RDGA 1J7BA 1K52A 4GB9A 1J8CA 2IBIB 3PO0A 1IP9A 1R4NB 3RUIB 2JWZA 2DZKA 4JGHB 3DBLI 1Y8RC 1I35A 1RFKA 1C3TA 2GBMA 4P1BC 1KLVA 3ZTCA 2IO2B 1MFWA 1OEYJ 2KMMA 3L0WB 5EE0A 3O13A 2ON8A 1R4NI 2BBCA 3ZNGC 3AEDB 3PZ8A 4MJSA 2H89B 1EF1A 2L3ZA 3QX1A 3Q6BA 5DCNA 1QOAA 4ZYSA 2JZPA 4HPMB 2KMAA 3V60A 3IAM1 3ML9A 4MH0E 5C1ZA 2D2QA 3KQ4A 3DHIC 1FCLA 5JXVA 4B9KA 3I9V1 2MJDA 4IKGA 2MWSB 5HHDG 3AE9B 2KFKB 4IWPA 1WI0A 3P4QB 5D3DA 2PVGC 1WH3A 3BYYB 1T5XD 1CMXB 2I2YA 2L52A 3PRMB 3M63B 4WJPA 2KTRB 2JY6A 1GPXA 4BOSC 4M00A 2CHZA 1TZ1A 2Z0DB 5JZEB 3BK2A 3R7RA 1XLQA 3V05A 3ZRCA 3RNCC 1F77A 1WF9A 1SBBB 1QLBB 4IM3A 2OOBB 3L4PA 1NEKB 3A4SC 4PS8A 4K1RB 4GXBA 3Q8FA 2NTSA 2QIEB 5HKHA 3OLMD 4W9FA 4A20A 5C3JB 1PGXA 2INDC 3WAPA
chains in the Genus database with same CATH topology
1TBEA 4I6NB 2LZ6A 1S3SG 1UD7A 1J0GA 2KC2A 3QJZA 1UBIA 2BKFA 4E74A 3QA8A 3ZTDA 1E5WA 3N32A 3ZNHB 3UINB 2FUHB 4ZDVA 1WJNA 1V6EA 4G50A 2LD9A 3IHPC 3V61A 2I1KA 3ZO5B 2ZEQA 1WJ6A 3AI5A 4FULA 4YL8A 4NY0A 1V2YA 5DPTA 1WXMA 4KIKA 1E7UA 1WGYA 5CX3A 3L54A 3LJ3A 3R3MA 3UIPB 1WE7A 2EKEC 2CHWA 2A5UA 2MLBA 2I1JA 2C9WB 3PPAA 1E8XA 3QARA 3VUYA 2C7MB 2M0XA 5LXIB 3ZUNA 2MP2B 2J0JA 2FCSA 2L00B 4MELA 3U8ZA 4KSLC 2LGDA 2WDTB 2ZVOA 4GDLA 4DWFA 1WX7A 2DAFA 4WJNA 5CHWA 4ICUA 2YLMA 3ZNID 2MW5A 4WWNA 3DCGA 3SD5A 3UF8A 1P1AA 2L7RA 3ECIA 5C23A 4BKSD 4CHKA 1F9JA 3CMMB 3QCAA 3GZNI 2KN5A 2N9EB 4NPNA 3QWZB 2G45B 4MGYE 4W9IA 1KJTA 4MSMB 2LGYA 1WM3A 4LCDE 1YQBA 4MM3A 1SIFA 2BYVE 4CYEA 3RULA 2CHXA 4ANVA 2D07B 4FHKA 1JRUA 1V81A 2IZVB 3NHEB 4DK5A 1L2NA 3CSFA 3DVNU 5E6PA 4W9GA 3VDZA 3DPDA 3EECA 3X23A 1T0YA 4MGIE 4HDOA 2Z0EB 2GBJA 1ZGUB 2PPHA 1WZ3A 4IW0A 2LUEA 4IC7B 1WGGA 2KMCA 3K9OB 3O65B 2K8BA 1MG8A 3K9PB 4RM9A 4LJPB 1PQSA 2N1VA 2NS5A 3RT3B 3PV1A 3DVGY 2AEHA 3RD2A 4M0WB 1WMHB 4HCNB 2ASQA 1ISNA 4TKNA 3ZNZB 2O2VB 4ZRIA 5JH5C 3LDZE 4IUMB 1P98A 4DBGA 4BOZB 2N9XA 4B95A 5TR5A 4MGZE 3L10B 1E8ZA 1Q0WB 1WRDB 1UGMA 3V62A 4HDQA 3APCA 3ZDTA 2LVQA 4NNJB 5L83A 2JVCA 3AU4A 3PRZA 3R7QA 2IO1B 2M4NA 3M62B 3A1QA 4HXDA 4TUUA 1YIWA 4KIKB 4XX5A 3T8MA 4AUQC 2L05A 3GOEA 4FN2A 3APFA 1TTNA 4RMAA 5FR6A 2KX0A 2JRHA 1WYWB 1BT0A 5KHOA 3JSVB 4FHJA 2IY1B 4TQ1A 4BKTA 2R2QA 2IO0B 2JT4B 1GC6A 4KDIC 2CR5A 2V1YA 5AEKB 3TL5A 1SE9A 2OJRA 3ZDMC 4FBJB 4F1SA 3A9KA 4MDKE 4DXAB 4PS3A 2DZJA 2WYQA 3CSTA 2MBEA 2WWZA 1V86A 3R66C 2MSED 1V5OA 2MBOA 4HK2A 3B0AA 2RPQA 4NQLB 2LWPA 3MJWA 4PYZA 5DPSA 3RCZA 2N1WA 3SDLC 4HCPB 5IA7A 2LVOA 1VD2A 1NDDA 1TGZB 1ZKHA 3N30A 4ZYNA 3RZFA 1WE6A 3IG3A 3T9LA 1WGHA 3RYTA 4TQ0A 4GN1A 3VTWA 1GJZA 4IG7B 4MJSB 4EUTA 3OJ4B 1AARA 1GNUA 2AL3A 4LDTB 1WJUA 5LXHA 4A3OA 1G6JA 2JZ3B 3VQIA 4EZLA 3WAMA 2L0TA 4FADA 3SHQA 2D10A 1LXDA 2C7HA 2ZPYA 3KUZA 3L08A 5KHQA 2K39A 1YD8U 2M17A 2W9NA 3A4RA 3PTFC 5D6JB 4G3XB 2MQJA 3A33B 4MSQB 4KVGB 4K81A 4TV3A 4DHZB 2ZJDA 3M3JA 4GDKB 2DHZA 2L0FA 4EZKA 2C7NB 2D11A 2KLGA 2NPTB 3QC8B 3QAQA 3CF6E 4DHJB 1NBFC 1WY8A 2KDIA 2UWQA 4GGQA 2GMIC 3KUCB 4KDLB 1UELA 1UZXB 5AZHA 3V6CB 3W1YA 4DHZE 2C60A 2PE9A 3N3KB 3KUDB 4BBNC 3NS8A 5BO4B 2BYEA 3L17A 3IVFA 4AJYB 3NZSA 4I6LB 3DBRI 4XZ4A 2WX0A 1RFAA 1RAXA 4X57B 2WX1A 4EZJA 4NAWB 3H9DA 5CTRC 1VCBA 2DZIA 4MEMA 4DDID 2MBBB 2YVCA 3H6NA 3I3TB 2K25A 3OJ3A 4JLCA 1WGDA 2JZZA 2IO3B 4AJWA 5J18A 5E6OA 3VXWA 3KVFB 1WZ0A 2MBHA 2MCNB 1WR1A 2LASA 3H7PA 1YX6B 2NVUI 3UGBB 1HE8A 2KQ7A 2BPSA 2N7DA 2NCNA 2EMTA 2DAJA 4P7IA 1IPGA 1V80A 1V9JA 2O6VB 2KOXA 1E7VA 2REXA 1Z2MA 5IAAC 3U30A 3ZKJC 4W9KA 4ICVA 2FCNA 3A9KB 2M8SA 2RR9A 3H7SA 2K6QA 4OVVA 3DOWA 3TIXA 4ANUA 2CU1A 4HWIB 3AU5A 4ZRKA 1P3QU 4EOYA 2PE6B 2A4ZA 1LFDA 2PEAA 1D3ZA 2BWES 2JPHA 1M94A 5E6NA 3PSEB 4K7UA 1WIAA 4II2B 4NJ6A 4WQOB 4II3B 1WFYA 3ZIMA 3VUXA 2KC1A 3X0WA 5GMVA 2K1FA 3DVNV 4W9CA 2FNJB 3S2AA 4ASWC 3HM6X 4K7SA 5EDSA 2PJHA 3VFKA 2KANA 1E8YA 4E71A 5AZFA 3VH4B 1XQQA 2GBRA 4GMVA 2XEWA 3Q3FA 2JUOA 3PT2B 3W1SA 2LI5A 1X1MA 3ZW3A 3WALA 4CO7A 2DENB 2K6DB 3W1SC 4E3CA 5JHAA 3TMPB 5JHBA 2FCQA 4FJZA 2KWUB 2NBWB 4JQWC 2CKHB 1L7YA 3ZLZA 3ML8A 4WAAA 1C1YB 1EUVB 1WM2A 3JW0X 2KZRA 3APDA 2MP2A 4KV2A 1OEYA 2HJ8A 3A9JA 4NAWA 4LJOB 2KDEB 1S1QB 2JRIB 3PLVA 4F8CB 5D7GA 4M8NA 2G3QB 4WWOA 5J17A 1RRBA 3DVGX 4GU2A 1YX5B 1WX8A 2XK5B 1GG3A 3ALBA 2IYDB 4JL9A 1WJ4A 2MA9B 3H7PB 4XC2A 2DX5B 2LXAA 2KX3A 2ZZPB 3TJPA 2KD0A 3MTNB 2IY0B 3QIJA 4ANWA 2C5LC 2KFJA 2KTFA 4BVUC 2RGFA 2NBVB 4G0NB 4BKSA 3WA0A 2HD5B 2KKCA 4B6WA 2GOWA 3AXCA 4ZRJA 3IFWB 1WR6E 2LVPA 1OQYA 2J0KA 1ZW7A 2N9PC 1P0RA 2VRRB 3HHMA 5G2NA 3WAOA 3JVZX 3V6EB 4A3PA 2V3SA 3B08A 2KQSA 2HTHA 3JYUA 3BY4B 1WX9A 2ZNVB 3PRPB 5D94A 2NPTA 2LJ5A 3IBEA 3KW5B 4KZ0A 3ENEA 1E90A 2RD0A 2FAZA 4IM0A 1SGHA 4K7WA 2KJRA 1KOTA 4W9DA 2JXXA 2R2OA 1OTRB 4HJKA 1LQBA 3NOBA 3TBLD 4HVBA 3NZUA 2AWTA 3PS6A 4KSKC 3VVWB 2D3GA 2KXJA 2KDFB 4PYUA 3UQAA 4W9JA 4DHJD 1Q5WB 1IYFA 1Q1OA 1U4AA 4GSWA 2KJ6A 5AZGA 4GIVA 2L76A 2CS4A 3A1QB 4NQKE 2DYOA 4IM2A 4WJQA 1NI2A 4GDKA 3PREA 4GB9A 1E8WA 1GC7A 2N7EA 3L16A 4BKGA 1J8CA 2IBIB 2Z59B 3VAWA 1IP9A 1LM8B 3PGEA 4J6IA 2KJHB 3ONSA 3PLUA 3RUIB 3AULA 2KDBA 2JWZA 2AL6A 1R4MI 2DZKA 2O6VA 2KWVB 3ZRFA 1UH6A 3HK0A 4JGHB 3DBLI 3UQBA 1Y8RC 1I35A 