2K2WA

Second brct domain of nbs1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
111
structure length
111
Chain Sequence
MKRKSIFKDKVFLFLNAKQYKKLSPAVLFGGGKTDLLMGELKDASVLDNPATCVIDVAMTESQLSESQSTQPWITSTLDLLQSKGLRTIPEAEIGLAVINVSTEIYCNPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a second BRCT domain identified in the nijmegen breakage syndrome protein Nbs1 and its function in an MDC1-dependent localization of Nbs1 to DNA damage sites.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Cell cycle
molecule keywords Recombination and DNA repair protein
total genus 33
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2k2wA00
2K2WA
chains in the Genus database with same CATH superfamily
2XSZA 1X14A 1CUVA 3H1FA 4BO7A 3RRYA 4LY9A 1CJTC 4Y9TA 4H4DA 2HMTA 4Z4HA 4K9SA 1ORWA 3EVZA 3IBFA 4U00A 2GEFA 1X92A 2YW2A 5IDXA 5FTKA 1IOZA 3FDXA 4LJ7A 3V1MA 2BFPA 3SQLA 2B8WA 2CMKA 1B4DA 1OBFO 3DLCA 4ROTA 5LOVA 5TLSA 5DH9A 2BELA 3HUEA 3PR3A 3UB2A 3QA3E 3COVA 1ODIA 1Y3HA 1JE1A 3KZVA 4HAIA 4C6TB 4PINA 2QQ5A 2CNLA 3UM9A 4E11A 1EVIA 2WI8A 3F5MA 5IVDA 5B6PA 1T1GA 3TDKA 2ZWVA 1Y5NA 2J4CA 2O06A 3ZGOA 4IIDA 1V1MB 2QP4A 2XDYA 1UC9A 4R3NA 4B8WA 1KZYC 4JP1A 3S7ZA 3OEEA 1H69A 4ZXPA 3PUVA 3TXAA 5DP2A 2P5SA 5FL7A 4CM4B 4IZIA 1SBHA 4URZR 5I7WA 1G98A 3K5PA 1CZLA 2B7CA 1SEVA 4QUBA 1F2UA 5TEWA 4BO9A 3GL9A 3NHWA 4BVHA 2BFCB 3SSNA 1OILA 1Z6TA 1DPFA 3AB3A 5TC4A 5EJ2A 3FYSA 1AKTA 3NEPX 5BOSB 1E3QA 2WABA 3K0SA 2QT1A 3MD0A 1Y6ZA 3P9NA 4IW3B 1AHHA 3RT9A 5AW1A 1OFUA 3D5TA 2QE7D 3OX3A 2EZ9A 4P53A 2G7ZA 4MIOA 3EOAI 4JC5A 3TWOA 1KMHA 1ZD4A 3OU6A 4NENA 4RD3A 4MQMA 4X84A 2Q28A 2W37A 2YBDA 2FZCA 4YMLA 1K27A 1N2SA 3G2QA 4LVNA 2PIDA 4V38A 4U6NA 4J0HA 2REOA 3IURA 1E8DA 3OF5A 4OUDA 5E4YA 3U7FB 2ZWIA 3IAHA 3HB5X 1L4YA 1RAGA 5EE1A 1MKYA 1PFWA 2OZEA 2PGXA 3TRIA 4A8JB 2Y0EA 4TSFD 1YS7A 1XEAA 2UZ1A 5TT0A 2WW8A 1ZISA 4BLVA 5DYGA 2RGGA 2EDAA 3FW1A 3K6KA 1NHWA 2HEGA 4YCDA 4HGQA 1KI6A 1D6MA 1K4YA 2EJCA 3PNSA 2PS9A 1C7ZA 2VDLB 4IIGA 1M34B 4MYRA 2JCYA 3ZUPA 1GAWA 4PHCA 1ORTA 4DWVA 2RIPA 1H2RS 4Z9AA 2OXEA 3N6XA 4JUBA 2ADMA 3HLKA 4ZODA 4A91A 1ZD5A 2CW5A 4EJFA 2VPTA 3THWB 3E9ZA 1R18A 2ROQA 3G0IA 3CB4A 3M33A 1Y42X 1VPDA 5DTMA 5DM60 1VJ0A 4G0QA 2F43B 2C3UA 3K71B 3B1FA 3A9CA 3Q15C 3F4BA 3NANA 1LDNA 4DV4B 4WOBA 2AOWA 2FKNA 5DHAA 3X2EA 4OFZA 1XMPA 2EJUA 4IRXA 3TNFA 1MZVA 3WLRA 4N39A 3COYA 3FNQA 1V5IA 1ETUA 4I1IA 4I55B 4XDGA 4FYJA 1FA9A 5HTOA 3C1OA 1N2GA 4K05A 1K86A 121PA 1WS6A 2VNSA 3L41A 2EFCB 5ITSA 2QTBA 1SBTA 4HEQA 1K8ZB 1R5NA 2YHAA 1KZ1A 3LCRA 1SXJE 5BV2P 2I3BA 4HWKA 3AHGA 4PFJA 2VNHA 4XWAA 1OLSA 3SFVA 3P9SA 2XGSA 2ZT5A 3OLVA 4YAKA 1JECA 3B38A 4BWFB 4RVSA 5IABA 4IXDA 1MAVA 3QLUC 4XQEA 3ASVA 1F17A 4RXTA 3GBVA 2HQOA 2ISCA 1SNYA 1KYWA 3LPMA 4GIBA 5FPSA 2HLPA 4AJJA 1LBEA 1P74A 3LUCA 3EQ8A 3RVMA 4QKQA 1P2TA 3U7HB 5JYDA 2VBIA 2FG5A 2VDQB 3FETA 4PPGA 1FDIA 4LJ9A 2L17A 3KR2A 2VG8A 2VQ3A 4IEEA 4N6OA 4URUR 2OHIA 1IWOA 4XEUA 5ALQA 4IDDA 4X24A 3UYKA 3IUBA 4AJOA 2QW1A 4B71A 2GHIA 2RHCA 3BICA 3H5TA 2VZ9A 4B47A 1KEWA 1IYZA 3K9LA 3W9SA 2Y1LA 3U3RA 1T26A 1U2EA 2OL4A 3QLVA 4NENB 4OQDA 1M1NA 5BMVF 2BRUC 2XLBA 1Y3CE 5F5XA 3OFVA 2CLFB 2QTHA 3CS3A 4MQFA 1RWOA 2AMLA 5ALXA 4DBLC 3QU4A 4G0PA 1PJCA 1PNTA 3AUXA 1VIYA 2DPYA 4ITRC 5HCIA 5TR9A 5AI8A 1G4UR 3KAKA 3S2SA 3DAHA 1W29A 4WLOA 5AVTA 5D1NA 5AJUA 2JLAA 3HKCB 1A1SA 4TTRA 4X1IB 3EAGA 4Q4JB 2DJIA 1WCXA 1LS6A 3VR4D 5C5DA 3K6SB 4KZPA 1TO6A 2I7XA 4KN8A 4L2IB 5C3UA 4BN4A 4YMGA 2CF6A 2CHEA 2WJIA 3BG5A 2BR4A 4JR2A 3KT3A 1Y5MA 4L16A 4MPDA 4ZVPA 5TJHA 3RRZA 4BTVA 1YA8A 2F9FA 1ZR4A 1CKEA 2YQ4A 3TGWA 4UMEA 4WCFA 2DBQA 3RREA 3RGWS 3JD1A 1E79A 4JFRA 4LJ8A 3ABZA 3QJ5A 2XNHA 4PYQA 3BIWA 3VDNB 2CKMA 4YH1A 3KXKA 5A05A 4QM6A 3HB7A 3PPVA 3WZLA 1U3DA 1U3CA 4F0JA 1E1QA 1P1CA 2WR8A 3QI2A 5KNCA 5L3SB 3EEYA 1LSSA 4V1CB 3MJVA 2G1JA 4QOSA 3GLRA 6YASA 3EXIB 4B45A 3J81A 3T7JA 1FUEA 3U49A 1IHPA 1XCOA 3WA6A 2PX0A 3GFSA 5KZMB 3VMMA 1U3TA 3AVVA 1J9ZA 2LCQA 1NVVR 4G5OA 3BF8A 4PG6A 3OKFA 4CCAA 1CQIB 1ZLXA 1IEWA 3BM5A 1WP9A 2Q5EA 1Z6AA 3EG9A 5AOBA 2W2TA 3ROZA 1JHQA 4KJZA 3CLUC 5GZ1A 3OC0A 1VIVA 3M1YA 3GP5A 4HLUC 4WKNA 1H1TA 4I50A 3B2NA 2H4HA 3K05A 3CLRD 4ND5A 1VE3A 3CKYA 4E5PA 4B5KA 4WJLA 4GH5A 4JYZA 2YVQA 5FTLA 1AVTA 4BAGA 3PX7A 1P9OA 1UBHS 5ELLA 3V2IA 3KOOA 1DRKA 1R0KA 2ZTMA 4PZZA 4YAIA 5L7WA 5KTMA 2H4JA 4JJKA 4ZREA 3GJSA 1B0UA 3ANYB 4QYXA 1GP2A 2WWHA 2OM2A 4J49A 3IESA 4NF2A 4C0HA 3OZTA 4F38A 4LDJA 4DMFA 3AYZB 1TM5E 4RZXA 5CTAA 4C0LA 2PEYA 3LUBA 4ZT4A 5CB0A 1Y4SA 3N0RA 4JLNA 4NE9A 4PXSA 5GIOE 1C8KA 1COWD 2GJSA 2VDPB 1FTSA 3BIXA 3RKUA 2AZ4A 4DDHA 3CNQS 1QHYA 4L8YA 3A05A 2DB3A 4LKRA 2IU0A 4YJHA 1ECLA 4WN9A 3VKWA 5LDDC 5KQGA 2REBA 3K8YA 3S8YA 5HFJA 3WYAA 3G5MA 2BFWA 3RRXA 1NM5C 4E4YA 4LZNA 1N2OA 2XY4A 4O5AA 4WOKA 2EFJA 4XGIA 5U4XA 2R6R1 4D0GA 4DLLA 1ONNA 1UC8A 3F9IA 2ZIWB 4N3BA 1GZ6A 2WF7A 5ER6A 5FOSA 5CHEA 4H1TA 3UEOA 4NZYA 2W22A 3D6FA 2R1VB 5H3CA 3JW8A 4A73A 1AK1A 1O96A 1X74A 1C3EA 4AW9A 1ZL2A 4E5UA 2X23A 4JYPA 4ITUA 4A6XA 5AVYA 4KQWA 5KC8A 1N75A 2XEXA 3WISA 5E1OA 1EGMB 3UUGA 3U26A 2O8DB 3P19A 1E9FA 4JGGA 2PXXA 3D7RA 2PJDA 