2K3BA

Seeing the invisible: structures of excited protein states by relaxation dispersion nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of invisible, excited protein states by relaxation dispersion NMR spectroscopy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords Actin-binding protein
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k3bA00
3JV3A 1N5ZA 4GBQA 2IIMA 1I07A 2DRKA 1W6XA 3GBQA 1M3BA 1UGVA 2GBQA 1EFNA 2ED1A 2DLPA 1JXOA 4OMLA 4CC7A 2J06A 1QWFA 2O31A 4GLMA 2L3SA 4Z89A 4EIKA 1E7OA 2DX1A 3M0RA 4JJCA 1JXMA 2HBWA 5I22A 3A98A 2KBTA 1AVZC 2PNIA 3LH5A 4D8KA 2RMOA 4OMNA 1T0JA 3M0TA 2CT4A 3ULRB 2CSQA 1M3AA 1W70A 2KRSA 2D0NA 2LP5A 2V1RA 2C0TA 1BK2A 1NG2A 2RQWA 2JS2A 3EHRA 1G83A 1YNZA 4Z8AA 2AKKA 2LZ6B 4J9EA 4AG2C 4F16A 1JU5C 1OEBA 4F17A 4RTWA 2NUZA 4JJBA 1UHCA 1GFCA 3EGUA 2DYBA 1FMKA 1I0CA 4J9CA 2YDLA 1JO8A 5L23A 4KRTA 4JJDA 2W10A 2KROA 5IXFA 3VRYA 2VWFA 3EHQA 2BZYA 2J6FA 1U3OA 1NYFA 2KT1A 1E6GA 3VS4A 4AFUC 3KFVA 1JQQA 2L2PA 2CUBA 5I11A 1JEGA 3PE0A 1RI9A 2KXCA 1U06A 4JZ4A 3RNJA 5FW9A 2X3XD 5GJVB 2X3WD 1PWTA 1WDXA 1NLPC 1YWPA 2EGAA 1OPKA 2K6DA 2FPDA 3RBBB 2MIOA 1HJDA 1SSHA 2HEQA 4HVWA 5EC7A 2KYBA 2KRMA 3SHWA 1SEMA 4OMQA 1TUDA 1H8KA 2FEIA 2M51A 2KE9A 3IQLA 1WYXA 2FPEA 2DA9A 2KYMA 1NM7A 2KR3A 2JT4A 1UJYA 3H41A 4AG1C 1SRMA 2LMJA 5IHKA 2PTKA 2MCNA 2GNCA 1NEGA 2DJQA 1K0SA 2LJ0A 4RTYA 2CSIA 4J9HA 1AOJA 1U5SA 2D8JA 3VS3A 2EKHA 1FYNA 3SEMA 4IIMA 2K7AA 1W1FA 2EBPA 2F2XA 2FO0A 2JW4A 2C0IA 2XMFA 4LUDA 1Z9QA 3CQTA 4DEYA 2CT3A 3QWXX 2RF0A 2RQTA 2K9GA 1WLPB 1ZX6A 1TUCA 1WIEA 1NEBA 1BBZA 3UF4A 1VA7A 2KGTA 3FJ5A 4DEXA 2O2OA 1T0HA 1WX6A 1X2KA 2CH4A 3NPFA 2J6KA 2JTEA 4IIOA 2A36A 1SHGA 2J05A 3NHNA 2G6FX 2D1XA 2FG0A 1GRIA 2O9SA 1UECA 3I5RA 2HCKA 2RNAA 1GBQA 4LNPA 1H3HA 1QLYA 4J9FA 1MUZA 1G2BA 3VS0A 1QCFA 2BTTA 2LQWA 2OI3A 2C0OA 2L3QA 2LJ1A 1AZGB 2CH4W 1KIKA 1UG1A 4CC4B 1KSWA 5IHIA 2K3BA 4J9GA 2FRWA 1UFFA 1PNJA 1SPKA 2DMOA 2EYWA 3QWYA 1OPLA 3EG0A 2DE0X 1S1NA 2EQIA 4RTZA 4JZ3A 2YUOA 2KRNA 4CC3A 2A37A 1CKBA 2LNHB 2ROLA 4QT7A 2JS0A 4HXJA 2V1QA 2W0ZA 4CC2A 1TG0A 5ECAA 2JMCA 2ABLA 2RQRA 2SEMA 4FSSA 3TSZA 2PZ1A 1WXBA 2CUDA 1M3CA 1SRLA 2LQNA 3H0FA 1GCQC 2SRCA 2JXBA 3PVLA 1YWOA 4LN2A 2O88A 3H0IA 1M27C 2DF6A 3PVQA 2L3PA 4LUEA 3M0UA 1X43A 3VS5A 2JMAA 2OJ2A 2GTOA 1X27A 3UA6A 1UE9A 1PHTA 1MV3A 2I0NA 2A28A 1PRLC 2FRYA 4R0KA 1K4US 5GJWB 1X2QA 4Z88A 3I9QA 1HSQA 2K2MA 2DBKA 4RTXA 1X6BA 1X69A 2RQVA 2DL7A 4HVUA 4Y92A 2CREA 1WXTA 4ORZA 4AFSC 1RUWA 1YP5A 2EYZA 2NWMA 1ZUUA 1QWEA 1RLQC 1IO6A 2DNUA 4K11A 2K79A 2A08A 4J9DA 2LJ3A 1AEYA 2AZVA 2GTJA 1ZLMA 2QDLA 1E6HA 2H8HA 1QKXA 2VVKA 1M8MA 1B07A 2VKNA 1OOTA 2DILA 3NMZC 4ESRA 1ARKA 1H92A 4LE9A 3THKA 1CSKA 2LX7A 4RTVA 3O5ZA 1UHFA 2P4RA 4A63B 1YN8A 1ZUYA 2GQIA 1I1JA 1KJWA 1WFWA 3TSWA 4HVVA 1Y0MA 4OMPA 1PRMC 1HD3A 1M30A 2FPFA 3REBB 2YUQA 4D8DA 2J7IA 3U23A 2KEAA 2BZ8A 5IHNA 1WA7A 1OV3A 5FWBA 2KNBB 2YSQA 2AKLA 2DBMA 2E5KA 1ZBJA 2AZSA 2L0AA 2HDAA 3UATA 3REAB 1ZUKA 1VYUA 1RLPC 4JPBW 1T3LA 2D8HA 1CKAA 1K76A 2DRMA 2RQUA 3M0QA 1VYTA 1YCSB 1AD5A 2YUPA 1AWWA 1GFDA 3VS1A 2EYXA 1NLOC 3M0PA 1ZSGA 3NGPA 4RTTA 1B3QA 1K1ZA 1K9AA 3C0CA 3VS6A 4E6RA 3H0HA 1LCKA 2KXDA 2O9VA 2OAWA 3TVTA 2YT6A 1GCPA 1J3TA 2F2VA 4AFZC 2ESWA 3UA7A 3EG3A 1Y57A 4J9IA 2RPNA 3I35A 1VYVA 2RN8A 2DL5A 1NYGA 4RUGA 4WCIA 3VRZA 1ABQA 1SHFA 2EPDA 1PKTA 2B86A 2J6OA 2BZXA 1UJ0A 1V1CA 5IH2A 2JM8A 3EG1A 1MV0B 3M0SA 1K0XA 2DL8A 1ABOA 1AZEA 1GCQA 4RTUA 2DL3A 2ROTA 2MOXA 3I5SA 1UDLA 5HCKA 1WXUA 4X1VA 1Z9ZA 3EG2A 2F2WA 1BB9A 2ED0A 2GGRA 2EGCA 2AK5A 1AWOA 2DM1A 2EW3A 1KFZA 4M4ZA 1AWJA 4ZNXA 2CDTA 4F14A 2ENMA 2EYYA 2JM9A 2LCSA 1BU1A 3R6NA 1WI7A 5IXBA 1PKSA 2M0YA 5FWCA 1UTIA 1A0NB 2YUNA 4OMOA 4HCKA 1T3SA 1GBRA 4OMMA 2KT8A 2HSPA 1GL5A 2EGEA 4J9BA 2DVJA 2ECZA 3VS7A 1AWXA 3VS2A 1X6GA 4AFQC 2EVRA 2DL4A 3ZL7C 1XOVA 1UUEA 1QKWA
chains in the Genus database with same CATH superfamily
2KI7A 4KUDK 4R55A 2L5QA 3I55T 1VQ6A 2IIMA 4IUUA 1I07A 1ZBXA 1W6XA 2GBQA 2ED1A 5GANd 2O31A 4NL3A 5LJ3d 4EIKA 5KCHA 2YXYA 4C0DC 2X4YA 5I22A 3LH5A 4PFPA 3ZEHA 1Q82U 3M0TA 3CMEA 1JB0E 1LNXA 4C8QG 5GAN7 1B34B 2RO0A 3NTIA 2KRSA 2D0NA 5LJ3e 1ZSZC 4M77G 1BK2A 2WSFE 5KE2A 1ZA2B 3JCMh 2QYZA 4ELZC 4C0ZA 3KUFA 1VQ7T 2VC8A 2LZ6B 4XTUA 4F16A 2Y4XA 2PUKB 3JCMP 3EGUA 3RR6A 2DYBA 3GOXA 1I0CA 4J9CA 1R0BG 3C95A 4JJDA 2W10A 2KROA 3VRYA 1U3OA 1NYFA 1E6GA 3M55A 2XDBA 1JQQA 4PFOA 2L2PA 3PE0A 1VQ6T 1YCYA 3CMET 4OVAA 2X3XD 1U8RA 4BD3A 2EGAA 4E7SA 1N27A 1X01A 5EC7A 2KYBA 2JVVA 2MWPA 3CXCS 2XK0A 2FEIA 2KE9A 4OB0B 1WYXA 1VQNQ 1Y96B 2DA9A 1NM7A 1UJYA 1BCMA 2GNCA 3R6OA 4PL6A 4LDYA 1K0SA 4O6JA 2E65A 3BDLA 1LJOA 4J9HA 1AOJA 1U5SA 3SWNC 2D8JA 2RJDA 5GANj 1WHJA 4F04B 3CQTA 4DEYA 2CT3A 2MI6A 4PJNA 1M9SA 1ZX6A 5GAOq 1WIEA 4XTXA 2LNVA 1RACB 3FJ5A 4M75E 3OMGA 2NLUA 2OTJA 2IG0A 2CH4A 3NPFA 2J6KA 1I8FA 2RHYA 4IIOA 2G6FX 2QGFB 3CCMA 4RMOA 1UECA 2F1LA 1KQSS 1N6AA 2DFUA 1Y71A 2QXFA 1QVGS 5LJ5j 4FT4A 1G2BA 4NS5A 4A54A 3VS0A 1VQ4A 3T9NA 4M7AA 2LJ1A 3PGGA 1RL2A 1VQMA 5CAIA 2FZGB 1UG1A 3EGDA 4XTWA 3HFNA 2FRWA 1UFFA 4J7FA 3I56T 1OPLA 2DE0X 4II1A 1S1NA 2K3XA 4C8QF 4C92G 3A8GB 3PMIA 3FLGA 4JS5A 4ELYC 4QT7A 2JS0A 4HXJA 2W0ZA 2O4XA 3DKMA 5ECAA 4ANJA 2ABLA 2PVOB 1W2BS 2PZ1A 1WXBA 3BDUA 1WNLA 1SRLA 5FU6C 4WF2A 1V29B 2XDPA 1GCQC 2SRCA 3CCEA 2R5MA 2JXBA 5IT9E 1YIJT 2F5TX 2CKKA 1M8VA 1NPRA 1WZOA 2DF6A 1VQLQ 3CCJT 1VQ8Q 4JS4A 4C92C 1UGPB 3INZA 2JMAA 2GTOA 3TU4K 1ACMB 4PLLA 4YTLA 4LDUA 4X9CA 1M1KU 1MV3A 2DXBA 2A28A 3JB9F 8AT1B 4PKCC 2DBKA 3RMSA 2HQEA 1KD1R 3GLXA 1X6BA 1X69A 3CCSA 5AYFA 1KC8U 2RQVA 2C06A 3RKXA 5GAMg 2DTHA 4DA4A 2CREA 2OTJQ 1B34A 1WQ7A 2JTMA 4ORZA 3KXTA 3G71T 1N9RA 3DB4A 1QVFP 3JB9D 2EYZA 1RLQC 3GF5A 3V8KA 4K11A 2K79A 4J9DA 2CGHA 3O8VA 2MPXC 2QQ9A 2GTJA 2CZ1B 1D1BA 1E6HA 2QG9B 3EFOA 4KH1B 1M8MA 4M75A 1OI1A 3E9GA 2HZYA 2VYTA 1OOTA 3M56A 2HKQB 4ESRA 1RI0A 5DLQE 4LE9A 1VQLT 4GLKA 3M53A 2HL3A 4J7IA 1H3ZA 3FEOA 1UHFA 2FVUA 2V8JA 3G4SQ 2F5KA 1YIJQ 1P92A 4XU0A 4Y91A 1I1JA 3C94A 1QVFA 1TOVA 1WFWA 3RUXA 4C8QB 4MDWA 4OMPA 4DQ2A 1HD3A 3CBOA 3QUIA 1TTHB 4HT8A 2PVGB 3U23A 1AHJB 1U1SA 3FJPA 3JB9I 4PJOC 3OYAA 2KNBB 