2UYZB 2BF8B 3UIOB 3NY5A 4FA6A 2XK5A 1C3TA 1YJ1A 2QHOA 2DYBA 2GBMA 2MBQA 2NR2A 1WMHA 3VTUA 1KLVA 1WGRA 3ZTCA 2IO2B 2O6VD 2ZNVC 3A9JB 4GOCA 5CHFA 2DZMA 4WWPA 2BWFA 4RM8A 3KYDD 2MX2A 1OEYJ 3L0WB 5D2MB 3D32A 3PHXB 2KVRA 2ZPNA 1R4NI 2LGXA 2NBUA 3U7DA 5DPRA 2K8HA 4BBNF 2LXCA 1OGWA 2KFKA 3JSVA 3ZNGC 2ZCCA 5L95C 4PS7A 4N9F4 4MJSA 3DBSA 3ZVVA 1WXVA 2KNBA 3QK0A 2BKRB 4FJYA 2KWCA 1EF1A 2GBKA 2L3ZA 3QQ8B 3KH0A 3QX1A 5DCNA 1EO6A 2EMSA 2DYMA 2M1MA 5CHVC 4HPMB 2KMAA 3V60A 3C0RB 3ML9A 4MH0E 3TCAA 3L13A 5C1ZA 2D2QA 2L8JA 2G4SA 3MHSD 4IWQA 1V5TA 3WIMA 4OVUA 2KHWB 4B9KA 4F7ZA 3OAWA 2RSUA 3H1UA 3P2BA 4DDGD 2ZVNA 3KYCD 2O2VA 4W9HA 2Y5BB 2MWSB 2KK8A 1EF5A 2KFKB 4WJOA 4IWPA 1H8CA 1WI0A 1P9DU 4G11A 1WH3A 2B3AA 4GDLB 1KM7A 2GBNA 4IWOA 1Z5SB 4AP4C 4EKUA 1J19A 1CMXB 2XBBC 3HIZA 3PHWB 2KLCA 3PRMB 3RZWC 4HPLB 4EEWA 3M63B 4AWJA 1I42A 4WJPA 2KTRB 2JY6A 3DBHI 3QHTA 4BOSC 2HE7A 2CHZA 1A5RA 1TZ1A 2Z0DB 5DPWA 5JZEB 1RLFA 1XT9B 3R7RA 4FLHA 3ZRCA 1WXAA 1V49A 4AOFA 3PVLA 2MRPA 3VTVA 3VUWA 3DQVA 3Q3JA 2J7QB 2LRUA 1WF9A 1UBQA 2J0MA 2LRWA 1QZEA 4LDTD 4W9EA 5G55A 2V4LA 1H4RA 3EFUA 4IM3A 2OOBB 3VH3B 4JIOU 4KZCA 3SU8X 3A4SC 3PZDA 4PS8A 4K1RB 1GUAB 3DDCB 3EC8A 3EHVA 3M95A 1K8RB 4W9LA 4GXBA 4URKA 1WXSA 2JF5A 3HM3A 4M8MA 1XD3B 2AYOB 4I6PA 1FXTB 3BINA 2N4FA 2BGFA 2BYFA 3B1LX 5LLIA 2ZCBA 3WANA 2FIDA 4BFRA 4HLEA 4FJVB 2FCMA 2G4DB 5HKHA 2KO3A 3OLMD 2K8CA 4W9FA 4EFOA 4A20A 4NJ7A 2FIFA 3WAPA 5J2RA 3VHTC 2KTRA 4ANXA 4MGKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBE A;  4I6N B;  2LZ6 A;  1S3S G;  1UD7 A;  1J0G A;  2KC2 A;  3QJZ A;  1UBI A;  2BKF A;  4E74 A;  3QA8 A;  3ZTD A;  1E5W A;  3N32 A;  3ZNH B;  3UIN B;  2FUH B;  4ZDV A;  1WJN A;  1V6E A;  4G50 A;  2LD9 A;  3IHP C;  3V61 A;  2I1K A;  3ZO5 B;  2ZEQ A;  1WJ6 A;  3AI5 A;  4FUL A;  4YL8 A;  4NY0 A;  1V2Y A;  5DPT A;  1WXM A;  4KIK A;  1E7U A;  1WGY A;  5CX3 A;  3L54 A;  3LJ3 A;  3R3M A;  3UIP B;  1WE7 A;  2EKE C;  2CHW A;  2A5U A;  2MLB A;  2I1J A;  2C9W B;  3PPA A;  1E8X A;  3QAR A;  3VUY A;  2C7M B;  2M0X A;  5LXI B;  3ZUN A;  2MP2 B;  2J0J A;  2FCS A;  2L00 B;  4MEL A;  3U8Z A;  4KSL C;  2LGD A;  2WDT B;  2ZVO A;  4GDL A;  4DWF A;  1WX7 A;  2DAF A;  4WJN A;  5CHW A;  4ICU A;  2YLM A;  3ZNI D;  2MW5 A;  4WWN A;  3DCG A;  3SD5 A;  3UF8 A;  1P1A A;  2L7R A;  3ECI A;  5C23 A;  4BKS D;  4CHK A;  1F9J A;  3CMM B;  3QCA A;  3GZN I;  2KN5 A;  2N9E B;  4NPN A;  3QWZ B;  2G45 B;  4MGY E;  4W9I A;  1KJT A;  4MSM B;  2LGY A;  1WM3 A;  4LCD E;  1YQB A;  4MM3 A;  1SIF A;  2BYV E;  4CYE A;  3RUL A;  2CHX A;  4ANV A;  2D07 B;  4FHK A;  1JRU A;  1V81 A;  2IZV B;  3NHE B;  4DK5 A;  1L2N A;  3CSF A;  3DVN U;  5E6P A;  4W9G A;  3VDZ A;  3DPD A;  3EEC A;  3X23 A;  1T0Y A;  4MGI E;  4HDO A;  2Z0E B;  2GBJ A;  1ZGU B;  2PPH A;  1WZ3 A;  4IW0 A;  2LUE A;  4IC7 B;  1WGG A;  2KMC A;  3K9O B;  3O65 B;  2K8B A;  1MG8 A;  3K9P B;  4RM9 A;  4LJP B;  1PQS A;  2N1V A;  2NS5 A;  3RT3 B;  3PV1 A;  3DVG Y;  2AEH A;  3RD2 A;  4M0W B;  1WMH B;  4HCN B;  2ASQ A;  1ISN A;  4TKN A;  3ZNZ B;  2O2V B;  4ZRI A;  5JH5 C;  3LDZ E;  4IUM B;  1P98 A;  4DBG A;  4BOZ B;  2N9X A;  4B95 A;  5TR5 A;  4MGZ E;  3L10 B;  1E8Z A;  1Q0W B;  1WRD B;  1UGM A;  3V62 A;  4HDQ A;  3APC A;  3ZDT A;  2LVQ A;  4NNJ B;  5L83 A;  2JVC A;  3AU4 A;  3PRZ A;  3R7Q A;  2IO1 B;  2M4N A;  3M62 B;  3A1Q A;  4HXD A;  4TUU A;  1YIW A;  4KIK B;  4XX5 A;  3T8M A;  4AUQ C;  2L05 A;  3GOE A;  4FN2 A;  3APF A;  1TTN A;  4RMA A;  5FR6 A;  2KX0 A;  2JRH A;  1WYW B;  1BT0 A;  5KHO A;  3JSV B;  4FHJ A;  2IY1 B;  4TQ1 A;  4BKT A;  2R2Q A;  2IO0 B;  2JT4 B;  1GC6 A;  4KDI C;  2CR5 A;  2V1Y A;  5AEK B;  3TL5 A;  1SE9 A;  2OJR A;  3ZDM C;  4FBJ B;  4F1S A;  3A9K A;  4MDK E;  4DXA B;  4PS3 A;  2DZJ A;  2WYQ A;  3CST A;  2MBE A;  2WWZ A;  1V86 A;  3R66 C;  2MSE D;  1V5O A;  2MBO A;  4HK2 A;  3B0A A;  2RPQ A;  4NQL B;  2LWP A;  3MJW A;  4PYZ A;  5DPS A;  3RCZ A;  2N1W A;  3SDL C;  4HCP B;  5IA7 A;  2LVO A;  1VD2 A;  1NDD A;  1TGZ B;  1ZKH A;  3N30 A;  4ZYN A;  3RZF A;  1WE6 A;  3IG3 A;  3T9L A;  1WGH A;  3RYT A;  4TQ0 A;  4GN1 A;  3VTW A;  1GJZ A;  4IG7 B;  4MJS B;  4EUT A;  3OJ4 B;  1AAR A;  1GNU A;  2AL3 A;  4LDT B;  1WJU A;  5LXH A;  4A3O A;  1G6J A;  2JZ3 B;  3VQI A;  4EZL A;  3WAM A;  2L0T A;  4FAD A;  3SHQ A;  2D10 A;  1LXD A;  2C7H A;  2ZPY A;  3KUZ A;  3L08 A;  5KHQ A;  2K39 A;  1YD8 U;  2M17 A;  2W9N A;  3A4R A;  3PTF C;  5D6J B;  4G3X B;  2MQJ A;  3A33 B;  4MSQ B;  4KVG B;  4K81 A;  4TV3 A;  4DHZ B;  2ZJD A;  3M3J A;  4GDK B;  2DHZ A;  2L0F A;  4EZK A;  2C7N B;  2D11 A;  2KLG A;  2NPT B;  3QC8 B;  3QAQ A;  3CF6 E;  4DHJ B;  1NBF C;  1WY8 A;  2KDI A;  2UWQ A;  4GGQ A;  2GMI C;  3KUC B;  4KDL B;  1UEL A;  1UZX B;  5AZH A;  3V6C B;  3W1Y A;  4DHZ E;  2C60 A;  2PE9 A;  3N3K B;  3KUD B;  4BBN C;  3NS8 A;  5BO4 B;  2BYE A;  3L17 A;  3IVF A;  4AJY B;  3NZS A;  4I6L B;  3DBR I;  4XZ4 A;  2WX0 A;  1RFA A;  1RAX A;  4X57 B;  2WX1 A;  4EZJ A;  4NAW B;  3H9D A;  5CTR C;  1VCB A;  2DZI A;  4MEM A;  4DDI D;  2MBB B;  