4W8HA 2AKEA 4PR3A 3OCYA 3THRA 4L5JA 1J0DA 2I8AA 1QAMA 1CY8A 4RIIA 1B23P 4IFBA 4FWBA 2QQ0A 2GAIA 1WBDA 3BE8A 1U2DA 2ZZNA 2WJPA 5I4CA 2HC9A 2RHLA 1OI7A 3OQJA 3N5CA 1M6EX 4OHCA 1RXWA 1C1DB 4OQPA 2FWBA 2XAUA 3T3HA 3Q5EA 4ZC1A 1KL7A 2G0NA 5FOXA 2SCUB 3ESBA 3PPIA 5GVSA 5AW5A 2B0CA 4IPTA 1XWWA 3SEZA 4CLRB 2VDWA 3C4QA 3IUEA 3LXRA 3KPYA 1M2EA 2QDKA 2FGKA 2ZATA 2NADA 4B3FX 3HR4A 4JC0A 3OY2A 3UV3A 4I3FA 4INAA 1RXIA 4NAHA 2ECFA 4DSOA 3BULA 1Z4JA 3QE2A 4JA2A 2W2VA 2IIBA 4IXTA 1Z33A 5M3BA 1O96B 2ZLBA 1FFXB 2GD1O 1E89A 2AWNA 3DBIA 3EZ9A 3NIWA 1MU0A 2VPQA 4KPUA 5ESDA 2RHBA 1L5ZA 3BIFA 4OHWA 4XVHA 1LWOA 5C0OE 4CF3A 2NQ2C 2WSIA 1VE9A 3E9NA 2QTNA 4FCTA 4RC9A 5EXXA 3VNAA 1OC2A 3FLEA 5I47A 4CFZA 2UU9B 4MB0A 3JRNA 3P94A 2O2EA 4NY1A 5G0WA 2AXPA 4LSMA 4PX2A 1BRTA 1U9IC 3TZBA 2PA0A 3C3AA 2X0FA 4NONA 4B75A 3WLMA 1WUKS 3DBHA 1GNLA 3HB4X 3WXMA 3OE1A 4POAA 3TLMA 5E2AA 1JSXA 2D59A 3MWEA 1B2LA 5ADUS 3N8HA 4KK3A 4ENPA 5E6RA 1NI4B 5IT4A 2FEWB 4LMPA 3PICA 1KDTA 4NMMA 2Q2VA 3KZMA 3R3VA 4ZFNA 2I78A 4KGZA 3T41A 1U8EA 3W6NA 3H9EO 3UK0A 4WNCA 2WFAA 4JENA 2AEMA 1UBKS 1U7WA 4QHSA 5H7XA 3RUFA 4E12A 2V1XA 5BUCA 4Y2TA 5CB4A 4Q9JA 4ND8A 1V5GA 1K8XB 1AUVA 2Q1SA 3CEPB 5LQDA 1HDCA 4JVOA 4TSFA 1I30A 1M1NB 2OP0A 4G25A 4MR7B 3TQOA 2IYVA 3VSBA 2Q7OE 4DLUA 5JO9A 3TOSA 5I9TA 3DGFC 3RTAA 3R6DA 4JLPA 2G5TA 4JLBA 5KDOA 6REQB 2UYQA 3WVNA 3U4GA 7ABPA 4FB4A 1Z5VA 4ND2A 1RACA 2D1SA 2ANBA 2EKBA 1XLTA 2IXAA 5AJWA 1TIKA 5TPWB 1DKNA 3WDLA 2CVHA 2D0IA 1WMSA 2QYSA 3HN7A 4TTQA 3KX2A 9ATCA 5AO9A 1PR6A 4FMPA 5AP9A 3P9YA 4WV3A 1GQQA 4JI3B 1V3TA 3TW8A 2OCXA 3P2OA 1Z0KA 5LB4A 3W6OA 2ZQZA 2Y93A 4M9UA 5EZSA 3PQEA 3A9RA 1B42A 4IGKA 1O9GA 3HDGA 5ILQA 2ZTSA 3AL0C 1XZQA 3DXZA 3ET4A 3I6IA 2VRCA 3OD1A 4FYYA 3SIPA 1GPMA 1OXUA 4G8BA 5JLJA 1JIVA 2QRUA 4LK3A 4YB8A 5B6IA 5JS7A 3TSZA 3DV2A 4QBKA 1KQGA 5H9WA 1D03A 1GZVA 1UWVA 4K9DA 3S1AA 5KPDA 3P9IA 1UL1X 3GAAA 1TA4A 1LCIA 3C48A 1LDGA 3C15C 2NMVA 1N2CB 2R47A 2WWXA 2X1HA 3STUA 4D6XA 2WM8A 3QU5A 5TS2A 4H7DA 1WZIA 3PNMA 5DRTA 1OW3B 5F1PA 5FBQB 3T38A 4FDAA 3ZGNA 2C9DA 5TMDA 1Z56C 2FEMA 1Y98A 4PBTA 1BKYA 1A71A 3SCZA 4YRCA 1LI7A 3AGQA 4JJGA 4IDQA 2IOQA 4GPBA 1ESZA 3HP1A 4F7WA 3L01A 1U0FA 3PVZA 5C4IA 4DNQA 3G8AA 3DBVO 4PRZA 2JLBA 4YCLA 4UU1A 4IUBS 2O7VA 4HXFB 3WGUA 4R5MA 1MXFA 4ARZB 1RHMA 1F3LA 3DMPA 3M0EA 2PH1A 3KB2A 4M7PA 4RLFA 1JEDA 3MQ2A 3FI0A 4W9NC 3BSYA 3UUFA 3DW1X 2LCFA 5HILA 2BM0A 1KPIA 5EZQA 4YK7A 4EGSA 2OB1A 4LFCB 2QAGB 1RWNA 2PYDA 4JJIA 2VP3A 3AJ8A 3B3QA 2GCNA 4IIXA 4DMKA 3E9YA 5KNBD 1DC4A 1RZ3A 3I0ZA 2VHCA 4YIHA 1QZXA 3UHJA 5EKDA 4YP1A 1SPXA 4CNBA 1B8VA 2H16A 1KDYA 4E1AA 1KMCA 1XHFA 1LD3A 2HRQA 3EHDA 3ZLVA 1QONA 3GX1A 1F9AA 2V9CA 5AKKA 4IIVA 3AW9A 4IIHA 4NZZA 1RFLA 4Q9AA 3LPNA 1NPDA 2GN2A 2I8LA 4DV1B 2G5GX 3C5WP 1VJGA 4D3XA 1P62B 3KSZO 3L5OA 4LTMA 1J23A 2YXNA 5D8DA 9MHTA 1NJ8A 4GEKA 1IM8A 2QKYA 1NQTA 3QW4B 5MN5A 2E6KA 1TTTA 4N54A 1I3CA 1QOPB 1YKGA 1UT5A 5A9RA 3QVGB 2CB0A 2GAJA 1PAUA 3H2YA 3RYFA 1S3GA 3M2TA 4FHCA 1R4NA 3OE7D 3TPFA 1YRLA 2ZS9A 1CE8A 3UJDA 3W04A 1RTKA 1IUKA 1GUBA 3AR7A 4WQMA 1W5FA 1H5UA 2CDBA 3A3PA 3AHCA 3MLAA 2HPAA 3W2HA 1IMJA 4F12A 4XM0A 2I6XA 3KM0A 1U7PA 4IVQA 3VR0A 3GOHA 3SZOA 5DHUA 4BLOA 1V37A 2IU3A 2FFRA 3LW7A 4MUJA 1PS8A 1C3JA 1XZDA 3BRQA 1RYMA 3HWX1 4NFLA 5D86A 1YJAA 2HUNA 1W0KA 4R7TA 4CM5A 5F9MA 1P9WA 1FS5A 2QT0A 2ONJA 5JW6A 5KBYA 1X15A 3VKGA 4IDPA 2XQIA 3V8BA 1QHGA 1CK4A 4P8RA 4EM6A 4F8YA 5E1BA 3O83A 1J99A 4TKMA 1T0UA 2J3QA 3P0RA 2PMCA 3F8TA 1ZUD1 4R8RA 4S0ZA 4FTWA 1NWCA 4K87A 1NT4A 3BDAA 3O4JA 3QIAA 1Z39A 2W6IA 2ZPUA 3IALA 5AVSA 4BE9A 4R9VA 1RPAA 3FFXA 4EOGA 2FYTA 4CIAA 1PQ4A 3NZEA 1IZ7A 3IELA 2G1AA 2QMUA 4Y2VA 2F67A 1EQ2A 3EEBA 1JXAA 1RWKA 1U4OA 3QU2A 2P3SA 3VR4H 4HX2A 2ERYA 2FN3A 3EZ2A 2AJLI 5DSXA 3G7NA 4MO9A 2CSXA 2W42A 2JB9A 2VDRB 2XYQA 1VPVA 4M1MA 4UD2A 2V9PA 3T9AA 9GPBA 4F91B 2LBPA 4O4JB 1F5NA 1H8HA 4P3OA 4QD3A 3UXHA 4J3FA 3Q2OA 5DV9A 5JROA 3GJTA 1GTL1 4ZO9A 3WIUA 4P7JA 3GB9A 4BNHA 1LBHA 3QUQA 2HA6A 4N9WA 3VVLA 2VSYA 1L4MA 1NNSA 5BW6B 1GRRA 2C0CA 4U3JB 5LQMA 2Q27A 2Z8XA 1A69A 1JTFA 3QEBZ 4R98A 3ZU5A 4JI2B 4H17A 4NOLA 5KX5B 2OZLB 4EI7A 2NTJA 2DR0A 1RTTA 3PNYA 1EZZA 2P2YA 2Y4OA 2JFXA 3TNDA 3UJ9A 4QBHA 4U7JA 3KSMA 2GPTA 1OASA 1J20A 1E5QA 1GFZA 5TF4A 3G02A 1FLNA 1T9DA 1VKZA 1FNBA 3W9UA 2O5CA 5L3QB 2ZULA 5FEMA 1KVRA 1T4GA 3PA6A 5H16A 2EKDA 2RH8A 1MDFA 5JAOA 1RQ7A 1WCV1 2OCLA 2GXSA 2ZVPX 4PQGA 5K0EA 1JEYA 2E48A 2PQ6A 4JK3A 5LM3A 1QMPA 1ELOA 1T4CA 1UKEA 4FT4A 4C20A 1XU7A 4ZV9A 5HA5A 1KHTA 5KEIA 4KG7A 4UUMA 1QIHA 5LMUB 4TKVA 1I8TA 3TINA 2W00A 2VN8A 4PLYA 4YT5A 2I1VB 2JS7A 3ZV4A 4QDUA 5KTKA 4TTTS 3ENNA 4NJEA 5HF6A 2WJHA 5I8PA 2Z1MA 4HWOA 3QVTA 2ASEA 4YMIA 2UXCB 1RAAA 1Z5GA 2VDNB 2ZDGA 3EFBA 3LCJA 4JLWA 4LBYA 3U9LA 3VO1A 3WYEA 3AU8A 3G9UA 2FCRA 4IYRA 1ZMBA 4ON9A 1O0SA 1ODFA 4IUCS 4WKCA 5K3CA 3QVVA 3Q7QA 3MTJA 4B6FA 4NIMA 2HWXA 2BGIA 3ABIA 1ZI6A 1I0LA 4MS3B 4BVEA 4D5EA 1ML3A 1YB4A 3ZLTA 1P6QA 3WMGA 1NVEA 4K9MA 1WU8A 4XWWA 4BNJA 2MSCB 2R7NA 3AJDA 2ZCVA 3IYLW 5CFLA 3V4SA 4GKJB 1E3SA 1NL3A 1XDBA 3MB8A 4H9GA 1NQ5A 1OWNA 2WB4A 1PLJA 2VWPA 4MKIA 2IHNA 4NH4A 2WJWA 3N1UA 4KWEA 