2K1SA

Solution nmr structure of the folded c-terminal fragment of yiad from escherichia coli. northeast structural genomics consortium target er553.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
149
Chain Sequence
YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inner membrane lipoprotein yiaD
publication title Solution NMR structure of the folded C-terminal fragment of YiaD from Escherichia coli. Northeast Structural Genomics Consortium target ER553.
rcsb
source organism Escherichia coli
molecule tags Lipoprotein
total genus 44
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2k1sA00
2ZVYA 4G88A 4G4ZA 5EAZA 3S06A 1R1MA 2KGWA 2HQSC 3IMPA 2ZOVA 4RHAA 3S0YA 3OONA 4G4YA 2L26A 2ZF8A 4R40B 3TD5A 5EB1B 3WPWA 4B5CA 5EB0A 3TD3A 4G4VA 2N48A 4G4XA 2K1SA 2AIZP 3WPXA 3S03A 4ZHWA 3CYQA 1OAPA 2W8BC 4B62A 4ERHA 4G4WA 2MQEA 2LCAA 3TD4A 4ZHYB 2ZVZA 4PWTA 3S0HA 3S0WA 3LDTA 2LBTA 3KHNA 3CYPB 4ZHVA 3S02A
chains in the Genus database with same CATH superfamily
1X52A 1U40A 3VO8A 5ITZA 5MN5A 3JAKA 3J81M 4FFBA 1RA4A 4EB6A 5BMVA 1VHAA 2UYJA 5LP6B 3WGKA 2R6R1 1GO1A 5HY2A 1XBIA 3F0EA 2L26A 5EZYA 2H6LA 5AVMA 2N48A 3C8LA 5EIBC 3KJKA 1VK3A 4IHJA 3C9UA 3CCMF 3AGKA 3M84A 3CCLF 4BT3A 3E20B 3NMUC 1FNKA 3QHDA 2LBTA 4NUTA 5G4UC 1YJ9F 5CA1B 1VQMF 3PLAC 3N4ZA 4O4LB 5JH7B 3O85A 3PAFA 3HKEA 3RYFA 3D00A 3VCZA 4ZI7B 5FJ4C 5IJ9A 5CB4B 5LXTB 3CB2A 3HKDA 2UYPA 3N2KA 2PMPA 2QEXF 4I50B 3MQWA 4I55A 3HKBA 4X1IB 5MN6A 3JAMM 3N4YA 1VQ7F 3WJPA 3C9TA 3K0TA 5JCOC 4PWTA 3F6MA 3P10A 2LBWA 3N2GA 5IJ0A 3RYCB 1YJNF 4BT2A 3S02A 5IYZA 1U43A 1VQ6F 3JALB 4BVSA 1W55A 1W41A 3UT5B 3LWPC 4RHAA 1IV4A 2AIFA 3GTZA 3V7EA 5ITZB 3JAKB 2Z01A 4FFBB 2KG4A 4EB6B 5BMVB 4LCKA 2BTQB 1UI9A 3CC4F 3IEWA 5B8FA 3T80A 4ZOLA 4DRXA 1VQPF 4ZHWA 5HY0A 2W8BC 5GONA 1Q82H 5EZYB 3VOAA 4RQOA 3LDTA 3KHNA 4IHJB 3G71F 2JNBA 4X3MA 3OBYA 1OFUA 3C9RA 1IV1A 3NK7A 3LWRC 1VQNF 5CA0B 4BT5A 3HJWC 3SIUA 3LWVC 3MCQA 2I6DA 3HKEB 3IEQA 5EB1B 3RYFB 3M1XA 4X1YA 3HWUA 1YJWF 1NQ3A 5IJ9B 5LP6C 1CLIA 3HKDB 3ZP7A 1X25A 2UZHA 1RQ7A 3N2KB 2CW4A 2ZVZA 3LMEA 4TUYA 3HKBB 3BYQA 1N8RH 1KQSF 5HWEA 3IKEA 1YIJF 