2YVC A;  3H6N A;  3I3T B;  2K25 A;  3OJ3 A;  4JLC A;  1WGD A;  2JZZ A;  2IO3 B;  4AJW A;  5J18 A;  5E6O A;  3VXW A;  3KVF B;  1WZ0 A;  2MBH A;  2MCN B;  1WR1 A;  2LAS A;  3H7P A;  1YX6 B;  2NVU I;  3UGB B;  1HE8 A;  2KQ7 A;  2BPS A;  2N7D A;  2NCN A;  2EMT A;  2DAJ A;  4P7I A;  1IPG A;  1V80 A;  1V9J A;  2O6V B;  2KOX A;  1E7V A;  2REX A;  1Z2M A;  5IAA C;  3U30 A;  3ZKJ C;  4W9K A;  4ICV A;  2FCN A;  3A9K B;  2M8S A;  2RR9 A;  3H7S A;  2K6Q A;  4OVV A;  3DOW A;  3TIX A;  4ANU A;  2CU1 A;  4HWI B;  3AU5 A;  4ZRK A;  1P3Q U;  4EOY A;  2PE6 B;  2A4Z A;  1LFD A;  2PEA A;  1D3Z A;  2BWE S;  2JPH A;  1M94 A;  5E6N A;  3PSE B;  4K7U A;  1WIA A;  4II2 B;  4NJ6 A;  4WQO B;  4II3 B;  1WFY A;  3ZIM A;  3VUX A;  2KC1 A;  3X0W A;  5GMV A;  2K1F A;  3DVN V;  4W9C A;  2FNJ B;  3S2A A;  4ASW C;  3HM6 X;  4K7S A;  5EDS A;  2PJH A;  3VFK A;  2KAN A;  1E8Y A;  4E71 A;  5AZF A;  3VH4 B;  1XQQ A;  2GBR A;  4GMV A;  2XEW A;  3Q3F A;  2JUO A;  3PT2 B;  3W1S A;  2LI5 A;  1X1M A;  3ZW3 A;  3WAL A;  4CO7 A;  2DEN B;  2K6D B;  3W1S C;  4E3C A;  5JHA A;  3TMP B;  5JHB A;  2FCQ A;  4FJZ A;  2KWU B;  2NBW B;  4JQW C;  2CKH B;  1L7Y A;  3ZLZ A;  3ML8 A;  4WAA A;  1C1Y B;  1EUV B;  1WM2 A;  3JW0 X;  2KZR A;  3APD A;  2MP2 A;  4KV2 A;  1OEY A;  2HJ8 A;  3A9J A;  4NAW A;  4LJO B;  2KDE B;  1S1Q B;  2JRI B;  3PLV A;  4F8C B;  5D7G A;  4M8N A;  2G3Q B;  4WWO A;  5J17 A;  1RRB A;  3DVG X;  4GU2 A;  1YX5 B;  1WX8 A;  2XK5 B;  1GG3 A;  3ALB A;  2IYD B;  4JL9 A;  1WJ4 A;  2MA9 B;  3H7P B;  4XC2 A;  2DX5 B;  2LXA A;  2KX3 A;  2ZZP B;  3TJP A;  2KD0 A;  3MTN B;  2IY0 B;  3QIJ A;  4ANW A;  2C5L C;  2KFJ A;  2KTF A;  4BVU C;  2RGF A;  2NBV B;  4G0N B;  4BKS A;  3WA0 A;  2HD5 B;  2KKC A;  4B6W A;  2GOW A;  3AXC A;  4ZRJ A;  3IFW B;  1WR6 E;  2LVP A;  1OQY A;  2J0K A;  1ZW7 A;  2N9P C;  1P0R A;  2VRR B;  3HHM A;  5G2N A;  3WAO A;  3JVZ X;  3V6E B;  4A3P A;  2V3S A;  3B08 A;  2KQS A;  2HTH A;  3JYU A;  3BY4 B;  1WX9 A;  2ZNV B;  3PRP B;  5D94 A;  2NPT A;  2LJ5 A;  3IBE A;  3KW5 B;  4KZ0 A;  3ENE A;  1E90 A;  2RD0 A;  2FAZ A;  4IM0 A;  1SGH A;  4K7W A;  2KJR A;  1KOT A;  4W9D A;  2JXX A;  2R2O A;  1OTR B;  4HJK A;  1LQB A;  3NOB A;  3TBL D;  4HVB A;  3NZU A;  2AWT A;  3PS6 A;  4KSK C;  3VVW B;  2D3G A;  2KXJ A;  2KDF B;  4PYU A;  3UQA A;  4W9J A;  4DHJ D;  1Q5W B;  1IYF A;  1Q1O A;  1U4A A;  4GSW A;  2KJ6 A;  5AZG A;  4GIV A;  2L76 A;  2CS4 A;  3A1Q B;  4NQK E;  2DYO A;  4IM2 A;  4WJQ A;  1NI2 A;  4GDK A;  3PRE A;  4GB9 A;  1E8W A;  1GC7 A;  2N7E A;  3L16 A;  4BKG A;  1J8C A;  2IBI B;  2Z59 B;  3VAW A;  1IP9 A;  1LM8 B;  3PGE A;  4J6I A;  2KJH B;  3ONS A;  3PLU A;  3RUI B;  3AUL A;  2KDB A;  2JWZ A;  2AL6 A;  1R4M I;  2DZK A;  2O6V A;  2KWV B;  3ZRF A;  1UH6 A;  3HK0 A;  4JGH B;  3DBL I;  3UQB A;  1Y8R C;  1I35 A;  2UYZ B;  2BF8 B;  3UIO B;  3NY5 A;  4FA6 A;  2XK5 A;  1C3T A;  1YJ1 A;  2QHO A;  2DYB A;  2GBM A;  2MBQ A;  2NR2 A;  1WMH A;  3VTU A;  1KLV A;  1WGR A;  3ZTC A;  2IO2 B;  2O6V D;  2ZNV C;  3A9J B;  4GOC A;  5CHF A;  2DZM A;  4WWP A;  2BWF A;  4RM8 A;  3KYD D;  2MX2 A;  1OEY J;  3L0W B;  5D2M B;  3D32 A;  3PHX B;  2KVR A;  2ZPN A;  1R4N I;  2LGX A;  2NBU A;  3U7D A;  5DPR A;  2K8H A;  4BBN F;  2LXC A;  1OGW A;  2KFK A;  3JSV A;  3ZNG C;  2ZCC A;  5L95 C;  4PS7 A;  4N9F 4;  4MJS A;  3DBS A;  3ZVV A;  1WXV A;  2KNB A;  3QK0 A;  2BKR B;  4FJY A;  2KWC A;  1EF1 A;  2GBK A;  2L3Z A;  3QQ8 B;  3KH0 A;  3QX1 A;  5DCN A;  1EO6 A;  2EMS A;  2DYM A;  2M1M A;  5CHV C;  4HPM B;  2KMA A;  3V60 A;  3C0R B;  3ML9 A;  4MH0 E;  3TCA A;  3L13 A;  5C1Z A;  2D2Q A;  2L8J A;  2G4S A;  3MHS D;  4IWQ A;  1V5T A;  3WIM A;  4OVU A;  2KHW B;  4B9K A;  4F7Z A;  3OAW A;  2RSU A;  3H1U A;  3P2B A;  4DDG D;  2ZVN A;  3KYC D;  2O2V A;  4W9H A;  2Y5B B;  2MWS B;  2KK8 A;  1EF5 A;  2KFK B;  4WJO A;  4IWP A;  1H8C A;  1WI0 A;  1P9D U;  4G11 A;  1WH3 A;  2B3A A;  4GDL B;  1KM7 A;  2GBN A;  4IWO A;  1Z5S B;  4AP4 C;  4EKU A;  1J19 A;  1CMX B;  2XBB C;  3HIZ A;  3PHW B;  2KLC A;  3PRM B;  3RZW C;  4HPL B;  4EEW A;  3M63 B;  4AWJ A;  1I42 A;  4WJP A;  2KTR B;  2JY6 A;  3DBH I;  3QHT A;  4BOS C;  2HE7 A;  2CHZ A;  1A5R A;  1TZ1 A;  2Z0D B;  5DPW A;  5JZE B;  1RLF A;  1XT9 B;  3R7R A;  4FLH A;  3ZRC A;  1WXA A;  1V49 A;  4AOF A;  3PVL A;  2MRP A;  3VTV A;  3VUW A;  3DQV A;  3Q3J A;  2J7Q B;  2LRU A;  1WF9 A;  1UBQ A;  2J0M A;  2LRW A;  1QZE A;  4LDT D;  4W9E A;  5G55 A;  2V4L A;  1H4R A;  3EFU A;  4IM3 A;  2OOB B;  3VH3 B;  4JIO U;  4KZC A;  3SU8 X;  3A4S C;  3PZD A;  4PS8 A;  4K1R B;  1GUA B;  3DDC B;  3EC8 A;  3EHV A;  3M95 A;  1K8R B;  4W9L A;  4GXB A;  4URK A;  1WXS A;  2JF5 A;  3HM3 A;  4M8M A;  1XD3 B;  2AYO B;  4I6P A;  1FXT B;  3BIN A;  2N4F A;  2BGF A;  2BYF A;  3B1L X;  5LLI A;  2ZCB A;  3WAN A;  2FID A;  4BFR A;  4HLE A;  4FJV B;  2FCM A;  2G4D B;  5HKH A;  2KO3 A;  3OLM D;  2K8C A;  4W9F A;  4EFO A;  4A20 A;  4NJ7 A;  2FIF A;  3WAP A;  5J2R A;  3VHT C;  2KTR A;  4ANX A;  4MGK E; 