1DC5A 2HDNB 1H0RA 4OO3A 2EFHB 2IEYA 3GVHA 3KLNA 3HKDB 1LKZA 3P9CA 4I4IA 3DE7X 5F7XA 4CMIA 4R6WA 3FOEC 1H2HA 4NS1A 1VIDA 1OH8A 3AUUA 4O4LF 1VLVA 1AG9A 1MO6A 1PR0A 1WNTA 2C3PA 2OKCA 1B76A 4FXPA 4KVZA 4RHXA 4YFYA 1B6SA 4XGNA 1I7NA 1N7IA 1CQWA 1XCLA 3AJEA 2PZBA 2V7XA 1TIBA 4DV3B 2E4VA 2HTEA 1UBGA 4ZCRA 1A9RA 1S5PA 3HABA 4HAYA 3CNHA 3ZDRA 5C2JB 2D5BA 5DSZA 1G1AA 4G3XA 4R16A 1BMFA 2YFYA 4OHVA 1N32B 5LMNB 2GEBA 2ZBGA 5CCEA 1VA5A 1RZRA 5EPEA 3MCTA 3LHFA 2IXFA 3F5QA 1AK2A 5EXPA 4C05A 2OHGA 2MINB 2QX7A 4HDRA 3VAYA 1E4EB 1TX4B 1XL0A 2C96A 2H5IA 3A1EA 3A31A 3EPRA 3NTRA 4LVUA 1YSCA 3AR4A 2ZRBA 3GLIE 3CYFA 3HR7A 4NCXA 3S2EA 5KI6A 3LW8A 3BZWA 5BSHA 1WXQA 3TLBA 4I5GA 4R2HA 2HQ1A 2ALJA 3QV1A 3VX4A 4B81A 1R0YA 2QJRA 5ETJA 2WIBA 3B89A 1R16A 2VQSA 3PUHA 5AXCA 3CG0A 3GMDA 3TLKA 5KSYA 4C2UA 2JFFA 3ROKA 3NIGB 2H8GA 3BGSA 2W2OA 3G68A 1MB4A 1OLXB 3HP7A 4UHBA 2IUEA 2E0IA 1S3SA 4MAFA 5CT6A 1HNZB 3TW0A 3FYHA 3NWJA 1A5SB 1AM4D 4PW0A 2B4YA 4E4RA 4EZBA 4NICA 1XZGA 4G07A 4EG3A 2Y9PB 2L82A 2ZJ8A 4V0SA 2RGBA 2P40A 3UJHA 3E3NA 5K09A 2YXDA 3BE5A 3TUJC 3W8EA 4DZRA 2ZM5A 3QFSA 1XZJA 3AI3A 2XGMA 5IZCC 3TAHA 2ZR7A 3K0AA 4IL5A 2PFGA 4WIAA 3BE6A 4RK0A 3H19A 2FPOA 3CW9A 5COBA 2ZWOA 4FCVA 5ITZA 2B61A 2QAGA 3H2BA 1V11A 3HNOA 5IC5A 1YU6A 3A1VA 2EQAA 3ZV7A 4JI0B 2H11A 4P31A 4MKGA 4R6XA 4ARZA 3KJIA 4U9HS 3EH1A 4I1VA 4INJA 1LGYA 2VOEA 2DFKB 3I2FA 4LJYA 2AQ8A 4CI9A 3MJHA 3CTMA 2P9BA 3PXUA 3FZEA 3Q85A 2NVBA 2XCQA 3CE6A 3I39X 3T7DA 4MJLA 1CPYA 1IAQA 2XDAA 3EPHA 1XKQA 1FMJA 2WHYA 3LXUX 4QUKA 2YRXA 3B9BA 3E9CA 5C52B 3IV7A 2Z08A 4LX0A 5AVRA 3D3KA 1OA1A 1JAXA 3IMEA 2I54A 2XNDA 3DZIA 4FFMA 4BTLA 2AXQA 3I92A 4O4IB 4NYMR 2NSLA 2PIAA 4CEHA 1N6RA 3I30X 3T9EA 4B46A 2JJ2D 4PGGA 5FULA 2JHFA 1JKJA 4MRMA 4WZBB 2WKWA 3BJIC 3PGVA 3F47A 1VP9A 1IBSA 2FSPA 2ZYWX 5DMXA 2BEWA 1IVYA 1Y1SA 4CNQA 2FDRA 1LUAA 2X2PA 2JGRA 1QH8A 3DXYA 3GD7A 2QRGA 3BPSA 1GL9B 4J1NA 4HH0A 3S1AB 4JLMA 3U3XA 3AO0B 3KKNA 1HSOA 1KGSA 1YULA 3CZQA 1DGQA 4BU1A 4UTXA 5FTNA 1UBUS 1XTUA 3GQVA 3A6HA 3H6HA 2FZKA 1KK0A 1Q16A 1Y3FE 2FE1A 2PH5A 3N7UA 3L8CA 3GI1A 4GBED 3FRIA 4W7SA 4B4DA 2B82A 3ZZ1A 4B6EA 4TQGA 2VCEA 1QYRA 4QZVA 3RYIA 3PF9A 4IICA 5EGSA 4TQ9A 4M8SA 2B3TA 4WL0A 4BIIA 3KT0A 3M6IA 1DLIA 3HB9A 3D54D 4UBIA 4DB4A 1BJTA 3EZFA 1D2MA 2N47A 5BNIA 7AT1A 2FRXA 3DM5A 3O8OB 1OMOA 2JA2A 4CRWB 2RSLA 4MV9A 3ENWA 3ZNOA 3BK2A 1RXYA 3GJ8A 3QEOA 4R41A 3QLVC 3C3YA 1N8SA 4HMQA 3FKJA 3OIVA 4WX2B 4PRLA 4WNAA 1VGVA 1T2AA 4ZK2A 2WLSA 3ANSA 5GONB 3A6PC 2O48X 3HFRA 4O63O 4YONB 3RAGA 3B60A 3OTQA 3PWSA 1JPNA 3HM9A 1DO2A 3CVVA 2IPAB 4CMJA 3KUCA 4QL3A 1SHKA 4X1KB 1Z28A 5E0OA 3JWJA 5LLSA 4CQLA 4O3FA 2BFOA 1FJXA 2SCUA 4O25A 3CZ4A 3JQEA 1USUA 4BJHB 3SG0A 4ZPJA 1E0SA 4BGEA 1C3VA 1IEVA 1OLUA 2V6FA 3A27A 4KBGA 5REQB 4E14A 2C9ZA 1VYUA 2RGEA 4Y1FA 3BA1A 2E82A 4RJ2A 5FUWA 4OI1A 5IH7A 2AEJA 3ZJ4A 3FRHA 3MAAC 13PKA 3O9ZA 3MS7A 4U7TB 1UF9A 2QUZA 1WSBA 2CNNA 5AHKA 1QH1A 521PA 3AR3A 4ZHQA 1T2EA 1X1TA 2H2IA 3B1YA 2VUSA 1VA4A 3B6IA 4WLNA 1ZRMA 2A1TR 2GYYA 3BWXA 1ZFNA 5AOAA 1TQDA 3DFFA 1GADO 2N46A 3FMOB 2GEDA 3H0KA 4QWMA 4OAQA 2D8AA 3UKDA 2DC1A 1EWRA 1DIOB 2EX1A 5EIXA 3NPMA 4KREA 1U2PA 2AFVA 2NO6A 4XD7A 2A5LA 1GCUA 2IKQA 2PBFA 2E7ZA 3C3BA 4Y2UA 4E51A 2LVBA 4HDAA 5GAJA 3E1SA 3WMRA 1YS2X 2J0UB 3C3PA 4NVRA 2H51A 1Z62A 1K9VF 2B20A 1E2LA 2GZMA 1RJDA 3H5LA 3WYBA 1VI2A 1WZCA 1DRVA 4PQRA 1K88A 1QFYA 5BO5A 3W6UA 2EKQA 1JX6A 2V6MA 3GUZA 3V46A 1OTHA 4DIUA 1IY9A 2FU5C 2Y05A 3IDSA 4ZRNA 3LRPA 3EIEA 4Q9DA 4TT8A 3TJRA 1W0JA 1RAHA 1C9KA 4BRWA 1E96A 1Q19A 4MOWA 4RPGA 1E2MA 1H1DA 4DA9A 2R1UA 3BRCA 3FI9A 2EAUA 3BGIA 3NNNA 1QAOA 2WYHA 4Z6KA 3ZCRA 5M7EA 4IX9A 2PO5A 2D7JA 3E3OA 3KYIB 4RV9A 3CX6A 4KQ9A 3REOA 3LL7A 4O4LB 3BH0A 1N33B 4R0MA 3DYIA 3E23A 3QXCA 3AEZA 1EEXB 2VYVD 4X85A 1L8AA 5HDBB 4V0OA 3NHMA 4LE1A 4ARAA 4BZXA 6ADHA 3GRVA 3GJXC 5HYVA 4P35A 3HDHA 1ULSA 2B25A 1Y63A 3E22A 3IT1A 3OX1A 3EVGA 4EYKA 1NP6A 4QPCA 2OLEA 4GKBA 4TQAA 1SKAA 2KX7A 1JPUA 3CKMA 1X1CA 2UZIR 1I2ZA 2OHXA 2HAEA 4HADA 1XZMA 5A2QA 4WZAE 3LQKA 1TA0A 3HO6A 3RS8A 4DRXA 1ENYA 4HYYA 3X1WA 4YT4A 4DV5B 4AKIA 4JB2A 2DLCX 2IOFK 1UIRA 3EXHB 3F96A 1P0CA 3R0VA 2JGDA 2K2QB 3HWRA 4JEMA 4IIFA 1V9SA 1TK3A 1Z35A 3C4VA 4MVJH 4BO6A 2ZUWA 5TDHA 3RC7A 3TVTA 1M6YA 3WWDA 3GRRA 2NP7A 1VB3A 2HNAA 2RGNC 1FNSA 2TMDA 4PX3A 4R2MA 3RIYA 4TM8A 3DMDA 2Q8QA 2DY1A 3I04A 5E6UB 4TKUB 4CCYA 1CNMA 3NVDA 2CZGA 5IJ0A 4KSCA 3U7EB 1V48A 4HTAA 1C4WA 5HZHA 1EDBA 5F5LA 1R9NA 3O6VA 3GIWA 4R1OA 4TMZA 2ZGVA 4RYDA 4RTJA 4E5YA 1NOJA 2PLAA 4BEBA 4FQ5A 4ZICA 5A7GA 1QYIA 2C99A 1N9GA 1BMQA 1YZKA 4YRRA 1R4MA 4PZEA 4CLEA 2UZAA 2HUPA 3FVRA 4P5DA 2OPHA 1H22A 2F3UA 4IWYA 4U2GA 2GN4A 5ECYA 4DIFA 2VP5A 4NMXB 3U9SA 1W36B 1PR2A 1G8GA 1UAGA 3CPHA 2Q5IA 3ILYA 3ORRA 3PUZA 3Q1LA 2XBUA 3SYMA 3F7TA 3X0DA 4B2LA 5C7OO 3EW7A 5JBQA 3WJ2A 2CDCA 3NNDA 3I1JA 3OJCA 3B1XA 3HJAA 1DKOA 5SYMA 5KKAA 5DU2A 1GRNA 5IUKC 3NBAA 3R0ZA 1Z18A 4P58A 3VNQA 3E9MA 3I09A 2A35A 4O08A 2IZ1A 1TJ4A 1EH5A 1U3UA 1FNDA 2V3VA 3GNSA 4XIYA 4BC1A 3IEPA 4HDKB 2JIPA 4UXJA 2XSZD 3WKBA 4KQXA 1AB6A 1CUGA 5BR7A 2PMFA 2X1LA 4HNGA 3ESRA 5K0NA 2HRBA 1T3GA 1KO7A 1TU4A 