2K1SA

Solution nmr structure of the folded c-terminal fragment of yiad from escherichia coli. northeast structural genomics consortium target er553.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
149
structure length
149
Chain Sequence
b'YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inner membrane lipoprotein yiaD
publication title Solution NMR structure of the folded C-terminal fragment of YiaD from Escherichia coli. Northeast Structural Genomics Consortium target ER553.
rcsb
source organism Escherichia coli
molecule tags Lipoprotein
total genus 44
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 2k1sA00
3S0HA 2W8BC 3WPWA 1R1MA 2ZVYA 1OAPA 4RHAA 3TD3A 2N48A 3CYQA 3TD5A 2LCAA 3S06A 4ZHWA 4PWTA 2ZF8A 2L26A 3LDTA 4R40B 4G4VA 3S03A 4G88A 2ZOVA 4B5CA 3S02A 5EB0A 3S0WA 3WPXA 3IMPA 4G4ZA 4G4YA 4G4XA 4B62A 3OONA 3S0YA 5EAZA 3TD4A 4ERHA 4ZHYB 4ZHVA 2MQEA 2AIZP 4G4WA 5EB1B 2ZVZA 2KGWA 3CYPB 2HQSC 3KHNA 2LBTA 2K1SA
chains in the Genus database with same CATH superfamily
3S0HA 2CHTA 1JN1A 1KC8H 1QAHA 3AGKA 2NMUA 1X52A 3TD3A 3K14A 3LWQC 1S72F 2DT4A 2LCAA 5KX5A 4FFBA 1FFXA 3CCSF 1TUBB 5CA0B 3CB2A 4BW0B 3DC2A 3P0ZA 2HVYD 4TUYA 4U3JB 5A2QM 1M90H 5C8YB 1VQ9F 3JCMM 4IHJA 2QEXF 2OTMA 1XHOA 1YGYA 3BYQA 4RQOA 1RA4A 1U40A 4BVQA 3ZP4A 2OHWA 2Z1EA 2KTUA 1KQSF 2ZAUA 3IR9A 2HP0B 1RQ2A 3FBAA 3FD6A 4O4HB 5IJ0A 4O4IB 4B45A 3D54A 3WGLA 2HS4A 4ZI7B 2CHSA 4C8GA 3CPQA 3I55F 5LYJA 1YJNF 3VOBA 4X1KB 1TVKB 2GZLA 3MCQA 2I6RA 4X1IA 2GLZA 2RB9A 3RYIB 3CCUF 5HY2A 2Z1TA 1R1MA 4I55B 2HRUA 3FD5A 5J2TA 3JAKA 2QA4F 4EB6B 3WGKA 4ZHQB 4ZHWA 1W2BF 4WBNB 2UYNA 2VGMA 3RYCB 5BMVA 1CN7A 5FNVA 5HY4A 2HRYA 4G4YA 3C9RA 3V7QA 4DRXA 3CD6F 3S0YA 2BTQB 1SA0A 3I56F 5JH7A 4ZHVA 3L7QA 1YITF 5IJ9A 2H8EA 2HS0A 4EI7A 3N4ZA 1ODEA 5IT9M 1VK3A 3R0PA 1VQMF 3OBWA 3MBMA 1U43A 3S06A 2BTUA 3ON1A 4O2BB 4YJ2A 1KD1H 1Q8RA 3K12A 3ZOPA 1X7OA 3DDNA 3S02A 5CB4A 5EB0A 4C8IA 1UI9A 4LNUB 5HP7A 3CCEF 1SZQA 3HKDB 4F6RA 2LBXA 5HY0A 3N4YA 3HWUA 4KWEA 3KJJA 2Q1YA 1W42A 3WGNA 3WGJA 2AIFA 3VCZA 2LBWA 4O2AA 2ZVYA 4I4TB 5B8FA 3HJWC 2N48A 3LFOA 3IKEA 4I50A 1VQ5F 4O4JB 2RHLA 