2YSQA 3RKWA 2GFAA 2YRDA 3M57A 2DD4A 1ZBJA 3SDZA 3CCRQ 4VUBA 2L0AA 4C92D 1ZUKA 1VYUA 2VUBA 1KG1A 3LGFA 1CKAA 1K76A 2DRMA 3QJYA 2RHXA 4A4KA 5I21A 1BCOA 2RHUA 2YWWA 1K73U 1YJWT 2QASA 3G7ZA 3HP9A 5DLOA 3L2UA 2DK3A 3CEYA 3OBYA 1K73C 1QP3A 2H3JA 4C92A 2QTVA 4L5GA 3H0HA 3UDCA 2AHJB 2DYIA 3OW2A 2NUTA 3X20B 1R77A 4M75B 1VQMQ 2E1HA 3JSCA 3OYHA 1PC0A 2BKDN 9ATCB 3EAEA 4QVDA 3EG9B 3CCUT 1QVFS 1NYGA 4BDYA 1IREB 3VRZA 1ABQA 2KSSA 3CD6Q 4PJOG 4ZN3A 4M7DG 5IH2A 2KAFA 3V8LA 2RHZA 1BI1A 1K0XA 5GAN4 1AZEA 2ZPEB 3GNFB 2F69A 4M75F 4JRPA 4RTUA 1FWZA 2MOXA 2VXEA 4F7UE 2XIDA 4E7ZA 2CP2A 5HCKA 1WXUA 4X1VA 3E2UA 5KYUB 4DBRA 8ATCB 2RJEA 2E64A 3CC7T 2EFIA 3CC2A 1Q82C 2DD5A 4OF1A 2EKOA 4ME7A 2LCLA 2COWA 4IUQA 2OX7A 3CPWA 2X35A 1BU1A 5FU7C 2QA4T 5FWCA 2CP3A 2YUNA 2X4JA 5LL6S 4HCKA 1T3SA 4TVRA 3S3MA 1G3YA 2XI9A 1GL5A 4OGEA 2WACA 5FROA 1W2BP 3PIOA 2ECZA 4XU1A 3VS2A 4AMCA 3ZL7C 5KYNA 1QKWA 3CCSQ 2COZA 4GBQA 4BB7A 5LJ5f 4NOYA 4BI4A 3NTKA 4C8QD 3QO3A 3CCLQ 1M3BA 4B9WA 1EFNA 2V26A 2DLPA 4OMLA 4CC7A 4F7UB 5HKCA 2J06A 5GAMf 1S72Q 2ZPHB 3E19A 4Z89A 5GMKm 3QSUA 1UGQB 2PUOB 2DXTA 2DEUA 3A98A 4C5EA 3CCEQ 5LJ3j 2PNIA 5I2SA 4E7KA 1XNIA 1VQLA 3QKJA 2H3EB 1M90R 1GXIE 5CKDA 2V1RA 2RQWA 1NG2A 2JS2A 1PSEA 4HCZA 1YNZA 4HT9A 4Z8AA 2HBPA 4J9EA 4AG2C 3I56A 3EFOB 2XDDA 1JU5C 5C6SA 3OS2A 1UHCA 3P8BB 3L1AA 1FMKA 4FU6A 1WHKA 1JO8A 5L23A 4ZGJB 5IXFA 2BIVA 3I55Q 2GQVA 2VWFA 2BZYA 2LTOA 1KQSA 4M7DD 1VIEA 3VS4A 1W4SA 3KFVA 2CP7A 3HPWA 3F70A 5KYWA 1JEGA 1OX9A 2JJ9A 5KCOA 4JZ4A 3PT9A 5GJVB 3QZ5B 1PWTA 1WDXA 1NLPC 1OPKA 4Q5WA 2FPDA 2MAMA 1QCOA 3L2ZA 2Z0WA 2DTIA 4PJOF 4OMQA 1S72A 2RI2A 1TUDA 1H8KA 2CP0A 2KYMA 1NZ9A 2QDYB 2DXCA 4RCCA 2DETA 2A7YA 3SFMA 1YHQA 2HNIA 2DJQA 1V76A 5LJ3h 2LJ0A 3QPHA 1KK7A 3GIBA 2QQAA 1H641 4KGXB 3VS3A 4N0AC 4M78G 5GAOm 2NUPA 3EFSA 1W1FA 2EBPA 2FO0A 2JW4A 4HCCA 3E9FA 2RF0A 4BI8B 2K9GA 4M78C 1WLPB 3JCMJ 4UC4A 4XTYA 3JAME 1OULA 4EPCA 4BI3A 4QQGA 3CCJA 1VA7A 5GAOp 3MEAA 1DJ7B 4JRQA 2E10A 1VQNA 3JCMd 4BE2A 3NHNA 1SHGA 2CZ0B 2D1XA 3OYEA 4BE1A 2FG0A 1S72T 1GRIA 5HY6A 3I5RA 2RNAA 1GBQA 4QKUA 4KGZB 3Q1JA 3H8ZA 2QQRA 3CCLT 2PQWA 3CD6A 4KUIA 3QBYA 5LJ5h 3EGXA 2OI3A 1WJRA 1AZGB 2OTLA 2DIQA 2BE7D 1R0CB 1KSWA 2O4XB 5IHIA 4GY5A 2FYKA 3QWYA 3WVDB 2EQIA 2MMPA 1D0XA 4RTZA 4JZ3A 1K9MU 4CC3A 5FLXE 1CKBA 3CCVT 1M90C 4CC2A 4JLIA 3MP6A 3URGA 4E2FB 2KK4A 4M7DF 1Q81R 2CUDA 2DZ9A 3H0FA 3VU3C 1JJ2P 4LN2A 2O88A 2V8KA 2RI3A 1YI2T 4IURA 2VASA 4C8QC 3PVQA 3BW1A 5DM7R 3EFRA 2L3PA 3QXEB 2YRCA 2OJ2A 1X27A 3G4SA 1VQ4Q 1WQWA 1Q95G 2KMTA 4M7AD 1UE9A 1C6VX 3NTHA 2EQUA 3META 4M78A 1N8RR 3I9QA 2QI2A 3X26B 1K8AU 2EQMA 2DERA 2EAYA 1NPPA 1VOMA 3CCRT 2QGGA 3AHUA 4E7JA 4Y92A 1RAIB 1RUWA 2PVDB 3UWNA 4IUPA 1QWEA 2EWNA 4MZMA 3M54A 4BUGA 1YJWQ 1YITT 4OB2B 2AZVA 1ZLMA 2NUTB 1QMCA 3A5ZB 1H92A 3THKA 2GF7A 3MEWA 2EJFA 5CVIA 3BFMA 5GAOn 1ZUYA 2GQIA 5KYWB 3S3NA 2QA4A 1PRMC 2LQ8A 2E5QA 2YLBA 4OGCA 3QG1A 1M1GA 2ZPFB 5J3BA 5FWBA 5AT1B 3D7SB 1I5OB 2AKLA 4EMKB 2RHIA 2AZSA 3OYGA 5GMKl 1VQ7A 3J7AF 2D9TA 2EIFA 1VQ5A 1RLPC 3JCMc 3ME9A 1MGQA 1Q82R 1HXDA 5GMKe 3SB2A 3M0QA 3QIIA 2K2VA 1GFDA 4JDSA 1RABB 3CMAT 1M2VB 1B3QA 2HQXA 4PJOD 2YHTA 1K1ZA 3VS6A 2FHDA 2BE9B 5CIUA 4E6RA 1YITA 1LCKA 2KXDA 2O9VA 3P8DA 2HL5C 2OAWA 1KHCA 3TVTA 2YT6A 1MMGA 1GCPA 3A8LB 4FYVB 4JRIA 2EQKA 2E41A 4J9IA 5J26A 1QP2A 3PIPA 3I35A 3M58A 4XTVA 1KHIA 2K5LA 1SHFA 1X75C 2EPDA 2MWOA 3LGLA 2J6OA 5C0MA 2MK5A 3CCET 2P4TA 2X4XA 3V8JA 3AT1B 1MV0B 4KBMB 4JJNK 4M77D 1VQ8T 2JNGA 1GCQA 2OAUA 1KC8R 2K5FA 7AT1B 1XJWB 2KVQG 3I5SA 3OYJA 2EJ9A 2V8IA 2DTOA 2RK1A 5KE3A 3EG2A 3L2QA 1JBMA 4EMKA 1PCXA 5IAYA 3GPLA 4AT1B 1AWOA 1WPYA 2Y90A 3CPWP 2LRQA 3CPWS 1Q81U 1KFZA 3LX7A 2I2LA 1AWJA 4ZNXA 1AT1B 1D1CA 3JCMb 2ENMA 5IXBA 2M0YA 3I56Q 1A0NB 5KYUA 4OMOA 1G3WA 4OMMA 4ZGDB 3FDRA 1VQ9T 2QTXA 2RK2A 1QW1A 3VS7A 2KDSA 2JN0A 3NGPA 5GAN3 3JV3A 1N5ZA 2EJGA 4FYXB 3CCST 3VKIA 1Q81C 3FC3A 4M77A 4ZGEB 1MHNA 3GBQA 3JRZA 1UGVA 4C5GA 1JXOA 4JRKA 3A8OB 2L3SA 1KD1U 1E7OA 1YI2Q 4PK4A 4MMLA 2HSEB 1I5LA 4J83A 3MPUB 4JJCA 1JXMA 2CYZB 1UB4A 3QYGB 4FW2A 2KBTA 1AVZC 3HTRA 4D8KA 5GANg 3CCQQ 4LD9K 3CD6T 3CC7Q 3ULRB 1IHWA 3E1SA 3DLMA 3CCQT 1M3AA 4QVCA 1SSFA 1KQSP 1ZSZB 4M7DC 3UT1A 3OS1A 3GP8A 2C0TA 1VQMT 2ZPIB 3CCLA 2P0KA 1OQKA 2VV5A 4BDZA 4FIBA 1OEBA 1SG5A 2NUZA 4JJBA 1TUGB 5GMKh 2P0PA 1IB8A 2DO3A 1OX8A 1HYOA 2YDLA 1YJ9A 1VQNT 4KRTA 2ZCFB 3EH1A 2E6ZA 3MEVA 3HL8A 5CQXA 3M5AA 4DOWA 5FU7B 2KT1A 1M2OA 4KT0E 1YIJA 2RB6A 1VQ9Q 3DLLA 4EMGA 3JCMe 3CMEQ 2CUBA 5I11A 1Q86R 3RNJA 1U06A 5FW9A 4N4IA 1D1AA 1TWBA 4ZTJA 2X3WD 1YWPA 3RBBB 4OP0A 2KRMA 1IHVA 2M0OA 3IQLA 4X34A 2K57A 1K73R 4M77F 4Y28E 1YI2A 2K5IA 2JZ2A 2FPEA 2KR3A 2JT4A 4AG1C 1FMWA 5IHKA 1RADB 5LJ5e 2M02A 2MCNA 4V2SA 1NEGA 1MMDA 3G4ST 4RTYA 2YRVA 1R8OB 3RMQA 3PNWC 2QK0A 3MCAB 3OMCA 2ZGWA 1LOJA 5GAMd 3MP8A 2XMFA 2QQSA 3QWXX 2K3YA 5CQYA 1NEBA 4FM4B 1BBZA 4E7LA 2O2OA 1T0HA 1JRIA 1WX6A 2LT4A 4HKEA 5M9OA 3EG9A 2J05A 3C12A 3OSSC 2QQBA 3MJXA 2O9SA 1VQKQ 3CBMA 2HCKA 1PD0A 4MZTA 2RI5A 1QLYA 5CO7A 1IRXA 3HRUA 5D6YA 3CMAQ 1JJ2S 2CS7A 4P5NA 3S3OA 3QZ9B 5GMKj 3MKDA 4RG2A 2R5AA 2M1HA 1QCFA 4DBQA 3QDFA 2VGMA 2E12A 2L3QA 1M4ZA 5J39A 2CH4W 4QQDA 3FRNA 2Y4YA 5GMKi 3CCJQ 1K9MC 4J9GA 1D3BA 4EMHA 3EG0A 3HRSA 2FB7A 3OW2P 2YUOA 5EG2A 4RKUE 2KRNA 1NJIR 1G3SA 5FU6B 2LNHB 2ROLA 1XQHA 3EGDB 1TG0A 2RQRA 2SEMA 2MYSA 3TSZA 1D0ZA 1M3CA 4JLGA 5A0LA 5D6XA 2ZAEA 2M16A 3PVLA 4FYYB 1M27C 3OY9A 2HMAA 1PM3A 1VQ5T 2RH2A 3VV0A 3VS5A 4N4GA 3M0UA 1QVPA 1X43A 3UPUA 5GAOr 4A53A 2L3RA 3M4GA 1ZQ1A 2LCCA 4BY6B 2X51A 1PHTA 4F7UA 2I0NA 1QQJA 2CP5A 1VUBA 3HRTA 4R0KA 3CC2T 1K4US 1X2QA 4E7IA 4MDXA 3RIRA 1HSQA 2K2MA 3ER0A 5GAN5 2R57A 4E47A 4HVUA 2RJCA 2QA4Q 1WXTA 3ASKA 1LVKA 4RG8A 2RJFA 1ZHIA 1ZUUA 3QYHB 4C92B 3CPFA 2A08A 2GCXA 1AEYA 3JCMV 1VQ4T 3OS5A 3PFSA 5LJ5d 1UGSB 1QKXA 4M77C 1IGUA 3OYLA 3JCMf 4FCYA 1WHLA 2ATCB 4EMKC 3NMZC 1VQ5Q 1IGQA 1FMVA 5GANe 1KD1C 4A4EA 4XU2A 1M5Q1 4FSXA 5HK3A 5KYYB 4N0AA 4RTVA 3OYNA 4J8OA 3SWNB 2P4RA 4A63B 4R56A 3HSBA 4LDVA 3C4SA 4FW1A 4BE0A 4XTZA 4M7AG 4M75D 4HVVA 1Y0MA 2K4YA 2WSCE 1FX7A 1YBYA 1M30A 2YUQA 4XAXB 5I2MA 3A8HB 4D8DA 2J7IA 1FXXA 3RKYA 3TEEA 