#chains in the Genus database with same CATH topology
 4LK0 M;  1S3S G;  1UD7 A;  1MHX A;  2KWD A;  3QJZ A;  1N5X A;  1UBI A;  2WXQ A;  2FUH B;  4ZDV A;  2ZEQ A;  4FUL A;  1SE2 A;  3AE4 B;  3MJ5 A;  2LMC A;  1FFU A;  1WGY A;  2EKE C;  2I1J A;  1E9M A;  1XCQ L;  2M0X A;  3MC8 A;  1TS5 A;  5IP4 D;  2J0J A;  1RM6 C;  4A55 A;  2WXO A;  2WDT B;  2DAF A;  4ZOH C;  4ICU A;  2MW5 A;  3QCA A;  3GZN I;  2QIL A;  2N9E B;  4MSM B;  3AN1 A;  4ANV A;  2RDB C;  3Q3O C;  1TS4 A;  3DPD A;  3EEC A;  3X23 A;  1T0Y A;  4MGI E;  1WZ3 A;  1WGG A;  3K9O B;  3K9P B;  4RM9 A;  3RT3 B;  1B9R A;  1IBX B;  3HRD D;  3DVG Y;  3PV1 A;  4M0W B;  2IDY A;  3R2T A;  1OQR A;  2WXM A;  1NYQ A;  3TEX A;  1P98 A;  4BOZ B;  4ZHP A;  2J42 A;  1Q0W B;  2K0P A;  1VRA B;  1WRD B;  4HDQ A;  2IGG A;  3FAH A;  2LVQ A;  4NNJ B;  1I4P A;  3T8M A;  4HXD A;  4KIK B;  4AUQ C;  3AMZ A;  1JWB D;  2L05 A;  1TTN A;  1ZDX A;  3WCQ A;  3JSV B;  2WDR B;  2JT4 B;  4KDI C;  2CR5 A;  2OJR A;  4FBJ B;  4MDK E;  4PS3 A;  1KF6 B;  2MBE A;  2WWZ A;  3R66 C;  2MBO A;  2BS2 B;  2HJ1 A;  4OZB A;  4NQL B;  1SB3 C;  2LWP A;  2XNA C;  5DPS A;  1B1Z A;  3SDL C;  5IA7 A;  1NDD A;  3N30 A;  4ZYN A;  1ZXH A;  2JXT A;  1WGH A;  1JW9 D;  1GJZ A;  4IG7 B;  3GS2 A;  4MJS B;  1AAR A;  4LDT B;  1E0Z A;  3SHQ A;  4KKJ A;  1LXD A;  1PDX A;  2C7H A;  1GB1 A;  2WQY B;  2W9N A;  1KTK A;  2N0S B;  3N20 C;  4N6E B;  4K81 A;  4TV3 A;  3N1X C;  1M4V A;  4EZK A;  4ZRP A;  2DHZ A;  2L1A A;  3TEZ A;  2KLG A;  2NPT B;  3ZJU A;  1NYR A;  4DHJ B;  4GGQ A;  1UZX B;  4IDI A;  3Q8C A;  4LNF A;  2BYE A;  3L17 A;  3DBR I;  4XZ4 A;  4C4V B;  4EZJ A;  1RFA A;  1FNW A;  2DZI A;  2IGH A;  3H6N A;  3OJ3 A;  1WGD A;  1L6V A;  3VR9 B;  1BXT A;  1QT9 A;  3P4S B;  3KVF B;  1WZ0 A;  2W54 A;  1YX6 B;  2QJL A;  2BPS A;  2DAJ A;  3HVZ A;  1YN4 A;  1SSN A;  2WU2 B;  5IAA C;  3VRB B;  3A9K B;  1J7A A;  2RR9 A;  2K6Q A;  4OVV A;  3TIX A;  2CU1 A;  5I4D A;  2OHF A;  4EOY A;  2PEA A;  1D3Z A;  1M94 A;  1WIA A;  4II2 B;  3ZGZ A;  4WQO B;  4YTN B;  1WFY A;  2XEW A;  3MFG A;  3Q3F A;  3W5U B;  2LI5 A;  5FKA C;  1X1M A;  4CO7 A;  1ET6 A;  3W1S C;  2K9X A;  2OJW A;  2KWU B;  2CKH B;  4M01 A;  1F52 A;  1SJE D;  4LJO B;  1S1Q B;  2M0A A;  4F8C B;  1JQ4 A;  5C2T B;  1RRB A;  1JWU D;  3DVG X;  3KWV A;  2XK5 B;  1GG3 A;  3NVV A;  4JL9 A;  3RN9 C;  2W3R A;  4YT0 B;  2LXA A;  4S0R A;  1GB4 A;  2NBV B;  4C4V A;  3AE3 B;  4B6W A;  3IFW B;  2N9L A;  2LVP A;  1OQY A;  2N9P C;  1ZW7 A;  2VRR B;  3JVZ X;  2V3S A;  3B08 A;  1L0Y B;  2CJO A;  5HFY A;  2CU3 A;  3ENE A;  1SGH A;  4K7W A;  4HJK A;  1OTR B;  3NOB A;  3RNG C;  2D3G A;  4PYU A;  4DHJ D;  2KAJ A;  2WXP A;  4OW0 A;  1IYF A;  4GSW A;  5AZG A;  1XXG A;  4GIV A;  5BMG A;  4IM2 A;  5BYQ A;  3B9J A;  5H8Y E;  1CK1 A;  1MPE A;  4GDK A;  1E8W A;  1GC7 A;  2N7E A;  1LM8 B;  3PGE A;  3EFC A;  3ONS A;  1I7H A;  2O6V A;  2ACZ B;  3RNB C;  1KRH A;  2BT6 A;  2W55 A;  1OQQ A;  3EUB 2;  3UIO B;  1YJ1 A;  2KT7 A;  3NVZ A;  2O6V D;  4GOC A;  4P16 A;  4REZ A;  1Y56 A;  2MX2 A;  3IT6 B;  1P7F A;  3P4P B;  1E6E B;  2NBU A;  3U7D A;  2LXC A;  1OGW A;  2KFK A;  3AE8 B;  4N9F 4;  1I4Q A;  2KNB A;  4YSX B;  2QEJ C;  4FJY A;  3H8H A;  2PLP A;  3KH0 A;  1EO6 A;  2EMS A;  3ZXV A;  2MJ3 A;  2M1M A;  5CHV C;  2KAC A;  1EWY C;  2G4S A;  1XO3 A;  1V5T A;  1DYQ A;  2INP E;  3OAW A;  2RSU A;  1D6E C;  1D5X C;  3DBL B;  3ABV B;  1ZXI A;  1CZP A;  4ZHO A;  3TEW A;  1H8C A;  4G11 A;  2B3A A;  1XLO A;  4GDL B;  2WDQ B;  2KLC A;  3RZW C;  1HXY D;  4EEW A;  1I42 A;  4AWJ A;  4RNA A;  3DBH I;  1AYF A;  3QHT A;  3SR6 A;  3SFE B;  5DPW A;  1RLF A;  3U7Z A;  3PVL A;  4JE3 B;  3VTV A;  3DQV A;  1JRO A;  2PIA A;  1RYJ A;  1UBQ A;  2J0M A;  5G55 A;  2GLS A;  3VH3 B;  4KZC A;  3SU8 X;  4XWW A;  2D3B A;  3EC8 A;  4W9L A;  4KX6 B;  4URK A;  2JF5 A;  2INN E;  4M8M A;  4H2A A;  3J9C A;  1FXT B;  2N4F A;  3AEF B;  1WRI A;  4FJV B;  1JML A;  2FIF A;  3I63 C;  3VHT C;  5J2R A;  2KTR A;  4ANX A;  2DLB A;  1C4A A;  3B2F A;  3ZJV A;  3R2I A;  2LZ6 A;  3FKY A;  3BK1 A;  1XLP A;  4E74 A;  2BKF A;  3QA8 A;  3MHZ A;  1V6E A;  2M56 B;  2I1K A;  3AI5 A;  4YL8 A;  4NY0 A;  4KIK A;  4YSY B;  1SIJ A;  1WE7 A;  2CHW A;  2MLB A;  1TKG A;  3BVG A;  4M0W A;  3P1M A;  3U8Z A;  5BMH A;  1IGC A;  3VRA B;  3N1Z C;  3BII D;  2LGD A;  2WDV B;  3DBR B;  5CHW A;  2WXH A;  5GXG B;  3ZNI D;  1DOX A;  4RFB A;  3SD5 A;  2RMM A;  1P1A A;  3ECI A;  2ZW0 A;  2HDE A;  4LNO A;  1HA5 A;  2KN5 A;  3W2D A;  3QWZ B;  2G45 B;  4MGY E;  4W9I A;  5FR3 A;  1EWC A;  4MT5 A;  1SIF A;  2CHX A;  2EKI A;  3C8Y A;  2LUM A;  2D07 B;  4FHK A;  1STE A;  3NHE B;  3CSF A;  1L4D B;  2XN9 C;  3VDZ A;  2Z0E B;  2GBJ A;  1ZGU B;  2PPH A;  2W82 A;  2LUE A;  4IC7 B;  4A9A A;  1E7P B;  2K8B A;  1MG8 A;  4ACF A;  1YMH E;  4LNN A;  1ZUD 2;  1WMH B;  2KQ4 X;  1FPY A;  5BMI A;  4ZRI A;  4DXG A;  2N9X A;  1K51 A;  4RGM A;  2BS4 B;  3APC A;  3ZDT A;  4LNK A;  3NRZ A;  5L83 A;  3AU4 A;  3PRZ A;  3RI7 C;  3M62 B;  3A1Q A;  4TUU A;  1N6Z A;  4XX5 A;  