4OI4A 5AUOB 1HO3A 5FXMA 3TZCA 3WB1A 3CWZA 2LZ0A 3LC1O 4BKQA 1ZAKA 3TN7A 4BX9A 5A9TA 3DT6A 4EF6A 4S1VA 1PUXA 3QG5A 4GVPA 3WYFA 3TNYA 1MABB 4G23A 1JIJA 3LWZA 3QHAA 3OEED 4ZHSA 2IA5A 2ONYA 2XTZA 2AOUA 3HI6A 4IIYA 3ZD7A 4F9TA 2BHLA 1VHQA 2VAPA 2ZRCA 3QV2A 1WMDA 2XUKA 2RG1A 1V8BA 4MHOA 5DHFA 4A03A 2PQ2A 3MWLA 4JL6A 4F8EA 1J0XO 4UDNA 5LA6F 1WW3A 4CMBA 2FP3A 4QDTA 3KNZA 4R5HA 3KCQA 1YHYA 1WMAA 5K4HA 5B3JC 5DI3B 3DZKA 4ZO7A 3MRTA 3DH0A 2X2EA 2C2ZA 2EHDA 4WN3A 5KMGB 3FMIA 4D46A 4J6EA 1G3UA 1T91A 2H31A 3KHTA 2AEEA 1NBEA 3ZBQA 3ZBPA 5EE9A 4L0QA 1C30B 2WZDA 1PDOA 1IXKA 1BX3A 2BEUB 4GWGA 2ZJ1A 1XAGA 4MMYB 5DLYA 3W5SA 3W8FA 4B74A 1RPZA 2V8OA 4C2TA 3IAXA 1WQ4A 1XXHE 5CK4A 2A33A 5IAGA 2MCFA 4RGVA 4JLAA 4YP5A 4MKXA 4EMUA 3PD7A 2GCOB 2NVUA 4Z0PA 4HT3B 4DV6B 4MZXA 1EM8B 3WKCA 4HGZA 4IFTA 4QOJA 1PCXA 5GQSA 2V7GA 3HDTA 1MF7A 5JJKA 2KLHA 3CF0A 3ADBA 1YRYE 1QDLB 1JIKA 4NZ9A 1T8UA 3LL4A 4AULA 4PM4A 3A1NA 3OA0A 1L1EA 3T99A 2LP4Y 3RAEC 1DKQA 3OCJA 1JP7A 2OCBA 1X3SA 3PP8A 1J07A 3U5ZB 4LF6B 2JKVA 3FSGD 4J0CA 4DY4A 1RVV1 1QIEA 5T41A 4MIKA 1BE0A 3TBHA 2VP6A 5JZBA 1CY1A 4M6WA 5AI0A 3WNCA 1A7AA 2A57A 1XZNA 2CLLB 2QXYA 3DQZA 3HUDA 3CURA 2KPOA 3V9AA 1C1HA 2QLNA 1V3UA 2IYSA 3DKKA 4QFMA 3U6KA 4UE3S 2FFQA 4EP1A 3DNPA 4Y6OA 1GYQA 1WVIA 2EKPA 3C97A 2PPVA 3ESZA 2BLLA 2IHUA 1OVGA 3NEJA 4XQ0A 2VJOA 1O8CA 3B7GA 1TVKB 3G5UA 4FZRA 3OE5A 4J91A 1T29A 5IZCA 1MQ9A 2QI9F 4PG8A 5CD9A 2VO1A 5IT9A 3IC5A 1GSAA 2BW0A 2BGJA 1MQAA 2KMLA 3JQPA 1UXKA 4E15A 5C7IO 4W5JA 4GW3A 4YN3A 4AYXA 1SIBE 2P3QA 4XWKA 1QHFA 2F90A 4PYJA 5CPBA 3ZU6A 1NP7A 1HT3A 3I5XA 1RT9A 5KJFA 4PO3X 3V7NA 2F9MA 4F5WA 1E7MA 3AONB 1M2NA 2GDJA 3K20A 3DHNA 5BNZA 3CGGA 3VOSA 3ZZTA 1EB8A 4JHLA 5J5AA 1NP3A 1XZAA 4PONA 3PNKA 1R8YA 3NBXX 3KOYA 4FS8A 1JFFA 4FNAA 2XNKA 2XYGA 4ONEA 4WOJA 5DW3A 2C92A 3HL4A 3UC5A 4AMBA 4C21A 1P5JA 1Y1PA 5LQUA 3RWMB 4DQUA 1SU8A 4TUYF 5DP1A 4I4TA 5FUQA 4HUQB 3H5WA 3QLJA 3V8NA 1RWBA 2DQYA 3R3HA 3PDHA 3RIHA 1NBAA 3H8WA 1CR4A 2Q9CA 1GG5A 4MV0A 2JHCA 3D2BA 4QDZA 1NR7A 4J4TA 4MS4A 1ZICA 1RNLA 4WNYA 5DGHA 2FK7A 4D0NA 1I4LD 1ST2A 4GYYA 4ZAWA 4HRAA 1XAIA 1W76A 2O8CA 1KJ9A 2YVUA 1R8JA 2EOAA 3EUFA 4EX7A 3M2PA 4LNUA 1JWLA 4JAVC 1IMOA 1GQYA 2OAGA 4NPHA 4FR2A 1D4OA 4QARA 3N2KA 4ZEWA 3PJRA 3R6GA 1CX9B 2A4KA 5T64A 4DDMA 4BFLA 4RSRA 4RV5A 2GM4A 3SKYA 3OP1A 1QO9A 3EUEA 3DCNA 3PC7A 1PLKA 3QKUA 3ZU4A 5B7NA 4HLNA 4Y9DA 1EVYA 5LBUA 1P7PA 4ARSA 2I6FA 4XX0A 3TFQA 3KR0A 3FNRA 3RC1A 1ZOPA 2GA8A 1VFPA 3FPSA 2VA9A 3VI4B 1E2IA 1O08A 2RK4A 2H2DA 4Q3LA 4YCSA 1UBLS 4R9SA 3J81k 3NJ4A 1WOYA 3E22B 3R24A 3DPIA 2D2VA 4HH3C 4BP9A 1XP8A 4TTAA 2XMSA 2EKZA 3PZBA 2AF4C 1I2CA 5KOJA 4IUDS 1UJ2A 2K5UA 1W0KD 1T8WA 4Q4CA 1QJ4A 3FMFA 5JS6A 1PZHA 3ND9A 7REQB 2UXBB 5CIWA 1D5WA 3UVEA 2HDOA 5BWLA 1MC4A 2E5WA 1Q77A 1L8QA 2GM5A 5JNSA 3W5BA 2P1RA 2I03A 3ASUA 3QVXA 1X7XA 1A9YA 5EP4A 4CU2A 5A5EA 1PKXA 3V4PB 1PJ2A 4KIGA 5AH0A 2CNOA 2P2GA 1IZ0A 4YV2A 3DO6A 1CEQA 5SZHB 3VUEA 1MIHA 2ZRNA 3D7LA 1RHJA 1R8SA 1Q92A 1IDN1 1W4AA 2P78A 1VZ3A 2QM0A 2V7VA 2XPCA 2Z57A 3OZ7A 4U8GA 4U9UA 4IM7A 1W73A 3I5AA 2YV5A 1GDTA 4YP0A 4X45A 2P9CA 3D5QA 2VKQA 3TZLA 3Q3EA 4K6KA 1TQ4A 4XIJA 1GL7A 2J67A 2VJLA 1MABA 3CZMA 4IDFA 3ZV6A 1EJ2A 1JTEA 4WH0A 5J63A 2P3OA 1H2FA 4AUKA 2G8LA 3C3MA 2WICA 1N6KA 3C1UA 3MRXA 3H18A 1IULA 2PZGA 2VPWA 3SMQA 3TR0A 2X5JO 2BBWA 2EJWA 4ZI7F 3HN2A 1W7AA 1N5DA 2H7XA 4OA5A 1E3EA 3C41J 5FBKA 1J9GA 5AKYA 3R7WB 4LJ5A 4DLPA 5I8WA 3PWKA 4GKAA 1MEEA 4KWIA 2C4UA 5F33A 2J41A 3WLAA 3SQWA 1JKFA 3IP3A 5B3LA 1FX0B 1CRPA 3P96A 5IHPA 1J0CA 4JLVA 4N7JA 1NVTA 3DUFB 4O5OA 4UMFA 5AR1A 4R1MA 3V8RA 1KP3A 4ZP1A 5EY5B 2OFXA 3E5NA 3N0XA 2PZMA 2JL1A 1SKYE 5CW2A 2ZYIA 3WYCA 1V5EA 1DRUA 1F0YA 1BROA 1BFDA 1VCNA 2NU7A 5FWAA 1YZQA 4TV9F 4KXYA 1YD7A 2YN0A 4H2DA 1R15A 3C8UA 4REMA 1U80A 4FONA 2GXQA 4RD2A 2MWMA 4RFVA 2Q0QA 2FW8A 4G8JA 2P6RA 2BZSA 1I1NA 1BAPA 3AR9A 5SY9A 1YMUA 1Z2NX 4OFWA 1YAJA 4G86A 4DSUA 4LHVA 3UXMA 3GK3A 3S5JA 2A58A 4ETIA 1TU3A 4RQBA 2AXEA 4BQOA 2R86A 3DL0A 1JQAA 2PZLA 4OTZA 3OPXA 4H7JA 3WGTA 1FU7A 1P5FA 4PYRA 3EVCA 1E2EA 1M0SA 1QPBA 1Q91A 4RGBA 4S1NA 1GQRA 3H16A 3SJAA 4OA8A 3WGLA 4DCSA 3H13A 3N2LA 3PEEA 4A0GA 3U3MA 4AJ2A 3C3EA 4TKZA 2BHTA 2ECOA 4L85A 3W90A 3ISTA 3NVKI 1YAHA 1TVEA 5ITVA 3GR6A 2ZB2A 3I72A 3EG9B 3M6VA 3QLUA 3DXXA 3IOBA 3VH2A 4GOMD 1P0IA 3D6NB 4YPOA 3GCGA 3OM0A 1NMZA 4KTVE 1DZ3A 1K1EA 3KUDA 3ORYA 2NO4A 1MLDA 1OB5A 1XGKA 5T57A 2JEYA 2ZUFA 3D3EA 5FB3A 4LOHA 4D6YA 2P9QA 4II7A 3IIKA 3SM3A 4UTNA 4D41A 3F9RA 4WZAB 3PX2A 5L3SA 2QP3A 2XNJA 4WJKB 2DKNA 2Q2OA 1G17A 3WLJA 1NQAO 1NUHA 4BS9A 5IKXA 4IZ6A 1SQGA 1ND6A 5ALNA 1NRXA 2WU8A 5A6SB 2WHPB 4ZZIA 4ZYYA 2HT1A 3PFHA 2C2MA 1FS4A 4YP9A 3DOFA 1BEUB 2M1XA 4CKZA 2CCKA 2N0SA 2XNSA 2BH9A 3AVOA 1NDHA 4B3BA 1I3KA 2OHHA 4YXFA 5A4FS 3H2IA 2V5UA 3KQPA 4L2IA 4S24A 4PS0A 3WIBA 3K9FC 2FEKA 1GTJ1 2GJ8A 4Q48A 4IQ8A 2YWHA 3D2AA 4DCCA 4DC9A 3LP5A 1XZFA 2DP4E 1CC1S 4UVDA 1JXQA 3GEEA 4X1YB 2PUVA 4XARA 2GZHA 2I8CA 4F5YA 4CM6A 1UZNA 4EO4A 5BQPA 2MSNA 3A1SA 1NXVA 2FCAA 2V3WA 1X0VA 4MGKR 2J6IA 4MUHA 2GZ2A 4UATA 1ECPA 1R7RA 4L08A 4AZ0B 2OORC 1BVYF 4D9NA 1F8FA 1OSNA 1E6MA 1LPAB 