5FRNA 6AT1B 2BZ8A 5IHNA 1WA7A 2E5KA 1VQ6Q 3V7RA 1Y96A 2E4HA 5LJ3f 3UATA 2RQUA 1VYTA 1YCSB 3HKSA 5L8RE 3OYCA 2EQJA 3SD4A 1WGSA 1NLOC 1BI0A 1ZSGA 3M0PA 4FL6A 1K9AA 3LLRA 4XK8E 2LQKA 3NFCA 4M78E 2L8DA 1N9SA 2IPOB 5GANh 1VQKT 3TREA 4BACA 3VUZA 2A3LA 1D0YA 3OA6A 2L89A 1J3TA 1ZSZA 4IUVA 4AFZC 3UA7A 3EG3A 2FZCB 3G71A 3CXCP 1OU8A 1Y57A 2RPNA 4PJOA 1VYVA 3P8HA 2RN8A 4WCIA 3L2RA 1PKTA 3HFOA 1TSFA 1PG5B 2B86A 2BZXA 5DY9A 5IN1A 1UJ0A 1N8RU 1TS9A 1G5VA 4ZTFA 3CCVA 1YHQT 1QVGP 1VQ7Q 2DL8A 1ABOA 3OYKA 3DB3A 2ROTA 3CCQA 1OYXA 1PSFA 5FRMA 4LXCA 3CMAA 2DJZA 1UDLA 5LJ3g 3EGXB 3OYYA 4XQ3A 4OB3B 1QCNA 1BB9A 4X9DA 2GGRA 1SF9A 2EGCA 3V7SA 2DEQA 1D3BB 2R58A 2DPPB 4F14A 3G71Q 1BKBA 3ZBDA 1VQPA 3TQ7P 1PKSA 1UTIA 1RAFB 1YJ9T 1GBRA 1SKUB 5LJ5g 1M2VA 2HSPA 2EGEA 4J9BA 5KH6A 2DVJA 3LYIA 2YLCA 1AWXA 1K9MR 1X6GA 1UGRB 2DL4A 1XOVA 4M75G 4CI0C 3CCRA 2JUFA 3OB9A 1VIFA 5GAN6 4NL2A 5A0GA 2DRKA 2LX9A 4WTOB 4MZPA 2XICA 1QWFA 4GLMA 4M7DB 5HK0A 1MMAA 2DX1A 2G3RA 3M0RA 1VQ9A 4C92F 1TU0B 2HBWA 1RAHB 1W2BA 1I4K1 3WVEB 3G6EQ 3BE3A 2RMOA 4OMNA 1T0JA 2CT4A 4Z02A 2CSQA 4B6MA 4C0DB 3MP1A 1RAGB 1W70A 4OB1B 2LP5A 2KY9A 3CC4Q 2OTLT 5GANf 1PD1A 3EHRA 1G83A 4C5HA 1B7TA 3QHSA 1YJNT 4CRIA 3OYMA 1F1BB 2AKKA 4LD6A 4L59A 2CZ6B 4F17A 4RTWA 1GFCA 3M9QA 1EZZB 1WJSA 1VQOT 3CC4A 2RD1A 3A1PA 2QEXT 1QVGA 3EHQA 1Q7YR 4L6V5 2J6FA 2CP6A 3OQ5A 4M7AE 3SWNA 3G6EA 4AFUC 4RCBA 2WSEE 1Q86C 4QQ6A 1RI9A 2KXCA 2X4WA 3QDRB 1WJQA 2K6DA 3CC4T 1VQOA 2MIOA 1HJDA 1SSHA 2HEQA 4HVWA 2BUDA 4M7DA 4C5IA 3SHWA 1SEMA 1WHMA 3V7CA 1M1KR 2M51A 4J6YA 4E7HA 3H41A 3MHXA 2B8AA 1SRMA 2LMJA 2HAXA 2PTKA 1MNEA 2DAQA 2LC4A 2AT1B 2QAZA 1K8AR 3HHTB 1D09B 1MMNA 2M9UA 4OMFB 5GAOl 2CSIA 1BIAA 4M7AC 3S6WA 3X28B 1OZ2A 1NJIC 2EKHA 1FYNA 2RM4A 3SEMA 1EX4A 4IIMA 3M4YA 2K7AA 2F2XA 1BIBA 2C0IA 5D6WA 4FYWB 4M7AF 4LUDA 1Z9QA 3CXCA 2RQTA 2FZKB 1VQ8A 3CCUQ 1TUCA 4ATOA 4PLIA 3J80E 4C0GA 3UF4A 3OBWA 2KGTA 4DEXA 4JUVA 1X2KA 3MEUA 3VUBA 4MMKA 1M1KC 2JTEA 4LDXA 2A36A 3CBPA 1BI2A 1YJ9Q 1Y07A 1KC8C 4M75C 4LNPA 3G1JA 3VJPA 1VQPQ 3X24B 1H3HA 4J9FA 1MUZA 3RDVA 3JCMg 4ZN1A 1O9SA 2KQWA 2X9HA 4J6XA 3A8MB 1MNDA 2BTTA 2LQWA 4F7UF 2C0OA 3PTAA 1U1TA 2JOYA 4C8QE 1I81A 2DXUA 2LDMA 2ZPGB 1JJ2A 1KIKA 4CC4B 3CCUA 2K3BA 3WXMB 1PNJA 1SPKA 2DMOA 1O75A 2EYWA 1RAAB 1YHQQ 5CKEA 1LPLA 3KBGA 1N8RC 3GNGA 2A37A 4KH0B 3CCMQ 1OZ3A 2V1QA 2JMCA 1Q7YU 4FSSA 2NUPB 2HD0A 3VYGA 5A0DA 4PJLA 2XU8A 2LQNA 5CK9A 1YWOA 1G3TA 1VQKA 2VGNA 3H0IA 1IXDA 3MO8A 4M78D 3CC7A 4J6WA 1Q86U 4LDWA 4DBHA 5GAMh 1KQ2A 4O5VA 3OYBA 4D6WA 4LUEA 1RAEB 3JB9J 3UA6A 4PJOE 4IUTA 4M7DE 1YITQ 1PRLC 3BY7A 3CCMT 1M90U 2FRYA 3OYDA 2HQHA 4PJMA 5GJWB 1X6OA 4Z88A 4PJJA 1YFNA 4QVZA 1M1FA 2OTJT 2IVWA 3L42A 4PFZA 4F7UG 1WHGA 4FT2A 4RTXA 3JCMQ 5KYXA 3RERA 2DL7A 3FB9A 4AFSC 1NBEB 2DIGA 1YP5A 2NWMA 2DVEA 2NYSA 3LH0A 5CKFA 1IO6A 2DNUA 4M77E 3OW2S 4PNOA 3X25B 2LJ3A 5KYYA 2QDLA 2H8HA 2LVMA 1K8AC 1G8XA 2FL7A 2VVKA 1VQPT 3VYHB 1B07A 1C1AA 1BI3A 1XTDA 2VKNA 2DILA 1ARKA 4PJOB 1CSKA 2E70A 2DZCA 2D0QB 3TCJA 2LX7A 3O5ZA 4C0FA 2EYQA 1YN8A 4M7AB 1IZ6A 3OS0A 3OYFA 4A4FA 1KJWA 3LWIA 3TSWA 3L2WA 4QW2A 2FPFA 3REBB 4DOVA 3CCVQ 2KEAA 2HKNA 2ZPBB 1OV3A 1Q7YC 1C0MA 2RA2A 2XHCA 5D7UA 5CCAA 2COYA 5CR2A 4A4GA 2DBMA 2E3HA 2HDAA 2XKOC 4M77B 3REAB 4JPBW 4DBFA 1OU9A 1T3LA 2O01E 2D8HA 1Y7XA 2DKGA 4M78F 5GAMj 3CC2Q 1AD5A 2YUPA 5KYXB 1AWWA 3VS1A 3FIFA 5CKBA 2QEXQ 2EYXA 4XU3A 4KULA 2AIRB 4RTTA 1VQOQ 2PU9B 1BYMA 3C0CA 2D6FA 4A4HA 1YJNQ 3LWHA 3ZFJA 4EDUA 4M78B 1HK9A 2F2VA 5GAN2 3JB9G 2ESWA 2OTLQ 1EIFA 2MF2A 4BY6C 1TH7A 2DL5A 4RUGA 2VXFA 1UEBA 3M59A 4B9XA 2XG8D 2ZZDA 3J81E 3G6ET 3LW5E 1V1CA 2JM8A 4C8QA 3JCMX 2E6NA 3EG1A 4HCBA 3M0SA 1KQ1A 3H9NA 3I55A 2DL3A 3JCMW 2P0QA 3QJ6A 3OYIA 3L2VA 1Z9ZA 2F2WA 1NJIU 4IKFA 2A0FB 2VB6A 3PMTA 4KGVB 3N5BB 2ED0A 1YJNA 2XD0A 4HA8A 5CKHA 2AK5A 3EH2A 2DM1A 2EW3A 4M4ZA 1ZA1B 2CDTA 5GAMe 2EYYA 2E3IA 2JM9A 2LCSA 3R6NA 1TXQA 2GFUA 1WI7A 3H6ZA 1NE8A 2QEXA 5GAN8 4N4HA 4C92E 1YJWA 2JTFA 2KT8A 1WHHA 5A2QE 2P84A 3RESA 2CZ7B 3JB9H 3OSVA 4J5YA 4AFQC 2EVRA 2LT1A 1UUEA
chains in the Genus database with same CATH topology
3JV3A 1N5ZA 4GBQA 2IIMA 1I07A 2DRKA 1W6XA 3GBQA 1M3BA 1UGVA 2GBQA 1EFNA 2ED1A 2DLPA 1JXOA 4OMLA 4CC7A 2J06A 1QWFA 2O31A 4GLMA 2L3SA 4Z89A 4EIKA 1E7OA 2DX1A 3M0RA 4JJCA 1JXMA 2HBWA 5I22A 3A98A 2KBTA 1AVZC 2PNIA 3LH5A 4D8KA 2RMOA 4OMNA 1T0JA 3M0TA 2CT4A 3ULRB 2CSQA 1M3AA 1W70A 2KRSA 2D0NA 2LP5A 2V1RA 2C0TA 1BK2A 1NG2A 2RQWA 2JS2A 3EHRA 1G83A 1YNZA 4Z8AA 2AKKA 2LZ6B 4J9EA 4AG2C 4F16A 1JU5C 1OEBA 4F17A 4RTWA 2NUZA 4JJBA 1UHCA 1GFCA 3EGUA 2DYBA 1FMKA 1I0CA 4J9CA 2YDLA 1JO8A 5L23A 4KRTA 4JJDA 2W10A 2KROA 5IXFA 3VRYA 2VWFA 3EHQA 2BZYA 2J6FA 1U3OA 1NYFA 2KT1A 1E6GA 3VS4A 4AFUC 3KFVA 1JQQA 2L2PA 2CUBA 5I11A 1JEGA 3PE0A 1RI9A 2KXCA 1U06A 4JZ4A 3RNJA 5FW9A 2X3XD 5GJVB 2X3WD 1PWTA 1WDXA 1NLPC 1YWPA 2EGAA 1OPKA 2K6DA 2FPDA 3RBBB 2MIOA 1HJDA 1SSHA 2HEQA 4HVWA 5EC7A 2KYBA 2KRMA 3SHWA 1SEMA 4OMQA 1TUDA 1H8KA 2FEIA 2M51A 2KE9A 3IQLA 1WYXA 2FPEA 2DA9A 2KYMA 1NM7A 2KR3A 2JT4A 1UJYA 3H41A 4AG1C 1SRMA 2LMJA 5IHKA 2PTKA 2MCNA 2GNCA 1NEGA 2DJQA 1K0SA 2LJ0A 4RTYA 2CSIA 4J9HA 1AOJA 1U5SA 2D8JA 3VS3A 2EKHA 1FYNA 3SEMA 4IIMA 2K7AA 1W1FA 2EBPA 2F2XA 2FO0A 2JW4A 2C0IA 2XMFA 4LUDA 1Z9QA 3CQTA 4DEYA 2CT3A 3QWXX 2RF0A 2RQTA 2K9GA 1WLPB 1ZX6A 1TUCA 1WIEA 1NEBA 1BBZA 3UF4A 1VA7A 2KGTA 3FJ5A 4DEXA 2O2OA 1T0HA 1WX6A 1X2KA 2CH4A 3NPFA 2J6KA 2JTEA 4IIOA 2A36A 1SHGA 2J05A 3NHNA 2G6FX 2D1XA 2FG0A 1GRIA 2O9SA 1UECA 3I5RA 2HCKA 2RNAA 1GBQA 4LNPA 1H3HA 1QLYA 4J9FA 1MUZA 1G2BA 3VS0A 1QCFA 2BTTA 2LQWA 2OI3A 2C0OA 2L3QA 2LJ1A 1AZGB 2CH4W 1KIKA 1UG1A 4CC4B 1KSWA 5IHIA 2K3BA 4J9GA 2FRWA 1UFFA 1PNJA 1SPKA 2DMOA 2EYWA 3QWYA 1OPLA 3EG0A 2DE0X 1S1NA 2EQIA 4RTZA 4JZ3A 2YUOA 2KRNA 4CC3A 2A37A 1CKBA 2LNHB 2ROLA 4QT7A 2JS0A 4HXJA 2V1QA 2W0ZA 4CC2A 1TG0A 5ECAA 2JMCA 2ABLA 2RQRA 2SEMA 4FSSA 3TSZA 2PZ1A 1WXBA 2CUDA 1M3CA 1SRLA 2LQNA 3H0FA 1GCQC 2SRCA 2JXBA 3PVLA 1YWOA 4LN2A 2O88A 3H0IA 1M27C 2DF6A 3PVQA 2L3PA 4LUEA 3M0UA 1X43A 3VS5A 2JMAA 2OJ2A 2GTOA 1X27A 3UA6A 1UE9A 1PHTA 1MV3A 2I0NA 2A28A 1PRLC 2FRYA 4R0KA 1K4US 5GJWB 1X2QA 4Z88A 3I9QA 1HSQA 