1IBX A;  3APF A;  2ZW1 A;  1XCT L;  5H92 C;  2I38 A;  4BKT A;  2R2Q A;  3NVY A;  3Q8E A;  5AEK B;  1V1P A;  2FUG 1;  4DXA B;  3I5J C;  1QKZ A;  2RPQ A;  2VH2 A;  3RCZ A;  2N1W A;  1D5Z C;  1ZKH A;  2G1E A;  1MG4 A;  3RZF A;  2R61 A;  1WE6 A;  3IG3 A;  3RYT A;  4RH6 A;  4EUT A;  2AL3 A;  1WJU A;  1G6J A;  2JZ3 B;  2SEB D;  5AUK A;  4M02 A;  3VQI A;  2L0T A;  4FAD A;  2D10 A;  4NZL B;  3AE6 B;  3KUZ A;  3L08 A;  2K39 A;  3PTF C;  3A4R A;  3AEA B;  4G3X B;  2MHJ A;  2KVZ A;  2MQJ A;  4MSQ B;  2D3C A;  1F2R I;  2C7N B;  3NVW A;  3QC8 B;  1TKY A;  4KDL B;  2GMI C;  2C60 A;  1VZ8 A;  2PKO A;  4XE0 A;  3IVF A;  3IAS 1;  1RAX A;  4NAW B;  1MVK A;  3EGR A;  4IOI E;  2MBB B;  2OED A;  5J18 A;  1VJK A;  2MCN B;  3UGB B;  3H7P A;  1FRR A;  1FRD A;  3P4R B;  2PMV A;  4P7I A;  2O6V B;  4RGN A;  1Z2M A;  3U30 A;  4ICV A;  1FO4 A;  1SE3 A;  3DOW A;  3HVD A;  1TY2 A;  2PE6 B;  2A4Z A;  1ZOY B;  3SEB A;  4GLS C;  4K7U A;  4NJ6 A;  4II3 B;  4HEA 1;  3ZIM A;  3PZ7 A;  2JYT A;  2KC1 A;  3Q69 A;  3X0W A;  1FEH A;  3RPF C;  4K7S A;  2PJH A;  2WHI A;  5EE1 A;  3P63 A;  1SJH D;  2YEP B;  5AZF A;  3Q2A C;  3VH4 B;  2Z8L A;  1UWX A;  3PT2 B;  3WAL A;  2N7J A;  1FCC C;  1MJD A;  1XEE A;  4JQW C;  3ML8 A;  4WAA A;  2WXJ A;  1YJJ A;  2V3N A;  1HQR D;  3ZYY X;  3APD A;  2Y5C A;  3E56 A;  3CIR B;  4NAW A;  2KDE B;  4M8N A;  1FIQ A;  5J17 A;  3FIL B;  1QF6 A;  1YX5 B;  2WXL A;  1WJ4 A;  2MA9 B;  3H7P B;  2DX5 B;  2GI9 A;  2LHD A;  3MC0 B;  1UUP A;  3MTN B;  2C5L C;  4RGT A;  2RGF A;  2D3A A;  4G0N B;  3WA0 A;  3RNF C;  1QOF A;  1TT5 B;  1YN5 A;  5G2N A;  1L4Z B;  1DOY A;  3BY4 B;  1PUT A;  3PRP B;  2NPT A;  4ITK A;  1T0S C;  2D5G A;  2RD0 A;  4HPP A;  2WLB A;  1LQB A;  3TBL D;  3NZU A;  3VVW B;  2KXJ A;  3UQA A;  3BZD B;  4P6V F;  2DYO A;  1DGJ A;  1CQV A;  1NI2 A;  3VR8 B;  3PRE A;  4BKG A;  2Z59 B;  4US8 A;  4J6I A;  3BYT B;  2KJH B;  3PLU A;  3AUL A;  2KDB A;  4XDC A;  3ZRF A;  1N61 A;  2KWV B;  1UH6 A;  3HK0 A;  3GE8 C;  1I4X A;  3BWU D;  2LJI A;  4WWM A;  2BF8 B;  3NY5 A;  4FA6 A;  2WXG A;  2QHO A;  1WGR A;  3W9C B;  1ENF A;  3IT4 B;  2DZM A;  2BWF A;  5D2M B;  2MH7 A;  2KVR A;  2ZPN A;  3HUI A;  4PS7 A;  1WWT A;  5HI1 A;  3DBS A;  3ZQ4 A;  4HJG E;  5IN7 A;  3ZVV A;  3QK0 A;  2KWC A;  2GBK A;  2DWQ A;  1VZ7 A;  4P1C C;  4N58 A;  3C0R B;  3TCA A;  1DOI A;  3MHS D;  4OVU A;  1ZPS A;  2KHW B;  4F7Z A;  3H1U A;  3P2B A;  4DDG D;  2ZVN A;  4WUR A;  1EF5 A;  1PFD A;  1FFV A;  4O1N A;  1P9D U;  2E3T A;  1KM7 A;  4IWO A;  1Z5S B;  2G9H D;  1J19 A;  2IJ0 A;  3HIZ A;  3PHW B;  4HPL B;  1HZ5 A;  3EA6 A;  4FLH A;  1IUE A;  4MM3 B;  1V49 A;  4AOF A;  2KDM A;  3VUW A;  3R8B A;  2J7Q B;  2LRW A;  1QZE A;  2LEK A;  4W9E A;  1H4R A;  1T0R C;  1GUA B;  3DDC B;  3EHV A;  2X8X X;  1VLB A;  1K8R B;  2BYT A;  1FNU A;  1FM0 D;  4OZA A;  2AYO B;  4I6P A;  3BIN A;  3AE2 B;  2BGF A;  5LLI A;  2ZCB A;  4C00 A;  1VDV A;  4WQM A;  4EE2 A;  2FCM A;  2G4D B;  3AM9 A;  2KO3 A;  2K8C A;  1QIL A;  2WXK A;  5BYS A;  1ZDV A;  1TBE A;  1J0G A;  1SEB D;  3MC9 A;  4AS1 A;  2KC2 A;  3RNA C;  3N32 A;  3ZNH B;  3UIN B;  1WJN A;  4G50 A;  2LD9 A;  3IHP C;  3ZO5 B;  1V1O A;  2NTT A;  4ARI A;  2VZK D;  2M19 A;  5D3I B;  2LGS A;  4PT5 A;  5CX3 A;  3L54 A;  3LJ3 A;  4XGA B;  1C78 A;  3PPA A;  2C9W B;  3LXF A;  3QAR A;  1V97 A;  5LXI B;  3ZUN A;  2MP2 B;  2FCS A;  2L00 B;  3U4E G;  4MEL A;  2V4I B;  4YSZ B;  1TS3 A;  2ZVO A;  4DWF A;  4WJN A;  2YLM A;  4S17 A;  3N9Y C;  3UF8 A;  5C23 A;  4BKS D;  1NI3 A;  1C4P A;  3CMM B;  2HTM E;  4NPN A;  1KJT A;  1XF5 L;  2LGY A;  1WM3 A;  4MM3 A;  1T0Q C;  4LNI A;  4CYE A;  3RUL A;  1MHH E;  2BTE A;  1ZP0 B;  2JYE A;  1V81 A;  2IZV B;  2K3U A;  1L0V B;  3DVN U;  2H88 B;  2VH1 A;  4IW0 A;  3UI3 A;  3O65 B;  1VR9 A;  4C56 C;  1TZO A;  1YOV B;  2AEH A;  1ISN A;  4TKN A;  3ZNZ B;  3LDZ E;  2YEP F;  4DBG A;  5TR5 A;  3AE5 B;  3Q3M C;  1E8Z A;  2LGI A;  1AN8 A;  3V62 A;  1EU4 A;  1F0Z A;  2JVC A;  2IO1 B;  2M4N A;  1YIW A;  3GOE A;  4RMA A;  5FR6 A;  2KX0 A;  2JRH A;  1WYW B;  1BT0 A;  5KHO A;  4TQ1 A;  2IY1 B;  1AW7 A;  1GC6 A;  4YTM B;  1SE9 A;  2WYQ A;  1C79 A;  3CST A;  2MSE D;  1F2R C;  1V5O A;  4HK2 A;  4HRO A;  1AWD A;  4PYZ A;  3MJW A;  4HCP B;  3NZ3 A;  3I57 A;  2AQ1 B;  2LVO A;  1VD2 A;  1TGZ B;  2GRI A;  2K5P A;  4TQ0 A;  4GN1 A;  4KGS A;  1GNU A;  2E6X A;  1UWM A;  4A3O A;  4EZL A;  3WAM A;  4C7Z A;  1FD6 A;  5HG2 A;  5KHQ A;  5D6J B;  3A33 B;  4DHZ B;  2ZJD A;  3M3J A;  2K22 A;  4GDK B;  2L0F A;  1ZE3 D;  1KH0 A;  3Q8A A;  3CF6 E;  2KDI A;  2UWQ A;  4DHZ E;  3KUC B;  3V6C B;  5AZH A;  4WIP A;  4BBN C;  3N3K B;  3KUD B;  3NS8 A;  5BO4 B;  3NZS A;  4C80 A;  4I6L B;  2WX0 A;  4X57 B;  1JRP A;  5CTR C;  4OVZ A;  1GAQ B;  4MEM A;  2YVC A;  1HTQ A;  4K3B A;  2K25 A;  1JWS D;  2JZZ A;  3OG5 A;  2FE8 A;  1WR1 A;  2LAS A;  2NVU I;  3AEE B;  1HE8 A;  4USA A;  1IPG A;  2KOX A;  1E7V A;  5IKC M;  4KGR A;  2FCN A;  2W3S A;  4C7Y A;  5MPO A;  3H7S A;  2WXR A;  4HWI B;  4JWS C;  