3NMUC 3K2XA 4X1YA 3IKFA 3E22B 5EYPA 1JJ2F 1JY8A 1VQLF 1VQ7F 1T0AA 4BT4A 3HAXD 1YJ9F 3JAMM 4BVRA 3MDOA 3V3TA 3F6MA 4ZOLA 4TV9B 2W8BC 4X3LA 2ZODA 3WPWA 4IIJB 3LMEA 4X3MA 2Q1XA 3CYQA 3JASB 1IV2A 3FFMA 5CA1B 1DT9A 4U39A 5FLXM 5IYZB 3J7AR 3FPIA 2CZWA 5LOVB 3LWPC 4B46A 1TUBA 5CA0A 1RQ7A 3JALB 3JAWA 2EWCA 3OONA 4C8EA 1T0KB 1W41A 3RYFB 1VH8A 4ERHA 5C8YA 1H7MA 3F0GA 5MN4A 2R751 1RLUA 3G4SF 5ITZB 3VMFB 3HKCB 1VQ6F 2K1SA 3PAFA 4RHAA 3O85A 3SIUA 3CMAF 4ZK7A 2ZF8A 3IEWA 2HP0A 4G88A 1ZWZA 4O4HA 4O4IA 3KIZA 1FNKA 1QVFF 4ZI7A 4G4WA 4X1KA 2ZVZA 5MN6A 1YI2F 3GHZA 3J81M 3G6EF 1H47A 1ONIA 2Z1UA 3RYIA 1U3LA 2KTVA 1XRGA 3D00A 1FSZA 3VYTC 4I55A 3QHDA 3MCAB 4EB6A 3S03A 3V7EA 1IV1A 4ZHQA 2VAMA 4WBNA 2GVIA 4NUTA 3RYCA 2JNBA 1W59A 3IMPA 1N8RH 4YJ3B 3T80A 4E6EA 2AMTA 4O4LB 5G4UC 2MQEA 5HP8A 1X25A 5GIPC 3CCVF 1YHQF 4B5CA 1VHAA 2DYYA 3GYQA 4HNAB 5HXZA 3CG6A 1W55A 2UYPA 3RA5A 4PWTA 2KG4A 3VOAA 2WALA 3CC7F 5KMGA 3C9SA 1UFYA 3E1YA 3PLAC 4O2BA 1XV2A 3JATB 3CC2F 5LP6B 4LNUA 3TD4A 1YIJF 1VQOF 4ZHYB 3M84A 2VGNA 3HKDA 4TV8B 3VYSC 3EORA 5LXTB 2LBTA 1VQVA 2HS3A 1VQPF 5JQGB 1VQ8F 1Z5WA 1OFUA 2CVLA 2IAFA 3VIUA 4I4TA 1NMUB 4NQ3A 3SIVA 4G4VA 3CC4F 2IQQA 5JCOA 3P4EA 3N2GB 3HTNA 4DXDA 3VTIC 3UT5B 1QVGF 1J7HA 5LA6B 5J2UB 5FJ4C 4O4JA 3K0TA 1U3PA 3CCMF 5AVMA 2B33A 3C9UA 3E22A 3B6NA 3JARB 5JVDA 5GAPK 1W5FA 2UYJA 1JD1A 1DBFA 4X20A 3HKBB 2H8CA 3HKEB 4TV9A 1COMA 2P6YA 2R6R1 5GONB 1K73H 4M8IA 3N2KB 4IIJA 2HX0A 3JASA 3ZP7A 1QD9A 5EZYB 5CA1A 3NVIB 5IYZA 3LWRC 4G4XA 3RYHB 3V4DA 3E20B 5LOVA 3OW2F 3JALA 5EIBD 5G4VC 1PXWA 4U3JA 3QTYA 1JFFB 5JVDB 1CK2A 4EI9A 3RYFA 5HWEA 2QTPA 2HQSC 3KJKA 3OBYA 5ITZA 3HKCA 4FFBB 5KX5B 3Q8HA 1FFXB 3CXCF 2VAPA 3P10A 3GTZA 3LDTA 4TUYB 3JAWB 5EO3A 3F0EA 1K9MH 2IG8A 3M1XA 1QU9A 4IHJB 1YQNA 3RA6A 3WGMA 2RHOA 5HY1A 2OTJF 2H6LA 2I6DA 1W581 2BTOA 1TVKA 3WJRA 2UZHA 5EB1B 1Q86H 2UYKA 2CW4A 5MN5A 1IV3A 3U0OA 1K8AH 5IJ0B 3CCLF 1SDSA 4BT5A 2Z1FA 1IPAA 1W5AA 3CCRF 5LYJB 1IV4A 3WJPA 2FC3A 4EI8A 1E7KA 3NK7A 1Z5VA 1YJWF 4NWOB 1GX1A 4C81A 4X1IB 3ERNA 5EAZA 3QUWA 4YJ3A 2FGYA 4BT6A 2YXZA 4O4LA 2KGWA 1KNJA 2G9IA 2HP3A 3F0DA 3CCJF 5J2TB 2RHJA 3I7TA 3D01A 