4XCQA 2FGYA 4X1KA 1SA0A 5LXTA 2KGWA 5IJ0B 3ZP4A 3N2GB 1ZWZA 3FD5A 3R0PA 4O2AA 5J2TB 5HXUA 3ESJA 5IYZB 4BVTA 3OW2F 4ZHQA 3NK6A 2Z1TA 5EWRA 4BY9D 4ZOLB 4DRXB 2HS4A 5GONB 5JVDA 3JAWA 3CPWF 4LNUA 4G4ZA 3S06A 1Q8RA 5LYJA 1W5BA 2YXZA 5GANK 2RB9A 3HTNA 3JVHA 1W3EX 4BW0B 3CCJF 2HP3A 1YHQF 4R40B 3WGNA 2VAMA 4C82A 1VQVA 3LWQC 5MN4A 5GAPK 3TD3A 5JQGA 3VYSC 2ZAUA 1GZ0A 4BT7A 3CPQA 3GYQA 3P4EA 2P6YA 3QUWA 2Q1XA 3FBAA 2IQQA 5LOVA 2UYNA 4X1YB 1XV2A 5J2UA 3WGLA 2OHWA 1E7KA 3CYPB 3F0FA 2DYYA 1H48A 2VXYA 1DT9A 5CA0A 3VYTC 4O4IA 5EYPA 3C9SA 3IMPA 4TUYB 1KNJA 1VH8A 5C8YA 3K12A 3WXMB 3KIZA 4X3LA 3FPIA 4BVRA 4IIJB 4X1KB 1SA0B 3G4SF 1VQLF 3ON1A 3TD5A 2GZLA 1NMUB 1T0AA 2VGMA 4O2AB 2GVIA 2CVLA 5HY1A 5GINC 4B62A 4ERHA 3ZO8A 4ZHQB 3I55F 3VTIC 4WBNA 4ZHVA 1KC8H 5KMGA 5HP8A 2H8CA 5J2TA 3M4SA 3RYIB 4X20A 4HNAA 3OONA 5JVDB 3JAWB 3QTYA 2YYEA 4LNUB 4O4JB 4I4TA 4U39A 3CG6A 3RA6A 4F6RA 1KD1H 5LYJB 3ERNA 3DC2A 1KNKA 2R751 1ODEA 2PHNA 4G4WA 2VGNA 4EI9A 5JQGB 2FC3A 1SZQA 1Q7YH 3CCEF 5G4VC 3NVKE 1W59A 3DDNA 5LOVB 2UYNB 2VAWA 3D54A 3CMAF 5J2UB 3S0YA 5IT9M 3CCRF 3IR9A 1YITF 4O4IB 1QVGF 1M90H 2HS0A 5EYPB 2HVYD 3JARB 5C8YB 3CXCF 3EORA 2AMTA 3FFMA 4TZZA 3V4DA 2RHJA 1FNJA 3RE3A 3S0WA 2RHOA 2Z1FA 1GX1A 2UYKA 4TV8A 4IIJA 3GHZA 4WBNB 3B6NA 5KMGB 1K8AH 3HKCA 1SDSA 4X20B 4HNAB 1FFXA 2CHTA 1JJ2F 3JASA 3NVIB 2BTOA 2EWCA 1W2BF 1VQ9F 4DXDA 1Z5WA 1VQ4F 1JN1A 5FNVA 4I4TB 3CD6F 4F6RB 4M8IA 4O2BA 4ZHYB 3VMFB 3RYIA 1W581 4ZK7A 4E6EA 4YJ2A 1PXWA 1YI2F 2QTPA 5KX5A 1UFYA 3CCQF 2HQSC 4O4JA 3OBWA 4EI7A 4O4HB 1X7PA 5FLXM 3WGJA 1QAHA 4BT4A 5EB0A 1JY8A 5LA6A 3RA5A 4G4VA 4C8GA 3IKFA 4TV9B 1J7HA 4YJ3A 2B33A 2F9ZC 1IV3A 1RQ2A 3E1YA 3RYHA 2H8EA 1TVKA 3K14A 2ALEA 2HRYA 3F0GA 3ZOPA 3V3TA 1DBFA 1Q81H 1U3LA 4G88A 5EAZA 1TUBB 3V7QA 1R1MA 1S72F 3JARA 2KTUA 4EI8A 2WALA 4TV8B 3VIUA 2NMUA 5HY4A 2RHLA 3I56F 4KWEA 2G9IA 1T0KB 1X7OA 1U3PA 2GLZA 1QVFF 4B45A 3HKCB 3MBMA 5GIOC 1FFXB 3JASB 3WGMA 2KTVA 2LCAA 1RLGA 5FNVB 2HS3A 3SIVA 5HP7A 1M1KH 4O2BB 3JCMM 1CK2A 3J80M 2HP0A 5JCOA 1VQ5F 3JATB 4YJ2B 4NQ3A 1XHOA 2ZF8A 4U3JB 5KX5B 1JFFB 1Z5VA 1XRGA 1IPAA 3LWOC 1W57A 5HXZA 2K1SA 3KJJA 3WPXA 