2K2MA 2DBKA 4RTXA 1X6BA 1X69A 2RQVA 2DL7A 4HVUA 4Y92A 2CREA 1WXTA 4ORZA 4AFSC 1RUWA 1YP5A 2EYZA 2NWMA 1ZUUA 1QWEA 1RLQC 1IO6A 2DNUA 4K11A 2K79A 2A08A 4J9DA 2LJ3A 1AEYA 2AZVA 2GTJA 1ZLMA 2QDLA 1E6HA 2H8HA 1QKXA 2VVKA 1M8MA 1B07A 2VKNA 1OOTA 2DILA 3NMZC 4ESRA 1ARKA 1H92A 4LE9A 3THKA 1CSKA 2LX7A 4RTVA 3O5ZA 1UHFA 2P4RA 4A63B 1YN8A 1ZUYA 2GQIA 1I1JA 1KJWA 1WFWA 3TSWA 4HVVA 1Y0MA 4OMPA 1PRMC 1HD3A 1M30A 2FPFA 3REBB 2YUQA 4D8DA 2J7IA 3U23A 2KEAA 2BZ8A 5IHNA 1WA7A 1OV3A 5FWBA 2KNBB 2YSQA 2AKLA 2DBMA 2E5KA 1ZBJA 2AZSA 2L0AA 2HDAA 3UATA 3REAB 1ZUKA 1VYUA 1RLPC 4JPBW 1T3LA 2D8HA 1CKAA 1K76A 2DRMA 2RQUA 3M0QA 1VYTA 1YCSB 1AD5A 2YUPA 1AWWA 1GFDA 3VS1A 2EYXA 1NLOC 3M0PA 1ZSGA 3NGPA 4RTTA 1B3QA 1K1ZA 1K9AA 3C0CA 3VS6A 4E6RA 3H0HA 1LCKA 2KXDA 2O9VA 2OAWA 3TVTA 2YT6A 1GCPA 1J3TA 2F2VA 4AFZC 2ESWA 3UA7A 3EG3A 1Y57A 4J9IA 2RPNA 3I35A 1VYVA 2RN8A 2DL5A 1NYGA 4RUGA 4WCIA 3VRZA 1ABQA 1SHFA 2EPDA 1PKTA 2B86A 2J6OA 2BZXA 1UJ0A 1V1CA 5IH2A 2JM8A 3EG1A 1MV0B 3M0SA 1K0XA 2DL8A 1ABOA 1AZEA 1GCQA 4RTUA 2DL3A 2ROTA 2MOXA 3I5SA 1UDLA 5HCKA 1WXUA 4X1VA 1Z9ZA 3EG2A 2F2WA 1BB9A 2ED0A 2GGRA 2EGCA 2AK5A 1AWOA 2DM1A 2EW3A 1KFZA 4M4ZA 1AWJA 4ZNXA 2CDTA 4F14A 2ENMA 2EYYA 2JM9A 2LCSA 1BU1A 3R6NA 1WI7A 5IXBA 1PKSA 2M0YA 5FWCA 1UTIA 1A0NB 2YUNA 4OMOA 4HCKA 1T3SA 1GBRA 4OMMA 2KT8A 2HSPA 1GL5A 2EGEA 4J9BA 2DVJA 2ECZA 3VS7A 1AWXA 3VS2A 1X6GA 4AFQC 2EVRA 2DL4A 3ZL7C 1XOVA 1UUEA 1QKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV3 A;  1N5Z A;  4GBQ A;  2IIM A;  1I07 A;  2DRK A;  1W6X A;  3GBQ A;  1M3B A;  1UGV A;  2GBQ A;  1EFN A;  2ED1 A;  2DLP A;  1JXO A;  4OML A;  4CC7 A;  2J06 A;  1QWF A;  2O31 A;  4GLM A;  2L3S A;  4Z89 A;  4EIK A;  1E7O A;  2DX1 A;  3M0R A;  4JJC A;  1JXM A;  2HBW A;  5I22 A;  3A98 A;  2KBT A;  1AVZ C;  2PNI A;  3LH5 A;  4D8K A;  2RMO A;  4OMN A;  1T0J A;  3M0T A;  2CT4 A;  3ULR B;  2CSQ A;  1M3A A;  1W70 A;  2KRS A;  2D0N A;  2LP5 A;  2V1R A;  2C0T A;  1BK2 A;  1NG2 A;  2RQW A;  2JS2 A;  3EHR A;  1G83 A;  1YNZ A;  4Z8A A;  2AKK A;  2LZ6 B;  4J9E A;  4AG2 C;  4F16 A;  1JU5 C;  1OEB A;  4F17 A;  4RTW A;  2NUZ A;  4JJB A;  1UHC A;  1GFC A;  3EGU A;  2DYB A;  1FMK A;  1I0C A;  4J9C A;  2YDL A;  1JO8 A;  5L23 A;  4KRT A;  4JJD A;  2W10 A;  2KRO A;  5IXF A;  3VRY A;  2VWF A;  3EHQ A;  2BZY A;  2J6F A;  1U3O A;  1NYF A;  2KT1 A;  1E6G A;  3VS4 A;  4AFU C;  3KFV A;  1JQQ A;  2L2P A;  2CUB A;  5I11 A;  1JEG A;  3PE0 A;  1RI9 A;  2KXC A;  1U06 A;  4JZ4 A;  3RNJ A;  5FW9 A;  2X3X D;  5GJV B;  2X3W D;  1PWT A;  1WDX A;  1NLP C;  1YWP A;  2EGA A;  1OPK A;  2K6D A;  2FPD A;  3RBB B;  2MIO A;  1HJD A;  1SSH A;  2HEQ A;  4HVW A;  5EC7 A;  2KYB A;  2KRM A;  3SHW A;  1SEM A;  4OMQ A;  1TUD A;  1H8K A;  2FEI A;  2M51 A;  2KE9 A;  3IQL A;  1WYX A;  2FPE A;  2DA9 A;  2KYM A;  1NM7 A;  2KR3 A;  2JT4 A;  1UJY A;  3H41 A;  4AG1 C;  1SRM A;  2LMJ A;  5IHK A;  2PTK A;  2MCN A;  2GNC A;  1NEG A;  2DJQ A;  1K0S A;  2LJ0 A;  4RTY A;  2CSI A;  4J9H A;  1AOJ A;  1U5S A;  2D8J A;  3VS3 A;  2EKH A;  1FYN A;  3SEM A;  4IIM A;  2K7A A;  1W1F A;  2EBP A;  2F2X A;  2FO0 A;  2JW4 A;  2C0I A;  2XMF A;  4LUD A;  1Z9Q A;  3CQT A;  4DEY A;  2CT3 A;  3QWX X;  2RF0 A;  2RQT A;  2K9G A;  1WLP B;  1ZX6 A;  1TUC A;  1WIE A;  1NEB A;  1BBZ A;  3UF4 A;  1VA7 A;  2KGT A;  3FJ5 A;  4DEX A;  2O2O A;  1T0H A;  1WX6 A;  1X2K A;  2CH4 A;  3NPF A;  2J6K A;  2JTE A;  4IIO A;  2A36 A;  1SHG A;  2J05 A;  3NHN A;  2G6F X;  2D1X A;  2FG0 A;  1GRI A;  2O9S A;  1UEC A;  3I5R A;  2HCK A;  2RNA A;  1GBQ A;  4LNP A;  1H3H A;  1QLY A;  4J9F A;  1MUZ A;  1G2B A;  3VS0 A;  1QCF A;  2BTT A;  2LQW A;  2OI3 A;  2C0O A;  2L3Q A;  2LJ1 A;  1AZG B;  2CH4 W;  1KIK A;  1UG1 A;  4CC4 B;  1KSW A;  5IHI A;  2K3B A;  4J9G A;  2FRW A;  1UFF A;  1PNJ A;  1SPK A;  2DMO A;  2EYW A;  3QWY A;  1OPL A;  3EG0 A;  2DE0 X;  1S1N A;  2EQI A;  4RTZ A;  4JZ3 A;  2YUO A;  2KRN A;  4CC3 A;  2A37 A;  1CKB A;  2LNH B;  2ROL A;  4QT7 A;  2JS0 A;  4HXJ A;  2V1Q A;  2W0Z A;  4CC2 A;  1TG0 A;  5ECA A;  2JMC A;  2ABL A;  2RQR A;  2SEM A;  4FSS A;  3TSZ A;  2PZ1 A;  1WXB A;  2CUD A;  1M3C A;  1SRL A;  2LQN A;  3H0F A;  1GCQ C;  2SRC A;  2JXB A;  3PVL A;  1YWO A;  4LN2 A;  2O88 A;  3H0I A;  1M27 C;  2DF6 A;  3PVQ A;  2L3P A;  4LUE A;  3M0U A;  1X43 A;  3VS5 A;  2JMA A;  2OJ2 A;  2GTO A;  1X27 A;  3UA6 A;  1UE9 A;  1PHT A;  1MV3 A;  2I0N A;  2A28 A;  1PRL C;  2FRY A;  4R0K A;  1K4U S;  5GJW B;  1X2Q A;  4Z88 A;  3I9Q A;  1HSQ A;  2K2M A;  2DBK A;  4RTX A;  1X6B A;  1X69 A;  2RQV A;  2DL7 A;  4HVU A;  4Y92 A;  2CRE A;  1WXT A;  4ORZ A;  4AFS C;  1RUW A;  1YP5 A;  2EYZ A;  2NWM A;  1ZUU A;  1QWE A;  1RLQ C;  1IO6 A;  2DNU A;  4K11 A;  2K79 A;  2A08 A;  4J9D A;  2LJ3 A;  1AEY A;  2AZV A;  2GTJ A;  1ZLM A;  2QDL A;  1E6H A;  2H8H A;  1QKX A;  2VVK A;  1M8M A;  1B07 A;  2VKN A;  1OOT A;  2DIL A;  3NMZ C;  4ESR A;  1ARK A;  1H92 A;  4LE9 A;  3THK A;  1CSK A;  2LX7 A;  4RTV A;  3O5Z A;  1UHF A;  2P4R A;  4A63 B;  1YN8 A;  1ZUY A;  2GQI A;  1I1J A;  1KJW A;  1WFW A;  3TSW A;  4HVV A;  1Y0M A;  4OMP A;  1PRM C;  1HD3 A;  1M30 A;  2FPF A;  3REB B;  2YUQ A;  4D8D A;  2J7I A;  3U23 A;  2KEA A;  2BZ8 A;  5IHN A;  1WA7 A;  1OV3 A;  5FWB A;  2KNB B;  2YSQ A;  2AKL A;  2DBM A;  2E5K A;  1ZBJ A;  2AZS A;  2L0A A;  2HDA A;  3UAT A;  3REA B;  1ZUK A;  1VYU A;  1RLP C;  4JPB W;  1T3L A;  2D8H A;  1CKA A;  1K76 A;  2DRM A;  2RQU A;  3M0Q A;  1VYT A;  1YCS B;  1AD5 A;  2YUP A;  1AWW A;  1GFD A;  3VS1 A;  2EYX A;  1NLO C;  3M0P A;  1ZSG A;  3NGP A;  4RTT A;  1B3Q A;  1K1Z A;  1K9A A;  3C0C A;  3VS6 A;  4E6R A;  3H0H A;  1LCK A;  2KXD A;  2O9V A;  2OAW A;  3TVT A;  2YT6 A;  1GCP A;  1J3T A;  2F2V A;  4AFZ C;  2ESW A;  3UA7 A;  3EG3 A;  1Y57 A;  4J9I A;  2RPN A;  3I35 A;  1VYV A;  2RN8 A;  2DL5 A;  1NYG A;  4RUG A;  4WCI A;  3VRZ A;  1ABQ A;  1SHF A;  2EPD A;  1PKT A;  2B86 A;  2J6O A;  2BZX A;  1UJ0 A;  1V1C A;  5IH2 A;  2JM8 A;  3EG1 A;  1MV0 B;  3M0S A;  1K0X A;  2DL8 A;  1ABO A;  1AZE A;  1GCQ A;  4RTU A;  2DL3 A;  2ROT A;  2MOX A;  3I5S A;  1UDL A;  5HCK A;  1WXU A;  4X1V A;  1Z9Z A;  3EG2 A;  2F2W A;  1BB9 A;  2ED0 A;  2GGR A;  2EGC A;  2AK5 A;  1AWO A;  2DM1 A;  2EW3 A;  1KFZ A;  4M4Z A;  1AWJ A;  4ZNX A;  2CDT A;  4F14 A;  2ENM A;  2EYY A;  2JM9 A;  2LCS A;  1BU1 A;  3R6N A;  1WI7 A;  5IXB A;  1PKS A;  2M0Y A;  5FWC A;  1UTI A;  1A0N B;  2YUN A;  4OMO A;  4HCK A;  1T3S A;  1GBR A;  4OMM A;  2KT8 A;  2HSP A;  1GL5 A;  2EGE A;  4J9B A;  2DVJ A;  2ECZ A;  3VS7 A;  1AWX A;  3VS2 A;  1X6G A;  4AFQ C;  2EVR A;  2DL4 A;  3ZL7 C;  1XOV A;  1UUE A;  1QKW A; 
