2K3BA

Seeing the invisible: structures of excited protein states by relaxation dispersion nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-binding protein
molecule tags Structural protein
source organism Saccharomyces cerevisiae
publication title Structures of invisible, excited protein states by relaxation dispersion NMR spectroscopy
pubmed doi rcsb
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k3bA00
4HVUA 1UTIA 1W6XA 1GBRA 4HVWA 2L3PA 1M27C 1NLPC 1WLPB 1ZUKA 1Y57A 3VS5A 2YUNA 1JXOA 2JW4A 2A28A 2DBMA 1MUZA 1RUWA 5FWBA 1M3CA 3REAB 1PRMC 2FRYA 3NMZC 1AWOA 1TUDA 4JZ4A 2HSPA 1VYUA 1OEBA 2EKHA 3JV3A 1YN8A 5IXFA 1WYXA 2MCNA 5IHIA 1E6HA 1Y0MA 3H0IA 1UJ0A 1G83A 1UECA 2K2MA 5IHNA 1U06A 3H0FA 2RPNA 1AWJA 3EG1A 3I9QA 1K0SA 2HCKA 1J3TA 4AG1C 2CT3A 3R6NA 2MOXA 4AFQC 2O9VA 1QLYA 2P4RA 2KT1A 2DBKA 4DEXA 1JU5C 4AFSC 2JMAA 2YUOA 1K1ZA 5I22A 4Z88A 2AZVA 1K0XA 1PRLC 2J6FA 1X2QA 4LN2A 3THKA 2DL5A 2CH4W 2C0TA 3EG0A 1SHGA 1RLQC 2JMCA 1NEBA 1NYGA 2F2VA 4AFUC 1YCSB 1YNZA 3TVTA 1GFCA 2FRWA 2ED1A 1WXBA 5IH2A 1JO8A 4OMQA 2O88A 1V1CA 2HDAA 1NM7A 3TSZA 1GL5A 2ABLA 4RTZA 4X1VA 2J6KA 4RTYA 2AKLA 5HCKA 1MV0B 1I0CA 5GJWB 4JJCA 1ZLMA 1HJDA 1WXTA 2I0NA 2DL8A 1ABQA 2JS2A 1W1FA 2LJ1A 2DMOA 1CKAA 2GGRA 2KT8A 4OMPA 2C0OA 2M0YA 1UFFA 1AD5A 2KXCA 3C0CA 2NWMA 1EFNA 2FPFA 1U5SA 1XOVA 3EG3A 2LZ6B 1MV3A 2PZ1A 2K7AA 1E7OA 2V1QA 5FWCA 1PKTA 4OMLA 3REBB 2DYBA 1K76A 2CDTA 2CREA 1AEYA 1IO6A 2EYYA 3I35A 3M0PA 2F2XA 5IHKA 1VA7A 4K11A 2B86A 1WDXA 2AZSA 2DL3A 4J9DA 1GRIA 1RLPC 3VS2A 3ULRB 1UHCA 4GLMA 1RI9A 4A63B 3VS1A 1FMKA 4RTWA 2JS0A 4J9BA 2BTTA 1JQQA 1BB9A 1T3LA 2D8JA 2LX7A 2ROTA 2E5KA 1SRMA 1ARKA 1OOTA 3NPFA 1WXUA 4EIKA 4E6RA 4IIMA 1PNJA 4F17A 3PE0A 3TSWA 5EC7A 1ZSGA 1VYTA 2C0IA 1UE9A 1U3OA 4J9HA 2RQWA 1NG2A 4IIOA 3M0TA 2BZYA 5FW9A 1AWXA 2JXBA 2W0ZA 2X3WD 2DF6A 2RQVA 2D1XA 2W10A 2EYWA 2DILA 3I5RA 2VWFA 3QWXX 2F2WA 1X2KA 1M8MA 2ENMA 2LP5A 1WFWA 2DRKA 1ABOA 3CQTA 1M3BA 1NEGA 1S1NA 2QDLA 1WIEA 2FO0A 4HVVA 2DX1A 3VS6A 3SEMA 2FPEA 3IQLA 2RNAA 2CUDA 1SSHA 1KJWA 3H0HA 1WA7A 3M0SA 2RMOA 1VYVA 2RN8A 4Z89A 2DLPA 3U23A 1QCFA 1NLOC 2A08A 2KXDA 2AK5A 2LNHB 2KRMA 3QWYA 4F14A 1AOJA 1N5ZA 4J9IA 4FSSA 1Z9ZA 3LH5A 4J9EA 1WX6A 1B3QA 2L2PA 4AFZC 1GBQA 1GCQC 4R0KA 2LJ3A 1SHFA 4JJDA 4LNPA 2DJQA 1T0JA 1ZUUA 1ZBJA 2JM9A 4HCKA 5GJVB 1KIKA 1ZUYA 2GBQA 3M0QA 3VRZA 2EQIA 4CC2A 2JTEA 2GTJA 2MIOA 4RTUA 2OJ2A 2EVRA 1YP5A 3EGUA 2EYXA 2K9GA 2DVJA 2PNIA 4AG2C 5IXBA 3I5SA 2LQNA 1TG0A 2FEIA 1H8KA 2SRCA 2KEAA 4Y92A 2J7IA 2O31A 2VVKA 2DM1A 1UG1A 2IIMA 3ZL7C 1T3SA 1H3HA 1CKBA 3VS7A 2KRSA 1QWEA 2O9SA 2DRMA 2EGEA 4D8DA 2YSQA 2KBTA 5ECAA 2DL7A 3H41A 1AVZC 2VKNA 1X69A 3FJ5A 1HD3A 2CT4A 2KRNA 3EHRA 2LJ0A 2M51A 1M3AA 2SEMA 1YWOA 2A37A 4QT7A 4Z8AA 3PVLA 1G2BA 3VS3A 4JPBW 1ZX6A 2KR3A 4WCIA 2KROA 3SHWA 3KFVA 1X27A 2L3QA 2KYBA 3O5ZA 4F16A 3A98A 4OMOA 1UJYA 1JEGA 4RTXA 2EGCA 4RTVA 3VRYA 4JZ3A 1OPKA 1NYFA 1OPLA 2H8HA 2BZXA 4GBQA 2YUQA 4ESRA 4J9GA 2ROLA 1OV3A 2X3XD 2EW3A 1QKWA 1B07A 2RQTA 3VS4A 2V1RA 2DNUA 1K9AA 3NGPA 3PVQA 2XMFA 2CSIA 2LMJA 1K4US 1JXMA 4OMMA 4LE9A 2OAWA 1AWWA 1BBZA 1H92A 2KYMA 2KE9A 1I07A 1SRLA 1KFZA 2FG0A 1E6GA 4DEYA 2A36A 1UHFA 1PHTA 2D8HA 2RQUA 1Z9QA 2EGAA 2L0AA 2ESWA 4D8KA 2JM8A 3UATA 5I11A 1HSQA 1UGVA 2RF0A 2HEQA 2NUZA 3RNJA 2YDLA 4KRTA 4RUGA 4RTTA 2YT6A 2HBWA 1GFDA 2GTOA 1GCQA 2AKKA 2LQWA 4HXJA 1T0HA 5L23A 1GCPA 1X43A 4CC7A 1A0NB 2BZ8A 1QWFA 2JT4A 2KNBB 3EG2A 1FYNA 1UUEA 2RQRA 3UA7A 3UA6A 2PTKA 2OI3A 2J6OA 4JJBA 1BK2A 2L3SA 2CSQA 1SEMA 2CH4A 1KSWA 1PKSA 4J9FA 1AZEA 1M30A 2J05A 4J9CA 3VS0A 1BU1A 1PWTA 4LUDA 2LCSA 1LCKA 3NHNA 1QKXA 4LUEA 4CC4B 1X6BA 3GBQA 2EBPA 2K3BA 3RBBB 3M0RA 3EHQA 1UDLA 2D0NA 2DL4A 1TUCA 2FPDA 4OMNA 3UF4A 1CSKA 2CUBA 1YWPA 1AZGB 1WI7A 2G6FX 2ED0A 1X6GA 2KGTA 1W70A 2YUPA 2GNCA 1I1JA 2ECZA 2DA9A 3M0UA 1SPKA 4M4ZA 2GQIA 4ORZA 4CC3A 2J06A 2K79A 2EYZA 4ZNXA 2O2OA 2K6DA 2DE0X 2EPDA
chains in the Genus database with same CATH superfamily
1OX9A 1UTIA 1W6XA 1KD1U 3I56T 1PSEA 5GAOn 3VS5A 2FVUA 3QG1A 2QDYB 7AT1B 1Q81U 1FMWA 1Y71A 3QUIA 5I2SA 2CP5A 5CQXA 2PUKB 2E5QA 3TCJA 5FU7B 3REAB 1AWOA 3V7SA 1IGUA 2HSPA 2PVGB 3C4SA 3VYGA 1QCNA 1QVGP 4M7DE 4O6JA 1D3BA 5M9OA 1IRXA 1YN8A 4C8QD 3G71A 5IHIA 2EWNA 3EH1A 1VQMA 1OYXA 4J7IA 1UECA 2K2MA 3DB4A 1U06A 5J26A 3CCQA 3CCST 1VQOA 2EKOA 4PFOA 3RDVA 4E7ZA 2Y4XA 3R6NA 2HL5C 4PJOE 2CP6A 1RAGB 1WJRA 1BI1A 4M75F 4LN2A 3CCLT 2DPPB 3SD4A 4M7DA 1NYGA 2XHCA 1RAHB 3G1JA 3P8HA 2MF2A 5DLOA 4C92B 2FZGB 2BUDA 5GANj 5KYXA 1WXBA 2LCLA 2CP7A 1JO8A 2E12A 1KD1C 3OYJA 2WSFE 2EQKA 1NM7A 2MWPA 1Q82C 1GL5A 2ABLA 4RTZA 1M1KC 2DK3A 3FRNA 1MV0B 2OTJT 3JCMg 3UWNA 2QASA 5A2QE 2YXYA 1KK7A 1BI0A 4WTOB 1W1FA 2DMOA 3QYHB 1M2OA 2QEXQ 1UFFA 3C0CA 4XTXA 1EFNA 2FPFA 1U5SA 4LDXA 4F7UA 1TUGB 