3VR6A 3DE5X 2A9QA 3VV2A 1M8PA 2A1UB 4BYGA 1B3RA 1UBFA 2QLFA 4MEJA 3GJ6A 3IPAA 3RFFA 2C97A 5ESRA 3UBTA 2EHJA 3JQAA 1E66A 3H1AA 5E3IA 3A4VA 3AETA 2I4IA 1O6CA 3QIVA 3W5HA 4J0DA 1FUIA 3QEJA 1QLHA 1RWPA 3MNFA 4S0XA 1N2HA 4WY8A 3SX0A 1U2QA 4PCAA 1WLSA 3MCUA 4INPA 5CG2A 1O95C 4ANFA 3QPWA 1UDWA 3M4NA 2H1WA 2PS3A 1W5TA 2YIJA 2JATA 1AUPA 2ZSDA 1PT8A 1Z22A 5BMVB 1R8QA 2HCFA 2Q45A 1MEOA 5EJMA 4QQKA 4G56A 2XF8A 1SK9A 1AF4A 4GSYA 2GWHA 1ZHFA 1QCDA 2NSJA 2PLNA 4LK2A 3U0VA 3UV7A 4C4ZA 2NZXA 2W9XA 3GFRA 4U8HA 3FPJA 4Z4QA 3VPDA 1UWLA 3B51X 4IBOA 3V32A 1KU0A 3UJ8A 2O3RA 4UNQA 4UTPA 1FY2A 2C61A 2DFTA 3JQBC 2PX5A 4YRJA 2O8CB 4IMRA 3UC9A 3JYQA 1HLGA 1CR6A 1U0BB 4WOCA 3IUJA 1QQTA 2JJQA 3NU1A 1O54A 3ZWBA 1N5KA 5TB5A 4D5GA 3WWYA 2I3AA 4GI3A 5BQXA 1YZUA 6NULA 1PV1A 2J7KA 4ISCA 4DJTA 4BC0A 1VXRA 5ARCA 1AH2A 3DDHA 4TN5A 1P0PA 4KITB 2NT3A 1YOVA 1GQSA 5AJTA 2P6MA 5F73A 3ZDEA 4PAOA 5AVVA 4B3TB 1ISIA 2GD2A 2RHDA 4FCCA 4L4SA 5KYYB 2ZSBA 1TAUA 4UDXX 5EP2A 4PC2A 4L22A 3ZS9A 2A4MA 2EWVA 3FTQA 1C0PA 4Q3KA 1HH4A 1UZAA 5D6NA 2VJPA 4MWEA 4NJMA 4P0TA 4GQIA 4OQNA 4HJXA 1COWA 3TOZA 2JFQA 4MVJF 1J0EA 4NU6A 5ECGC 3MUNA 1EDEA 1E58A 4RMHA 3SJBA 2FZVA 1CRZA 3I1FA 3QBDA 1XDUA 4BRSA 3VC1A 5C7LO 1HSZA 1GUYA 1HY3A 4ZVLA 3RSOA 3WS7A 1OLSB 3A9TA 4EFDA 3KOXA 5HVNA 2YZMA 3CX4A 2FR0A 4I4TF 3VPGA 1P0FA 1DKLA 5L45A 2E9SA 2AVNA 4WGFA 4BQIA 1OHHA 3OQVA 3SBOA 3T12A 2WQ6A 4AKTA 4CFYA 1AJEA 2H6EA 3NW9A 1T1RA 3FE2A 3GJYA 3MBKA 2Z8YA 2FJUA 3RARA 3AI1A 1NW7A 5KX5F 1QRSA 3J7AC 3TMAA 3MG9A 3P4YA 4O29A 4U0JA 1L4FA 1U8FO 3KQKA 5EMHA 1W36C 1Z3IX 4WESB 4JC4A 2XUZA 3TZ6A 1Q7TA 2WWWA 1NFRA 3SI7A 4RV4A 2GJKA 3I37X 4EJSA 4MR7A 1J5PA 1NSYA 3DMYA 4ARVA 1ZXBA 1RCFA 1PFKA 1UDBA 2RG7A 3HZOA 4GM4A 3VKFA 4S04A 1TFUA 4I08A 4XJTA 3H5IA 3ZU3A 3IJ5A 3WRXA 1DAHA 3BGDA 5FF9A 3OOWA 1YVPA 1A8SA 3PVSA 3HBJA 3SIRA 3FTEA 4B82A 1P1KA 4DMHA 1EX6A 3BK1A 1R6BX 3G2OA 4Q18A 1KY2A 3UOGA 2CWDA 3GAZA 1M74A 4PG5A 4BTEA 5CURA 1VCHA 1WVMA 2F55A 1VRCA 3PZRA 2IS4A 1VL5A 2Z5VA 3VSEA 4KQKA 5KTPA 1JW9B 1M6VA 4Q3OA 5FWDA 3ESAA 4L51A 4XR9A 4KFRA 1MX9A 1YL5A 3R3UA 3B53X 2HPZA 4RHEA 1NMQA 2GKOA 2V0NA 2Y6UA 3SAJA 3T5BA 2NXCA 5DJ5A 1EM8A 5EXTA 3WSVA 1EZ4A 4MP3A 2I7DA 4W9RA 1GPAA 1AQYA 1WMEA 1U4NA 2RAPA 1Z8NA 2FN9A 2C84A 4YUZA 1XZKA 3A2MA 4M3NA 4YJ2A 3LHSA 1J49A 1LF0A 1CS0A 3K2IA 5JJLA 1E2QA 2CSUA 1BTOA 2MYUA 1Y3DE 4Y30A 1DBPA 4DJAA 4EYQA 4L4XA 1Z7EA 4H15A 2DBRA 2CN1A 1G8YA 2DFDA 4UJ5A 1DG1G 3KPJA 3TL2A 2Y99A 5THQA 3RDPA 1K98A 5IW8A 4EI9A 4F85A 2QY9A 5A3QA 3A9VA 4XM2A 3SEAA 4NSNA 3URKA 4KSYA 4D3DA 1PBTA 1YE8A 4EVQA 2NACA 1Z5NA 5CX4A 4EI8A 4N9QA 4PC7A 3PFWO 3O95A 4P5PA 3U1BA 4JJEA 4ZO4A 3GD5A 4L57A 3O31A 4X6LA 3T94A 1TEZA 1W93A 1K7YA 1BVRA 1WPRA 1M2KA 3BMOB 3HCEA 3O90A 5H0IA 5SY4A 3GGDA 5J4KA 4ITVA 4Y98A 1V3QE 1QVVA 2C98A 3AV3A 2FSSA 1Z7BA 3BXZA 5JEEA 1K2WA 1VKOA 2Q4OA 1DBQA 3I0MA 4HWPA 2W0SA 2C2GA 1JHPA 2YUTA 4LGVA 4RK1A 1UM8A 3NH6A 1Q1AA 4NFSA 4JJ8A 1KK3A 3PD0A 4DCTA 4EZIA 5FI5A 2FFAA 3IVMA 5EG5A 4H0CA 1LRLA 5HCNA 4AZ3A 1WABA 3EMKA 2CNWA 3D8TA 1NLZA 1I4OA 1ZA1A 4KACA 4LA4A 4GGPA 4WFQA 2BHSA 1QG6A 3DPUA 1BFUA 2BDEA 2FGJA 1E2NA 4FGWA 4GXTA 4IOLA 2IXGA 4HO1X 4OHBA 2EGGA 2JFHA 3I6BA 2X3UA 1XLTC 2XVAA 3H1TA 4FFSA 1A2KC 2NX2A 3QLTA 5B37A 1URPA 1X8JA 2BSXA 2GRJA 2PD6A 2X0DA 5FEUA 4N48A 3CTPA 2WSYB 3D6AA 1A72A 2VYND 3A6LA 1LLDA 2OILA 4CQJA 5IBQA 4DDTA 3I8OA 4REQB 5LWHA 2NU6B 4I1RA 5JAIA 3DEYX 3R4VA 4XIIA 1WL8A 2QW8A 3WYGA 1FNNA 5DN6A 5CDGA 4OQ4A 5B53A 2QLJA 3GCWA 3MOGA 2WY2D 1VCOA 2ZYAA 4KDEA 1NXQA 2G3YA 4FJ2A 4NHOA 3KHKA 1P7VA 4G6ZA 1Z2CA 3E9EA 1CZOA 1MJGM 1XTPA 4NBUA 1TMGE 1I1QB 1PUIA 3KD2A 3CUEF 1P81A 2C5GA 3R2JA 4NG5A 5IVIA 5BSKA 2MSWA 4XWOA 5MN4A 1DAKA 5BNWA 4FN4A 4UHDA 1LWNA 1RQXA 4KH0A 2IBMA 3KTFA 3LC2O 4RFSB 1U02A 1G5TA 2EP8A 1DIRA 3L84A 5DWVA 4IHKA 4UQOA 3SKVA 2HIHA 3SJCA 3T9CA 4JLSA 1PNQA 4G1UC 4N7BA 3QVMA 3RO7A 1YQWA 3SN6A 3O5AA 5CB4F 2P0YA 1DQYA 1BD4A 2QMYA 4K9KA 3ETGA 4UFPA 1M0EA 1KJQA 3RUIA 1XMXA 3FWNA 2G6TA 3KPVA 3O2QB 2FOLA 1J06A 4V1CI 1W88A 2G9RA 1UFRA 5H83A 3TLGA 5IEJA 1IM2A 3W2EA 2IYUA 3GJRA 2IV3A 4ZYTA 3ETEA 3QPVA 4PAQA 1P2DA 3LBHA 3A6FA 2WHXA 4M8KA 2P1DA 3IT2A 2F3PA 3D4IA 3N53A 3AP3A 5FR2A 1MC1A 1RC0A 2K6GA 2ZSEA 2RCNA 3ZWMA 4JLJA 4TMYA 4QHYA 1U5CA 3S81A 1M6VB 4US1R 3W0LB 1JMVA 2AUNA 3QEMB 4I1UA 1XK6A 4EEXA 4RH0A 4WBSA 5BSGA 2X8JA 4UEJA 2WTUA 2C8LA 2IZ6A 3R74A 2VK2A 3JYNA 4MH0R 4BECA 3PKJA 1LEHA 4D7AA 3UOWA 1UBTS 4PNHA 5FADA 4ZK6A 3LGXA 3L04A 2J5KA 3IBCA 5CJPA 3KQWA 2WTNA 4XWGA 1Z63A 1ZHHA 1GM5A 3NKVA 4XVCA 2OZLA 3I6QA 3OPYA 4MKFA 2WQ7A 1T3ZA 2C1XA 3DEZA 4X1KA 4ZVTA 3I58A 4OK6A 1YUMA 4XB1A 5PGMA 4OX9Y 1MTOA 1UP4A 4TLDA 2GXUA 1U0NA 2F62A 4HR7A 3HK2A 4QQ8A 4IIJB 1OIXA 4XTCS 3E2IA 3HA5A 3ESDA 1C9MA 4AM8A 2YWCA 1YO6A 2AFRA 2HCRA 3Q6IA 5AW7A 3VOAA 4EATA 1TLTA 5KDDA 2O8BB 3HRHA 3ZE1B 4UCWA 4B6SA 2CNWD 1QPGA 3K8OE 4I9FA 4L5IA 4U7WA 5KINB 1D2RA 1H2XA 1DX9A 5DXJA 5IKMA 3KQMA 3HHEA 1QVZA 1A50B 1TM2A 2PX4A 4D8WA 1NUUA 2V45A 3M4YA 5BSRA 5EQDA 3RNLA 4M0CA 3LH5A 2X6RA 1IUOA 1ADGA 1XC7A 3FKQA 4M38A 3OIFA 2AN1A 2GETA 4AK9A 1EG2A 2YJ3A 4CKBA 2IPNA 4OP3A 5CU7A 2QQGA 4XB2A 4WXPA 