#chains in the Genus database with same CATH topology
 2KI7 A;  4KUD K;  4R55 A;  2L5Q A;  3I55 T;  1VQ6 A;  2IIM A;  4IUU A;  1I07 A;  1ZBX A;  1W6X A;  2GBQ A;  2ED1 A;  5GAN d;  2O31 A;  4NL3 A;  5LJ3 d;  4EIK A;  5KCH A;  2YXY A;  4C0D C;  2X4Y A;  5I22 A;  3LH5 A;  4PFP A;  3ZEH A;  1Q82 U;  3M0T A;  3CME A;  1JB0 E;  1LNX A;  4C8Q G;  5GAN 7;  1B34 B;  2RO0 A;  3NTI A;  2KRS A;  2D0N A;  5LJ3 e;  1ZSZ C;  4M77 G;  1BK2 A;  2WSF E;  5KE2 A;  1ZA2 B;  3JCM h;  2QYZ A;  4ELZ C;  4C0Z A;  3KUF A;  1VQ7 T;  2VC8 A;  2LZ6 B;  4XTU A;  4F16 A;  2Y4X A;  2PUK B;  3JCM P;  3EGU A;  3RR6 A;  2DYB A;  3GOX A;  1I0C A;  4J9C A;  1R0B G;  3C95 A;  4JJD A;  2W10 A;  2KRO A;  3VRY A;  1U3O A;  1NYF A;  1E6G A;  3M55 A;  2XDB A;  1JQQ A;  4PFO A;  2L2P A;  3PE0 A;  1VQ6 T;  1YCY A;  3CME T;  4OVA A;  2X3X D;  1U8R A;  4BD3 A;  2EGA A;  4E7S A;  1N27 A;  1X01 A;  5EC7 A;  2KYB A;  2JVV A;  2MWP A;  3CXC S;  2XK0 A;  2FEI A;  2KE9 A;  4OB0 B;  1WYX A;  1VQN Q;  1Y96 B;  2DA9 A;  1NM7 A;  1UJY A;  1BCM A;  2GNC A;  3R6O A;  4PL6 A;  4LDY A;  1K0S A;  4O6J A;  2E65 A;  3BDL A;  1LJO A;  4J9H A;  1AOJ A;  1U5S A;  3SWN C;  2D8J A;  2RJD A;  5GAN j;  1WHJ A;  4F04 B;  3CQT A;  4DEY A;  2CT3 A;  2MI6 A;  4PJN A;  1M9S A;  1ZX6 A;  5GAO q;  1WIE A;  4XTX A;  2LNV A;  1RAC B;  3FJ5 A;  4M75 E;  3OMG A;  2NLU A;  2OTJ A;  2IG0 A;  2CH4 A;  3NPF A;  2J6K A;  1I8F A;  2RHY A;  4IIO A;  2G6F X;  2QGF B;  3CCM A;  4RMO A;  1UEC A;  2F1L A;  1KQS S;  1N6A A;  2DFU A;  1Y71 A;  2QXF A;  1QVG S;  5LJ5 j;  4FT4 A;  1G2B A;  4NS5 A;  4A54 A;  3VS0 A;  1VQ4 A;  3T9N A;  4M7A A;  2LJ1 A;  3PGG A;  1RL2 A;  1VQM A;  5CAI A;  2FZG B;  1UG1 A;  3EGD A;  4XTW A;  3HFN A;  2FRW A;  1UFF A;  4J7F A;  3I56 T;  1OPL A;  2DE0 X;  4II1 A;  1S1N A;  2K3X A;  4C8Q F;  4C92 G;  3A8G B;  3PMI A;  3FLG A;  4JS5 A;  4ELY C;  4QT7 A;  2JS0 A;  4HXJ A;  2W0Z A;  2O4X A;  3DKM A;  5ECA A;  4ANJ A;  2ABL A;  2PVO B;  1W2B S;  2PZ1 A;  1WXB A;  3BDU A;  1WNL A;  1SRL A;  5FU6 C;  4WF2 A;  1V29 B;  2XDP A;  1GCQ C;  2SRC A;  3CCE A;  2R5M A;  2JXB A;  5IT9 E;  1YIJ T;  2F5T X;  2CKK A;  1M8V A;  1NPR A;  1WZO A;  2DF6 A;  1VQL Q;  3CCJ T;  1VQ8 Q;  4JS4 A;  4C92 C;  1UGP B;  3INZ A;  2JMA A;  2GTO A;  3TU4 K;  1ACM B;  4PLL A;  4YTL A;  4LDU A;  4X9C A;  1M1K U;  1MV3 A;  2DXB A;  2A28 A;  3JB9 F;  8AT1 B;  4PKC C;  2DBK A;  3RMS A;  2HQE A;  1KD1 R;  3GLX A;  1X6B A;  1X69 A;  3CCS A;  5AYF A;  1KC8 U;  2RQV A;  2C06 A;  3RKX A;  5GAM g;  2DTH A;  4DA4 A;  2CRE A;  2OTJ Q;  1B34 A;  1WQ7 A;  2JTM A;  4ORZ A;  3KXT A;  3G71 T;  1N9R A;  3DB4 A;  1QVF P;  3JB9 D;  2EYZ A;  1RLQ C;  3GF5 A;  3V8K A;  4K11 A;  2K79 A;  4J9D A;  2CGH A;  3O8V A;  2MPX C;  2QQ9 A;  2GTJ A;  2CZ1 B;  1D1B A;  1E6H A;  2QG9 B;  3EFO A;  4KH1 B;  1M8M A;  4M75 A;  1OI1 A;  3E9G A;  2HZY A;  2VYT A;  1OOT A;  3M56 A;  2HKQ B;  4ESR A;  1RI0 A;  5DLQ E;  4LE9 A;  1VQL T;  4GLK A;  3M53 A;  2HL3 A;  4J7I A;  1H3Z A;  3FEO A;  1UHF A;  2FVU A;  2V8J A;  3G4S Q;  2F5K A;  1YIJ Q;  1P92 A;  4XU0 A;  4Y91 A;  1I1J A;  3C94 A;  1QVF A;  1TOV A;  1WFW A;  3RUX A;  4C8Q B;  4MDW A;  4OMP A;  4DQ2 A;  1HD3 A;  3CBO A;  3QUI A;  1TTH B;  4HT8 A;  2PVG B;  3U23 A;  1AHJ B;  1U1S A;  3FJP A;  3JB9 I;  4PJO C;  3OYA A;  2KNB B;  2YSQ A;  3RKW A;  2GFA A;  2YRD A;  3M57 A;  2DD4 A;  1ZBJ A;  3SDZ A;  3CCR Q;  4VUB A;  2L0A A;  4C92 D;  1ZUK A;  1VYU A;  2VUB A;  1KG1 A;  3LGF A;  1CKA A;  1K76 A;  2DRM A;  3QJY A;  2RHX A;  4A4K A;  5I21 A;  1BCO A;  2RHU A;  2YWW A;  1K73 U;  1YJW T;  2QAS A;  3G7Z A;  3HP9 A;  5DLO A;  3L2U A;  2DK3 A;  3CEY A;  3OBY A;  1K73 C;  1QP3 A;  2H3J A;  4C92 A;  2QTV A;  4L5G A;  3H0H A;  3UDC A;  2AHJ B;  2DYI A;  3OW2 A;  2NUT A;  3X20 B;  1R77 A;  4M75 B;  1VQM Q;  2E1H A;  3JSC A;  3OYH A;  1PC0 A;  2BKD N;  9ATC B;  3EAE A;  4QVD A;  3EG9 B;  3CCU T;  1QVF S;  1NYG A;  4BDY A;  1IRE B;  3VRZ A;  1ABQ A;  2KSS A;  3CD6 Q;  4PJO G;  4ZN3 A;  4M7D G;  5IH2 A;  2KAF A;  3V8L A;  2RHZ A;  1BI1 A;  1K0X A;  5GAN 4;  1AZE A;  2ZPE B;  3GNF B;  2F69 A;  4M75 F;  4JRP A;  4RTU A;  1FWZ A;  2MOX A;  2VXE A;  4F7U E;  2XID A;  4E7Z A;  2CP2 A;  5HCK A;  1WXU A;  4X1V A;  3E2U A;  5KYU B;  4DBR A;  8ATC B;  2RJE A;  2E64 A;  3CC7 T;  2EFI A;  3CC2 A;  1Q82 C;  2DD5 A;  4OF1 A;  2EKO A;  4ME7 A;  2LCL A;  2COW A;  4IUQ A;  2OX7 A;  3CPW A;  2X35 A;  1BU1 A;  5FU7 C;  2QA4 T;  5FWC A;  2CP3 A;  2YUN A;  2X4J A;  5LL6 S;  4HCK A;  1T3S A;  4TVR A;  3S3M A;  1G3Y A;  2XI9 A;  1GL5 A;  4OGE A;  2WAC A;  5FRO A;  1W2B P;  3PIO A;  2ECZ A;  4XU1 A;  3VS2 A;  4AMC A;  3ZL7 C;  5KYN A;  1QKW A;  3CCS Q;  2COZ A;  4GBQ A;  4BB7 A;  5LJ5 f;  4NOY A;  4BI4 A;  3NTK A;  4C8Q D;  3QO3 A;  3CCL Q;  1M3B A;  4B9W A;  1EFN A;  2V26 A;  2DLP A;  4OML A;  4CC7 A;  4F7U B;  5HKC A;  2J06 A;  5GAM f;  1S72 Q;  2ZPH B;  3E19 A;  4Z89 A;  5GMK m;  3QSU A;  1UGQ B;  2PUO B;  2DXT A;  2DEU A;  3A98 A;  4C5E A;  3CCE Q;  5LJ3 j;  2PNI A;  5I2S A;  4E7K A;  1XNI A;  1VQL A;  3QKJ A;  2H3E B;  1M90 R;  1GXI E;  5CKD A;  2V1R A;  2RQW A;  1NG2 A;  2JS2 A;  1PSE A;  4HCZ A;  1YNZ A;  4HT9 A;  4Z8A A;  2HBP A;  4J9E A;  4AG2 C;  3I56 A;  3EFO B;  2XDD A;  1JU5 C;  5C6S A;  3OS2 A;  1UHC A;  3P8B B;  3L1A A;  1FMK A;  4FU6 A;  1WHK A;  1JO8 A;  5L23 A;  4ZGJ B;  5IXF A;  2BIV A;  3I55 Q;  2GQV A;  2VWF A;  2BZY A;  2LTO A;  1KQS A;  4M7D D;  1VIE A;  3VS4 A;  1W4S