2K1OA

Nmr structure of helicobacter pylori jhp0511 (hp0564).
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
54
structure length
54
Chain Sequence
KRNFSVTFYLSKEEHDVLRRLADEEVESVNSFVKRHILKTIIYKKGTNQDSSIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HP0564 from Helicobacter pylori identifies it as a new transcriptional regulator.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Gene regulation
molecule keywords Putative
total genus 12
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2k1oA00
1ARQA 2WVEA 2HZVA 1NLAA 2K29A 1P94A 2K1OA 2K5JA 2WVCA 2H1OE 2GPEA 2BJ7A 1X93A 2BJ3A 1QTGA 2K6LA 2HZAA 1ARRA 2WVDA 3H87C 2BJ1A 4HV0A 3GXQA 3VW4A 1BDTA 1Q5VA 2WVFA 2BJ8A 4ME7E 1MNTA 2BA3A 2CA9A 3QOQA 1EA4A 2CAJA 1B28A 2BNZA 2RBFA 2BNWA 4D8JA 1U9PA 3VEAA 2CAXA 1BAZA 2CPGA 2K9IA 1MYKA 3FT7A 2JXIA 1PARA 3VEBA 2WVBA 1BDVA 3FMTA 2AY0A 2JXHA 3LGHA 2BSQE 2BJ9A 1MYLA 1IRQA 2CADA 4FXEA 3OD2A 2KELA 1B01A 2JXGA
chains in the Genus database with same CATH superfamily
2WVEA 1NLAA 3SFUA 3QIDA 4QPXA 3LJPA 1BDTA 2WVFA 2BJ8A 1SIWA 2CAXA 2H3AA 4LRVA 1MYKA 2WVBA 1BDVA 3NO7A 2AY0A 2JXHA 3LGHA 4FXEA 2CADA 3OD2A 1B01A 2JXGA 2B43A 2KKEA 2K5JA 2WVCA 3SFGA 3H5XA 2UUTA 2BJ7A 1X93A 1SH2A 1ARRA 3H87C 2AN7A 4ME7E 1MNTA 1EA4A 1B28A 2RBFA 4LQ9A 2BNWA 1U9PA 3VEAA 4O4RA 1SH3A 3H5YA 3FMTA 2ADLA 2BJ9A 3UR0A 2CKWA 2K1OA 2H1OE 2GPEA 2BJ3A 2Q2KA 2K6LA 2HZAA 2BJ1A 3VW4A 4MJWA 3GXQA 3NAHA 3QOQA 2CAJA 2WK4A 4D8JA 1OG7A 1BAZA 4NRTA 2A2BA 2JXIA 1PARA 4LQ3A 1IRQA 1Q16A 2KELA 4AAIA 3NAIA 1ARQA 2HZVA 2K29A 2UUWA 1P94A 2KOEA 1QTGA 3UQSA 2WVDA 4HV0A 1Q5VA 2BA3A 2CA9A 3BSOA 3UPFA 2BNZA 1OHNA 2CPGA 2K9IA 2JBVA 3FT7A 3G5OA 3IR7A 3VEBA 2BSQE 3BSNA 1MYLA 1SH0A 3NNEA 4NRUA
chains in the Genus database with same CATH topology
1ARQA 2WVEA 2HZVA 1NLAA 2K29A 1P94A 2K1OA 2K5JA 2WVCA 2H1OE 2GPEA 2BJ7A 1X93A 2BJ3A 1QTGA 2K6LA 2HZAA 1ARRA 2WVDA 3H87C 2BJ1A 4HV0A 3GXQA 3VW4A 1BDTA 1Q5VA 2WVFA 2BJ8A 4ME7E 1MNTA 2BA3A 2CA9A 3QOQA 1EA4A 2CAJA 1B28A 2BNZA 2RBFA 2BNWA 4D8JA 1U9PA 3VEAA 2CAXA 1BAZA 2CPGA 2K9IA 1MYKA 3FT7A 2JXIA 1PARA 3VEBA 2WVBA 1BDVA 3FMTA 2AY0A 2JXHA 3LGHA 2BSQE 2BJ9A 1MYLA 1IRQA 2CADA 4FXEA 3OD2A 2KELA 1B01A 2JXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARQ A;  2WVE A;  2HZV A;  1NLA A;  2K29 A;  1P94 A;  2K1O A;  2K5J A;  2WVC A;  2H1O E;  2GPE A;  2BJ7 A;  1X93 