5GMKe 3PGGA 3G6EA 2K7AA 3LH0A 4RMOA 1EX4A 3OYEA 5FWCA 2XKOC 3G6EQ 2YRVA 3L2ZA 4LDVA 1PKTA 4DBRA 4OMLA 3REBB 4EMKC 2DO3A 2CDTA 2CREA 2RJEA 1D1AA 3I35A 4M77C 1VA7A 1OQKA 4PJNA 4ELZC 2AZSA 4C5GA 4GLMA 2OTLQ 1VQ6Q 1UGPB 3CBOA 1FMKA 4RTWA 3OYCA 1NJIR 4C92G 4M7AF 2KSSA 3LGFA 5CIUA 3LWHA 2E5KA 1YITT 3FDRA 2RJFA 3CC4T 3J81E 4OB3B 1NBEB 4IIMA 2K3XA 1VQ6A 2QYZA 2IPOB 2ZPEB 4J9HA 9ATCB 3EG9B 5GMKm 4KH0B 2DZCA 2X3WD 4HCBA 2RQVA 2D1XA 1VQPQ 2DILA 3I5RA 3H6ZA 2VWFA 2ENMA 2DRKA 2XU8A 3AT1B 1NEGA 4J6XA 4OVAA 2CS7A 3IQLA 4IURA 2E41A 1WA7A 1OULA 2RMOA 3CPWA 3M54A 3CMAT 2VXFA 3U23A 4C92F 2L89A 3CCSA 1VQOT 1ZSZB 4J6WA 4M78E 1N8RC 2DKGA 1BKBA 3GP8A 5GAMf 2KXDA 5KYWB 4M7AC 4PJJA 1YJWQ 3OYDA 3X25B 1W2BP 1Z9ZA 2D6FA 3CC4A 4A4FA 3A8MB 1M5Q1 2YLBA 4JUVA 1Q86U 4N4HA 2DETA 2JJ9A 1SHFA 3T9NA 2ZPIB 4LNPA 1M2VB 4M77F 2DJQA 4BI3A 1T0JA 1KHCA 1RAAB 3MEWA 1KIKA 5I21A 2WSEE 1WHMA 3GOXA 2K57A 3CC7Q 3H8ZA 2MIOA 2EVRA 1XNIA 4HA8A 5IXBA 2FB7A 1MHNA 2K3YA 1H8KA 2MWOA 4KH1B 4B6MA 2L3RA 4P5NA 3ZL7C 3VS7A 2O9SA 4XTVA 4A4HA 2EGEA 4R56A 2YSQA 2KBTA 2DL7A 2MPXC 5GAN6 2MK5A 1AT1B 4XU2A 4FIBA 2OTJQ 1X69A 3DLMA 1HD3A 3EHRA 3HHTB 2CGHA 2LJ0A 2M51A 3X24B 1YWOA 3VS3A 3MEUA 2XK0A 1OU9A 3EGXA 3CCLA 2KROA 1JB0E 4DOVA 4QVDA 2E6NA 5FLXE 1JEGA 3RKXA 1W2BS 4JLGA 3VRYA 3G71Q 1OPKA 1UB4A 2QA4Q 3R6OA 1Q7YR 2QQAA 1OPLA 2D0QB 3MEAA 3JCMf 4ESRA 1OV3A 4L5GA 1P92A 4GY5A 2EW3A 3D7SB 3VS4A 2V1RA 3OB9A 1JXMA 2RB6A 4EPCA 2F5TX 4CI0C 2E65A 2E4HA 2KE9A 1YHQA 5HK0A 1KFZA 2XG8D 4BI8B 1E6GA 2HAXA 1UHFA 1IB8A 3EFOA 4XTYA 3VJPA 3MJXA 3CCQT 1BCOA 1B34B 3RNJA 4KRTA 5GAOm 1VQ5Q 2YT6A 3CEYA 3OYGA 3MP8A 1VQ8T 5FROA 1GCQA 3QDRB 3M53A 2VB6A 1AHJB 3BFMA 4PLLA 5GMKl 2BZ8A 2MYSA 2K5IA 1UUEA 1JBMA 4XU1A 4AMCA 1M90R 1QW1A 1XJWB 3CMAQ 3SWNB 1R8OB 4AT1B 4FT4A 1W4SA 2OI3A 2J6OA 4JJBA 2L5QA 2MAMA 1BK2A 1HK9A 1PKSA 4F7UG 2J05A 2KMTA 4Z02A 3JB9H 4BE2A 2NUPB 3VS0A 4DOWA 4ZGDB 1C6VX 4QQDA 2JTMA 2PQWA 2VYTA 2RI5A 4LUEA 1YJWA 3JCMP 1JJ2A 2NLUA 2M9UA 1KD1R 3PNWC 4BACA 3RBBB 3OYBA 3QJYA 4VUBA 5FU7C 4M75D 2D0NA 5GAMe 3SB2A 5FRMA 2GFAA 3UF4A 2RO0A 1CSKA 2CUBA 4M7DC 2CP2A 3OA6A 2YUPA 1I1JA 4FYYB 3FC3A 5GANe 3CCJA 4II1A 3A8OB 1BIBA 4BY6B 2IG0A 1SPKA 3VV0A 4M4ZA 5D6YA 1WZOA 4ORZA 3HSBA 1I5LA 1YITA 2K79A 2FL7A 1TWBA 2M02A 2K6DA 2DE0X 1WHLA 5IT9E 3O8VA 2EPDA 3M4GA 4HVUA 5GANf 2L3PA 5L8RE 1M27C 1K9MU 1ZUKA 1Y57A 2M1HA 2VV5A 1QVFA 1JXOA 2M0OA 1QVFS 4FL6A 2LT1A 2CYZB 1MUZA 2IVWA 3BDUA 5GAN3 5FWBA 3E9FA 5D7UA 1M3CA 1N6AA 3NMZC 5HY6A 1OEBA 2FZKB 3NFCA 1Y07A 2RI3A 5IXFA 1WYXA 4HT8A 2DFUA 2MCNA 3G6ET 2EJFA 8AT1B 1KQ1A 1E6HA 3EFSA 1UJ0A 1G83A 3H0FA 2LQKA 4LD6A 1B34A 2DZ9A 4BE1A 1TH7A 2HCKA 2LQ8A 1VIEA 3OS0A 2CT3A 1Y96B 4J8OA 4AFQC 1X01A 1QLYA 1VOMA 5GAOr 4AFSC 3JB9I 1UGQB 5GAN5 2YUOA 5GANg 3V7RA 1SF9A 2K2VA 2O4XB 2NYSA 3VKIA 1G3WA 1PRLC 2A3LA 2XIDA 2DL5A 5C0MA 2C0TA 1RLQC 2E70A 1JJ2S 3CCUT 4IKFA 1WHHA 1NEBA 3QBYA 4C92E 4EMKA 2V8KA 2XI9A 3TVTA 4M77G 1NJIC 3E19A 5GMKh 2ZZDA 4JDSA 2O88A 1V1CA 1DJ7B 3QXEB 4X1VA 1H3ZA 2EYQA 2AKLA 3CMET 1LOJA 3OMGA 2AIRB 1I0CA 1YIJT 1IREB 3JCMW 2I0NA 2DL8A 2JZ2A 3VUBA 2KK4A 3EGXB 4OB1B 2KT8A 4OMPA 1YI2T 2BE9B 1AD5A 3OSSC 2KXCA 2NWMA 4RCCA 1MV3A 5AYFA 3OBYA 2HD0A 3JB9F 1E7OA 3NTIA 5CCAA 2QG9B 3ER0A 2YHTA 1SSFA 2DYBA 3HFOA 4EMGA 1K76A 3DLLA 1M1KU 1IO6A 1U8RA 4ATOA 2EYYA 3M0PA 2F2XA 5IHKA 2DJZA 1ZBXA 3MO8A 2B86A 1RLPC 5GAMj 2CKKA 3VS2A 4GLKA 3ULRB 1UHCA 2RK2A 3I56A 2ZPFB 2OAUA 3VS1A 4C8QF 1WGSA 1RAFB 4BB7A 2JS0A 1OU8A 1VQLT 1WHJA 1C0MA 2M16A 3E9GA 2BTTA 1PC0A 3X20B 1YIJA 2D8JA 1NZ9A 2LX7A 4A4KA 3OYKA 4M7AG 2JUFA 3CCSQ 3WVDB 1WXUA 4J83A 2RHUA 4E6RA 3CD6A 2WSCE 1PNJA 2DEQA 3HKSA 4F17A 1ZSGA 4MDXA 1K8AU 2E3HA 2HL3A 4F7UE 1NG2A 4IIOA 5FRNA 2BZYA 3PFSA 4QQ6A 2JXBA 1Y7XA 1MNEA 1OZ2A 5CKDA 4PFPA 1RI0A 3OY9A 2F2WA 2OTJA 5GAN7 3OBWA 1Q81C 2LP5A 3CQTA 1M3BA 5I2MA 1S1NA 1WIEA 2FO0A 4HVVA 4FSXA 3OMCA 2DX1A 3VS6A 3SEMA 2RNAA 1SSHA 2D9TA 1KJWA 2EJ9A 4Y91A 2RN8A 5FU6B 4PJOB 5DLQE 1YCYA 3CCEA 2KRMA 1AOJA 4F7UF 5CK9A 4PLIA 4M75C 1N5ZA 4JS5A 3LH5A 3CCVQ 1QP2A 1VQPA 5DM7R 4KULA 2HMAA 1GBQA 1GCQC 2QGFB 4QVZA 2HBPA 4NS5A 2DYIA 2I2LA 1VQLA 1ZUUA 1ZBJA 2JM9A 1OX8A 5GJVB 1TU0B 4NOYA 4E7KA 8ATCB 3VRZA 3CCMQ 1YJNA 4C8QC 1VQMT 3HRSA 5LJ3g 2QTVA 3EGUA 4TVRA 4C92D 2EAYA 2EYXA 2K9GA 1YBYA 2HQHA 2ZPHB 3PIPA 2SRCA 2GF7A 3CMEA 2J7IA 2DM1A 1UG1A 3JCMh 1X75C 1D1CA 2DXUA 1V76A 1QWEA 3QDFA 3CPWS 2DRMA 2QQRA 2O01E 3OW2S 3OYMA 3FJ5A 4L59A 1ACMB 1FX7A 3VYHB 3BY7A 3G7ZA 2XDBA 3PVLA 2YRCA 3META 2X9HA 4M78F 2O4XA 3SHWA 4JLIA 3KFVA 4B9WA 3A98A 3UDCA 2AT1B 2EGCA 3HTRA 2Z0WA 4RTVA 2XDDA 4C8QG 1NYFA 5CR2A 2H8HA 1VQ8A 1VQNA 2HQXA 4J9GA 4ZGEB 5A0DA 3P8DA 4FW2A 4C92A 2VC8A 3QZ5B 4M75E 3L2WA 4OMMA 1O75A 5GAMd 1KQSS 1AWWA 2OTLA 1BI3A 2KYMA 3HP9A 2QEXA 2F5KA 4XU0A 4DEYA 2A36A 