2VAPA 5DCVA 5EO3A 3WJRA 3MDOA 1K9MH 2HX0A 2ZODA 3Q8HA 5LA6B 3F0DA 2CWJA 5EIBD 3J7AR 4YJ3B 4O4HA 4C8EA 3CC2F 5A2QM 2BTUA 3RYHB 2ZOVA 1TVKB 1GO0A 2IG8A 1PF5A 3E22A 1VQOF 1COMA 2Z1EA 1W42A 4TV9A 3MCAB 3CC7F 2DT4A 1W40A 3S03A 1K73H 1OAPA 2LBXA 2CZWA 1JD1A 3CCUF 2RHHA 3CCVF 3S0HA 1TUBA 2Q1YA 5LP6A 1YQNA 3FD6A 3HAXD 1IV2A 3LFOA 3WJQA 1H7MA 4B46A 3CCSF 3D01A 4C8IA 2HRUA 2HP0B 3K2XA 2QA4F 2OTJF 4G4XA 3VYUC 3CYQA 1W5EA 2BO1A 5CA1A 1FSZA 4O4LA 5JH7A 4I55B 2I6RA 2MQEA 4NWOB 4C81A 4ZI7A 3JATA 2ZVYA 3G6EF 1CN7A 2CSLA 1QD9A 5CB4A 1RLUA 2Z1UA 5GIPC 4U3JA 3U0OA 1JFFA 4BVQA 1YGYA 1NJIH 3CMEF 4I50A 4G4YA 4X1IA 3I3FA 3VI6A 4BT6A 1H47A 3WPWA 3VOBA 4B5CA 2OTLF 3P0ZA 3E22B 1QU9A 1ONIA 2AIZP 2V9YA 1Q86H 3RYCA 2OTMA 1W5AA 3LYBA 2CHSA 3ELCA 1W5FA 3I7TA 1VQ8F 3KE1A 1VQKF 4C4WC 3JALA 2IAFA 3TD4A 3UT5A 2OZBA 2QI2A 3L7QA
chains in the Genus database with same CATH topology
2ZVYA 4G88A 4G4ZA 5EAZA 3S06A 1R1MA 2KGWA 2HQSC 3IMPA 2ZOVA 4RHAA 3S0YA 3OONA 4G4YA 2L26A 2ZF8A 4R40B 3TD5A 5EB1B 3WPWA 4B5CA 5EB0A 3TD3A 4G4VA 2N48A 4G4XA 2K1SA 2AIZP 3WPXA 3S03A 4ZHWA 3CYQA 1OAPA 2W8BC 4B62A 4ERHA 4G4WA 2MQEA 2LCAA 3TD4A 4ZHYB 2ZVZA 4PWTA 3S0HA 3S0WA 3LDTA 2LBTA 3KHNA 3CYPB 4ZHVA 3S02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVY A;  4G88 A;  4G4Z A;  5EAZ A;  3S06 A;  1R1M A;  2KGW A;  2HQS C;  3IMP A;  2ZOV A;  4RHA A;  3S0Y A;  3OON A;  4G4Y A;  2L26 A;  2ZF8 A;  4R40 B;  3TD5 A;  5EB1 B;  3WPW A;  4B5C A;  5EB0 A;  3TD3 A;  4G4V A;  2N48 A;  4G4X A;  2K1S A;  2AIZ P;  3WPX A;  3S03 A;  4ZHW A;  3CYQ A;  1OAP A;  2W8B C;  4B62 A;  4ERH A;  4G4W A;  2MQE A;  2LCA A;  3TD4 A;  4ZHY B;  2ZVZ A;  4PWT A;  3S0H A;  3S0W A;  3LDT A;  2LBT A;  3KHN A;  3CYP B;  4ZHV A;  3S02 A; 
#chains in the Genus database with same CATH topology
 1X52 A;  1U40 A;  3VO8 A;  5ITZ A;  5MN5 A;  3JAK A;  3J81 M;  4FFB A;  1RA4 A;  4EB6 A;  5BMV A;  1VHA A;  2UYJ A;  5LP6 B;  3WGK A;  2R6R 1;  1GO1 A;  5HY2 A;  1XBI A;  3F0E A;  2L26 A;  5EZY A;  2H6L A;  5AVM A;  2N48 A;  3C8L A;  5EIB C;  3KJK A;  1VK3 A;  4IHJ A;  3C9U A;  3CCM F;  3AGK A;  3M84 A;  3CCL