1T4BA 3RV3A 2YXPX 1KIMA 3CLVA 1CZHA 2G36A 3HUTA 3CE9A 3C85A 1BDIA 2E2WA 3RVRA 4EA8A 2V6JA 4OYRA 2H9IA 4F45A 4BNVA 1GU1A 3ICPA 2G4VA 4RKYA 2GZAA 2QJTA 3OMWA 3PJDA 2DWOA 1Z12A 3ZH9B 1K5HA 2WHEA 2X86A 3SYTA 1BS2A 3O2SB 5ERGB 2IOHA 3SHTA 2A59A 4IIBA 4RL4A 4U2DA 4ZOLA 2IE8A 3KPUA 5EAIA 3V3TA 2AJCA 2P8JA 5HFNA 4CM3A 3GBPA 4IGIA 4CIWA 1H4QA 2GS9A 3KHSA 2ORED 4EW2A 2O6HA 1CYDA 4C1NA 3EA4A 2PYIA 1IB0A 5C1OA 2YHSA 1MORA 5IJAA 5AUPB 3STHA 2VZ0A 5JXWA 1G20B 1CUYA 5J5CA 2JJ1A 1JHDA 2EDCA 4F1KA 3TR5A 2IH5A 2WWGA 4D6PA 3G2PA 2XVMA 1YI1A 3AESB 4HZUB 5K99A 1ABFA 2RGRA 4LWPA 3SZRA 4TT3D 3H1EA 3L46A 1H0SA 5LP1A 2O3SA 4LV8B 1W8DA 5HQTA 4BLPA 4MULA 4Y1RB 1XO1A 2XHZA 3U44B 5DNUA 5IMBA 1PO7A 2OO5C 2GAFA 5FI0B 1P31A 1VE5A 4TS3A 5HFAA 4Q1VA 3TGPA 3UK2A 5MN6A 2QYTA 4UVIA 4R71A 1EK6A 1I13A 4EPRA 1II8B 1JBKA 1KKMA 1NATA 4OREX 5CCBA 1CF4A 3JX9A 4AXBA 2PWBA 1TNDA 3BMNB 4JZYA 2QD3A 1Y3BE 3MWKA 2ZZKA 1E1CB 4GOXA 1BCSA 4V1CA 1BCRA 1R37A 1VDZA 1XIVA 2VT2A 3EZXA 1PG2A 2E4AA 4ZYUA 5MDHA 1YS4A 5JHHB 4B7CA 4TTJA 1VSQA 2C2OA 2X6QA 4AYWA 4D0LB 2PWAA 1F6BA 4PNEA 3HG7A 4YQFA 3TRKA 3QWHA 2LNDA 4YDRA 3ZDXB 4YUAA 3VAAA 4E07A 4OOFA 4R1PA 1ZVJA 4QOHA 1QC5A 2B0JA 1MO5A 4HGPA 1ZSVA 1A5BB 2FE4A 5EMKA 1L5GB 5HQ3A 3ADCA 3H2GA 3NGMA 2JI9A 1NZJA 1WTAA 4FXOA 4C08A 2CVFA 2GNAA 3FFBA 5ICEA 1P4RA 2CK3A 1HM5A 2VYVA 3ITEA 1PEAA 5AM5A 3TQTA 4B9EA 2Q5QA 1GZ3A 3QTTA 3K9HA 1WXFA 2DT5A 1GG2A 1WMFA 4HQRA 4YBZA 4RIEA 3SOPA 4ZU1X 3HFGA 1GDDA 1OTYA 3A70A 3RODA 4B85A 1KOJA 1TRHA 1YWGO 1D04A 3L1KA 1KPHA 2BCGY 2Q2QA 4KQMA 2QXTA 5CAEB 5AUNB 1EG7A 3U5TA 1EWVA 3K9GA 1Q5PA 1EUYA 1ZM9A 3GPDG 5G4KA 2D2XA 4EHJA 4JWTA 4R84A 1TPYA 3H4IA 4E6EA 3TTYA 2V5AA 5KWVA 1JL3A 3V4VB 2JAXA 2IL1A 3KDSE 3DHWC 3LLMA 1NYTA 5IX8A 1NW8A 2W98A 3GGJA 4Q9KA 1P19A 3EDMA 3A1DA 3SXJA 1T8RA 1E32A 2CYBA 4EFLA 3R9WA 1HDGO 3H5VA 4RVCA 1NVMB 3FBTA 1QBKC 2MMCA 3F98A 3KO8A 3QKTA 1LLCA 4INOA 3VYVA 3BXXA 1JIXA 3LI2A 3ZZUA 4DL9A 2BJWA 1D0SA 2VP0A 3PG5A 3IOMA 3WP0A 1TJNA 3U4CA 1CLEA 2KBEA 1X19A 1B43A 3Q3GE 1C3XA 1NOKA 3UAYA 2E3JA 5E4TA 5B1IA 3UW3A 4MAMA 2IDMA 3GLUA 3A28A 3AG6A 5DBOA 4ZHQB 3FUXA 5AQ1A 2VK4A 3M6AA 2Q2WA 3N74A 1RQGA 4LDNA 4BAUA 5IM5A 2H5EA 5EPOA 1SGWA 1XKTA 4OB6A 1W4RA 3MERA 1R0RE 1DRWA 4H31A 4BNDA 4Q34A 1TEXA 1XROA 3GEDA 1P18A 4J7CA 3AFNA 4JBXA 1YDHA 3WRXC 5KSWB 5J2UA 5A04A 4FNMA 1EFTA 5CRIA 3UMVA 3VUFA 1M1XB 2GCIA 4ZMSA 2YDYA 3PQ3A 1HLPA 2BCEA 2LW7A 4TVKA 3BK7A 1GPKA 4RVFA 4B0PA 2H4YA 5I7EA 5F4ZA 5JNLA 4B3GA 4GE0A 1C14A 5KX5A 4YCNA 3GFQA 2OO7A 4TOIA 5J43A 2G63A 5AJVB 2FG6C 3WWEA 6PFKA 5FPQA 3KQTA 3CHYA 3GELA 3BUSA 3NIFB 4MITA 3H2HA 1M34A 3RRJA 3EXAA 1U7DA 1A8PA 4HYQA 4L02A 4FB5A 4E5SA 5EHZA 3MM4A 3D4NA 3VR5H 3OM8A 4GUAA 3TYXA 2OOSA 4ZT5A 5CCDA 4CF4A 2I65A 2PNFA 3D0KA 3DGEC 4LW8A 1W6UA 4TL8A 2V55B 1Y1KE 1U1IA 3RSCA 1F38A 1Z16A 1M2JA 2E55A 4EG1A 4F04A 3L4KA 2CNBA 1H5NA 1YUNA 2ZR8A 4FZ5A 4NCNA 3UAXA 1BYIA 4MKHA 5C5CA 3RS7A 1RJFA 2OD2A 3ENZA 4FMDF 3DL2A 1QCYA 3FJ1A 5FR1A 5U4QA 4XLTA 5TIIA 4OQLA 1ZRNA 4BQFA 1RHQA 3BHNA 1YXMA 3KT6A 5I8ZA 1K66A 1JJIA 3GFOA 4K8OA 4RUKA 2IU6A 4RQUA 5FL3A 4Q24A 4MQ6A 4PF1A 3UA3A 5CH5A 4S35A 2V4MA 5JVDF 4CG3A 5FNVF 4E21A 3RS5A 1RC1A 2I1QA 2ZRIA 3DDCA 1Q0ZA 2I99A 3HP4A 4DUPA 3S2YA 4ZO6A 4OMFG 4E6PA 1P2FA 3CPSA 1N5JA 3DJYA 4P4UA 2O8EA 2FY8A 4BIMA 1RYBA 2HXSA 3CUTA 4QOEA 1CQZA 4DB2A 1PEYA 1X9GA 2IYAA 2PUHA 4INZA 1TYAE 3DFMA 1C9NA 5EFOA 2DECA 5H70A 2NXEA 3TSOA 1H65A 2AG6A 1N8NA 2OD9A 1U0SY 1RQPA 3LIPA 4IIEA 2EKLA 5L3RA 5KS2A 7MHTA 2PMKA 5LA6A 1TDJA 3L0OA 4WERA 5JD5A 4H7EA 5I01A 5FFNA 1I14A 3QPAA 5B64A 3FWZA 4OI2A 5IC6A 4MWZA 1TGVA 4LPSA 1TK9A 4E5MA 2PVCA 5H3LA 2QN2A 3WL4A 2UV8A 1JDVA 1TCCA 1LPSA 5DI9A 2M6RA 2RC6A 3GA7A 4ZVOA 2DHCA 2OO3A 4QELA 2CFCA 4N8DA 3RCBA 1GPLA 4ZV4A 2QVBA 3D7NA 2HZ7A 3GEHA 3JSXA 3L18A 4WMLA 5LNK6 2ZRJA 3KFXA 1E9CA 1P3JA 4Y0VA 4QVIA 4HB2A 2WIDA 2PGJA 4HEHA 4QJ4A 2P9YA 4I4NA 1V7QA 3CXUA 3Q8XB 4GGMX 3CX7A 3R6TA 5E1DA 5FTJA 1H3FA 3RSSA 3BBLA 2PY6A 3P2JA 2O2ZA 3I9FA 3F3MA 1YFKA 4LHEA 3R6LA 2NZJA 2X5XA 1NPYA 4GMHA 1MQ8B 5B3KA 1MC5A 2QI9C 2R4QA 1P72A 3UWKA 4JHXA 2CLEB 2WLTA 4P1ZA 4P7BA 1US8A 4WN9B 4CFSA 2CJXA 2E4ZA 3UWOA 4I55A 3HGQA 4P84A 5LZ9A 1FSPA 4GT1A 5DTRA 4F4IA 1DCFA 4G37A 4YAOA 1FYVA 1ECCA 3CLTD 1ZM2A 5F51A 3DZHA 2F8MA 3E9QA 2BFFB 5KOHA 1FSGA 2IYPA 2QX9A 3HQ4O 2IODA 3VR3A 3EXG2 2TECE 3VXKA 1VXOA 1MRSA 4PN7A 1M2WA 4NYMQ 2CMHA 4FILA 3VSCA 2AMYA 2PLWA 1UIMA 1YIAA 2ZJZA 5J4YA 2IY8A 1DI0A 4KR3A 4LWOA 4KH1A 2ZT6A 4R51A 5EOVA 3J80A 3OLZA 4PCVA 2A5GA 3ZDZB 5FTWA 1SHZA 4K9RA 4R2XA 4WINA 3RVNA 4DJEC 4GC5A 4TS4A 4D4IA 2R11A 2D13A 4NS4A 3ESXA 4Y3UA 1XOIA 3K9BA 3SSAA 4QYIB 4JMPA 2JF0A 3I01A 1MX1A 4GZ3A 4XX0B 4ZQEA 3W3AH 1L2TA 2PYZA 1M7BA 3HKBA 2XRFA 3B85A 1VLHA 5FAXA 1GZ5A 1ODCA 1CQJA 4PYMA 1E5LA 4TLLB 2F1KA 3HYSA 4FI3C 4NDZA 3TTWA 4CTKA 1UJNA 2VUIB 4MRMB 4WZBA 1Q3TA 3VHQA 3CLHA 2GPYA 3KXIA 3D59A 3GXBA 3MUOA 4MCIA 4PCLA 3V1NA 5CJJA 4DPMA 1DOHA 2PSEA 2HSDA 3KOMA 4RESA 3B6ZA 1J8YF 3JTEA 1XFDA 3ETDA 1RLJA 1VPEA 4MW1A 2J6HA 4KLZA 1OXVA 2R97A 2TS1A 4QX6A 3IEIA 4UNRA 1T9CA 1DG9A 1ZCZA 1DC6A 3H9BA 2R96A 3F71A 3KU4A 4GGOA 2W43A 