1PHTA 5GAN2 2XDPA 4UC4A 4XTZA 3OQ5A 4DBQA 2L8DA 2EFIA 5I11A 1HSQA 1UGVA 4E7LA 4RTTA 3OYNA 2HBWA 1GFDA 1S72T 2OX7A 2GTOA 2AKKA 2LQWA 5L23A 2HZYA 4E7SA 4M77B 4A54A 3UT1A 3UPUA 1GCPA 1X43A 2DIGA 2JT4A 1N8RR 1WQ7A 3M9QA 5KYYB 1ZA1B 4EMHA 2DXTA 2DTOA 2L3SA 1VQ5T 4IUUA 1KSWA 1AZEA 1M30A 4J9CA 1D0ZA 1HYOA 1G3TA 2LT4A 1VQ5A 2RHYA 1LCKA 1PM3A 4PJOC 1NPPA 4E7HA 4CC4B 2EBPA 1QVFP 2K3BA 3V8JA 3RR6A 3BE3A 3CD6Q 2NUPA 1KC8U 1TUCA 3CCJT 2FPDA 4D6WA 1YWPA 2X35A 1X6GA 1KG1A 5DY9A 5LJ3h 1PSFA 5J39A 1M1KR 2ECZA 3G71T 2KDSA 3CCLQ 1QCOA 3M0UA 3SWNA 1FXXA 3G4ST 2FYKA 1VQ4A 1TOVA 3FIFA 3X28B 2DXCA 4IUQA 4M7AB 2K5LA 2KAFA 1IHVA 4ZNXA 4X34A 3JCMV 2P4TA 2H3JA 4RCBA 2LCCA 3JB9D 4C0GA 4PJOA 3LGLA 4HVWA 4KUIA 1NLPC 2DIQA 3OYIA 3EFRA 3MHXA 2YUNA 2DXBA 2A28A 2KVQG 2DBMA 3TQ7P 1RUWA 4PKCC 3OS2A 3FLGA 2DAQA 2LRQA 1PRMC 2FRYA 1TUDA 1MMNA 4JRQA 4XAXB 1YHQT 2G3RA 3LLRA 4JZ4A 2RJCA 3H9NA 4LD9K 2E3IA 3L1AA 3EGDA 1QVGA 3JV3A 1NJIU 3I55T 1M4ZA 1QQJA 4LXCA 3QO3A 3WXMB 1G3YA 3M4YA 4LDUA 2RPNA 3EG1A 1K0SA 4AG1C 2DEUA 3RMSA 1LJOA 2P4RA 2KT1A 4MMLA 2DBKA 4DEXA 1JU5C 3S3MA 4BDZA 1K1ZA 5I22A 4Z88A 2AZVA 1X2QA 5CKBA 3THKA 1VQ9T 1Q81R 2CH4W 3EG0A 1SHGA 1B7TA 4C0DC 2F2VA 3CCET 5LJ5d 4AFUC 3E1SA 1YCSB 4PNOA 1YFNA 2RJDA 5CAIA 3EG9A 1GFCA 1HXDA 4BI4A 4OMQA 2R5MA 1RACB 3JAME 2ZPBB 2HDAA 4C0DB 3J7AF 2QXFA 2CP0A 4RTYA 1Q82R 1N27A 1FWZA 1VQPT 1G5VA 4C92C 5GJWB 1D0XA 1ZLMA 1YJ9T 1ABQA 1G8XA 1NPRA 2LJ1A 1VQ7A 1CKAA 1K9MC 1M1GA 2YWWA 2C0OA 3AHUA 1IHWA 2EQJA 1EZZB 3EG3A 2LZ6B 1BI2A 2CZ1B 5GAN4 2JNGA 3OW2A 1ZQ1A 3S6WA 4XQ3A 4M75A 1UEBA 1PD0A 4O5VA 4E7IA 4A4EA 3M57A 4ANJA 1AEYA 5LJ5j 4M7DF 1VQ7Q 4BY6C 2QTXA 1WDXA 4ZN1A 2DL3A 4Q5WA 2RI2A 4NL2A 4EMKB 4KGVB 1RI9A 1Q82U 2LX9A 4PK4A 3C95A 2HNIA 2P84A 3C12A 3CCRQ 3MKDA 2JVVA 2HKNA 4E7JA 2ROTA 5IAYA 1ARKA 1SRMA 3GNGA 1VQ8Q 3NPFA 2QQ9A 4EDUA 4EIKA 1Y96A 2RHXA 1LVKA 3JCMb 5HK3A 3TSWA 2C0IA 2E10A 1UE9A 1U3OA 4N4IA 3JB9G 2RQWA 1NE8A 3MCAB 5LJ5g 2A0FB 4LDYA 1YI2A 3ZFJA 5GANh 5KYNA 4NL3A 2PUOB 2RA2A 4XK8E 2W10A 2Y4YA 1PG5B 4JRIA 3CPWP 3QWXX 1W2BA 4R55A 1X2KA 1M8MA 1WFWA 1ABOA 2COWA 3L2UA 2HSEB 3A8HB 2FPEA 2V26A 3JCMc 3M0SA 2EQUA 1VYVA 4Z89A 4RKUE 4DQ2A 1QCFA 2A08A 1WHKA 2BKDN 5LJ3j 4M7AA 3CCUA 3L42A 4J9IA 4JJNK 3OYHA 1WX6A 1B3QA 5LJ5f 4PJLA 2L2PA 4AFZC 3JCMe 4JRPA 1MNDA 2DD4A 4PJOD 2LJ3A 4JJDA 2HKQB 3OYAA 1IXDA 4OGEA 3V8LA 1ZUYA 1X6OA 1KQSP 2JTEA 3ZBDA 1KQ2A 3MP1A 3CCEQ 1OI1A 2PNIA 4AG2C 1YJ9A 2LQNA 3URGA 3F70A 2O31A 3QKJA 4ELYC 1T3SA 1N9SA 1CKBA 3BW1A 2KRSA 2QQSA 5ECAA 1RADB 1K73R 3CC2A 1AVZC 3A8LB 4WF2A 3JRZA 5J3BA 4J5YA 2CT4A 3KBGA 2RH2A 4ZGJB 1M3AA 2SEMA 4Z8AA 1G2BA 2LNVA 4JPBW 1ZX6A 3CCVA 3KXTA 4WCIA 3CD6T 3P8BB 1VQ9A 4C8QE 4B9XA 1X27A 1VQOQ 2KYBA 3O5ZA 4M7DD 3KUFA 4F16A 1YI2Q 5EG2A 5GAOp 4RTXA 4M77A 2DERA 2RHIA 1D1BA 4DA4A 3VUZA 4L6V5 5CQYA 3QSUA 1Q7YC 1S72A 4C8QB 2ROLA 3S3OA 2X3XD 3MP6A 1WNLA 5C6SA 3CCJQ 3WVEB 1QKWA 1B07A 2RQTA 5AT1B 3NGPA 3DKMA 3I55Q 1D09B 1D3BB 2CSIA 2LMJA 2FHDA 3V8KA 4LE9A 1VQ4Q 2OAWA 1H92A 5GAMg 1WPYA 3CC7A 1SRLA 3ZEHA 2FG0A 4C0ZA 2E64A 4OGCA 3CC2Q 3A1PA 2D8HA 2RQUA 2X4WA 2EGAA 2ESWA 4D8KA 4OB2B 3UATA 2HEQA 2A7YA 2NUZA 1N8RU 2YDLA 3JCMX 3CXCP 4XU3A 2CZ6B 2YRDA 4FM4B 2F1LA 3GNFB 4CC7A 1A0NB 1VUBA 1QWFA 3CBMA 1FYNA 2F69A 4QW2A 1KC8C 2PVOB 4J6YA 1YJWT 3I56Q 3CCMT 2QAZA 1ZA2B 1C1AA 4PJMA 4MDWA 1UGSB 2CSQA 1SEMA 1BCMA 2EIFA 3G4SQ 1RABB 1YIJQ 4KGXB 3X26B 1XQHA 2COYA 1TXQA 3BDLA 3CMAA 1LNXA 1PWTA 4LUDA 1VQKA 1Q7YU 2LCSA 3NHNA 3MPUB 1X6BA 3GBQA 3LYIA 4MZMA 5GAOl 4IUVA 2RHZA 2ZCFB 3G4SA 3EHQA 2Y90A 1XTDA 1UDLA 2MMPA 1MMGA 2VUBA 4DBHA 4FYVB 3JSCA 4OMNA 4FW1A 3PTAA 1JJ2P 3GF5A 4QKUA 1WI7A 2G6FX 2ED0A 2KGTA 3ME9A 4CRIA 2DA9A 3GLXA 4OB0B 4KT0E 3EH2A 3HPWA 3GPLA 4ZTFA 1SKUB 1QMCA 1SG5A 4FU6A 4BD3A 3LWIA 1VQMQ 3OYFA 4M78B 4OMFB 2VGNA 1VQNQ 5CO7A 3QYGB 1LPLA 4PJOG 2JN0A 4ZN3A 1YJNT 1GBRA 1WLPB 3L2RA 1QVGS 2P0QA 1O9SA 2JW4A 4C5IA 5LJ5h 3FB9A 3CCRA 1WHGA 5KCHA 3OYYA 1M2VA 5KYYA 4BDYA 2ZPGB 2COZA 4C5HA 4M7DG 2QEXT 2JOYA 3M58A 1VYUA 3OS1A 2GQVA 1QVPA 2EKHA 2VGMA 1TS9A 2CZ0B 1I4K1 2BE7D 3L2QA 1I5OB 1Y0MA 3H0IA 5IHNA 5KYWA 1AWJA 1VQNT 3I9QA 1RAEB 1ZSZA 1J3TA 3HRUA 4QVCA 1Q86C 1VQ7T 2MOXA 2O9VA 4DBFA 4ME7A 1YJ9Q 5CVIA 2JMAA 1ZSZC 2RD1A 1K0XA 2J6FA 2LC4A 3JB9J 2JMCA 2H3EB 4M78D 1OZ3A 4JS4A 2VXEA 1YNZA 2FRWA 4HCZA 1I8FA 2ED1A 4C8QA 5IH2A 4PFZA 3TU4K 4BUGA 3SFMA 3TSZA 3RIRA 3M55A 2J6KA 3RKYA 1U1SA 4HT9A 5HCKA 3Q1JA 4JJCA 2AHJB 1TTHB 1G3SA 1WJSA 1HJDA 1WXTA 5KYUB 3M5AA 1U1TA 4F7UB 2JS2A 2MI6A 2ZGWA 2GGRA 5KE3A 3CPFA 1YHQQ 2M0YA 5GAOq 4PJOF 5CKFA 4FYXB 1XOVA 5KH6A 4KGZB 2RK1A 1KHIA 5FU6C 2PZ1A 5GAN8 3I55A 2V1QA 3TEEA 4N4GA 1VQ6T 4OF1A 4FCYA 2XICA 1EIFA 2QK0A 3CXCS 1R77A 1VQLQ 2KQWA 2P0KA 5CKEA 4K11A 5KYXB 4HKEA 2V8IA 3PMIA 3ASKA 4J9DA 1GRIA 1JRIA 2BIVA 4A63B 