4MAC A;  1NEN B;  4B0E A;  3SFD B;  1UNS A;  2BWE S;  2JPH A;  3PSE B;  1A70 A;  4TMA B;  3VUX A;  3C19 A;  4W9C A;  1MI0 A;  2FNJ B;  3S2A A;  2B76 B;  3HM6 X;  5EDS A;  4Q2J A;  3VFK A;  1E8Y A;  4ARC A;  2RDH A;  1XQQ A;  4JX1 C;  2GBR A;  4GMV A;  2JQR B;  2JUO A;  2X38 A;  1FNV A;  3W1S A;  3ZW3 A;  2DEN B;  2K6D B;  2PVO D;  3DWG C;  1TIF A;  5JHB A;  2NBW B;  4KGT A;  3GP7 A;  3ZLZ A;  1C1Y B;  3FC4 A;  1ROE A;  2KZR A;  2WXN A;  1OEY A;  2JRI B;  2BB5 A;  5D7G A;  2G3Q B;  2DNF A;  2WNM A;  1ACC A;  3RFZ B;  1JAL A;  1QOG A;  1PYW D;  4GU2 A;  2IYD B;  3TEY A;  4YWG G;  4RF0 A;  2CJN A;  2KX3 A;  4BVU C;  2UU7 A;  3ZXR A;  4BKS A;  2HD5 B;  3B2G A;  3DHH C;  3AXC A;  1WR6 E;  1F1H A;  1P0R A;  1HZ6 A;  3V6E B;  2WGS A;  1C4C A;  2IGD A;  1C76 A;  4HKQ A;  2FAZ A;  4IM0 A;  4W9D A;  2JXX A;  1BML C;  4KSK C;  3V3X A;  4FXC A;  3U2S C;  1TS2 A;  1U4A A;  2KJ6 A;  3AE1 B;  3A1Q B;  1C9F A;  3Q14 C;  4WJQ A;  3BVZ A;  2WP9 B;  5TSS A;  3L16 A;  3VAW A;  2WXF A;  2AL6 A;  1R4M I;  3UQB A;  2UYZ B;  3KWL A;  2XK5 A;  1PGB A;  2DYB A;  2MBQ A;  2NR2 A;  1WMH A;  3VTU A;  4K3C A;  2ZNV C;  3A9J B;  5CHF A;  4WWP A;  3CWI A;  3KYD D;  4RM8 A;  1FXI A;  1EU3 A;  3D32 A;  2PTL A;  3PHX B;  2JX5 A;  2LGX A;  5LNK 1;  3KLS X;  2K8H A;  5DPR A;  4BBN F;  2WXI A;  3JSV A;  3ZJT A;  2ZCC A;  5L95 C;  1EM7 A;  3P42 A;  1WXV A;  2BB6 A;  2BKR B;  3QQ8 B;  2AQ3 B;  2LFI A;  1D4B A;  2DYM A;  4HRS A;  3AE7 B;  1SF0 A;  1FXA A;  1Q10 A;  3L13 A;  1KLG D;  4YTP B;  2L8J A;  4IWQ A;  3WIM A;  1L6U A;  3NS1 A;  3KYC D;  2O2V A;  4W9H A;  1BUI C;  2Y5B B;  2KK8 A;  1D5M C;  3NUH B;  4WJO A;  3N1Y C;  2GBN A;  4EKU A;  4AP4 C;  2EEL A;  2XBB C;  3AEC B;  2HE7 A;  4BZA A;  1A5R A;  2FBW B;  1XT9 B;  2J53 A;  4L23 A;  5E6J A;  1LGR A;  1WXA A;  2GB1 A;  3NG0 A;  2MRP A;  3T3N A;  3Q3J A;  2LRU A;  4KKI A;  4LDT D;  1GOZ A;  3TUO A;  1WGK A;  3DWM A;  5T8I A;  1YNT E;  2V4L A;  3EFU A;  1FMA D;  4JIO U;  1I4G A;  3PZD A;  1N63 A;  4NJC A;  3M95 A;  1PGA A;  1WXS A;  4L1B A;  4XYC A;  3HM3 A;  3Q8B A;  1KLU D;  5AUI A;  1XD3 B;  2BYF A;  3B1L X;  3WAN A;  2FID A;  4BFR A;  1UF0 A;  4HLE A;  3LYY A;  1WXQ A;  4EFO A;  4NJ7 A;  2J4X A;  4MGK E;  4I6N B;  3ZTD A;  1E5W A;  2TSS A;  1I4R A;  2BW2 A;  3V61 A;  1WJ6 A;  1T6B X;  1V2Y A;  5DPT A;  1WXM A;  2Y3A A;  1E7U A;  3FIL A;  3R3M A;  3UIP B;  2A5U A;  1E8X A;  1NVI D;  2MJE A;  1N62 A;  3VUY A;  4AQ7 A;  2C7M B;  4R3D A;  1K53 A;  4KSL C;  1YQ3 B;  4ZRQ A;  2ONQ A;  4GDL A;  1WX7 A;  5FK9 C;  2V0G A;  4WWN A;  3IXS A;  1CJE A;  3DCG A;  2L7R A;  4CHK A;  1YJI A;  1F9J A;  3NJT A;  1JCK B;  4D2K A;  4LCD E;  1YQB A;  2BYV E;  2L32 A;  1IGD A;  1R4M B;  4TSS A;  1JRU A;  4DK5 A;  1L2N A;  3AEB B;  5E6P A;  2RPV A;  4W9G A;  4HDO A;  2V9H A;  4HKZ E;  2KMC A;  4OZC A;  1TYG B;  4LJP B;  1PQS A;  2N1V A;  2NS5 A;  3DHG C;  1P7E A;  1JWM D;  3RD2 A;  2BS3 B;  1QQR A;  2ASQ A;  4HCN B;  3W5V B;  2O2V B;  4A90 A;  5JH5 C;  4IUM B;  4B95 A;  1N60 A;  4MGZ E;  3L10 B;  3GE3 C;  1YQ4 B;  1UGM A;  4A6Q A;  4A8X C;  1V1P B;  3R7Q A;  4MH8 A;  4FN2 A;  4NAM A;  1YN3 A;  3AEG B;  3AH7 A;  3Q3N C;  4FHJ A;  2IO0 B;  4US9 A;  2V1Y A;  3TL5 A;  2NMQ A;  1R7S A;  3ZDM C;  4F1S A;  3A9K A;  3E9S A;  2DZJ A;  2SAK A;  1V86 A;  1E10 A;  4UDU C;  3B0A A;  3OWE B;  3RMK C;  2QMT A;  3T9L A;  2MEK A;  3ETR A;  5G5H A;  3VTW A;  1TJE A;  2Q5W D;  3OJ4 B;  5LXH A;  1KFY B;  2ZPY A;  1C77 A;  2IPK D;  1YD8 U;  2M17 A;  1L5P A;  2JWU A;  4KVG B;  2KN4 A;  4RCO A;  2ICI A;  2D11 A;  1WYG A;  4RGO S;  1ESF A;  3QAQ A;  1NBF C;  1WY8 A;  3TSS A;  1UEL A;  3W1Y A;  1WSP A;  1V8C A;  2PE9 A;  3GZN B;  1HEZ E;  2L83 A;  2Y5P A;  4QAY A;  4AJY B;  4PK1 A;  2BQQ A;  2QSD A;  2PW9 A;  2QCZ A;  2LHE A;  2QC8 A;  2WX1 A;  3H9D A;  1VCB A;  4J3O D;  4DDI D;  1RWS A;  3I3T B;  4JLC A;  2DBY A;  2IO3 B;  4AJW A;  5E6O A;  5IO9 A;  4YXD B;  3VXW A;  2MBH A;  4JWU C;  2WS3 B;  2KQ7 A;  5IOI A;  4XWT A;  2N7D A;  2NCN A;  2EMT A;  2KYW A;  1V80 A;  1V9J A;  2AX5 A;  3U52 E;  2REX A;  3ZKJ C;  4W9K A;  2AQ2 B;  2JSV X;  1T3Q A;  2M8S A;  4DXF A;  1VZ6 A;  4ANU A;  3AU5 A;  4ZRK A;  1P3Q U;  1LFD A;  3AB5 A;  2J52 A;  5E6N A;  1XLN A;  5GMV A;  2K1F A;  3DVN V;  4ASW C;  4E71 A;  2KAN A;  2N9K A;  1K50 A;  3T3O A;  1I4H A;  3BVM A;  1OFF A;  4E3C A;  1SXT A;  4B0M A;  5JHA A;  4WAF A;  3TMP B;  2FCQ A;  4FJZ A;  4L2Y A;  1L7Y A;  4JPS A;  3RNE C;  1EUV B;  1WM2 A;  3JW0 X;  5EE3 A;  2V3P A;  2MP2 A;  4KV2 A;  2HJ8 A;  3A9J A;  4BAX A;  2JU6 X;  4OHJ A;  3PLV A;  2VZK B;  1SE4 A;  1L0X B;  4WWO A;  1TY0 A;  4WH4 A;  5G5G A;  2QDF A;  1WX8 A;  3ALB A;  4XC2 A;  1JWA D;  3LB8 C;  2ZZP B;  3TJP A;  4RF1 A;  2KD0 A;  2IY0 B;  3QIJ A;  4ANW A;  1LO5 D;  2KFJ A;  1UGJ A;  2KTF A;  3URY A;  2KKC A;  2GOW A;  1N5W A;  4ZRJ A;  3MP9 A;  1ET9 A;  2J0K A;  4LLG M;  3HHM A;  3WAO A;  4A3P A;  4CQN A;  2KQS A;  2HTH A;  3JYU A;  5EE9 A;  1WX9 A;  2ZNV B;  2WU5 B;  