3M4SA 3JAKB 5LP6C 3C9TA 3VI6A 4BT3A 4LCKA 3ZO8A 3WJQA 2UYNB 5BMVB 5EIBC 3C8LA 1H48A 3VYUC 4HNAA 5FNVB 2V9YA 4DRXB 3JVHA 3S0WA 1SA0B 4B62A 4G4ZA 5JH7B 4BVTA 1KNKA 2CWJA 3I3FA 5IJ9B 5JCOC 3NVKE 3JATA 1GZ0A 2AIZP 5DCVA 5LP6A 5GINC 3F0FA 3CCQF 1Q7YH 1XBIA 4TV8A 1X7PA 3RE3A 3CMEF 5LXTA 2PHNA 5KMGB 2OTLF 4YJ2B 5JQGA 1W57A 2L26A 3NK6A 5CB4B 1W40A 3LWVC 3G71F 5EWRA 1GO0A 2ZOVA 1W5EA 5GANK 1FNJA 3LYBA 3WPXA 4F6RB 3N2GA 1RLGA 3UT5A 1GO1A 1M1KH 2CSLA 5HXUA 5LA6A 2QI2A 5J2UA 4BY9D 2RHHA 3WXMB 3CYPB 4O2AB 1W3EX 3KHNA 3KE1A 1NJIH 3JARA 4XCQA 1NQ3A 3MQWA 2Z01A 1VQ4F 1OAPA 1VQKF 3HKBA 3TD5A 5GIOC 2F9ZC 3HKEA 4I50B 4R40B 1Q82H 4BVSA 4X1YB 1CLIA 5GONA 3N2KA 3ELCA 2PMPA 2VAWA 4TZZA 5EYPB 3ESJA 1Q81H 4BT2A 5EZYA 1W5BA 4C82A 1PF5A 3IEQA 2ALEA 3RYHA 3J80M 4X20B 2BO1A 4BT7A 3LWOC 2YYEA 4ZOLB 3VO8A 1VQNF 4C4WC 2OZBA 3CPWF 1JFFA 2VXYA
chains in the Genus database with same CATH topology
3S0HA 2W8BC 3WPWA 1R1MA 2ZVYA 1OAPA 4RHAA 3TD3A 2N48A 3CYQA 3TD5A 2LCAA 3S06A 4ZHWA 4PWTA 2ZF8A 2L26A 3LDTA 4R40B 4G4VA 3S03A 4G88A 2ZOVA 4B5CA 3S02A 5EB0A 3S0WA 3WPXA 3IMPA 4G4ZA 4G4YA 4G4XA 4B62A 3OONA 3S0YA 5EAZA 3TD4A 4ERHA 4ZHYB 4ZHVA 2MQEA 2AIZP 4G4WA 5EB1B 2ZVZA 2KGWA 3CYPB 2HQSC 3KHNA 2LBTA 2K1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0H A;  2W8B C;  3WPW A;  1R1M A;  2ZVY A;  1OAP A;  4RHA A;  3TD3 A;  2N48 A;  3CYQ A;  3TD5 A;  2LCA A;  3S06 A;  4ZHW A;  4PWT A;  2ZF8 A;  2L26 A;  3LDT A;  4R40 B;  4G4V A;  3S03 A;  4G88 A;  2ZOV A;  4B5C A;  3S02 A;  5EB0 A;  3S0W A;  3WPX A;  3IMP A;  4G4Z A;  4G4Y A;  4G4X A;  4B62 A;  3OON A;  3S0Y A;  5EAZ A;  3TD4 A;  4ERH A;  4ZHY B;  4ZHV A;  2MQE A;  2AIZ P;  4G4W A;  5EB1 B;  2ZVZ A;  2KGW A;  3CYP B;  2HQS C;  3KHN A;  2LBT A;  2K1S A; 
#chains in the Genus database with same CATH topology