3HRTA 2DD5A 2LVMA 4MZPA 4MZTA 4J9BA 5LJ3f 2WACA 1JQQA 1BB9A 1T3LA 4YTLA 2KY9A 1OOTA 1S72Q 1VQ4T 2ATCB 4M75G 1YJNQ 2EJGA 3PE0A 5EC7A 1VYTA 4J7FA 5A0GA 5GANd 2K4YA 2QA4A 4XTWA 3M0TA 5FW9A 1AWXA 2QA4T 3A8GB 2W0ZA 2KI7A 4IUPA 2DF6A 3OS5A 4E2FB 2EYWA 4M7DB 3SWNC 1V29B 3MEVA 1Q95G 3TREA 2QDLA 4A53A 4BE0A 4F04B 2CUDA 5GAMh 2FZCB 3H0HA 2DLPA 4ZTJA 3NTHA 1NLOC 3OSVA 3J80E 1F1BB 3N5BB 3DB3A 2AK5A 2LNHB 3QWYA 2YLCA 3RKWA 4F14A 2VASA 4FSSA 5GMKi 1K8AR 2CP3A 4J9EA 3PMTA 4M75B 3FJPA 4N0AC 4R0KA 3HL8A 5LL6S 3CCRT 1RL2A 1I81A 1FMVA 1RAIB 4HCKA 3E2UA 3QZ9B 2GBQA 1YITQ 3M0QA 1Q86R 1MMAA 2EQIA 4CC2A 1VQKQ 2V8JA 2GTJA 5KYUA 2E1HA 4IUTA 4RTUA 5CKHA 2OJ2A 1YP5A 3PT9A 2PVDB 3OW2P 3QPHA 1R0BG 2DVJA 3NTKA 4OP0A 3I5SA 3CCUQ 1TG0A 1ZHIA 2FEIA 2DTIA 4C0FA 2KEAA 4QQGA 3CBPA 1K9MR 4Y92A 4E47A 1KQSA 2VVKA 1IZ6A 2IIMA 3RUXA 2QGGA 1H3HA 4D8DA 3V7CA 5LJ3d 3H41A 1TSFA 3JCMJ 2VKNA 5KE2A 2KRNA 1PD1A 2RM4A 5IN1A 1PCXA 2A37A 1UGRB 4QT7A 3INZA 2KR3A 2LTOA 3C94A 2QQBA 1KC8R 4M7AE 1M8VA 2L3QA 3OYLA 4OMOA 4M78C 1UJYA 4JZ3A 5HKCA 1MGQA 1N9RA 1MMDA 2ZAEA 4JRKA 2BZXA 2NUTA 4GBQA 2YUQA 4RG2A 1K8AC 4V2SA 3CC4Q 2C06A 1GXIE 2X4XA 2LDMA 3PVQA 2DNUA 1K9AA 3EFOB 2XMFA 3RERA 1K73C 1K4US 1QP3A 2X51A 1K73U 3S3NA 5D6WA 1BBZA 5A0LA 3CCMA 3QIIA 4C5EA 3CCQQ 1I07A 1D0YA 2XD0A 3A5ZB 4XTUA 1H641 4N0AA 1Z9QA 2L0AA 3L2VA 2JM8A 4HCCA 6AT1B 2RF0A 2GFUA 2R5AA 2R57A 4RUGA 4M77D 5GMKj 3M59A 3CXCA 4M78G 5LJ5e 1M9SA 4HXJA 1T0HA 4M78A 3QHSA 4A4GA 1BYMA 2K5FA 3QJ6A 4KUDK 3EGDB 2KNBB 3VU3C 3EG2A 2RQRA 3CC7T 4PL6A 4X9CA 3UA7A 3UA6A 4RG8A 5D6XA 2E6ZA 2PTKA 3EAEA 1R0CB 3CCVT 2GCXA 4M77E 2CH4A 4J9FA 4KBMB 2B8AA 2CZ7B 1M90U 5LJ3e 4FYWB 1BU1A 4LDWA 2NUTB 1BIAA 2DTHA 3PIOA 1QKXA 1M1FA 5KCOA 1VIFA 4Y28E 4FT2A 2X4JA 3M0RA 2OTLT 1WQWA 4X9DA 2EQMA 3RMQA 2DL4A 3GIBA 4MMKA 1VQKT 1AZGB 2QI2A 2R58A 2JTFA 3CMEQ 1W70A 3CC2T 2GNCA 3RESA 3M56A 1VQ9Q 2X4YA 2P0PA 2PU9B 3SDZA 2GQIA 3JCMd 1WJQA 4M7AD 3LX7A 4CC3A 2J06A 2HQEA 3FEOA 3JCMQ 1M90C 3LW5E 2EYZA 3HFNA 2O2OA 1IGQA 2DVEA
chains in the Genus database with same CATH topology
4HVUA 1UTIA 1W6XA 1GBRA 4HVWA 2L3PA 1M27C 1NLPC 1WLPB 1ZUKA 1Y57A 3VS5A 2YUNA 1JXOA 2JW4A 2A28A 2DBMA 1MUZA 1RUWA 5FWBA 1M3CA 3REAB 1PRMC 2FRYA 3NMZC 1AWOA 1TUDA 4JZ4A 2HSPA 1VYUA 1OEBA 2EKHA 3JV3A 1YN8A 5IXFA 1WYXA 2MCNA 5IHIA 1E6HA 1Y0MA 3H0IA 1UJ0A 1G83A 1UECA 2K2MA 5IHNA 1U06A 3H0FA 2RPNA 1AWJA 3EG1A 3I9QA 1K0SA 2HCKA 1J3TA 4AG1C 2CT3A 3R6NA 2MOXA 4AFQC 2O9VA 1QLYA 2P4RA 2KT1A 2DBKA 4DEXA 1JU5C 4AFSC 2JMAA 2YUOA 1K1ZA 5I22A 4Z88A 2AZVA 1K0XA 1PRLC 2J6FA 1X2QA 4LN2A 3THKA 2DL5A 2CH4W 2C0TA 3EG0A 1SHGA 1RLQC 2JMCA 1NEBA 1NYGA 2F2VA 4AFUC 1YCSB 1YNZA 3TVTA 1GFCA 2FRWA 2ED1A 1WXBA 5IH2A 1JO8A 4OMQA 2O88A 1V1CA 2HDAA 1NM7A 3TSZA 1GL5A 2ABLA 4RTZA 4X1VA 2J6KA 4RTYA 2AKLA 5HCKA 1MV0B 1I0CA 5GJWB 4JJCA 1ZLMA 1HJDA 1WXTA 2I0NA 2DL8A 1ABQA 2JS2A 1W1FA 2LJ1A 2DMOA 1CKAA 2GGRA 2KT8A 4OMPA 2C0OA 2M0YA 1UFFA 1AD5A 2KXCA 3C0CA 2NWMA 1EFNA 2FPFA 1U5SA 1XOVA 3EG3A 2LZ6B 1MV3A 2PZ1A 2K7AA 1E7OA 2V1QA 5FWCA 1PKTA 4OMLA 3REBB 2DYBA 1K76A 2CDTA 2CREA 1AEYA 1IO6A 2EYYA 3I35A 3M0PA 2F2XA 5IHKA 1VA7A 4K11A 2B86A 1WDXA 2AZSA 2DL3A 4J9DA 1GRIA 1RLPC 3VS2A 3ULRB 1UHCA 4GLMA 1RI9A 4A63B 3VS1A 1FMKA 4RTWA 2JS0A 4J9BA 2BTTA 1JQQA 1BB9A 1T3LA 2D8JA 2LX7A 2ROTA 2E5KA 1SRMA 1ARKA 1OOTA 3NPFA 1WXUA 4EIKA 4E6RA 4IIMA 1PNJA 4F17A 3PE0A 3TSWA 5EC7A 1ZSGA 1VYTA 2C0IA 1UE9A 1U3OA 4J9HA 2RQWA 1NG2A 4IIOA 3M0TA 2BZYA 5FW9A 1AWXA 2JXBA 2W0ZA 2X3WD 2DF6A 2RQVA 2D1XA 2W10A 2EYWA 2DILA 3I5RA 2VWFA 3QWXX 2F2WA 1X2KA 1M8MA 2ENMA 2LP5A 1WFWA 2DRKA 1ABOA 3CQTA 1M3BA 1NEGA 1S1NA 2QDLA 1WIEA 2FO0A 4HVVA 2DX1A 3VS6A 3SEMA 2FPEA 3IQLA 2RNAA 2CUDA 1SSHA 1KJWA 3H0HA 1WA7A 3M0SA 2RMOA 1VYVA 2RN8A 4Z89A 2DLPA 3U23A 1QCFA 1NLOC 2A08A 2KXDA 2AK5A 2LNHB 2KRMA 3QWYA 4F14A 1AOJA 1N5ZA 4J9IA 4FSSA 1Z9ZA 3LH5A 4J9EA 1WX6A 1B3QA 2L2PA 4AFZC 1GBQA 1GCQC 4R0KA 2LJ3A 1SHFA 4JJDA 4LNPA 2DJQA 1T0JA 1ZUUA 1ZBJA 2JM9A 4HCKA 5GJVB 1KIKA 1ZUYA 2GBQA 3M0QA 3VRZA 2EQIA 4CC2A 2JTEA 2GTJA 2MIOA 4RTUA 2OJ2A 2EVRA 1YP5A 3EGUA 2EYXA 2K9GA 2DVJA 2PNIA 4AG2C 5IXBA 3I5SA 2LQNA 1TG0A 2FEIA 1H8KA 2SRCA 2KEAA 4Y92A 2J7IA 2O31A 2VVKA 2DM1A 1UG1A 2IIMA 3ZL7C 1T3SA 1H3HA 1CKBA 3VS7A 2KRSA 1QWEA 2O9SA 2DRMA 2EGEA 4D8DA 2YSQA 2KBTA 5ECAA 2DL7A 3H41A 1AVZC 2VKNA 1X69A 3FJ5A 1HD3A 2CT4A 2KRNA 3EHRA 2LJ0A 2M51A 1M3AA 2SEMA 1YWOA 2A37A 4QT7A 4Z8AA 3PVLA 1G2BA 3VS3A 4JPBW 1ZX6A 2KR3A 4WCIA 2KROA 3SHWA 3KFVA 1X27A 2L3QA 2KYBA 3O5ZA 4F16A 3A98A 4OMOA 1UJYA 1JEGA 4RTXA 2EGCA 4RTVA 3VRYA 4JZ3A 1OPKA 1NYFA 1OPLA 2H8HA 2BZXA 4GBQA 2YUQA 4ESRA 4J9GA 2ROLA 1OV3A 2X3XD 2EW3A 1QKWA 1B07A 2RQTA 3VS4A 2V1RA 2DNUA 1K9AA 3NGPA 3PVQA 2XMFA 2CSIA 2LMJA 1K4US 1JXMA 4OMMA 4LE9A 2OAWA 1AWWA 1BBZA 1H92A 2KYMA 2KE9A 