4ZCQA 4B48A 2XCSB 2H57A 4K88A 4HOYA 1IRIA 1CE8B 3PLAE 2ZI3A 5ALDA 2R5NA 1C3OA 4Z9YA 4CMAA 3E8MA 5ILOA 4EGFA 2AS0A 2WFLA 3S4YA 1NVDA 1GRVA 1R6XA 2UAGA 1ZJWA 1E1KA 2HMAA 1QQ7A 2JGFA 2N3ZA 3I23A 3HYTA 5DMHA 3W34A 3QW2A 5FBZA 1X6VA 3SPXA 5LVAA 2GCOA 2V6BA 5AMXA 2OUIA 3DOOA 3VPHA 4ZXFA 2YC2C 4LDZA 1DB3A 3T6KA 4B3HA 3RSFA 3UW1A 3FPHA 4LIPD 2OHFA 5K7SA 1Z4PX 3GZNB 1WXDA 2JGNA 1HL3A 5ADWA 3EWNA 3LYUA 3IEVA 1BDJA 1A9XB 2DT8A 3OF3A 4OOEA 1UJCA 1TEHA 3D7KA 2YMQA 3OQNA 4E3ZA 3HTXA 4TWZA 4B73A 1EFKA 2FOXA 3O3MB 3ZBTA 2WE8A 3UICA 2FQ1A 1QH9A 4FBLA 2AFIB 4MUXA 1KAEA 1XCMA 3I9V6 2P4UA 4F1WA 2P9EA 1SVKA 2GPSA 3LX5A 3INYA 1S3FA 3JV7A 1LBQA 1PJLA 3WMFA 1TVMA 2UXDB 2AFHB 1AN9A 5CITA 1NLUA 2ZVQX 5FBVB 1BXRB 4DQLA 4JX9A 5IF9A 4AQYB 3QXJA 5TJ9A 4OJYA 2R79A 5DIZA 4G5QA 4HL6A 2XTJA 1DLJA 1MX3A 1Z6QA 3GGOA 4OQEA 3IUQA 4MPPA 2PD4A 4AWAA 4EHNA 3ZCPA 4EG5A 3HY3A 3EQ9A 2AW5A 2W2MA 4M60A 5EQTA 1KRWA 4RSHA 1JLLB 5G1OA 3H17A 4DPLA 4Q9IA 5FPPA 5IAJA 1WXEA 5DYWA 1NQXA 1JR3A 2P4HX 5NLLA 1L6RA 4B09A 3GJ4A 3P0JA 4XGRA 5FO1A 3STTA 5KOHB 1RM4A 4HNAB 4B2YA 4YCCA 2GHQA 3BTOA 1DUSA 2HBYA 2BCJQ 4EFNA 4MYDA 2I7CA 2AXNA 3DBHB 2WUGA 1V4NA 2J32A 4N01A 4YDSA 1CIPA 2BGRA 1XTJA 2Z2KA 3LUDA 1I7PA 1HDIA 2VNKA 3L79A 2NPFA 3SQMA 2I55A 4DC1A 4LZJA 3WR5A 1R00A 4AMZA 1JHUA 1JJVA 1T36B 4YWJA 3EJWA 1FE8A 1EWKA 3JXEA 4MRAA 4PIPA 5JZ9A 2HWWA 3GQBB 2H1IA 4GZLA 3ODPA 3QUAA 1U7OA 2XADA 2V7QA 1PJTA 2C8JA 2PL5A 3RHZA 2DBVO 1H1LA 3L4SO 3WKAA 1RABA 2FVYA 2YIDA 4A15A 1Q1GA 3FZGA 3R7WA 1LLUA 4XW2A 4ZVQA 1F7UA 1GFSA 4PC3A 1PZEA 2ZT8A 4MI6A 2VVTA 1IY0A 1EUDA 4DZZA 2Z56A 5J4LA 1YR3A 1TXGA 1XWIA 1A9ZA 2DQSA 5TX7A 5BXQC 4G4GA 1K8QA 4L1KA 2OQVA 2PN1A 4QQFA 4BX2A 3NT2A 1NMXA 3E7PA 4HTFB 1TUGA 2BE7A 2JI4A 3CRW1 3R3XA 4U2EA 3GPBA 1J7KA 1M1YA 1ZOSA 3LZCA 3H4TA 1BWSA 2GN6A 5FWXB 3FNIA 5I7RA 4CF6A 3FLMA 4M37A 4DABA 2QE6A 1YDWA 2QTVA 2DG2A 1QTRA 1I33A 4D4MA 3K92A 4E46A 2QAJA 5ENDA 4L0MA 1YC2A 4I5EA 1O6ZA 3H3FA 3EVBA 1HG0A 4U7FA 4OSOA 4GLJA 2VNJA 4V0RA 1OXKB 3UPUA 4H4EA 1L8OA 3QMVA 4RKEA 1MB2A 4NCJA 3N07A 4RZQA 1PGOA 3B1WA 4ZI7B 3E70C 5KYYA 1ZA2A 3NXKA 4M99A 4HNVA 2AN5A 2ZU0C 3PI7A 4LI0A 1AB5A 1JZSA 1B00A 3RVLA 3QBVA 3UQYS 4N6NA 3W9BA 4GPEA 2WYVA 4HAZA 5J5VA 3MVEA 1F48A 1U31A 2XKJE 4FS3A 4MRSA 2G4CA 2QROA 4FFLA 1FF9A 4K9QA 3UYLA 1H2AS 2Z09A 4L5BA 3AVXA 4E5NA 2HSJA 4UNSA 3PFFA 1LPNA 1NYRA 1QGZA 1ZQ9A 3A3OA 4DLAA 4DVJA 5KQLA 5KSPA 2R1TA 2JVIA 4UKDA 1DAGA 2VQEB 3L49A 4L7QA 3UH0A 2PL3A 4FMBB 3OUTA 5CMLA 4C22A 4D74A 4FUTA 4F2HA 5C37A 5HKBA 1DFGA 2P2ZA 2QLTA 2CUNA 1EFPB 2FWRA 2AQHA 2MHCA 5GZ3A 4YVFA 2E87A 3IBGA 5L6MB 3FN4A 3LHKA 1CZKA 2JBWA 2W7TA 3O8DA 1NRIA 4MWOA 4TXHA 1G18A 2Y71A 2IZZA 2OBYA 3GLSA 3UMYA 2R6FA 3F8SA 3JPWA 3VU8A 1O97D 3RVPA 1EBBA 3ZHZA 1XZIA 2CV2A 1JJFA 4FYPA 5K20A 3BJZA 2RGXA 1FSFA 1E9EA 1ZMOA 3ZY5A 3AYXB 5LZ8A 3WDKA 1I0ZA 4L3WA 2GXAA 1WD5A 4N4AA 3IAAA 4Q3DA 3DAOA 1GQOA 1EIWA 3QG1A 5KTYA 2C4VA 3VRHA 1C0EA 4B1FA 1SCAA 2OQIA 3PK0A 2YXLA 4O3MA 1CUXA 3G17A 1GGHA 1E3MA 2WINI 2B99A 2ZEJA 3SWWA 2B7LA 2IF2A 1C9DB 3LQRA 2V7PA 4UHJA 4O6VA 3SU8A 3EX7C 4KXXA 4DANA 3Q9UA 5LYYA 2JVJA 5J47A 1GLGA 1PK7A 1U9IA 3A8TA 2WT4A 3LDUA 1UKZA 3NIDB 1QBGA 2PSSA 1DV2A 3KKMA 3PEUA 4N0PA 1JF8A 1LLFA 2I3ZA 3S2UA 3UPDA 4F06A 5ICMA 4AJPA 2BZ1A 1M33A 5EMJA 4G67A 2Q1WA 4JV5B 4W63A 1RZRD 4GXRA 1Z34A 2V54A 3SX2A 3WV5A 1HKHA 4CG0A 2X1MA 3IDQA 1XEXB 5JARA 3ELUA 1U8UA 1UJBA 1R9JA 2BONA 1SB8A 1V35A 2DY0A 4FEGA 1EJBA 2TRSB 2PNJA 5B55A 1JU3A 2FSGA 4N76A 4YHBA 4RTKA 2OEPA 3L8HA 1SBZA 4GD3Q 3NBMA 3Q7PA 4CUJA 1WG8A 3TOCA 1YR1A 4RD0A 5EIBD 3UUEA 2PUGA 1JJBA 4J94A 2EEZA 2ZJ0A 2XWPA 5IPFA 1E0JA 2J0SA 1ESNA 1BKDR 1QGYA 1U9CA 2W6JD 1OOEA 1WF3A 5LZ7A 3WOVA 2G0AA 3EOZA 3FGZA 1QTQA 4TKLA 2QTMA 3G8DA 3DMFA 1BVHA 3QWAA 1PJ3A 3DPSA 1ARZA 1BMDA 2E49A 3HCOA 3TMKA 4C5CA 3H0EA 3BSSA 4KR2A 1KEVA 1Z5PA 3EZYA 1MW8X 2O2HA 2YTZA 4ND8B 4YRPA 3G1WA 1QR6A 2J33A 1B74A 3EVNA 3GLIA 1Z7GA 4AJNA 4G01B 4GPTA 3ZIAD 4MO2A 5JADA 1CG6A 1GEGA 2GBPA 2RJNA 4WEOA 3WWOA 2DUWA 4IMPA 1DQRA 3EF3A 1WUYA 1E6EA 3DP9A 3H3XA 3OZFA 1BN7A 4H0FA 4G5RA 3TD6A 4BVJA 1KH2A 1SCBA 3KTOA 3UQZA 4QPNA 1RMTA 4KPGA 3FROA 1R0WA 3ZWWA 4RA9B 1ACLA 3EDQA 4GZMA 4IJKA 4MVJG 4QGSA 4EAAA 5K45A 4F72A 2E85A 1RQLA 1D2EA 2WJYA 4KQEA 4UBLA 3SDBA 3ZE0B 5GJBA 2Y0DA 4LC0A 4YAGA 2CVZA 2CHFA 3V3KA 3C3WA 3AHHA 3RFTA 3W06A 2ODAA 4JOCA 2ZPTX 2YYYA 3RFXA 4MJXA 1E18A 1XMOB 4GMXA 1O94D 4OH1A 2Q3DA 3AI7A 4V0MA 1NY6A 3F2IA 1NI5A 1CSEE 3GU3A 1WVGA 3KZKA 3MJSA 3QELB 4BNYA 4CQMD 1YJQA 4AF8A 3C6KA 1F1JA 4DFDA 1FDVA 2DFNA 2ODBA 3P5BA 2HMUA 1UXOA 1BC5A 1NY5A 4LJLA 3FYDA 5AICA 5FOVA 3W7AA 2FVXA 4KXLA 3T7KA 3VZQA 3QEAZ 1YR6A 4U5QA 2IOYA 1CB7A 2NZ8A 2XOKA 4Q3AA 3VJLA 5JQGA 1XCJA 1MXHA 2M6SA 3GN1A 2D7CA 1YQQA 3D4BA 5DX0A 4AUNA 5H8WA 2B78A 3G82C 1PZXA 3VJRA 2Q2NA 4KMSA 4BNDB 1M73E 2OFOA 2VUTA 2V1UA 1RLUA 2O52A 4ND1A 5IDQA 4TMVA 3UNXA 2OP1A 2ZXEA 4JP3A 3PWTA 3GH3A 5ANRB 1BOFA 4BEJA 3LOQA 1QV7A 1KZ4A 4N7RA 4Q9LA 4OQMA 1ZBQA 2EVWX 5EP1A 2LCIA 2V6GA 1VSUA 1E7SA 1ZNYA 1BRMA 4E4TA 4XCVA 1F51E 1SXIA 5JSZB 1R64A 4YP6A 1S1CA 1ZEMA 2W6OA 4RA6B 3T4XA 2QLMA 3KB8A 4Q1CA 3BHIA 3FTNA 