F;  4BT3 A;  3E20 B;  3NMU C;  1FNK A;  3QHD A;  2LBT A;  4NUT A;  5G4U C;  1YJ9 F;  5CA1 B;  1VQM F;  3PLA C;  3N4Z A;  4O4L B;  5JH7 B;  3O85 A;  3PAF A;  3HKE A;  3RYF A;  3D00 A;  3VCZ A;  4ZI7 B;  5FJ4 C;  5IJ9 A;  5CB4 B;  5LXT B;  3CB2 A;  3HKD A;  2UYP A;  3N2K A;  2PMP A;  2QEX F;  4I50 B;  3MQW A;  4I55 A;  3HKB A;  4X1I B;  5MN6 A;  3JAM M;  3N4Y A;  1VQ7 F;  3WJP A;  3C9T A;  3K0T A;  5JCO C;  4PWT A;  3F6M A;  3P10 A;  2LBW A;  3N2G A;  5IJ0 A;  3RYC B;  1YJN F;  4BT2 A;  3S02 A;  5IYZ A;  1U43 A;  1VQ6 F;  3JAL B;  4BVS A;  1W55 A;  1W41 A;  3UT5 B;  3LWP C;  4RHA A;  1IV4 A;  2AIF A;  3GTZ A;  3V7E A;  5ITZ B;  3JAK B;  2Z01 A;  4FFB B;  2KG4 A;  4EB6 B;  5BMV B;  4LCK A;  2BTQ B;  1UI9 A;  3CC4 F;  3IEW A;  5B8F A;  3T80 A;  4ZOL A;  4DRX A;  1VQP F;  4ZHW A;  5HY0 A;  2W8B C;  5GON A;  1Q82 H;  5EZY B;  3VOA A;  4RQO A;  3LDT A;  3KHN A;  4IHJ B;  3G71 F;  2JNB A;  4X3M A;  3OBY A;  1OFU A;  3C9R A;  1IV1 A;  3NK7 A;  3LWR C;  1VQN F;  5CA0 B;  4BT5 A;  3HJW C;  3SIU A;  3LWV C;  3MCQ A;  2I6D A;  3HKE B;  3IEQ A;  5EB1 B;  3RYF B;  3M1X A;  4X1Y A;  3HWU A;  1YJW F;  1NQ3 A;  5IJ9 B;  5LP6 C;  1CLI A;  3HKD B;  3ZP7 A;  1X25 A;  2UZH A;  1RQ7 A;  3N2K B;  2CW4 A;  2ZVZ A;  3LME A;  4TUY A;  3HKB B;  3BYQ A;  1N8R H;  1KQS F;  5HWE A;  3IKE A;  1YIJ F;  4XCQ A;  2FGY A;  4X1K A;  1SA0 A;  5LXT A;  2KGW A;  5IJ0 B;  3ZP4 A;  3N2G B;  1ZWZ A;  3FD5 A;  3R0P A;  4O2A A;  5J2T B;  5HXU A;  3ESJ A;  5IYZ B;  4BVT A;  3OW2 F;  4ZHQ A;  3NK6 A;  2Z1T A;  5EWR A;  4BY9 D;  4ZOL B;  4DRX B;  2HS4 A;  5GON B;  5JVD A;  3JAW A;  3CPW F;  4LNU A;  4G4Z A;  3S06 A;  1Q8R A;  5LYJ A;  1W5B A;  2YXZ A;  5GAN K;  2RB9 A;  3HTN A;  3JVH A;  1W3E X;  4BW0 B;  3CCJ F;  2HP3 A;  1YHQ F;  4R40 B;  3WGN A;  2VAM A;  4C82 A;  1VQV A;  3LWQ C;  5MN4 A;  5GAP K;  3TD3 A;  5JQG A;  3VYS C;  2ZAU A;  1GZ0 A;  4BT7 A;  3CPQ A;  3GYQ A;  3P4E A;  2P6Y A;  3QUW A;  2Q1X A;  3FBA A;  2IQQ A;  5LOV A;  2UYN A;  4X1Y B;  1XV2 A;  5J2U A;  3WGL A;  2OHW A;  1E7K A;  3CYP B;  3F0F A;  2DYY A;  1H48 A;  2VXY A;  1DT9 A;  