A;  3KFV A;  2CP7 A;  3HPW A;  3F70 A;  5KYW A;  1JEG A;  1OX9 A;  2JJ9 A;  5KCO A;  4JZ4 A;  3PT9 A;  5GJV B;  3QZ5 B;  1PWT A;  1WDX A;  1NLP C;  1OPK A;  4Q5W A;  2FPD A;  2MAM A;  1QCO A;  3L2Z A;  2Z0W A;  2DTI A;  4PJO F;  4OMQ A;  1S72 A;  2RI2 A;  1TUD A;  1H8K A;  2CP0 A;  2KYM A;  1NZ9 A;  2QDY B;  2DXC A;  4RCC A;  2DET A;  2A7Y A;  3SFM A;  1YHQ A;  2HNI A;  2DJQ A;  1V76 A;  5LJ3 h;  2LJ0 A;  3QPH A;  1KK7 A;  3GIB A;  2QQA A;  1H64 1;  4KGX B;  3VS3 A;  4N0A C;  4M78 G;  5GAO m;  2NUP A;  3EFS A;  1W1F A;  2EBP A;  2FO0 A;  2JW4 A;  4HCC A;  3E9F A;  2RF0 A;  4BI8 B;  2K9G A;  4M78 C;  1WLP B;  3JCM J;  4UC4 A;  4XTY A;  3JAM E;  1OUL A;  4EPC A;  4BI3 A;  4QQG A;  3CCJ A;  1VA7 A;  5GAO p;  3MEA A;  1DJ7 B;  4JRQ A;  2E10 A;  1VQN A;  3JCM d;  4BE2 A;  3NHN A;  1SHG A;  2CZ0 B;  2D1X A;  3OYE A;  4BE1 A;  2FG0 A;  1S72 T;  1GRI A;  5HY6 A;  3I5R A;  2RNA A;  1GBQ A;  4QKU A;  4KGZ B;  3Q1J A;  3H8Z A;  2QQR A;  3CCL T;  2PQW A;  3CD6 A;  4KUI A;  3QBY A;  5LJ5 h;  3EGX A;  2OI3 A;  1WJR A;  1AZG B;  2OTL A;  2DIQ A;  2BE7 D;  1R0C B;  1KSW A;  2O4X B;  5IHI A;  4GY5 A;  2FYK A;  3QWY A;  3WVD B;  2EQI A;  2MMP A;  1D0X A;  4RTZ A;  4JZ3 A;  1K9M U;  4CC3 A;  5FLX E;  1CKB A;  3CCV T;  1M90 C;  4CC2 A;  4JLI A;  3MP6 A;  3URG A;  4E2F B;  2KK4 A;  4M7D F;  1Q81 R;  2CUD A;  2DZ9 A;  3H0F A;  3VU3 C;  1JJ2 P;  4LN2 A;  2O88 A;  2V8K A;  2RI3 A;  1YI2 T;  4IUR A;  2VAS A;  4C8Q C;  3PVQ A;  3BW1 A;  5DM7 R;  3EFR A;  2L3P A;  3QXE B;  2YRC A;  2OJ2 A;  1X27 A;  3G4S A;  1VQ4 Q;  1WQW A;  1Q95 G;  2KMT A;  4M7A D;  1UE9 A;  1C6V X;  3NTH A;  2EQU A;  3MET A;  4M78 A;  1N8R R;  3I9Q A;  2QI2 A;  3X26 B;  1K8A U;  2EQM A;  2DER A;  2EAY A;  1NPP A;  1VOM A;  3CCR T;  2QGG A;  3AHU A;  4E7J A;  4Y92 A;  1RAI B;  1RUW A;  2PVD B;  3UWN A;  4IUP A;  1QWE A;  2EWN A;  4MZM A;  3M54 A;  4BUG A;  1YJW Q;  1YIT T;  4OB2 B;  2AZV A;  1ZLM A;  2NUT B;  1QMC A;  3A5Z B;  1H92 A;  3THK A;  2GF7 A;  3MEW A;  2EJF A;  5CVI A;  3BFM A;  5GAO n;  1ZUY A;  2GQI A;  5KYW B;  3S3N A;  2QA4 A;  1PRM C;  2LQ8 A;  2E5Q A;  2YLB A;  4OGC A;  3QG1 A;  1M1G A;  2ZPF B;  5J3B A;  5FWB A;  5AT1 B;  3D7S B;  1I5O B;  2AKL A;  4EMK B;  2RHI A;  2AZS A;  3OYG A;  5GMK l;  1VQ7 A;  3J7A F;  2D9T A;  2EIF A;  1VQ5 A;  1RLP C;  3JCM c;  3ME9 A;  1MGQ A;  1Q82 R;  1HXD A;  5GMK e;  3SB2 A;  3M0Q A;  3QII A;  2K2V A;  1GFD A;  4JDS A;  1RAB B;  3CMA T;  1M2V B;  1B3Q A;  2HQX A;  4PJO D;  2YHT A;  1K1Z A;  3VS6 A;  2FHD A;  2BE9 B;  5CIU A;  4E6R A;  1YIT A;  1LCK A;  2KXD A;  2O9V A;  3P8D A;  2HL5 C;  2OAW A;  1KHC A;  3TVT A;  2YT6 A;  1MMG A;  1GCP A;  3A8L B;  4FYV B;  4JRI A;  2EQK A;  2E41 A;  4J9I A;  5J26 A;  1QP2 A;  3PIP A;  3I35 A;  3M58 A;  4XTV A;  1KHI A;  2K5L A;  1SHF A;  1X75 C;  2EPD A;  2MWO A;  3LGL A;  2J6O A;  5C0M A;  2MK5 A;  3CCE T;  2P4T A;  2X4X A;  3V8J A;  3AT1 B;  1MV0 B;  4KBM B;  4JJN K;  4M77 D;  1VQ8 T;  2JNG A;  1GCQ A;  2OAU A;  1KC8 R;  2K5F A;  7AT1 B;  1XJW B;  2KVQ G;  3I5S A;  3OYJ A;  2EJ9 A;  2V8I A;  2DTO A;  2RK1 A;  5KE3 A;  3EG2 A;  3L2Q A;  1JBM A;  4EMK A;  1PCX A;  5IAY A;  3GPL A;  4AT1 B;  1AWO A;  1WPY A;  2Y90 A;  3CPW P;  2LRQ A;  3CPW S;  1Q81 U;  1KFZ A;  3LX7 A;  2I2L A;  1AWJ A;  4ZNX A;  1AT1 B;  1D1C A;  3JCM b;  2ENM A;  5IXB A;  2M0Y A;  3I56 Q;  1A0N B;  5KYU A;  4OMO A;  1G3W A;  4OMM A;  4ZGD B;  3FDR A;  1VQ9 T;  2QTX A;  2RK2 A;  1QW1 A;  3VS7 A;  2KDS A;  2JN0 A;  3NGP A;  5GAN 3;  3JV3 A;  1N5Z A;  2EJG A;  4FYX B;  3CCS T;  3VKI A;  1Q81 C;  3FC3 A;  4M77 A;  4ZGE B;  1MHN A;  3GBQ A;  3JRZ A;  1UGV A;  4C5G A;  1JXO A;  4JRK A;  3A8O B;  2L3S A;  1KD1 U;  1E7O A;  1YI2 Q;  4PK4 A;  4MML A;  2HSE B;  1I5L A;  4J83 A;  3MPU B;  4JJC A;  1JXM A;  2CYZ B;  1UB4 A;  3QYG B;  4FW2 A;  2KBT A;  1AVZ C;  3HTR A;  4D8K A;  5GAN g;  3CCQ Q;  4LD9 K;  3CD6 T;  3CC7 Q;  3ULR B;  1IHW A;  3E1S A;  3DLM A;  3CCQ T;  1M3A A;  4QVC A;  1SSF A;  1KQS P;  1ZSZ B;  4M7D C;  3UT1 A;  3OS1 A;  3GP8 A;  2C0T A;  1VQM T;  2ZPI B;  3CCL A;  2P0K A;  1OQK A;  2VV5 A;  4BDZ A;  4FIB A;  1OEB A;  1SG5 A;  2NUZ A;  4JJB A;  1TUG B;  5GMK h;  2P0P A;  1IB8 A;  2DO3 A;  1OX8 A;  1HYO A;  2YDL A;  1YJ9 A;  1VQN T;  4KRT A;  2ZCF B;  3EH1 A;  2E6Z A;  3MEV A;  3HL8 A;  5CQX A;  3M5A A;  4DOW A;  5FU7 B;  2KT1 A;  1M2O A;  4KT0 E;  1YIJ A;  2RB6 A;  1VQ9 Q;  3DLL A;  4EMG A;  3JCM e;  3CME Q;  2CUB A;  5I11 A;  1Q86 R;  3RNJ A;  1U06 A;  5FW9 A;  4N4I A;  1D1A A;  1TWB A;  4ZTJ A;  2X3W D;  1YWP A;  3RBB B;  4OP0 A;  2KRM A;  1IHV A;  2M0O A;  3IQL A;  4X34 A;  2K57 A;  1K73 R;  4M77 F;  4Y28 E;  1YI2 A;  2K5I A;  2JZ2 A;  2FPE A;  2KR3 A;  2JT4 A;  4AG1 C;  1FMW A;  5IHK A;  1RAD B;  5LJ5 e;  2M02 A;  2MCN A;  4V2S A;  1NEG A;  1MMD A;  3G4S T;  4RTY A;  2YRV A;  1R8O B;  3RMQ A;  3PNW C;  2QK0 A;  3MCA B;  3OMC A;  2ZGW A;  1LOJ A;  5GAM d;  3MP8 A;  2XMF A;  2QQS A;  3QWX X;  2K3Y A;  5CQY A;  1NEB A;  4FM4 B;  1BBZ A;  4E7L A;  2O2O A;  1T0H A;  1JRI A;  1WX6 A;  2LT4 A;  4HKE A;  5M9O A;  3EG9 A;  2J05 A;  3C12 A;  3OSS C;  2QQB A;  3MJX A;  2O9S A;  1VQK Q;  3CBM A;  2HCK A;  1PD0 A;  4MZT A;  2RI5 A;  1QLY A;  5CO7 A;  1IRX A;  3HRU A;  5D6Y A;  3CMA Q;  1JJ2 S;  2CS7 A;  4P5N A;  3S3O A;  3QZ9 B;  5GMK j;  3MKD A;  4RG2 A;  2R5A A;  2M1H A;  1QCF A;  4DBQ A;  3QDF A;  2VGM A;  2E12 A;  2L3Q A;  1M4Z A;  5J39 A;  2CH4 W;  4QQD A;  3FRN A;  2Y4Y A;  5GMK i;  3CCJ Q;  1K9M C;  4J9G A;  1D3B A;  4EMH A;  3EG0 A;  3HRS A;  2FB7 A;  3OW2 P;  2YUO A;  5EG2 A;  4RKU E;  2KRN A;  1NJI R;  1G3S A;  5FU6 B;  2LNH B;  2ROL A;  1XQH A;  3EGD B;  1TG0 A;  2RQR A;  2SEM A;  2MYS A;  3TSZ A;  1D0Z A;  1M3C A;  4JLG A;  5A0L A;  5D6X A;  2ZAE A;  2M16 A;  3PVL A;  4FYY B;  1M27 C;  3OY9 A;  2HMA A;  1PM3 A;  1VQ5 T;  2RH2 A;  3VV0 A;  3VS5 A;  4N4G A;  3M0U A;  1QVP A;  1X43 A;  3UPU A;  5GAO r;  4A53 A;  2L3R A;  3M4G A;  1ZQ1 A;  2LCC A;  4BY6 B;  2X51 A;  1PHT A;  4F7U A;  2I0N