1I07A 1SRLA 1KFZA 2FG0A 1E6GA 4DEYA 2A36A 1UHFA 1PHTA 2D8HA 2RQUA 1Z9QA 2EGAA 2L0AA 2ESWA 4D8KA 2JM8A 3UATA 5I11A 1HSQA 1UGVA 2RF0A 2HEQA 2NUZA 3RNJA 2YDLA 4KRTA 4RUGA 4RTTA 2YT6A 2HBWA 1GFDA 2GTOA 1GCQA 2AKKA 2LQWA 4HXJA 1T0HA 5L23A 1GCPA 1X43A 4CC7A 1A0NB 2BZ8A 1QWFA 2JT4A 2KNBB 3EG2A 1FYNA 1UUEA 2RQRA 3UA7A 3UA6A 2PTKA 2OI3A 2J6OA 4JJBA 1BK2A 2L3SA 2CSQA 1SEMA 2CH4A 1KSWA 1PKSA 4J9FA 1AZEA 1M30A 2J05A 4J9CA 3VS0A 1BU1A 1PWTA 4LUDA 2LCSA 1LCKA 3NHNA 1QKXA 4LUEA 4CC4B 1X6BA 3GBQA 2EBPA 2K3BA 3RBBB 3M0RA 3EHQA 1UDLA 2D0NA 2DL4A 1TUCA 2FPDA 4OMNA 3UF4A 1CSKA 2CUBA 1YWPA 1AZGB 1WI7A 2G6FX 2ED0A 1X6GA 2KGTA 1W70A 2YUPA 2GNCA 1I1JA 2ECZA 2DA9A 3M0UA 1SPKA 4M4ZA 2GQIA 4ORZA 4CC3A 2J06A 2K79A 2EYZA 4ZNXA 2O2OA 2K6DA 2DE0X 2EPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  1UTI A;  1W6X A;  1GBR A;  4HVW A;  2L3P A;  1M27 C;  1NLP C;  1WLP B;  1ZUK A;  1Y57 A;  3VS5 A;  2YUN A;  1JXO A;  2JW4 A;  2A28 A;  2DBM A;  1MUZ A;  1RUW A;  5FWB A;  1M3C A;  3REA B;  1PRM C;  2FRY A;  3NMZ C;  1AWO A;  1TUD A;  4JZ4 A;  2HSP A;  1VYU A;  1OEB A;  2EKH A;  3JV3 A;  1YN8 A;  5IXF A;  1WYX A;  2MCN A;  5IHI A;  1E6H A;  1Y0M A;  3H0I A;  1UJ0 A;  1G83 A;  1UEC A;  2K2M A;  5IHN A;  1U06 A;  3H0F A;  2RPN A;  1AWJ A;  3EG1 A;  3I9Q A;  1K0S A;  2HCK A;  1J3T A;  4AG1 C;  2CT3 A;  3R6N A;  2MOX A;  4AFQ C;  2O9V A;  1QLY A;  2P4R A;  2KT1 A;  2DBK A;  4DEX A;  1JU5 C;  4AFS C;  2JMA A;  2YUO A;  1K1Z A;  5I22 A;  4Z88 A;  2AZV A;  1K0X A;  1PRL C;  2J6F A;  1X2Q A;  4LN2 A;  3THK A;  2DL5 A;  2CH4 W;  2C0T A;  3EG0 A;  1SHG A;  1RLQ C;  2JMC A;  1NEB A;  1NYG A;  2F2V A;  4AFU C;  1YCS B;  1YNZ A;  3TVT A;  1GFC A;  2FRW A;  2ED1 A;  1WXB A;  5IH2 A;  1JO8 A;  4OMQ A;  2O88 A;  1V1C A;  2HDA A;  1NM7 A;  3TSZ A;  1GL5 A;  2ABL A;  4RTZ A;  4X1V A;  2J6K A;  4RTY A;  2AKL A;  5HCK A;  1MV0 B;  1I0C A;  5GJW B;  4JJC A;  1ZLM A;  1HJD A;  1WXT A;  2I0N A;  2DL8 A;  1ABQ A;  2JS2 A;  1W1F A;  2LJ1 A;  2DMO A;  1CKA A;  2GGR A;  2KT8 A;  4OMP A;  2C0O A;  2M0Y A;  1UFF A;  1AD5 A;  2KXC A;  3C0C A;  2NWM A;  1EFN A;  2FPF A;  1U5S A;  1XOV A;  3EG3 A;  2LZ6 B;  1MV3 A;  2PZ1 A;  2K7A A;  1E7O A;  2V1Q A;  5FWC A;  1PKT A;  4OML A;  3REB B;  2DYB A;  1K76 A;  2CDT A;  2CRE A;  1AEY A;  1IO6 A;  2EYY A;  3I35 A;  3M0P A;  2F2X A;  5IHK A;  1VA7 A;  4K11 A;  2B86 A;  1WDX A;  2AZS A;  2DL3 A;  4J9D A;  1GRI A;  1RLP C;  3VS2 A;  3ULR B;  1UHC A;  4GLM A;  1RI9 A;  4A63 B;  3VS1 A;  1FMK A;  4RTW A;  2JS0 A;  4J9B A;  2BTT A;  1JQQ A;  1BB9 A;  1T3L A;  2D8J A;  2LX7 A;  2ROT A;  2E5K A;  1SRM A;  1ARK A;  1OOT A;  3NPF A;  1WXU A;  4EIK A;  4E6R A;  4IIM A;  1PNJ A;  4F17 A;  3PE0 A;  3TSW A;  5EC7 A;  1ZSG A;  1VYT A;  2C0I A;  1UE9 A;  1U3O A;  4J9H A;  2RQW A;  1NG2 A;  4IIO A;  3M0T A;  2BZY A;  5FW9 A;  1AWX A;  2JXB A;  2W0Z A;  2X3W D;  2DF6 A;  2RQV A;  2D1X A;  2W10 A;  2EYW A;  2DIL A;  3I5R A;  2VWF A;  3QWX X;  2F2W A;  1X2K A;  1M8M A;  2ENM A;  2LP5 A;  1WFW A;  2DRK A;  1ABO A;  3CQT A;  1M3B A;  1NEG A;  1S1N A;  2QDL A;  1WIE A;  2FO0 A;  4HVV A;  2DX1 A;  3VS6 A;  3SEM A;  2FPE A;  3IQL A;  2RNA A;  2CUD A;  1SSH A;  1KJW A;  3H0H A;  1WA7 A;  3M0S A;  2RMO A;  1VYV A;  2RN8 A;  4Z89 A;  2DLP A;  3U23 A;  1QCF A;  1NLO C;  2A08 A;  2KXD A;  2AK5 A;  2LNH B;  2KRM A;  3QWY A;  4F14 A;  1AOJ A;  1N5Z A;  4J9I A;  4FSS A;  1Z9Z A;  3LH5 A;  4J9E A;  1WX6 A;  1B3Q A;  2L2P A;  4AFZ C;  1GBQ A;  1GCQ C;  4R0K A;  2LJ3 A;  1SHF A;  4JJD A;  4LNP A;  2DJQ A;  1T0J A;  1ZUU A;  1ZBJ A;  2JM9 A;  4HCK A;  5GJV B;  1KIK A;  1ZUY A;  2GBQ A;  3M0Q A;  3VRZ A;  2EQI A;  4CC2 A;  2JTE A;  2GTJ A;  2MIO A;  4RTU A;  2OJ2 A;  2EVR A;  1YP5 A;  3EGU A;  2EYX A;  2K9G A;  2DVJ A;  2PNI A;  4AG2 C;  5IXB A;  3I5S A;  2LQN A;  1TG0 A;  2FEI A;  1H8K A;  2SRC A;  2KEA A;  4Y92 A;  2J7I A;  2O31 A;  2VVK A;  2DM1 A;  1UG1 A;  2IIM A;  3ZL7 C;  1T3S A;  1H3H A;  1CKB A;  3VS7 A;  2KRS A;  1QWE A;  2O9S A;  2DRM A;  2EGE A;  4D8D A;  2YSQ A;  2KBT A;  5ECA A;  2DL7 A;  3H41 A;  1AVZ C;  2VKN A;  1X69 A;  3FJ5 A;  1HD3 A;  2CT4 A;  2KRN A;  3EHR A;  2LJ0 A;  2M51 A;  1M3A A;  2SEM A;  1YWO A;  2A37 A;  4QT7 A;  4Z8A A;  3PVL A;  1G2B A;  3VS3 A;  4JPB W;  1ZX6 A;  2KR3 A;  4WCI A;  2KRO A;  3SHW A;  3KFV A;  1X27 A;  2L3Q A;  2KYB A;  3O5Z A;  4F16 A;  3A98 A;  4OMO A;  1UJY A;  1JEG A;  4RTX A;  2EGC A;  4RTV A;  3VRY A;  4JZ3 A;  1OPK A;  1NYF A;  1OPL A;  2H8H A;  2BZX A;  4GBQ A;  2YUQ A;  4ESR A;  4J9G A;  2ROL A;  1OV3 A;  2X3X D;  2EW3 A;  1QKW A;  1B07 A;  2RQT A;  3VS4 A;  2V1R A;  2DNU A;  1K9A A;  3NGP A;  3PVQ A;  2XMF A;  2CSI A;  2LMJ A;  1K4U S;  