5D94 A;  4KZ0 A;  2LJ5 A;  3IBE A;  3KW5 B;  1HTO A;  1E90 A;  2KJR A;  1KOT A;  2INC C;  2R2O A;  1QOB A;  4HVB A;  5BYR A;  4N59 A;  3PS6 A;  2AWT A;  4LTU A;  1J7C A;  2KDF B;  1TKE A;  2BVC A;  4W9J A;  1Q5W B;  3AV8 A;  1Q1O A;  4DQO C;  3GB1 A;  3DBH B;  2L76 A;  2CS4 A;  4XDD A;  4NQK E;  2RDG A;  1J7B A;  1K52 A;  4GB9 A;  1J8C A;  2IBI B;  3PO0 A;  1IP9 A;  1R4N B;  3RUI B;  2JWZ A;  2DZK A;  4JGH B;  3DBL I;  1Y8R C;  1I35 A;  1RFK A;  1C3T A;  2GBM A;  4P1B C;  1KLV A;  3ZTC A;  2IO2 B;  1MFW A;  1OEY J;  2KMM A;  3L0W B;  5EE0 A;  3O13 A;  2ON8 A;  1R4N I;  2BBC A;  3ZNG C;  3AED B;  3PZ8 A;  4MJS A;  2H89 B;  1EF1 A;  2L3Z A;  3QX1 A;  3Q6B A;  5DCN A;  1QOA A;  4ZYS A;  2JZP A;  4HPM B;  2KMA A;  3V60 A;  3IAM 1;  3ML9 A;  4MH0 E;  5C1Z A;  2D2Q A;  3KQ4 A;  3DHI C;  1FCL A;  5JXV A;  4B9K A;  3I9V 1;  2MJD A;  4IKG A;  2MWS B;  5HHD G;  3AE9 B;  2KFK B;  4IWP A;  1WI0 A;  3P4Q B;  5D3D A;  2PVG C;  1WH3 A;  3BYY B;  1T5X D;  1CMX B;  2I2Y A;  2L52 A;  3PRM B;  3M63 B;  4WJP A;  2KTR B;  2JY6 A;  1GPX A;  4BOS C;  4M00 A;  2CHZ A;  1TZ1 A;  2Z0D B;  5JZE B;  3BK2 A;  3R7R A;  1XLQ A;  3V05 A;  3ZRC A;  3RNC C;  1F77 A;  1WF9 A;  1SBB B;  1QLB B;  4IM3 A;  2OOB B;  3L4P A;  1NEK B;  3A4S C;  4PS8 A;  4K1R B;  4GXB A;  3Q8F A;  2NTS A;  2QIE B;  5HKH A;  3OLM D;  4W9F A;  4A20 A;  5C3J B;  1PGX A;  2IND C;  3WAP A; 
#chains in the Genus database with same CATH homology
 1TBE A;  4I6N B;  2LZ6 A;  1S3S G;  1UD7 A;  1J0G A;  2KC2 A;  3QJZ A;  1UBI A;  2BKF A;  4E74 A;  3QA8 A;  3ZTD A;  1E5W A;  3N32 A;  3ZNH B;  3UIN B;  2FUH B;  4ZDV A;  1WJN A;  1V6E A;  4G50 A;  2LD9 A;  3IHP C;  3V61 A;  2I1K A;  3ZO5 B;  2ZEQ A;  1WJ6 A;  3AI5 A;  4FUL A;  4YL8 A;  4NY0 A;  1V2Y A;  5DPT A;  1WXM A;  4KIK A;  1E7U A;  1WGY A;  5CX3 A;  3L54 A;  3LJ3 A;  3R3M A;  3UIP B;  1WE7 A;  2EKE C;  2CHW A;  2A5U A;  2MLB A;  2I1J A;  2C9W B;  3PPA A;  1E8X A;  3QAR A;  3VUY A;  2C7M B;  2M0X A;  5LXI B;  3ZUN A;  2MP2 B;  2J0J A;  2FCS A;  2L00 B;  4MEL A;  3U8Z A;  4KSL C;  2LGD A;  2WDT B;  2ZVO A;  4GDL A;  4DWF A;  1WX7 A;  2DAF A;  4WJN A;  5CHW A;  4ICU A;  2YLM A;  3ZNI D;  2MW5 A;  4WWN A;  3DCG A;  3SD5 A;  3UF8 A;  1P1A A;  2L7R A;  3ECI A;  5C23 A;  4BKS D;  4CHK A;  1F9J A;  3CMM B;  3QCA A;  3GZN I;  2KN5 A;  2N9E B;  4NPN A;  3QWZ B;  2G45 B;  4MGY E;  4W9I A;  1KJT A;  4MSM B;  2LGY A;  1WM3 A;  4LCD E;  1YQB A;  4MM3 A;  1SIF A;  2BYV E;  4CYE A;  3RUL A;  2CHX A;  4ANV A;  2D07 B;  4FHK A;  1JRU A;  1V81 A;  2IZV B;  3NHE B;  4DK5 A;  1L2N A;  3CSF A;  3DVN U;  5E6P A;  4W9G A;  3VDZ A;  3DPD A;  3EEC A;  3X23 A;  1T0Y A;  4MGI E;  4HDO A;  2Z0E B;  2GBJ A;  1ZGU B;  2PPH A;  1WZ3 A;  4IW0 A;  2LUE A;  4IC7 B;  1WGG A;  2KMC A;  3K9O B;  3O65 B;  2K8B A;  1MG8 A;  3K9P B;  4RM9 A;  4LJP B;  1PQS A;  2N1V A;  2NS5 A;  3RT3 B;  3PV1 A;  3DVG Y;  2AEH A;  3RD2 A;  4M0W B;  1WMH B;  4HCN B;  2ASQ A;  1ISN A;  4TKN A;  3ZNZ B;  2O2V B;  4ZRI A;  5JH5 C;  3LDZ E;  4IUM B;  1P98 A;  4DBG A;  4BOZ B;  2N9X A;  4B95 A;  5TR5 A;  4MGZ E;  3L10 B;  1E8Z A;  1Q0W B;  1WRD B;  1UGM A;  3V62 A;  4HDQ A;  3APC A;  3ZDT A;  2LVQ A;  4NNJ B;  5L83 A;  2JVC A;  3AU4 A;  3PRZ A;  3R7Q A;  2IO1 B;  2M4N A;  3M62 B;  3A1Q A;  4HXD A;  4TUU A;  1YIW A;  4KIK B;  4XX5 A;  3T8M A;  4AUQ C;  2L05 A;  3GOE A;  4FN2 A;  3APF A;  1TTN A;  4RMA A;  5FR6 A;  2KX0 A;  2JRH A;  1WYW B;  1BT0 A;  5KHO A;  3JSV B;  4FHJ A;  2IY1 B;  4TQ1 A;  4BKT A;  2R2Q A;  2IO0 B;  2JT4 B;  1GC6 A;  4KDI C;  2CR5 A;  2V1Y A;  5AEK B;  3TL5 A;  1SE9 A;  2OJR A;  3ZDM C;  4FBJ B;  4F1S A;  3A9K A;  4MDK E;  4DXA B;  4PS3 A;  2DZJ A;  2WYQ A;  3CST A;  2MBE A;  2WWZ A;  1V86 A;  3R66 C;  2MSE D;  1V5O A;  2MBO A;  4HK2 A;  3B0A A;  2RPQ A;  4NQL B;  2LWP A;  3MJW A;  4PYZ A;  5DPS A;  3RCZ A;  2N1W A;  3SDL C;  4HCP B;  5IA7 A;  2LVO A;  1VD2 A;  1NDD A;  1TGZ B;  1ZKH A;  3N30 A;  4ZYN A;  3RZF A;  1WE6 A;  3IG3 A;  3T9L A;  1WGH A;  3RYT A;  4TQ0 A;  4GN1 A;  3VTW A;  1GJZ A;  4IG7 B;  4MJS B;  4EUT A;  3OJ4 B;  1AAR A;  1GNU A;  2AL3 A;  4LDT B;  1WJU A;  5LXH A;  4A3O A;  1G6J A;  2JZ3 B;  3VQI A;  4EZL A;  3WAM A;  2L0T A;  4FAD A;  3SHQ A;  2D10 A;  1LXD A;  2C7H A;  2ZPY A;  3KUZ A;  3L08 A;  5KHQ A;  2K39 A;  1YD8 U;  2M17 A;  2W9N A;  3A4R A;  3PTF C;  5D6J B;  4G3X B;  2MQJ A;  3A33 B;  4MSQ B;  4KVG B;  4K81 A;  4TV3 A;  4DHZ B;  2ZJD A;  3M3J A;  4GDK B;  2DHZ A;  2L0F A;  4EZK A;  2C7N B;  2D11 A;  2KLG A;  2NPT B;  3QC8 B;  3QAQ A;  3CF6 E;  4DHJ B;  1NBF C;  1WY8 A;  2KDI A;  2UWQ A;  4GGQ A;  2GMI C;  3KUC B;  4KDL B;  1UEL A;  1UZX B;  5AZH A;  3V6C B;  3W1Y A;  4DHZ E;  2C60 A;  2PE9 A;  3N3K B;  3KUD B;  4BBN C;  3NS8 A;  5BO4 B;  2BYE A;  3L17 A;  3IVF A;  4AJY B;  3NZS A;  4I6L B;  3DBR I;  4XZ4 A;  2WX0 A;  1RFA A;  1RAX A;  4X57 B;  2WX1 A;  4EZJ A;  4NAW B;  3H9D A;  5CTR C;  1VCB A;  2DZI A;  4MEM A;  4DDI D;  2MBB B;  2YVC A;  3H6N A;  3I3T B;  2K25 