1XPOA 1DELA 3ICEA 3MMNA 3QNUA 4KYUA 4PIMA 1QF9A 4YAEA 4FHZA 5KYGA 1S2NA 1H4VB 1V6AA 4F5DA 3D0RA 1N92A 1N25A 2L42A 1NFFA 3DHVA 3PITA 5ALMA 3SHOA 5AW4A 3SVTA 3HB0A 4CHGA 3IA2A 3EPPA 3UA4A 2O9JA 2MYPA 4ZWNA 1QORA 2HTFA 1EXMA 2FZEA 3OU7A 3OCZA 4K6OA 4MGEA 1DUIA 3RIGA 1IVSA 4HY3A 4PZCA 2WG2A 4QFCA 1QKIA 4ZAVA 4CLHA 4QXOA 1MHPA 5I6DA 4EW6A 3PXGA 1VOTA 3HEMA 3UMBA 1BE8A 2OCGA 2OBFA 2YFQA 3JQQA 3MMZA 4RKFA 1AURA 5BN3B 2G04A 2R8RA 3FUCA 1IOWA 2H1CA 1SXQA 2PANA 3K1AB 1KYTA 1UBMS 1PKEA 2BBOA 1PU2A 4FGUA 4KJXA 1LBIA 4ZV7A 4RW0A 4PLGA 1J21A 3T4EA 2GBCA 1A98A 3VU0A 1N78A 2OTCA 3GFVA 4OK5A 3THXA 5FUXA 1F3OA 4URFA 1OT5A 1QC5B 5KNDD 3PGLA 1U0GA 5CG1A 2X0KA 1GD1O 3CT6A 2JK1A 4CGZA 2V58A 4FYIA 2Y4NA 2HU7A 2ZRDA 2PLFA 3IS3A 1Q7GA 1QOQB 4O2RA 4FPXA 4S1WA 4Y6SA 1G19A 2QPOA 3GEMA 5EMLA 4ALNA 2D6FA 2FZWA 2A0WA 4ZDWA 3JATB 3KDPA 3MB5A 5IWAB 4X66B 2WFZA 3IILA 3KXDA 1IN4A 4FDUA 4DA7A 4YUWA 3IO5A 1BXZA 3ZHTA 2LKCA 4QGFA 3CMMA 5AYVA 2HA7A 1WW8A 2JGDB 5HPYB 3DULA 4FE7A 2FSIA 1G5QA 4RO0A 5FOUA 2DFLA 3TQFA 5LOVF 5A0VA 1GPJA 2NVOA 1QRRA 4GBMA 4UASA 4BV3A 2OFWA 4BLQA 5DI3A 4NZNA 3IOCA 3QHPA 2A30A 2X40A 4IVPA 4DRXB 1JU4A 3MTDA 1O0BA 4UZFA 4TMFA 3BMQA 4HUTA 1EFRA 1P2SA 3O8QA 3HJUA 1JG3A 3QE4A 1ZD9A 3JATA 3TZHA 4FQ8A 4PTLA 1X94A 3B7WA 4RPCA 4D9MA 2RAFA 2IDKA 2BJVA 2C03A 2ZP1A 4P7GA 2TYSB 2WMOB 3EBOA 3VC7A 2FWIA 1I01A 3F6RA 1HL7A 1THTA 4TT3A 5IBPA 4WVLA 2CDRA 1GTG1 1XAJA 2EIXA 4J8PA 3GDHA 2CXTA 2PUWA 1QZUA 2Q1UA 2RKOA 2ZAMA 4UTOA 1LDMA 5BSFA 3RH0A 4BASA 1IY8A 1U1GA 3LUJA 1RKXA 1V9LA 4LC1A 2OZPA 1NJ2A 4D0SA 2DHDA 5AXAA 1DOAA 2A9RA 3PQ7A 4RTQA 3HEBA 5HWSA 5I7FA 1GCIA 2Q5JA 4G4SP 1ZD3A 3MOSA 1YFJA 1CR1A 1OBCA 1V1RB 4HNSA 3TCXB 3CLUD 1YFLA 4MR9B 4ZEVA 3N6RA 3TCNA 2CJYA 2PXAA 1ULTA 3O8LA 2QUKA 3M5WA 4XX1A 4R01A 4HS9A 4BBZA 1TA9A 4XD7D 2ZRHA 5JMTA 4QQNA 2Q6IA 3VMFA 5I9LA 3UK6A 4M55A 4HQKA 4OHZA 2V03A 2FPPB 2NU8A 1ZS9A 5KKNB 5FA6A 1PR5A 3JRXA 3Q1KA 5EIWA 3ZGVA 1N2BA 3ZXUB 2VYQA 3PFGA 3HI4A 2YJ6A 3NGLA 3X44A 2ZJAA 1JG4A 4K2HA 2E1PA 3L4BA 2W6PA 5B1HA 4ZJZA 1DCTA 4M8IA 3ETJA 2HRCA 2XXBA 3WB9A 3TIXB 3K7EA 3GUYA 1J42A 1JDBC 3L07A 4ZCSA 4FW8A 4DIEA 1ZJJA 4NKRA 1JXMA 1Y80A 1NF3A 1W96A 3U7RA 3EISA 3KEMA 5G2OA 3ZWDA 4M2LA 2XQJA 4GNKA 1IBRA 5CJ2A 3IE1A 3MJEA 4Q3CA 4WLUA 1QWOA 2Q6TA 4LRSB 4YO7A 4C6RA 1FTGA 2OVFA 1WEKA 2QU8A 2PRZA 2NTEA 1DXHA 4PWZA 4TL9A 3S40A 4QGAA 2JAWA 5JSFA 3SEQA 1BJKA 3KQQA 3QSGA 2OHOA 4HDNB 3EJ6A 1SM4A 2XMGA 4L4RA 1NG9A 2J48A 3KU1A 4H27A 4K6CA 5D7BA 4RDHA 1VMAA 3FNFA 1GT6A 1RQNA 1B7GO 2ZRFA 1RRCA 3QE3A 5CDUA 1E61A 4XUCA 3GJQA 2FW1A 4TKUA 5L4LA 1C81A 2QA5A 2R25B 3PT5A 4PGAA 4RGYA 2WPDA 2YKGA 2WM9B 3MQ4A 4IGFA 5CYOA 4F93B 1N34B 1QS0A 1BU8A 5ALJA 1CUFA 2WVGA 1ZGCA 3JQCA 2R85A 5IN4A 3R7AA 4M36A 3GCZA 2VEOA 3DYBA 1CRQA 5A4IS 5F98A 1B6RA 1AQLA 1ISGA 1WCIB 2R4UA 3N87A 4MVXA 4MDEA 4KLRA 2QD1A 3O92A 1HK7A 1MAWA 2JLVA 1ZCJA 3L0BA 4ISBA 1DADA 4MYSA 2HA2A 4UBOA 1FYXA 3P4UA 3CXRA 1XJ5A 5CVUA 4KIFA 5ADVA 2XXAA 1AKMA 1PVOA 3ZHCA 1YQ9A 4R2KA 1Y4ZA 3AUFA 1GTMA 4DEXA 1KI6B 2QIPA 4KFUA 1M3SA 2C1EA 5GM1A 4DGSA 4LDRA 3K2QA 3VFDA 1E7RA 5JC8A 2YL2A 3PENA 1CUHA 3EXG1 1GU7A 1NJ1A 3B12A 4HP8A 4U3JA 2QNRA 4Y9RA 4ZVRA 4CIDA 3QUCA 4C7OA 1X87A 4RMIA 1MG5A 1BXKA 3MA0A 4H35A 4BB0A 2IP4A 1B8NA 1AXRA 5JAZA 1HMPA 3M1IA 4UPDA 4YJ3F 2IFTA 1CWUA 3W2IA 2ICAA 4L5YA 1KH1A 4G0ZA 1JS1X 3GT4A 4ZQCB 4DG8A 3ZGYA 5FJIA 2PGOA 1M8KA 2NLOA 4LOAA 3SS7X 1CHNA 3M49A 3LCMA 1ISPA 2OV6A 4G9BA 4OGFA 3TAXA 1EBUA 3LO8A 2GLXA 1C7IA 5K6TA 1E9BA 1NXWA 3JASB 3M89A 1E6UA 3IUMA 1FFGA 2FPGA 2IW3A 3BRSA 4X94A 3UJBA 1JEQB 3VYRB 1E4OA 3F5FA 3L4JA 1GVNB 1E7QA 1L7XA 2BKVA 4O33A 4UVHA 2VAMA 3NTUA 4LRWA 3KLMX 4EUKA 3FIUA 1IY1A 3RABA 1FXWA 1XKLA 2AZTA 1I3NA 3PHIA 2W93A 1FP4A 1RJ9B 3QPBA 5CT9A 4DA0A 1V7CA 3I9MA 2JZNA 3K4HA 2O14A 4XXHA 3BT7A 1PYOA 2XA2A 4DOMA 5E95A 4WFKA 1NE7A 4R9UC 1M8FA 2YZNA 2HI0A 4ND3A 3VR2A 1UBEA 5DGDA 4ATNA 2BM8A 2YIVX 1H4SA 1B1AA 1PD1A 2PRYA 3HKEA 5IUJC 2R2AA 2G9ZA 3FSRA 3I5MA 2IEAA 5BRNA 1EVZA 4FN5A 4MW6A 2ZPAA 1JEEA 1XDZA 1P7ZA 3DTTA 2IYRA 4EVRA 2AJTA 2OSBA 1C50A 4WXEA 1ZHOA 2I4NA 1D8AA 4GX1A 4TMTA 3WWPA 5IT0A 3Q7EA 3RPEA 1Z0FA 2JPDA 3JQDA 3VPFA 1GPYA 3QI7A 2YY5A 4O4HA 1WB5A 1DE0A 4ABTA 2WJJA 4Y2RA 2VJDA 3M5DA 3TDMA 4BKOA 4DBZA 4ZANA 3RM3A 4RTSA 2H59A 1QR2A 4NNJA 4CKWB 2HREA 1B6TA 4HZGA 5D3KA 4DG5A 221PA 4K8RB 4ZZ2A 1UT8A 4BKMA 1CETA 2OB2A 2ZK7A 4BJ3A 5DBHX 4C0XA 2EQBA 3JZMA 4W7HA 3P0FA 4S12A 3VHRA 1JFRA 4F71A 3FHTA 3IA7A 3DO5A 1E4EA 4RTLA 1ZCBA 3IL2A 4Z3OA 1BGVA 2VWQA 1DAEA 3LPCA 4WGGA 1D7OA 3VR6H 1ZKMA 1ZOIA 4ZVVA 5HHTA 3DEJA 1JFSA 4RIGA 4A82A 2QRQA 3AL3A 1ACJA 3ONVA 1PZFA 1VCMA 1PS0A 4ID3A 1XK7A 4MHTA 4JJ6A 5AQEA 2IXTA 3JZFA 4P98A 1UKYA 4NP6A 1KXZA 1UM9B 2KWIA 4P4NA 5EQFA 1JHMA 1J9EA 1G8AA 4I4LA 3GWZA 5JR3A 3BAZA 2I2DA 4OI0A 4DQXA 1G0OA 5KJCA 2WSMA 3NH9A 3I61A 2PH7A 2IYZA 4G0YA 4KRFA 5LSAA 5BUQA 1Y34E 3IR5A 3PC3A 2GHTA 3QEKA 3QHQA 2A1UA 4AUMA 1FEZA 1ONOA 3OJEA 4ZAGA 3DLBA 4ND7A 1Q0SA 3P9ZA 2VNIA 2FPPA 5CA1F 5I3CA 2ID8A 2ZXUA 2ZR9A 1YJBA 3IPYA 4FKBA 3VH4A 4JJAA 1OR8A 2HCBA 1P1BA 3DMTA 3KJXA 4OIFA 5KMGA 1GEEA 1FYDA 1KPGA 3TW6A 1WETA 1TI7A