1JXM A;  4OMM A;  4LE9 A;  2OAW A;  1AWW A;  1BBZ A;  1H92 A;  2KYM A;  2KE9 A;  1I07 A;  1SRL A;  1KFZ A;  2FG0 A;  1E6G A;  4DEY A;  2A36 A;  1UHF A;  1PHT A;  2D8H A;  2RQU A;  1Z9Q A;  2EGA A;  2L0A A;  2ESW A;  4D8K A;  2JM8 A;  3UAT A;  5I11 A;  1HSQ A;  1UGV A;  2RF0 A;  2HEQ A;  2NUZ A;  3RNJ A;  2YDL A;  4KRT A;  4RUG A;  4RTT A;  2YT6 A;  2HBW A;  1GFD A;  2GTO A;  1GCQ A;  2AKK A;  2LQW A;  4HXJ A;  1T0H A;  5L23 A;  1GCP A;  1X43 A;  4CC7 A;  1A0N B;  2BZ8 A;  1QWF A;  2JT4 A;  2KNB B;  3EG2 A;  1FYN A;  1UUE A;  2RQR A;  3UA7 A;  3UA6 A;  2PTK A;  2OI3 A;  2J6O A;  4JJB A;  1BK2 A;  2L3S A;  2CSQ A;  1SEM A;  2CH4 A;  1KSW A;  1PKS A;  4J9F A;  1AZE A;  1M30 A;  2J05 A;  4J9C A;  3VS0 A;  1BU1 A;  1PWT A;  4LUD A;  2LCS A;  1LCK A;  3NHN A;  1QKX A;  4LUE A;  4CC4 B;  1X6B A;  3GBQ A;  2EBP A;  2K3B A;  3RBB B;  3M0R A;  3EHQ A;  1UDL A;  2D0N A;  2DL4 A;  1TUC A;  2FPD A;  4OMN A;  3UF4 A;  1CSK A;  2CUB A;  1YWP A;  1AZG B;  1WI7 A;  2G6F X;  2ED0 A;  1X6G A;  2KGT A;  1W70 A;  2YUP A;  2GNC A;  1I1J A;  2ECZ A;  2DA9 A;  3M0U A;  1SPK A;  4M4Z A;  2GQI A;  4ORZ A;  4CC3 A;  2J06 A;  2K79 A;  2EYZ A;  4ZNX A;  2O2O A;  2K6D A;  2DE0 X;  2EPD A; 
#chains in the Genus database with same CATH topology
 1OX9 A;  1UTI A;  1W6X A;  1KD1 U;  3I56 T;  1PSE A;  5GAO n;  3VS5 A;  2FVU A;  3QG1 A;  2QDY B;  7AT1 B;  1Q81 U;  1FMW A;  1Y71 A;  3QUI A;  5I2S A;  2CP5 A;  5CQX A;  2PUK B;  2E5Q A;  3TCJ A;  5FU7 B;  3REA B;  1AWO A;  3V7S A;  1IGU A;  2HSP A;  2PVG B;  3C4S A;  3VYG A;  1QCN A;  1QVG P;  4M7D E;  4O6J A;  1D3B A;  5M9O A;  1IRX A;  1YN8 A;  4C8Q D;  3G71 A;  5IHI A;  2EWN A;  3EH1 A;  1VQM A;  1OYX A;  4J7I A;  1UEC A;  2K2M A;  3DB4 A;  1U06 A;  5J26 A;  3CCQ A;  3CCS T;  1VQO A;  2EKO A;  4PFO A;  3RDV A;  4E7Z A;  2Y4X A;  3R6N A;  2HL5 C;  4PJO E;  2CP6 A;  1RAG B;  1WJR A;  1BI1 A;  4M75 F;  4LN2 A;  3CCL T;  2DPP B;  3SD4 A;  4M7D A;  1NYG A;  2XHC A;  1RAH B;  3G1J A;  3P8H A;  2MF2 A;  5DLO A;  4C92 B;  2FZG B;  2BUD A;  5GAN j;  5KYX A;  1WXB A;  2LCL A;  2CP7 A;  1JO8 A;  2E12 A;  1KD1 C;  3OYJ A;  2WSF E;  2EQK A;  1NM7 A;  2MWP A;  1Q82 C;  1GL5 A;  2ABL A;  4RTZ A;  1M1K C;  2DK3 A;  3FRN A;  1MV0 B;  2OTJ T;  3JCM g;  3UWN A;  2QAS A;  5A2Q E;  2YXY A;  1KK7 A;  1BI0 A;  4WTO B;  1W1F A;  2DMO A;  3QYH B;  1M2O A;  2QEX Q;  1UFF A;  3C0C A;  4XTX A;  1EFN A;  2FPF A;  1U5S A;  4LDX A;  4F7U A;  1TUG B;  5GMK e;  3PGG A;  3G6E A;  2K7A A;  3LH0 A;  4RMO A;  1EX4 A;  3OYE A;  5FWC A;  2XKO C;  3G6E Q;  2YRV A;  3L2Z A;  4LDV A;  1PKT A;  4DBR A;  4OML A;  3REB B;  4EMK C;  2DO3 A;  2CDT A;  2CRE A;  2RJE A;  1D1A A;  3I35 A;  4M77 C;  1VA7 A;  1OQK A;  4PJN A;  4ELZ C;  2AZS A;  4C5G A;  4GLM A;  2OTL Q;  1VQ6 Q;  1UGP B;  3CBO A;  1FMK A;  4RTW A;  3OYC A;  1NJI R;  4C92 G;  4M7A F;  2KSS A;  3LGF A;  5CIU A;  3LWH A;  2E5K A;  1YIT T;  3FDR A;  2RJF A;  3CC4 T;  3J81 E;  4OB3 B;  1NBE B;  4IIM A;  2K3X A;  1VQ6 A;  2QYZ A;  2IPO B;  2ZPE B;  4J9H A;  9ATC B;  3EG9 B;  5GMK m;  4KH0 B;  2DZC A;  2X3W D;  4HCB A;  2RQV A;  2D1X A;  1VQP Q;  2DIL A;  3I5R A;  3H6Z A;  2VWF A;  2ENM A;  2DRK A;  2XU8 A;  3AT1 B;  1NEG A;  4J6X A;  4OVA A;  2CS7 A;  3IQL A;  4IUR A;  2E41 A;  1WA7 A;  1OUL A;  2RMO A;  3CPW A;  3M54 A;  3CMA T;  2VXF A;  3U23 A;  4C92 F;  2L89 A;  3CCS A;  1VQO T;  1ZSZ B;  4J6W A;  4M78 E;  1N8R C;  2DKG A;  1BKB A;  3GP8 A;  5GAM f;  2KXD A;  5KYW B;  4M7A C;  4PJJ A;  1YJW Q;  3OYD A;  3X25 B;  1W2B P;  1Z9Z A;  2D6F A;  3CC4 A;  4A4F A;  3A8M B;  1M5Q 1;  2YLB A;  4JUV A;  1Q86 U;  4N4H A;  2DET A;  2JJ9 A;  1SHF A;  3T9N A;  2ZPI B;  4LNP A;  1M2V B;  4M77 F;  2DJQ A;  4BI3 A;  1T0J A;  1KHC A;  1RAA B;  3MEW A;  1KIK A;  5I21 A;  2WSE E;  1WHM A;  3GOX A;  2K57 A;  3CC7 Q;  3H8Z A;  2MIO A;  2EVR A;  1XNI A;  4HA8 A;  5IXB A;  2FB7 A;  1MHN A;  2K3Y A;  1H8K A;  2MWO A;  4KH1 B;  4B6M A;  2L3R A;  4P5N A;  3ZL7 C;  3VS7 A;  2O9S A;  4XTV A;  4A4H A;  2EGE A;  4R56 A;  2YSQ A;  2KBT A;  2DL7 A;  2MPX C;  5GAN 6;  2MK5 A;  1AT1 B;  4XU2 A;  4FIB A;  2OTJ Q;  1X69 A;  3DLM A;  1HD3 A;  3EHR A;  3HHT B;  2CGH A;  2LJ0 A;  2M51 A;  3X24 B;  1YWO A;  3VS3 A;  3MEU A;  2XK0 A;  1OU9 A;  3EGX A;  3CCL A;  2KRO A;  1JB0 E;  4DOV A;  4QVD A;  2E6N A;  5FLX E;  1JEG A;  3RKX A;  1W2B S;  4JLG A;  3VRY A;  3G71 Q;  1OPK A;  1UB4 A;  2QA4 Q;  3R6O A;  1Q7Y R;  2QQA A;  1OPL A;  2D0Q B;  3MEA A;  3JCM f;  4ESR A;  1OV3 A;  4L5G A;  1P92 A;  4GY5 A;  2EW3 A;  3D7S B;  3VS4 A;  2V1R A;  3OB9 A;  1JXM A;  2RB6 A;  4EPC A;  2F5T X;  4CI0 C;  2E65 A;  2E4H A;  2KE9 A;  1YHQ A;  5HK0 A;  1KFZ A;  2XG8 D;  