 3S0H A;  2CHT A;  1JN1 A;  1KC8 H;  1QAH A;  3AGK A;  2NMU A;  1X52 A;  3TD3 A;  3K14 A;  3LWQ C;  1S72 F;  2DT4 A;  2LCA A;  5KX5 A;  4FFB A;  1FFX A;  3CCS F;  1TUB B;  5CA0 B;  3CB2 A;  4BW0 B;  3DC2 A;  3P0Z A;  2HVY D;  4TUY A;  4U3J B;  5A2Q M;  1M90 H;  5C8Y B;  1VQ9 F;  3JCM M;  4IHJ A;  2QEX F;  2OTM A;  1XHO A;  1YGY A;  3BYQ A;  4RQO A;  1RA4 A;  1U40 A;  4BVQ A;  3ZP4 A;  2OHW A;  2Z1E A;  2KTU A;  1KQS F;  2ZAU A;  3IR9 A;  2HP0 B;  1RQ2 A;  3FBA A;  3FD6 A;  4O4H B;  5IJ0 A;  4O4I B;  4B45 A;  3D54 A;  3WGL A;  2HS4 A;  4ZI7 B;  2CHS A;  4C8G A;  3CPQ A;  3I55 F;  5LYJ A;  1YJN F;  3VOB A;  4X1K B;  1TVK B;  2GZL A;  3MCQ A;  2I6R A;  4X1I A;  2GLZ A;  2RB9 A;  3RYI B;  3CCU F;  5HY2 A;  2Z1T A;  1R1M A;  4I55 B;  2HRU A;  3FD5 A;  5J2T A;  3JAK A;  2QA4 F;  4EB6 B;  3WGK A;  4ZHQ B;  4ZHW A;  1W2B F;  4WBN B;  2UYN A;  2VGM A;  3RYC B;  5BMV A;  1CN7 A;  5FNV A;  5HY4 A;  2HRY A;  4G4Y A;  3C9R A;  3V7Q A;  4DRX A;  3CD6 F;  3S0Y A;  2BTQ B;  1SA0 A;  3I56 F;  5JH7 A;  4ZHV A;  3L7Q A;  1YIT F;  5IJ9 A;  2H8E A;  2HS0 A;  4EI7 A;  3N4Z A;  1ODE A;  5IT9 M;  1VK3 A;  3R0P A;  1VQM F;  3OBW A;  3MBM A;  1U43 A;  3S06 A;  2BTU A;  3ON1 A;  4O2B B;  4YJ2 A;  1KD1 H;  1Q8R A;  3K12 A;  3ZOP A;  1X7O A;  3DDN A;  3S02 A;  5CB4 A;  5EB0 A;  4C8I A;  1UI9 A;  4LNU B;  5HP7 A;  3CCE F;  1SZQ A;  3HKD B;  4F6R A;  2LBX A;  5HY0 A;  3N4Y A;  3HWU A;  4KWE A;  3KJJ A;  2Q1Y A;  1W42 A;  3WGN A;  3WGJ A;  2AIF A;  3VCZ A;  2LBW A;  4O2A A;  2ZVY A;  4I4T B;  5B8F A;  3HJW C;  2N48 A;  3LFO A;  3IKE A;  4I50 A;  1VQ5 F;  4O4J B;  2RHL A;  3NMU C;  3K2X A;  4X1Y A;  3IKF A;  3E22 B;  5EYP A;  1JJ2 F;  1JY8 A;  1VQL F;  1VQ7 F;  1T0A A;  4BT4 A;  3HAX D;  1YJ9 F;  3JAM M;  4BVR A;  3MDO A;  3V3T A;  3F6M A;  4ZOL A;  4TV9 B;  2W8B C;  4X3L A;  2ZOD A;  3WPW A;  4IIJ B;  3LME A;  4X3M A;  2Q1X A;  3CYQ A;  3JAS B;  1IV2 A;  3FFM A;  5CA1 B;  1DT9 A;  4U39 A;  5FLX M;  5IYZ B;  3J7A R;  3FPI A;  2CZW A;  5LOV B;  3LWP C;  4B46 A;  1TUB A;  5CA0 A;  1RQ7 A;  3JAL B;  3JAW A;  2EWC A;  3OON A;  4C8E A;  1T0K B;  1W41 A;  3RYF B;  1VH8 A;  4ERH A;  5C8Y A;  1H7M A;  3F0G A;  5MN4 A;  2R75 1;  1RLU A;  3G4S F;  5ITZ B;  3VMF B;  3HKC B;  1VQ6 F;  2K1S A;  3PAF A;  4RHA A;  3O85 A;  3SIU A;  3CMA F;  4ZK7 A;  2ZF8 A;  3IEW A;  2HP0 A;  4G88 A;  1ZWZ A;  4O4H A;  4O4I A;  3KIZ A;  1FNK A;  1QVF F;  4ZI7 A;  