5CA0 A;  3VYT C;  4O4I A;  5EYP A;  3C9S A;  3IMP A;  4TUY B;  1KNJ A;  1VH8 A;  5C8Y A;  3K12 A;  3WXM B;  3KIZ A;  4X3L A;  3FPI A;  4BVR A;  4IIJ B;  4X1K B;  1SA0 B;  3G4S F;  1VQL F;  3ON1 A;  3TD5 A;  2GZL A;  1NMU B;  1T0A A;  2VGM A;  4O2A B;  2GVI A;  2CVL A;  5HY1 A;  5GIN C;  4B62 A;  4ERH A;  3ZO8 A;  4ZHQ B;  3I55 F;  3VTI C;  4WBN A;  4ZHV A;  1KC8 H;  5KMG A;  5HP8 A;  2H8C A;  5J2T A;  3M4S A;  3RYI B;  4X20 A;  4HNA A;  3OON A;  5JVD B;  3JAW B;  3QTY A;  2YYE A;  4LNU B;  4O4J B;  4I4T A;  4U39 A;  3CG6 A;  3RA6 A;  4F6R A;  1KD1 H;  5LYJ B;  3ERN A;  3DC2 A;  1KNK A;  2R75 1;  1ODE A;  2PHN A;  4G4W A;  2VGN A;  4EI9 A;  5JQG B;  2FC3 A;  1SZQ A;  1Q7Y H;  3CCE F;  5G4V C;  3NVK E;  1W59 A;  3DDN A;  5LOV B;  2UYN B;  2VAW A;  3D54 A;  3CMA F;  5J2U B;  3S0Y A;  5IT9 M;  3CCR F;  3IR9 A;  1YIT F;  4O4I B;  1QVG F;  1M90 H;  2HS0 A;  5EYP B;  2HVY D;  3JAR B;  5C8Y B;  3CXC F;  3EOR A;  2AMT A;  3FFM A;  4TZZ A;  3V4D A;  2RHJ A;  1FNJ A;  3RE3 A;  3S0W A;  2RHO A;  2Z1F A;  1GX1 A;  2UYK A;  4TV8 A;  4IIJ A;  3GHZ A;  4WBN B;  3B6N A;  5KMG B;  1K8A H;  3HKC A;  1SDS A;  4X20 B;  4HNA B;  1FFX A;  2CHT A;  1JJ2 F;  3JAS A;  3NVI B;  2BTO A;  2EWC A;  1W2B F;  1VQ9 F;  4DXD A;  1Z5W A;  1VQ4 F;  1JN1 A;  5FNV A;  4I4T B;  3CD6 F;  4F6R B;  4M8I A;  4O2B A;  4ZHY B;  3VMF B;  3RYI A;  1W58 1;  4ZK7 A;  4E6E A;  4YJ2 A;  1PXW A;  1YI2 F;  2QTP A;  5KX5 A;  1UFY A;  3CCQ F;  2HQS C;  4O4J A;  3OBW A;  4EI7 A;  4O4H B;  1X7P A;  5FLX M;  3WGJ A;  1QAH A;  4BT4 A;  5EB0 A;  1JY8 A;  5LA6 A;  3RA5 A;  4G4V A;  4C8G A;  3IKF A;  4TV9 B;  1J7H A;  4YJ3 A;  2B33 A;  2F9Z C;  1IV3 A;  1RQ2 A;  3E1Y A;  3RYH A;  2H8E A;  1TVK A;  3K14 A;  2ALE A;  2HRY A;  3F0G A;  3ZOP A;  3V3T A;  1DBF A;  1Q81 H;  1U3L A;  4G88 A;  5EAZ A;  1TUB B;  3V7Q A;  1R1M A;  1S72 F;  3JAR A;  2KTU A;  4EI8 A;  2WAL A;  4TV8 B;  3VIU A;  2NMU A;  5HY4 A;  2RHL A;  3I56 F;  4KWE A;  2G9I A;  1T0K B;  1X7O A;  1U3P A;  2GLZ A;  1QVF F;  4B45 A;  3HKC B;  3MBM A;  5GIO C;  1FFX B;  3JAS B;  3WGM A;  2KTV A;  2LCA A;  1RLG