4BI8 B;  1E6G A;  2HAX A;  1UHF A;  1IB8 A;  3EFO A;  4XTY A;  3VJP A;  3MJX A;  3CCQ T;  1BCO A;  1B34 B;  3RNJ A;  4KRT A;  5GAO m;  1VQ5 Q;  2YT6 A;  3CEY A;  3OYG A;  3MP8 A;  1VQ8 T;  5FRO A;  1GCQ A;  3QDR B;  3M53 A;  2VB6 A;  1AHJ B;  3BFM A;  4PLL A;  5GMK l;  2BZ8 A;  2MYS A;  2K5I A;  1UUE A;  1JBM A;  4XU1 A;  4AMC A;  1M90 R;  1QW1 A;  1XJW B;  3CMA Q;  3SWN B;  1R8O B;  4AT1 B;  4FT4 A;  1W4S A;  2OI3 A;  2J6O A;  4JJB A;  2L5Q A;  2MAM A;  1BK2 A;  1HK9 A;  1PKS A;  4F7U G;  2J05 A;  2KMT A;  4Z02 A;  3JB9 H;  4BE2 A;  2NUP B;  3VS0 A;  4DOW A;  4ZGD B;  1C6V X;  4QQD A;  2JTM A;  2PQW A;  2VYT A;  2RI5 A;  4LUE A;  1YJW A;  3JCM P;  1JJ2 A;  2NLU A;  2M9U A;  1KD1 R;  3PNW C;  4BAC A;  3RBB B;  3OYB A;  3QJY A;  4VUB A;  5FU7 C;  4M75 D;  2D0N A;  5GAM e;  3SB2 A;  5FRM A;  2GFA A;  3UF4 A;  2RO0 A;  1CSK A;  2CUB A;  4M7D C;  2CP2 A;  3OA6 A;  2YUP A;  1I1J A;  4FYY B;  3FC3 A;  5GAN e;  3CCJ A;  4II1 A;  3A8O B;  1BIB A;  4BY6 B;  2IG0 A;  1SPK A;  3VV0 A;  4M4Z A;  5D6Y A;  1WZO A;  4ORZ A;  3HSB A;  1I5L A;  1YIT A;  2K79 A;  2FL7 A;  1TWB A;  2M02 A;  2K6D A;  2DE0 X;  1WHL A;  5IT9 E;  3O8V A;  2EPD A;  3M4G A;  4HVU A;  5GAN f;  2L3P A;  5L8R E;  1M27 C;  1K9M U;  1ZUK A;  1Y57 A;  2M1H A;  2VV5 A;  1QVF A;  1JXO A;  2M0O A;  1QVF S;  4FL6 A;  2LT1 A;  2CYZ B;  1MUZ A;  2IVW A;  3BDU A;  5GAN 3;  5FWB A;  3E9F A;  5D7U A;  1M3C A;  1N6A A;  3NMZ C;  5HY6 A;  1OEB A;  2FZK B;  3NFC A;  1Y07 A;  2RI3 A;  5IXF A;  1WYX A;  4HT8 A;  2DFU A;  2MCN A;  3G6E T;  2EJF A;  8AT1 B;  1KQ1 A;  1E6H A;  3EFS A;  1UJ0 A;  1G83 A;  3H0F A;  2LQK A;  4LD6 A;  1B34 A;  2DZ9 A;  4BE1 A;  1TH7 A;  2HCK A;  2LQ8 A;  1VIE A;  3OS0 A;  2CT3 A;  1Y96 B;  4J8O A;  4AFQ C;  1X01 A;  1QLY A;  1VOM A;  5GAO r;  4AFS C;  3JB9 I;  1UGQ B;  5GAN 5;  2YUO A;  5GAN g;  3V7R A;  1SF9 A;  2K2V A;  2O4X B;  2NYS A;  3VKI A;  1G3W A;  1PRL C;  2A3L A;  2XID A;  2DL5 A;  5C0M A;  2C0T A;  1RLQ C;  2E70 A;  1JJ2 S;  3CCU T;  4IKF A;  1WHH A;  1NEB A;  3QBY A;  4C92 E;  4EMK A;  2V8K A;  2XI9 A;  3TVT A;  4M77 G;  1NJI C;  3E19 A;  5GMK h;  2ZZD A;  4JDS A;  2O88 A;  1V1C A;  1DJ7 B;  3QXE B;  4X1V A;  1H3Z A;  2EYQ A;  2AKL A;  3CME T;  1LOJ A;  3OMG A;  2AIR B;  1I0C A;  1YIJ T;  1IRE B;  3JCM W;  2I0N A;  2DL8 A;  2JZ2 A;  3VUB A;  2KK4 A;  3EGX B;  4OB1 B;  2KT8 A;  4OMP A;  1YI2 T;  2BE9 B;  1AD5 A;  3OSS C;  2KXC A;  2NWM A;  4RCC A;  1MV3 A;  5AYF A;  3OBY A;  2HD0 A;  3JB9 F;  1E7O A;  3NTI A;  5CCA A;  2QG9 B;  3ER0 A;  2YHT A;  1SSF A;  2DYB A;  3HFO A;  4EMG A;  1K76 A;  3DLL A;  1M1K U;  1IO6 A;  1U8R A;  4ATO A;  2EYY A;  3M0P A;  2F2X A;  5IHK A;  2DJZ A;  1ZBX A;  3MO8 A;  2B86 A;  1RLP C;  5GAM j;  2CKK A;  3VS2 A;  4GLK A;  3ULR B;  1UHC A;  2RK2 A;  3I56 A;  2ZPF B;  2OAU A;  3VS1 A;  4C8Q F;  1WGS A;  1RAF B;  4BB7 A;  2JS0 A;  1OU8 A;  1VQL T;  1WHJ A;  1C0M A;  2M16 A;  3E9G A;  2BTT A;  1PC0 A;  3X20 B;  1YIJ A;  2D8J A;  1NZ9 A;  2LX7 A;  4A4K A;  3OYK A;  4M7A G;  2JUF A;  3CCS Q;  3WVD B;  1WXU A;  4J83 A;  2RHU A;  4E6R A;  3CD6 A;  2WSC E;  1PNJ A;  2DEQ A;  3HKS A;  4F17 A;  1ZSG A;  4MDX A;  1K8A U;  2E3H A;  2HL3 A;  4F7U E;  1NG2 A;  4IIO A;  5FRN A;  2BZY A;  3PFS A;  4QQ6 A;  2JXB A;  1Y7X A;  1MNE A;  1OZ2 A;  5CKD A;  4PFP A;  1RI0 A;  3OY9 A;  2F2W A;  2OTJ A;  5GAN 7;  3OBW A;  1Q81 C;  2LP5 A;  3CQT A;  1M3B A;  5I2M A;  1S1N A;  1WIE A;  2FO0 A;  4HVV A;  4FSX A;  3OMC A;  2DX1 A;  3VS6 A;  3SEM A;  2RNA A;  1SSH A;  2D9T A;  1KJW A;  2EJ9 A;  4Y91 A;  2RN8 A;  5FU6 B;  4PJO B;  5DLQ E;  1YCY A;  3CCE A;  2KRM A;  1AOJ A;  4F7U F;  5CK9 A;  4PLI A;  4M75 C;  1N5Z A;  4JS5 A;  3LH5 A;  3CCV Q;  1QP2 A;  1VQP A;  5DM7 R;  4KUL A;  2HMA A;  1GBQ A;  1GCQ C;  2QGF B;  4QVZ A;  2HBP A;  4NS5 A;  2DYI A;  2I2L A;  1VQL A;  1ZUU A;  1ZBJ A;  2JM9 A;  1OX8 A;  5GJV B;  1TU0 B;  4NOY A;  4E7K A;  8ATC B;  3VRZ A;  3CCM Q;  1YJN A;  4C8Q C;  1VQM T;  3HRS A;  5LJ3 g;  2QTV A;  3EGU A;  4TVR A;  4C92 D;  2EAY A;  2EYX A;  2K9G A;  1YBY A;  2HQH A;  2ZPH B;  3PIP A;  2SRC A;  2GF7 A;  3CME A;  2J7I A;  2DM1 A;  1UG1 A;  3JCM h;  1X75 C;  1D1C A;  2DXU A;  1V76 A;  1QWE A;  3QDF A;  3CPW S;  2DRM A;  2QQR A;  2O01 E;  3OW2 S;  3OYM A;  3FJ5 A;  4L59 A;  1ACM B;  1FX7 A;  3VYH B;  3BY7 A;  3G7Z A;  2XDB A;  3PVL A;  2YRC A;  3MET A;  2X9H A;  4M78 F;  2O4X A;  3SHW A;  4JLI A;  3KFV A;  4B9W A;  3A98 A;  3UDC A;  2AT1 B;  2EGC A;  3HTR A;  2Z0W A;  4RTV A;  2XDD A;  4C8Q G;  1NYF A;  5CR2 A;  2H8H A;  1VQ8 A;  1VQN A;  2HQX A;  4J9G A;  4ZGE B;  5A0D A;  3P8D A;  4FW2 A;  4C92 A;  2VC8 A;  3QZ5 B;  4M75 E;  3L2W A;  4OMM A;  