A;  1QQJ A;  2CP5 A;  1VUB A;  3HRT A;  4R0K A;  3CC2 T;  1K4U S;  1X2Q A;  4E7I A;  4MDX A;  3RIR A;  1HSQ A;  2K2M A;  3ER0 A;  5GAN 5;  2R57 A;  4E47 A;  4HVU A;  2RJC A;  2QA4 Q;  1WXT A;  3ASK A;  1LVK A;  4RG8 A;  2RJF A;  1ZHI A;  1ZUU A;  3QYH B;  4C92 B;  3CPF A;  2A08 A;  2GCX A;  1AEY A;  3JCM V;  1VQ4 T;  3OS5 A;  3PFS A;  5LJ5 d;  1UGS B;  1QKX A;  4M77 C;  1IGU A;  3OYL A;  3JCM f;  4FCY A;  1WHL A;  2ATC B;  4EMK C;  3NMZ C;  1VQ5 Q;  1IGQ A;  1FMV A;  5GAN e;  1KD1 C;  4A4E A;  4XU2 A;  1M5Q 1;  4FSX A;  5HK3 A;  5KYY B;  4N0A A;  4RTV A;  3OYN A;  4J8O A;  3SWN B;  2P4R A;  4A63 B;  4R56 A;  3HSB A;  4LDV A;  3C4S A;  4FW1 A;  4BE0 A;  4XTZ A;  4M7A G;  4M75 D;  4HVV A;  1Y0M A;  2K4Y A;  2WSC E;  1FX7 A;  1YBY A;  1M30 A;  2YUQ A;  4XAX B;  5I2M A;  3A8H B;  4D8D A;  2J7I A;  1FXX A;  3RKY A;  3TEE A;  5FRN A;  6AT1 B;  2BZ8 A;  5IHN A;  1WA7 A;  2E5K A;  1VQ6 Q;  3V7R A;  1Y96 A;  2E4H A;  5LJ3 f;  3UAT A;  2RQU A;  1VYT A;  1YCS B;  3HKS A;  5L8R E;  3OYC A;  2EQJ A;  3SD4 A;  1WGS A;  1NLO C;  1BI0 A;  1ZSG A;  3M0P A;  4FL6 A;  1K9A A;  3LLR A;  4XK8 E;  2LQK A;  3NFC A;  4M78 E;  2L8D A;  1N9S A;  2IPO B;  5GAN h;  1VQK T;  3TRE A;  4BAC A;  3VUZ A;  2A3L A;  1D0Y A;  3OA6 A;  2L89 A;  1J3T A;  1ZSZ A;  4IUV A;  4AFZ C;  3UA7 A;  3EG3 A;  2FZC B;  3G71 A;  3CXC P;  1OU8 A;  1Y57 A;  2RPN A;  4PJO A;  1VYV A;  3P8H A;  2RN8 A;  4WCI A;  3L2R A;  1PKT A;  3HFO A;  1TSF A;  1PG5 B;  2B86 A;  2BZX A;  5DY9 A;  5IN1 A;  1UJ0 A;  1N8R U;  1TS9 A;  1G5V A;  4ZTF A;  3CCV A;  1YHQ T;  1QVG P;  1VQ7 Q;  2DL8 A;  1ABO A;  3OYK A;  3DB3 A;  2ROT A;  3CCQ A;  1OYX A;  1PSF A;  5FRM A;  4LXC A;  3CMA A;  2DJZ A;  1UDL A;  5LJ3 g;  3EGX B;  3OYY A;  4XQ3 A;  4OB3 B;  1QCN A;  1BB9 A;  4X9D A;  2GGR A;  1SF9 A;  2EGC A;  3V7S A;  2DEQ A;  1D3B B;  2R58 A;  2DPP B;  4F14 A;  3G71 Q;  1BKB A;  3ZBD A;  1VQP A;  3TQ7 P;  1PKS A;  1UTI A;  1RAF B;  1YJ9 T;  1GBR A;  1SKU B;  5LJ5 g;  1M2V A;  2HSP A;  2EGE A;  4J9B A;  5KH6 A;  2DVJ A;  3LYI A;  2YLC A;  1AWX A;  1K9M R;  1X6G A;  1UGR B;  2DL4 A;  1XOV A;  4M75 G;  4CI0 C;  3CCR A;  2JUF A;  3OB9 A;  1VIF A;  5GAN 6;  4NL2 A;  5A0G A;  2DRK A;  2LX9 A;  4WTO B;  4MZP A;  2XIC A;  1QWF A;  4GLM A;  4M7D B;  5HK0 A;  1MMA A;  2DX1 A;  2G3R A;  3M0R A;  1VQ9 A;  4C92 F;  1TU0 B;  2HBW A;  1RAH B;  1W2B A;  1I4K 1;  3WVE B;  3G6E Q;  3BE3 A;  2RMO A;  4OMN A;  1T0J A;  2CT4 A;  4Z02 A;  2CSQ A;  4B6M A;  4C0D B;  3MP1 A;  1RAG B;  1W70 A;  4OB1 B;  2LP5 A;  2KY9 A;  3CC4 Q;  2OTL T;  5GAN f;  1PD1 A;  3EHR A;  1G83 A;  4C5H A;  1B7T A;  3QHS A;  1YJN T;  4CRI A;  3OYM A;  1F1B B;  2AKK A;  4LD6 A;  4L59 A;  2CZ6 B;  4F17 A;  4RTW A;  1GFC A;  3M9Q A;  1EZZ B;  1WJS A;  1VQO T;  3CC4 A;  2RD1 A;  3A1P A;  2QEX T;  1QVG A;  3EHQ A;  1Q7Y R;  4L6V 5;  2J6F A;  2CP6 A;  3OQ5 A;  4M7A E;  3SWN A;  3G6E A;  4AFU C;  4RCB A;  2WSE E;  1Q86 C;  4QQ6 A;  1RI9 A;  2KXC A;  2X4W A;  3QDR B;  1WJQ A;  2K6D A;  3CC4 T;  1VQO A;  2MIO A;  1HJD A;  1SSH A;  2HEQ A;  4HVW A;  2BUD A;  4M7D A;  4C5I A;  3SHW A;  1SEM A;  1WHM A;  3V7C A;  1M1K R;  2M51 A;  4J6Y A;  4E7H A;  3H41 A;  3MHX A;  2B8A A;  1SRM A;  2LMJ A;  2HAX A;  2PTK A;  1MNE A;  2DAQ A;  2LC4 A;  2AT1 B;  2QAZ A;  1K8A R;  3HHT B;  1D09 B;  1MMN A;  2M9U A;  4OMF B;  5GAO l;  2CSI A;  1BIA A;  4M7A C;  3S6W A;  3X28 B;  1OZ2 A;  1NJI C;  2EKH A;  1FYN A;  2RM4 A;  3SEM A;  1EX4 A;  4IIM A;  3M4Y A;  2K7A A;  2F2X A;  1BIB A;  2C0I A;  5D6W A;  4FYW B;  4M7A F;  4LUD A;  1Z9Q A;  3CXC A;  2RQT A;  2FZK B;  1VQ8 A;  3CCU Q;  1TUC A;  4ATO A;  4PLI A;  3J80 E;  4C0G A;  3UF4 A;  3OBW A;  2KGT A;  4DEX A;  4JUV A;  1X2K A;  3MEU A;  3VUB A;  4MMK A;  1M1K C;  2JTE A;  4LDX A;  2A36 A;  3CBP A;  1BI2 A;  1YJ9 Q;  1Y07 A;  1KC8 C;  4M75 C;  4LNP A;  3G1J A;  3VJP A;  1VQP Q;  3X24 B;  1H3H A;  4J9F A;  1MUZ A;  3RDV A;  3JCM g;  4ZN1 A;  1O9S A;  2KQW A;  2X9H A;  4J6X A;  3A8M B;  1MND A;  2BTT A;  2LQW A;  4F7U F;  2C0O A;  3PTA A;  1U1T A;  2JOY A;  4C8Q E;  1I81 A;  2DXU A;  2LDM A;  2ZPG B;  1JJ2 A;  1KIK A;  4CC4 B;  3CCU A;  2K3B A;  3WXM B;  1PNJ A;  1SPK A;  2DMO A;  1O75 A;  2EYW A;  1RAA B;  1YHQ Q;  5CKE A;  1LPL A;  3KBG A;  1N8R C;  3GNG A;  2A37 A;  4KH0 B;  3CCM Q;  1OZ3 A;  2V1Q A;  2JMC A;  1Q7Y U;  4FSS A;  2NUP B;  2HD0 A;  3VYG A;  5A0D A;  4PJL A;  2XU8 A;  2LQN A;  5CK9 A;  1YWO A;  1G3T A;  1VQK A;  2VGN A;  3H0I A;  1IXD A;  3MO8 A;  4M78 D;  3CC7 A;  4J6W A;  1Q86 U;  4LDW A;  4DBH A;  5GAM h;  1KQ2 A;  4O5V A;  3OYB A;  4D6W A;  4LUE A;  1RAE B;  3JB9 J;  3UA6 A;  4PJO E;  4IUT A;  4M7D E;  1YIT Q;  1PRL C;  3BY7 A;  3CCM T;  1M90 U;  2FRY A;  3OYD A;  2HQH A;  4PJM A;  5GJW B;  1X6O A;  4Z88 A;  4PJJ A;  1YFN A;  4QVZ A;  1M1F A;  2OTJ T;  2IVW A;  3L42 A;  4PFZ A;  4F7U G;  1WHG A;  4FT2 A;  4RTX A;  3JCM Q;  5KYX A;  3RER A;  2DL7 A;  3FB9 A;  4AFS C;  1NBE B;  2DIG A;  1YP5 A;  2NWM A;  2DVE A;  2NYS A;  3LH0 A;  5CKF A;  1IO6 A;  2DNU A;  4M77 E;  3OW2 S;  4PNO A;  3X25 B;  2LJ3 A;  5KYY A;  2QDL A;  2H8H A;  2LVM A;  1K8A C;  1G8X A;  2FL7 A;  2VVK A;  1VQP T;  3VYH B;  1B07 A;  1C1A A;  1BI3 A;  1XTD A;  2VKN A;  2DIL A;  1ARK A;  4PJO B;  1CSK A;  2E70 A;  2DZC A;  2D0Q B;  3TCJ A;  2LX7 A;  3O5Z A;  4C0F A;  2EYQ A;  1YN8 A;  4M7A B;  1IZ6 A;  3OS0 A;  3OYF A;  4A4F A;  1KJW A;  3LWI A;  3TSW A;  3L2W A;  4QW2 A;  2FPF A;  3REB B;  4DOV A;  3CCV Q;  2KEA A;  2HKN A;  2ZPB B;  1OV3 A;  1Q7Y C;  1C0M A;  2RA2 A;  2XHC A;  5D7U A;  5CCA A;  2COY A;  5CR2 A;  4A4G A;  2DBM A;  2E3H A;  2HDA A;  2XKO C;  4M77 B;  3REA B;  4JPB W;  4DBF A;  1OU9 A;  1T3L A;  2O01 E;  2D8H A;  1Y7X A;  2DKG A;  4M78 F;  5GAM j;  3CC2 Q;  1AD5 A;  2YUP A;  5KYX B;  1AWW A;  3VS1 A;  3FIF A;  5CKB A;  2QEX Q;  2EYX A;  4XU3 A;  4KUL A;  2AIR B;  4RTT A;  1VQO Q;  2PU9 B;  1BYM A;  3C0C A;  2D6F A;  4A4H A;  1YJN Q;  3LWH A;  3ZFJ A;  4EDU A;  4M78 B;  1HK9 A;  2F2V A;  5GAN 2;  3JB9 G;  2ESW A;  2OTL Q;  1EIF A;  2MF2 A;  4BY6 C;  1TH7 A;  2DL5 A;  4RUG A;  2VXF A;  1UEB A;  3M59 A;  4B9X A;  2XG8 D;  2ZZD A;  3J81 E;  3G6E T;  3LW5 E;  1V1C A;  2JM8 A;  4C8Q A;  3JCM X;  2E6N A;  3EG1 A;  4HCB A;  3M0S A;  1KQ1 A;  3H9N A;  3I55 A;  2DL3 A;  3JCM W;  2P0Q A;  3QJ6 A;  3OYI A;  3L2V A;  1Z9Z A;  2F2W A;  1NJI U;  4IKF A;  2A0F B;  2VB6 A;  3PMT A;  4KGV B;  3N5B B;  2ED0 A;  1YJN A;  2XD0 A;  4HA8 A;  5CKH A;  2AK5 A;  3EH2 A;  2DM1 A;  2EW3 A;  4M4Z A;  1ZA1 B;  2CDT A;  5GAM e;  2EYY A;  2E3I A;  2JM9 A;  2LCS A;  3R6N A;  1TXQ A;  2GFU A;  1WI7 A;  3H6Z A;  1NE8 A;  2QEX A;  5GAN 8;  4N4H A;  4C92 E;  1YJW A;  2JTF A;  2KT8 A;  1WHH A;  5A2Q E;  2P84 A;  3RES A;  2CZ7 B;  3JB9 H;  3OSV A;  4J5Y A;  4AFQ C;  2EVR A;  2LT1 A;  1UUE A; 