A;  2BJ3 A;  1QTG A;  2K6L A;  2HZA A;  1ARR A;  2WVD A;  3H87 C;  2BJ1 A;  4HV0 A;  3GXQ A;  3VW4 A;  1BDT A;  1Q5V A;  2WVF A;  2BJ8 A;  4ME7 E;  1MNT A;  2BA3 A;  2CA9 A;  3QOQ A;  1EA4 A;  2CAJ A;  1B28 A;  2BNZ A;  2RBF A;  2BNW A;  4D8J A;  1U9P A;  3VEA A;  2CAX A;  1BAZ A;  2CPG A;  2K9I A;  1MYK A;  3FT7 A;  2JXI A;  1PAR A;  3VEB A;  2WVB A;  1BDV A;  3FMT A;  2AY0 A;  2JXH A;  3LGH A;  2BSQ E;  2BJ9 A;  1MYL A;  1IRQ A;  2CAD A;  4FXE A;  3OD2 A;  2KEL A;  1B01 A;  2JXG A; 
#chains in the Genus database with same CATH topology
 2WVE A;  1NLA A;  3SFU A;  3QID A;  4QPX A;  3LJP A;  1BDT A;  2WVF A;  2BJ8 A;  1SIW A;  2CAX A;  2H3A A;  4LRV A;  1MYK A;  2WVB A;  1BDV A;  3NO7 A;  2AY0 A;  2JXH A;  3LGH A;  4FXE A;  2CAD A;  3OD2 A;  1B01 A;  2JXG A;  2B43 A;  2KKE A;  2K5J A;  2WVC A;  3SFG A;  3H5X A;  2UUT A;  2BJ7 A;  1X93 A;  1SH2 A;  1ARR A;  3H87 C;  2AN7 A;  4ME7 E;  1MNT A;  1EA4 A;  1B28 A;  2RBF A;  4LQ9 A;  2BNW A;  1U9P A;  3VEA A;  4O4R A;  1SH3 A;  3H5Y A;  3FMT A;  2ADL A;  2BJ9 A;  3UR0 A;  2CKW A;  2K1O A;  2H1O E;  2GPE A;  2BJ3 A;  2Q2K A;  2K6L A;  2HZA A;  2BJ1 A;  3VW4 A;  4MJW A;  3GXQ A;  3NAH A;  3QOQ A;  2CAJ A;  2WK4 A;  4D8J A;  1OG7 A;  1BAZ A;  4NRT A;  2A2B A;  2JXI A;  1PAR A;  4LQ3 A;  1IRQ A;  1Q16 A;  2KEL A;  4AAI A;  3NAI A;  1ARQ A;  2HZV A;  2K29 A;  2UUW A;  1P94 A;  2KOE A;  1QTG A;  3UQS A;  2WVD A;  4HV0 A;  1Q5V A;  2BA3 A;  2CA9 A;  3BSO A;  3UPF A;  2BNZ A;  1OHN A;  2CPG A;  2K9I A;  2JBV A;  3FT7 A;  3G5O A;  3IR7 A;  3VEB A;  2BSQ E;  3BSN A;  1MYL A;  1SH0 A;  3NNE A;  4NRU A; 
#chains in the Genus database with same CATH homology
 1ARQ A;  2WVE A;  2HZV A;  1NLA A;  2K29 A;  1P94 A;  2K1O A;  2K5J A;  2WVC A;  2H1O E;  2GPE A;  2BJ7 A;  1X93 A;  2BJ3 A;  1QTG A;  2K6L A;  2HZA A;  1ARR A;  2WVD A;  3H87 C;  2BJ1 A;  4HV0 A;  3GXQ A;  3VW4 A;  1BDT A;  1Q5V A;  2WVF A;  2BJ8 A;  4ME7 E;  1MNT A;  2BA3 A;  2CA9 A;  3QOQ A;  1EA4 A;  2CAJ A;  1B28 A;  2BNZ A;  2RBF A;  2BNW A;  4D8J A;  1U9P A;  3VEA A;  2CAX A;  1BAZ A;  2CPG A;  2K9I A;  1MYK A;  3FT7 A;  2JXI A;  1PAR A;  3VEB A;  2WVB A;  1BDV A;  3FMT A;  2AY0 A;  2JXH A;  3LGH A;  2BSQ E;  2BJ9 A;  1MYL A;  1IRQ A;  2CAD A;  4FXE A;  3OD2 A;  2KEL A;  1B01 A;  2JXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...