4G4W A;  4X1K A;  2ZVZ A;  5MN6 A;  1YI2 F;  3GHZ A;  3J81 M;  3G6E F;  1H47 A;  1ONI A;  2Z1U A;  3RYI A;  1U3L A;  2KTV A;  1XRG A;  3D00 A;  1FSZ A;  3VYT C;  4I55 A;  3QHD A;  3MCA B;  4EB6 A;  3S03 A;  3V7E A;  1IV1 A;  4ZHQ A;  2VAM A;  4WBN A;  2GVI A;  4NUT A;  3RYC A;  2JNB A;  1W59 A;  3IMP A;  1N8R H;  4YJ3 B;  3T80 A;  4E6E A;  2AMT A;  4O4L B;  5G4U C;  2MQE A;  5HP8 A;  1X25 A;  5GIP C;  3CCV F;  1YHQ F;  4B5C A;  1VHA A;  2DYY A;  3GYQ A;  4HNA B;  5HXZ A;  3CG6 A;  1W55 A;  2UYP A;  3RA5 A;  4PWT A;  2KG4 A;  3VOA A;  2WAL A;  3CC7 F;  5KMG A;  3C9S A;  1UFY A;  3E1Y A;  3PLA C;  4O2B A;  1XV2 A;  3JAT B;  3CC2 F;  5LP6 B;  4LNU A;  3TD4 A;  1YIJ F;  1VQO F;  4ZHY B;  3M84 A;  2VGN A;  3HKD A;  4TV8 B;  3VYS C;  3EOR A;  5LXT B;  2LBT A;  1VQV A;  2HS3 A;  1VQP F;  5JQG B;  1VQ8 F;  1Z5W A;  1OFU A;  2CVL A;  2IAF A;  3VIU A;  4I4T A;  1NMU B;  4NQ3 A;  3SIV A;  4G4V A;  3CC4 F;  2IQQ A;  5JCO A;  3P4E A;  3N2G B;  3HTN A;  4DXD A;  3VTI C;  3UT5 B;  1QVG F;  1J7H A;  5LA6 B;  5J2U B;  5FJ4 C;  4O4J A;  3K0T A;  1U3P A;  3CCM F;  5AVM A;  2B33 A;  3C9U A;  3E22 A;  3B6N A;  3JAR B;  5JVD A;  5GAP K;  1W5F A;  2UYJ A;  1JD1 A;  1DBF A;  4X20 A;  3HKB B;  2H8C A;  3HKE B;  4TV9 A;  1COM A;  2P6Y A;  2R6R 1;  5GON B;  1K73 H;  4M8I A;  3N2K B;  4IIJ A;  2HX0 A;  3JAS A;  3ZP7 A;  1QD9 A;  5EZY B;  5CA1 A;  3NVI B;  5IYZ A;  3LWR C;  4G4X A;  3RYH B;  3V4D A;  3E20 B;  5LOV A;  3OW2 F;  3JAL A;  5EIB D;  5G4V C;  1PXW A;  4U3J A;  3QTY A;  1JFF B;  5JVD B;  1CK2 A;  4EI9 A;  3RYF A;  5HWE A;  2QTP A;  2HQS C;  3KJK A;  3OBY A;  5ITZ A;  3HKC A;  4FFB B;  5KX5 B;  3Q8H A;  1FFX B;  3CXC F;  2VAP A;  3P10 A;  3GTZ A;  3LDT A;  4TUY B;  3JAW B;  5EO3 A;  3F0E A;  1K9M H;  2IG8 A;  3M1X A;  1QU9 A;  4IHJ B;  1YQN A;  3RA6 A;  3WGM A;  2RHO A;  5HY1 A;  2OTJ F;  2H6L A;  2I6D A;  1W58 1;  2BTO A;  1TVK A;  3WJR A;  2UZH A;  5EB1 B;  1Q86 H;  2UYK A;  2CW4 A;  5MN5 A;  1IV3 A;  3U0O A;  1K8A H;  5IJ0 B;  3CCL F;  1SDS A;  4BT5 A;  2Z1F A;  1IPA A;  1W5A A;  3CCR F;  5LYJ B;  1IV4 A;  3WJP A;  2FC3 A;  