#chains in the Genus database with same CATH homology
 3JV3 A;  1N5Z A;  4GBQ A;  2IIM A;  1I07 A;  2DRK A;  1W6X A;  3GBQ A;  1M3B A;  1UGV A;  2GBQ A;  1EFN A;  2ED1 A;  2DLP A;  1JXO A;  4OML A;  4CC7 A;  2J06 A;  1QWF A;  2O31 A;  4GLM A;  2L3S A;  4Z89 A;  4EIK A;  1E7O A;  2DX1 A;  3M0R A;  4JJC A;  1JXM A;  2HBW A;  5I22 A;  3A98 A;  2KBT A;  1AVZ C;  2PNI A;  3LH5 A;  4D8K A;  2RMO A;  4OMN A;  1T0J A;  3M0T A;  2CT4 A;  3ULR B;  2CSQ A;  1M3A A;  1W70 A;  2KRS A;  2D0N A;  2LP5 A;  2V1R A;  2C0T A;  1BK2 A;  1NG2 A;  2RQW A;  2JS2 A;  3EHR A;  1G83 A;  1YNZ A;  4Z8A A;  2AKK A;  2LZ6 B;  4J9E A;  4AG2 C;  4F16 A;  1JU5 C;  1OEB A;  4F17 A;  4RTW A;  2NUZ A;  4JJB A;  1UHC A;  1GFC A;  3EGU A;  2DYB A;  1FMK A;  1I0C A;  4J9C A;  2YDL A;  1JO8 A;  5L23 A;  4KRT A;  4JJD A;  2W10 A;  2KRO A;  5IXF A;  3VRY A;  2VWF A;  3EHQ A;  2BZY A;  2J6F A;  1U3O A;  1NYF A;  2KT1 A;  1E6G A;  3VS4 A;  4AFU C;  3KFV A;  1JQQ A;  2L2P A;  2CUB A;  5I11 A;  1JEG A;  3PE0 A;  1RI9 A;  2KXC A;  1U06 A;  4JZ4 A;  3RNJ A;  5FW9 A;  2X3X D;  5GJV B;  2X3W D;  1PWT A;  1WDX A;  1NLP C;  1YWP A;  2EGA A;  1OPK A;  2K6D A;  2FPD A;  3RBB B;  2MIO A;  1HJD A;  1SSH A;  2HEQ A;  4HVW A;  5EC7 A;  2KYB A;  2KRM A;  3SHW A;  1SEM A;  4OMQ A;  1TUD A;  1H8K A;  2FEI A;  2M51 A;  2KE9 A;  3IQL A;  1WYX A;  2FPE A;  2DA9 A;  2KYM A;  1NM7 A;  2KR3 A;  2JT4 A;  1UJY A;  3H41 A;  4AG1 C;  1SRM A;  2LMJ A;  5IHK A;  2PTK A;  2MCN A;  2GNC A;  1NEG A;  2DJQ A;  1K0S A;  2LJ0 A;  4RTY A;  2CSI A;  4J9H A;  1AOJ A;  1U5S A;  2D8J A;  3VS3 A;  2EKH A;  1FYN A;  3SEM A;  4IIM A;  2K7A A;  1W1F A;  2EBP A;  2F2X A;  2FO0 A;  2JW4 A;  2C0I A;  2XMF A;  4LUD A;  1Z9Q A;  3CQT A;  4DEY A;  2CT3 A;  3QWX X;  2RF0 A;  2RQT A;  2K9G A;  1WLP B;  1ZX6 A;  1TUC A;  1WIE A;  1NEB A;  1BBZ A;  3UF4 A;  1VA7 A;  2KGT A;  3FJ5 A;  4DEX A;  2O2O A;  1T0H A;  1WX6 A;  1X2K A;  2CH4 A;  3NPF A;  2J6K A;  2JTE A;  4IIO A;  2A36 A;  1SHG A;  2J05 A;  3NHN A;  2G6F X;  2D1X A;  2FG0 A;  1GRI A;  2O9S A;  1UEC A;  3I5R A;  2HCK A;  2RNA A;  1GBQ A;  4LNP A;  1H3H A;  1QLY A;  4J9F A;  1MUZ A;  1G2B A;  3VS0 A;  1QCF A;  2BTT A;  2LQW A;  2OI3 A;  2C0O A;  2L3Q A;  2LJ1 A;  1AZG B;  2CH4 W;  1KIK A;  1UG1 A;  4CC4 B;  1KSW A;  5IHI A;  2K3B A;  4J9G A;  2FRW A;  1UFF A;  1PNJ A;  1SPK A;  2DMO A;  2EYW A;  3QWY A;  1OPL A;  3EG0 A;  2DE0 X;  1S1N A;  2EQI A;  4RTZ A;  4JZ3 A;  2YUO A;  2KRN A;  4CC3 A;  2A37 A;  1CKB A;  2LNH B;  2ROL A;  4QT7 A;  2JS0 A;  4HXJ A;  2V1Q A;  2W0Z A;  4CC2 A;  1TG0 A;  5ECA A;  2JMC A;  2ABL A;  2RQR A;  2SEM A;  4FSS A;  3TSZ A;  2PZ1 A;  1WXB A;  2CUD A;  1M3C A;  1SRL A;  2LQN A;  3H0F A;  1GCQ C;  2SRC A;  2JXB A;  3PVL A;  1YWO A;  4LN2 A;  2O88 A;  3H0I A;  1M27 C;  2DF6 A;  3PVQ A;  2L3P A;  4LUE A;  3M0U A;  1X43 A;  3VS5 A;  2JMA A;  2OJ2 A;  2GTO A;  1X27 A;  3UA6 A;  1UE9 A;  1PHT A;  1MV3 A;  2I0N A;  2A28 A;  1PRL C;  2FRY A;  4R0K A;  1K4U S;  5GJW B;  1X2Q A;  4Z88 A;  3I9Q A;  1HSQ A;  2K2M A;  2DBK A;  4RTX A;  1X6B A;  1X69 A;  2RQV A;  2DL7 A;  4HVU A;  4Y92 A;  2CRE A;  1WXT A;  4ORZ A;  4AFS C;  1RUW A;  1YP5 A;  2EYZ A;  2NWM A;  1ZUU A;  1QWE A;  1RLQ C;  1IO6 A;  2DNU A;  4K11 A;  2K79 A;  2A08 A;  4J9D A;  2LJ3 A;  1AEY A;  2AZV A;  2GTJ A;  1ZLM A;  2QDL A;  1E6H A;  2H8H A;  1QKX A;  2VVK A;  1M8M A;  1B07 A;  2VKN A;  1OOT A;  2DIL A;  3NMZ C;  4ESR A;  1ARK A;  1H92 A;  4LE9 A;  3THK A;  1CSK A;  2LX7 A;  4RTV A;  3O5Z A;  1UHF A;  2P4R A;  4A63 B;  1YN8 A;  1ZUY A;  2GQI A;  1I1J A;  1KJW A;  1WFW A;  3TSW A;  4HVV A;  1Y0M A;  4OMP A;  1PRM C;  1HD3 A;  1M30 A;  2FPF A;  3REB B;  2YUQ A;  4D8D A;  2J7I A;  3U23 A;  2KEA A;  2BZ8 A;  5IHN A;  1WA7 A;  1OV3 A;  5FWB A;  2KNB B;  2YSQ A;  2AKL A;  2DBM A;  2E5K A;  1ZBJ A;  2AZS A;  2L0A A;  2HDA A;  3UAT A;  3REA B;  1ZUK A;  1VYU A;  1RLP C;  4JPB W;  1T3L A;  2D8H A;  1CKA A;  1K76 A;  2DRM A;  2RQU A;  3M0Q A;  1VYT A;  1YCS B;  1AD5 A;  2YUP A;  1AWW A;  1GFD A;  3VS1 A;  2EYX A;  1NLO C;  3M0P A;  1ZSG A;  3NGP A;  4RTT A;  1B3Q A;  1K1Z A;  1K9A A;  3C0C A;  3VS6 A;  4E6R A;  3H0H A;  1LCK A;  2KXD A;  2O9V A;  2OAW A;  3TVT A;  2YT6 A;  1GCP A;  1J3T A;  2F2V A;  4AFZ C;  2ESW A;  3UA7 A;  3EG3 A;  1Y57 A;  4J9I A;  2RPN A;  3I35 A;  1VYV A;  2RN8 A;  2DL5 A;  1NYG A;  4RUG A;  4WCI A;  3VRZ A;  1ABQ A;  1SHF A;  2EPD A;  1PKT A;  2B86 A;  2J6O A;  2BZX A;  1UJ0 A;  1V1C A;  5IH2 A;  2JM8 A;  3EG1 A;  1MV0 B;  3M0S A;  1K0X A;  2DL8 A;  1ABO A;  1AZE A;  1GCQ A;  4RTU A;  2DL3 A;  2ROT A;  2MOX A;  3I5S A;  1UDL A;  5HCK A;  1WXU A;  4X1V A;  1Z9Z A;  3EG2 A;  2F2W A;  1BB9 A;  2ED0 A;  2GGR A;  2EGC A;  2AK5 A;  1AWO A;  2DM1 A;  2EW3 A;  1KFZ A;  4M4Z A;  1AWJ A;  4ZNX A;  2CDT A;  4F14 A;  2ENM A;  2EYY A;  2JM9 A;  2LCS A;  1BU1 A;  3R6N A;  1WI7 A;  5IXB A;  1PKS A;  2M0Y A;  5FWC A;  1UTI A;  1A0N B;  2YUN A;  4OMO A;  4HCK A;  1T3S A;  1GBR A;  4OMM A;  2KT8 A;  2HSP A;  1GL5 A;  2EGE A;  4J9B A;  2DVJ A;  2ECZ A;  3VS7 A;  1AWX A;  3VS2 A;  1X6G A;  4AFQ C;  2EVR A;  2DL4 A;  3ZL7 C;  1XOV A;  1UUE A;  1QKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...