A;  3OJ3 A;  4JLC A;  1WGD A;  2JZZ A;  2IO3 B;  4AJW A;  5J18 A;  5E6O A;  3VXW A;  3KVF B;  1WZ0 A;  2MBH A;  2MCN B;  1WR1 A;  2LAS A;  3H7P A;  1YX6 B;  2NVU I;  3UGB B;  1HE8 A;  2KQ7 A;  2BPS A;  2N7D A;  2NCN A;  2EMT A;  2DAJ A;  4P7I A;  1IPG A;  1V80 A;  1V9J A;  2O6V B;  2KOX A;  1E7V A;  2REX A;  1Z2M A;  5IAA C;  3U30 A;  3ZKJ C;  4W9K A;  4ICV A;  2FCN A;  3A9K B;  2M8S A;  2RR9 A;  3H7S A;  2K6Q A;  4OVV A;  3DOW A;  3TIX A;  4ANU A;  2CU1 A;  4HWI B;  3AU5 A;  4ZRK A;  1P3Q U;  4EOY A;  2PE6 B;  2A4Z A;  1LFD A;  2PEA A;  1D3Z A;  2BWE S;  2JPH A;  1M94 A;  5E6N A;  3PSE B;  4K7U A;  1WIA A;  4II2 B;  4NJ6 A;  4WQO B;  4II3 B;  1WFY A;  3ZIM A;  3VUX A;  2KC1 A;  3X0W A;  5GMV A;  2K1F A;  3DVN V;  4W9C A;  2FNJ B;  3S2A A;  4ASW C;  3HM6 X;  4K7S A;  5EDS A;  2PJH A;  3VFK A;  2KAN A;  1E8Y A;  4E71 A;  5AZF A;  3VH4 B;  1XQQ A;  2GBR A;  4GMV A;  2XEW A;  3Q3F A;  2JUO A;  3PT2 B;  3W1S A;  2LI5 A;  1X1M A;  3ZW3 A;  3WAL A;  4CO7 A;  2DEN B;  2K6D B;  3W1S C;  4E3C A;  5JHA A;  3TMP B;  5JHB A;  2FCQ A;  4FJZ A;  2KWU B;  2NBW B;  4JQW C;  2CKH B;  1L7Y A;  3ZLZ A;  3ML8 A;  4WAA A;  1C1Y B;  1EUV B;  1WM2 A;  3JW0 X;  2KZR A;  3APD A;  2MP2 A;  4KV2 A;  1OEY A;  2HJ8 A;  3A9J A;  4NAW A;  4LJO B;  2KDE B;  1S1Q B;  2JRI B;  3PLV A;  4F8C B;  5D7G A;  4M8N A;  2G3Q B;  4WWO A;  5J17 A;  1RRB A;  3DVG X;  4GU2 A;  1YX5 B;  1WX8 A;  2XK5 B;  1GG3 A;  3ALB A;  2IYD B;  4JL9 A;  1WJ4 A;  2MA9 B;  3H7P B;  4XC2 A;  2DX5 B;  2LXA A;  2KX3 A;  2ZZP B;  3TJP A;  2KD0 A;  3MTN B;  2IY0 B;  3QIJ A;  4ANW A;  2C5L C;  2KFJ A;  2KTF A;  4BVU C;  2RGF A;  2NBV B;  4G0N B;  4BKS A;  3WA0 A;  2HD5 B;  2KKC A;  4B6W A;  2GOW A;  3AXC A;  4ZRJ A;  3IFW B;  1WR6 E;  2LVP A;  1OQY A;  2J0K A;  1ZW7 A;  2N9P C;  1P0R A;  2VRR B;  3HHM A;  5G2N A;  3WAO A;  3JVZ X;  3V6E B;  4A3P A;  2V3S A;  3B08 A;  2KQS A;  2HTH A;  3JYU A;  3BY4 B;  1WX9 A;  2ZNV B;  3PRP B;  5D94 A;  2NPT A;  2LJ5 A;  3IBE A;  3KW5 B;  4KZ0 A;  3ENE A;  1E90 A;  2RD0 A;  2FAZ A;  4IM0 A;  1SGH A;  4K7W A;  2KJR A;  1KOT A;  4W9D A;  2JXX A;  2R2O A;  1OTR B;  4HJK A;  1LQB A;  3NOB A;  3TBL D;  4HVB A;  3NZU A;  2AWT A;  3PS6 A;  4KSK C;  3VVW B;  2D3G A;  2KXJ A;  2KDF B;  4PYU A;  3UQA A;  4W9J A;  4DHJ D;  1Q5W B;  1IYF A;  1Q1O A;  1U4A A;  4GSW A;  2KJ6 A;  5AZG A;  4GIV A;  2L76 A;  2CS4 A;  3A1Q B;  4NQK E;  2DYO A;  4IM2 A;  4WJQ A;  1NI2 A;  4GDK A;  3PRE A;  4GB9 A;  1E8W A;  1GC7 A;  2N7E A;  3L16 A;  4BKG A;  1J8C A;  2IBI B;  2Z59 B;  3VAW A;  1IP9 A;  1LM8 B;  3PGE A;  4J6I A;  2KJH B;  3ONS A;  3PLU A;  3RUI B;  3AUL A;  2KDB A;  2JWZ A;  2AL6 A;  1R4M I;  2DZK A;  2O6V A;  2KWV B;  3ZRF A;  1UH6 A;  3HK0 A;  4JGH B;  3DBL I;  3UQB A;  1Y8R C;  1I35 A;  2UYZ B;  2BF8 B;  3UIO B;  3NY5 A;  4FA6 A;  2XK5 A;  1C3T A;  1YJ1 A;  2QHO A;  2DYB A;  2GBM A;  2MBQ A;  2NR2 A;  1WMH A;  3VTU A;  1KLV A;  1WGR A;  3ZTC A;  2IO2 B;  2O6V D;  2ZNV C;  3A9J B;  4GOC A;  5CHF A;  2DZM A;  4WWP A;  2BWF A;  4RM8 A;  3KYD D;  2MX2 A;  1OEY J;  3L0W B;  5D2M B;  3D32 A;  3PHX B;  2KVR A;  2ZPN A;  1R4N I;  2LGX A;  2NBU A;  3U7D A;  5DPR A;  2K8H A;  4BBN F;  2LXC A;  1OGW A;  2KFK A;  3JSV A;  3ZNG C;  2ZCC A;  5L95 C;  4PS7 A;  4N9F 4;  4MJS A;  3DBS A;  3ZVV A;  1WXV A;  2KNB A;  3QK0 A;  2BKR B;  4FJY A;  2KWC A;  1EF1 A;  2GBK A;  2L3Z A;  3QQ8 B;  3KH0 A;  3QX1 A;  5DCN A;  1EO6 A;  2EMS A;  2DYM A;  2M1M A;  5CHV C;  4HPM B;  2KMA A;  3V60 A;  3C0R B;  3ML9 A;  4MH0 E;  3TCA A;  3L13 A;  5C1Z A;  2D2Q A;  2L8J A;  2G4S A;  3MHS D;  4IWQ A;  1V5T A;  3WIM A;  4OVU A;  2KHW B;  4B9K A;  4F7Z A;  3OAW A;  2RSU A;  3H1U A;  3P2B A;  4DDG D;  2ZVN A;  3KYC D;  2O2V A;  4W9H A;  2Y5B B;  2MWS B;  2KK8 A;  1EF5 A;  2KFK B;  4WJO A;  4IWP A;  1H8C A;  1WI0 A;  1P9D U;  4G11 A;  1WH3 A;  2B3A A;  4GDL B;  1KM7 A;  2GBN A;  4IWO A;  1Z5S B;  4AP4 C;  4EKU A;  1J19 A;  1CMX B;  2XBB C;  3HIZ A;  3PHW B;  2KLC A;  3PRM B;  3RZW C;  4HPL B;  4EEW A;  3M63 B;  4AWJ A;  1I42 A;  4WJP A;  2KTR B;  2JY6 A;  3DBH I;  3QHT A;  4BOS C;  2HE7 A;  2CHZ A;  1A5R A;  1TZ1 A;  2Z0D B;  5DPW A;  5JZE B;  1RLF A;  1XT9 B;  3R7R A;  4FLH A;  3ZRC A;  1WXA A;  1V49 A;  4AOF A;  3PVL A;  2MRP A;  3VTV A;  3VUW A;  3DQV A;  3Q3J A;  2J7Q B;  2LRU A;  1WF9 A;  1UBQ A;  2J0M A;  2LRW A;  1QZE A;  4LDT D;  4W9E A;  5G55 A;  2V4L A;  1H4R A;  3EFU A;  4IM3 A;  2OOB B;  3VH3 B;  4JIO U;  4KZC A;  3SU8 X;  3A4S C;  3PZD A;  4PS8 A;  4K1R B;  1GUA B;  3DDC B;  3EC8 A;  3EHV A;  3M95 A;  1K8R B;  4W9L A;  4GXB A;  4URK A;  1WXS A;  2JF5 A;  3HM3 A;  4M8M A;  1XD3 B;  2AYO B;  4I6P A;  1FXT B;  3BIN A;  2N4F A;  2BGF A;  2BYF A;  3B1L X;  5LLI A;  2ZCB A;  3WAN A;  2FID A;  4BFR A;  4HLE A;  4FJV B;  2FCM A;  2G4D B;  5HKH A;  2KO3 A;  3OLM D;  2K8C A;  4W9F A;  4EFO A;  4A20 A;  4NJ7 A;  2FIF A;  3WAP A;  5J2R A;  3VHT C;  2KTR A;  4ANX A;  4MGK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...