4EI8 A;  1E7K A;  3NK7 A;  1Z5V A;  1YJW F;  4NWO B;  1GX1 A;  4C81 A;  4X1I B;  3ERN A;  5EAZ A;  3QUW A;  4YJ3 A;  2FGY A;  4BT6 A;  2YXZ A;  4O4L A;  2KGW A;  1KNJ A;  2G9I A;  2HP3 A;  3F0D A;  3CCJ F;  5J2T B;  2RHJ A;  3I7T A;  3D01 A;  3M4S A;  3JAK B;  5LP6 C;  3C9T A;  3VI6 A;  4BT3 A;  4LCK A;  3ZO8 A;  3WJQ A;  2UYN B;  5BMV B;  5EIB C;  3C8L A;  1H48 A;  3VYU C;  4HNA A;  5FNV B;  2V9Y A;  4DRX B;  3JVH A;  3S0W A;  1SA0 B;  4B62 A;  4G4Z A;  5JH7 B;  4BVT A;  1KNK A;  2CWJ A;  3I3F A;  5IJ9 B;  5JCO C;  3NVK E;  3JAT A;  1GZ0 A;  2AIZ P;  5DCV A;  5LP6 A;  5GIN C;  3F0F A;  3CCQ F;  1Q7Y H;  1XBI A;  4TV8 A;  1X7P A;  3RE3 A;  3CME F;  5LXT A;  2PHN A;  5KMG B;  2OTL F;  4YJ2 B;  5JQG A;  1W57 A;  2L26 A;  3NK6 A;  5CB4 B;  1W40 A;  3LWV C;  3G71 F;  5EWR A;  1GO0 A;  2ZOV A;  1W5E A;  5GAN K;  1FNJ A;  3LYB A;  3WPX A;  4F6R B;  3N2G A;  1RLG A;  3UT5 A;  1GO1 A;  1M1K H;  2CSL A;  5HXU A;  5LA6 A;  2QI2 A;  5J2U A;  4BY9 D;  2RHH A;  3WXM B;  3CYP B;  4O2A B;  1W3E X;  3KHN A;  3KE1 A;  1NJI H;  3JAR A;  4XCQ A;  1NQ3 A;  3MQW A;  2Z01 A;  1VQ4 F;  1OAP A;  1VQK F;  3HKB A;  3TD5 A;  5GIO C;  2F9Z C;  3HKE A;  4I50 B;  4R40 B;  1Q82 H;  4BVS A;  4X1Y B;  1CLI A;  5GON A;  3N2K A;  3ELC A;  2PMP A;  2VAW A;  4TZZ A;  5EYP B;  3ESJ A;  1Q81 H;  4BT2 A;  5EZY A;  1W5B A;  4C82 A;  1PF5 A;  3IEQ A;  2ALE A;  3RYH A;  3J80 M;  4X20 B;  2BO1 A;  4BT7 A;  3LWO C;  2YYE A;  4ZOL B;  3VO8 A;  1VQN F;  4C4W C;  2OZB A;  3CPW F;  1JFF A;  2VXY A; 
#chains in the Genus database with same CATH homology
 3S0H A;  2W8B C;  3WPW A;  1R1M A;  2ZVY A;  1OAP A;  4RHA A;  3TD3 A;  2N48 A;  3CYQ A;  3TD5 A;  2LCA A;  3S06 A;  4ZHW A;  4PWT A;  2ZF8 A;  2L26 A;  3LDT A;  4R40 B;  4G4V A;  3S03 A;  4G88 A;  2ZOV A;  4B5C A;  3S02 A;  5EB0 A;  3S0W A;  3WPX A;  3IMP A;  4G4Z A;  4G4Y A;  4G4X A;  4B62 A;  3OON A;  3S0Y A;  5EAZ A;  3TD4 A;  4ERH A;  4ZHY B;  4ZHV A;  2MQE A;  2AIZ P;  4G4W A;  5EB1 B;  2ZVZ A;  2KGW A;  3CYP B;  2HQS C;  3KHN A;  2LBT A;  2K1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...