A;  5FNV B;  2HS3 A;  3SIV A;  5HP7 A;  1M1K H;  4O2B B;  3JCM M;  1CK2 A;  3J80 M;  2HP0 A;  5JCO A;  1VQ5 F;  3JAT B;  4YJ2 B;  4NQ3 A;  1XHO A;  2ZF8 A;  4U3J B;  5KX5 B;  1JFF B;  1Z5V A;  1XRG A;  1IPA A;  3LWO C;  1W57 A;  5HXZ A;  2K1S A;  3KJJ A;  3WPX A;  2VAP A;  5DCV A;  5EO3 A;  3WJR A;  3MDO A;  1K9M H;  2HX0 A;  2ZOD A;  3Q8H A;  5LA6 B;  3F0D A;  2CWJ A;  5EIB D;  3J7A R;  4YJ3 B;  4O4H A;  4C8E A;  3CC2 F;  5A2Q M;  2BTU A;  3RYH B;  2ZOV A;  1TVK B;  1GO0 A;  2IG8 A;  1PF5 A;  3E22 A;  1VQO F;  1COM A;  2Z1E A;  1W42 A;  4TV9 A;  3MCA B;  3CC7 F;  2DT4 A;  1W40 A;  3S03 A;  1K73 H;  1OAP A;  2LBX A;  2CZW A;  1JD1 A;  3CCU F;  2RHH A;  3CCV F;  3S0H A;  1TUB A;  2Q1Y A;  5LP6 A;  1YQN A;  3FD6 A;  3HAX D;  1IV2 A;  3LFO A;  3WJQ A;  1H7M A;  4B46 A;  3CCS F;  3D01 A;  4C8I A;  2HRU A;  2HP0 B;  3K2X A;  2QA4 F;  2OTJ F;  4G4X A;  3VYU C;  3CYQ A;  1W5E A;  2BO1 A;  5CA1 A;  1FSZ A;  4O4L A;  5JH7 A;  4I55 B;  2I6R A;  2MQE A;  4NWO B;  4C81 A;  4ZI7 A;  3JAT A;  2ZVY A;  3G6E F;  1CN7 A;  2CSL A;  1QD9 A;  5CB4 A;  1RLU A;  2Z1U A;  5GIP C;  4U3J A;  3U0O A;  1JFF A;  4BVQ A;  1YGY A;  1NJI H;  3CME F;  4I50 A;  4G4Y A;  4X1I A;  3I3F A;  3VI6 A;  4BT6 A;  1H47 A;  3WPW A;  3VOB A;  4B5C A;  2OTL F;  3P0Z A;  3E22 B;  1QU9 A;  1ONI A;  2AIZ P;  2V9Y A;  1Q86 H;  3RYC A;  2OTM A;  1W5A A;  3LYB A;  2CHS A;  3ELC A;  1W5F A;  3I7T A;  1VQ8 F;  3KE1 A;  1VQK F;  4C4W C;  3JAL A;  2IAF A;  3TD4 A;  3UT5 A;  2OZB A;  2QI2 A;  3L7Q A; 
#chains in the Genus database with same CATH homology
 2ZVY A;  4G88 A;  4G4Z A;  5EAZ A;  3S06 A;  1R1M A;  2KGW A;  2HQS C;  3IMP A;  2ZOV A;  4RHA A;  3S0Y A;  3OON A;  4G4Y A;  2L26 A;  2ZF8 A;  4R40 B;  3TD5 A;  5EB1 B;  3WPW A;  4B5C A;  5EB0 A;  3TD3 A;  4G4V A;  2N48 A;  4G4X A;  2K1S A;  2AIZ P;  3WPX A;  3S03 A;  4ZHW A;  3CYQ A;  1OAP A;  2W8B C;  4B62 A;  4ERH A;  4G4W A;  2MQE A;  2LCA A;  3TD4 A;  4ZHY B;  2ZVZ A;  4PWT A;  3S0H A;  3S0W A;  3LDT A;  2LBT A;  3KHN A;  3CYP B;  4ZHV A;  3S02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...