1O75 A;  5GAM d;  1KQS S;  1AWW A;  2OTL A;  1BI3 A;  2KYM A;  3HP9 A;  2QEX A;  2F5K A;  4XU0 A;  4DEY A;  2A36 A;  1PHT A;  5GAN 2;  2XDP A;  4UC4 A;  4XTZ A;  3OQ5 A;  4DBQ A;  2L8D A;  2EFI A;  5I11 A;  1HSQ A;  1UGV A;  4E7L A;  4RTT A;  3OYN A;  2HBW A;  1GFD A;  1S72 T;  2OX7 A;  2GTO A;  2AKK A;  2LQW A;  5L23 A;  2HZY A;  4E7S A;  4M77 B;  4A54 A;  3UT1 A;  3UPU A;  1GCP A;  1X43 A;  2DIG A;  2JT4 A;  1N8R R;  1WQ7 A;  3M9Q A;  5KYY B;  1ZA1 B;  4EMH A;  2DXT A;  2DTO A;  2L3S A;  1VQ5 T;  4IUU A;  1KSW A;  1AZE A;  1M30 A;  4J9C A;  1D0Z A;  1HYO A;  1G3T A;  2LT4 A;  1VQ5 A;  2RHY A;  1LCK A;  1PM3 A;  4PJO C;  1NPP A;  4E7H A;  4CC4 B;  2EBP A;  1QVF P;  2K3B A;  3V8J A;  3RR6 A;  3BE3 A;  3CD6 Q;  2NUP A;  1KC8 U;  1TUC A;  3CCJ T;  2FPD A;  4D6W A;  1YWP A;  2X35 A;  1X6G A;  1KG1 A;  5DY9 A;  5LJ3 h;  1PSF A;  5J39 A;  1M1K R;  2ECZ A;  3G71 T;  2KDS A;  3CCL Q;  1QCO A;  3M0U A;  3SWN A;  1FXX A;  3G4S T;  2FYK A;  1VQ4 A;  1TOV A;  3FIF A;  3X28 B;  2DXC A;  4IUQ A;  4M7A B;  2K5L A;  2KAF A;  1IHV A;  4ZNX A;  4X34 A;  3JCM V;  2P4T A;  2H3J A;  4RCB A;  2LCC A;  3JB9 D;  4C0G A;  4PJO A;  3LGL A;  4HVW A;  4KUI A;  1NLP C;  2DIQ A;  3OYI A;  3EFR A;  3MHX A;  2YUN A;  2DXB A;  2A28 A;  2KVQ G;  2DBM A;  3TQ7 P;  1RUW A;  4PKC C;  3OS2 A;  3FLG A;  2DAQ A;  2LRQ A;  1PRM C;  2FRY A;  1TUD A;  1MMN A;  4JRQ A;  4XAX B;  1YHQ T;  2G3R A;  3LLR A;  4JZ4 A;  2RJC A;  3H9N A;  4LD9 K;  2E3I A;  3L1A A;  3EGD A;  1QVG A;  3JV3 A;  1NJI U;  3I55 T;  1M4Z A;  1QQJ A;  4LXC A;  3QO3 A;  3WXM B;  1G3Y A;  3M4Y A;  4LDU A;  2RPN A;  3EG1 A;  1K0S A;  4AG1 C;  2DEU A;  3RMS A;  1LJO A;  2P4R A;  2KT1 A;  4MML A;  2DBK A;  4DEX A;  1JU5 C;  3S3M A;  4BDZ A;  1K1Z A;  5I22 A;  4Z88 A;  2AZV A;  1X2Q A;  5CKB A;  3THK A;  1VQ9 T;  1Q81 R;  2CH4 W;  3EG0 A;  1SHG A;  1B7T A;  4C0D C;  2F2V A;  3CCE T;  5LJ5 d;  4AFU C;  3E1S A;  1YCS B;  4PNO A;  1YFN A;  2RJD A;  5CAI A;  3EG9 A;  1GFC A;  1HXD A;  4BI4 A;  4OMQ A;  2R5M A;  1RAC B;  3JAM E;  2ZPB B;  2HDA A;  4C0D B;  3J7A F;  2QXF A;  2CP0 A;  4RTY A;  1Q82 R;  1N27 A;  1FWZ A;  1VQP T;  1G5V A;  4C92 C;  5GJW B;  1D0X A;  1ZLM A;  1YJ9 T;  1ABQ A;  1G8X A;  1NPR A;  2LJ1 A;  1VQ7 A;  1CKA A;  1K9M C;  1M1G A;  2YWW A;  2C0O A;  3AHU A;  1IHW A;  2EQJ A;  1EZZ B;  3EG3 A;  2LZ6 B;  1BI2 A;  2CZ1 B;  5GAN 4;  2JNG A;  3OW2 A;  1ZQ1 A;  3S6W A;  4XQ3 A;  4M75 A;  1UEB A;  1PD0 A;  4O5V A;  4E7I A;  4A4E A;  3M57 A;  4ANJ A;  1AEY A;  5LJ5 j;  4M7D F;  1VQ7 Q;  4BY6 C;  2QTX A;  1WDX A;  4ZN1 A;  2DL3 A;  4Q5W A;  2RI2 A;  4NL2 A;  4EMK B;  4KGV B;  1RI9 A;  1Q82 U;  2LX9 A;  4PK4 A;  3C95 A;  2HNI A;  2P84 A;  3C12 A;  3CCR Q;  3MKD A;  2JVV A;  2HKN A;  4E7J A;  2ROT A;  5IAY A;  1ARK A;  1SRM A;  3GNG A;  1VQ8 Q;  3NPF A;  2QQ9 A;  4EDU A;  4EIK A;  1Y96 A;  2RHX A;  1LVK A;  3JCM b;  5HK3 A;  3TSW A;  2C0I A;  2E10 A;  1UE9 A;  1U3O A;  4N4I A;  3JB9 G;  2RQW A;  1NE8 A;  3MCA B;  5LJ5 g;  2A0F B;  4LDY A;  1YI2 A;  3ZFJ A;  5GAN h;  5KYN A;  4NL3 A;  2PUO B;  2RA2 A;  4XK8 E;  2W10 A;  2Y4Y A;  1PG5 B;  4JRI A;  3CPW P;  3QWX X;  1W2B A;  4R55 A;  1X2K A;  1M8M A;  1WFW A;  1ABO A;  2COW A;  3L2U A;  2HSE B;  3A8H B;  2FPE A;  2V26 A;  3JCM c;  3M0S A;  2EQU A;  1VYV A;  4Z89 A;  4RKU E;  4DQ2 A;  1QCF A;  2A08 A;  1WHK A;  2BKD N;  5LJ3 j;  4M7A A;  3CCU A;  3L42 A;  4J9I A;  4JJN K;  3OYH A;  1WX6 A;  1B3Q A;  5LJ5 f;  4PJL A;  2L2P A;  4AFZ C;  3JCM e;  4JRP A;  1MND A;  2DD4 A;  4PJO D;  2LJ3 A;  4JJD A;  2HKQ B;  3OYA A;  1IXD A;  4OGE A;  3V8L A;  1ZUY A;  1X6O A;  1KQS P;  2JTE A;  3ZBD A;  1KQ2 A;  3MP1 A;  3CCE Q;  1OI1 A;  2PNI A;  4AG2 C;  1YJ9 A;  2LQN A;  3URG A;  3F70 A;  2O31 A;  3QKJ A;  4ELY C;  1T3S A;  1N9S A;  1CKB A;  3BW1 A;  2KRS A;  2QQS A;  5ECA A;  1RAD B;  1K73 R;  3CC2 A;  1AVZ C;  3A8L B;  4WF2 A;  3JRZ A;  5J3B A;  4J5Y A;  2CT4 A;  3KBG A;  2RH2 A;  4ZGJ B;  1M3A A;  2SEM A;  4Z8A A;  1G2B A;  2LNV A;  4JPB W;  1ZX6 A;  3CCV A;  3KXT A;  4WCI A;  3CD6 T;  3P8B B;  1VQ9 A;  4C8Q E;  4B9X A;  1X27 A;  1VQO Q;  2KYB A;  3O5Z A;  4M7D D;  3KUF A;  4F16 A;  1YI2 Q;  5EG2 A;  5GAO p;  4RTX A;  4M77 A;  2DER A;  2RHI A;  1D1B A;  4DA4 A;  3VUZ A;  4L6V 5;  5CQY A;  3QSU A;  1Q7Y C;  1S72 A;  4C8Q B;  2ROL A;  3S3O A;  2X3X D;  3MP6 A;  1WNL A;  5C6S A;  3CCJ Q;  3WVE B;  1QKW A;  1B07 A;  2RQT A;  5AT1 B;  3NGP A;  3DKM A;  3I55 Q;  1D09 B;  1D3B B;  2CSI A;  2LMJ A;  2FHD A;  3V8K A;  4LE9 A;  1VQ4 Q;  2OAW A;  1H92 A;  5GAM g;  1WPY A;  3CC7 A;  1SRL A;  3ZEH A;  2FG0 A;  4C0Z A;  2E64 A;  4OGC A;  3CC2 Q;  3A1P A;  2D8H A;  2RQU A;  2X4W A;  2EGA A;  2ESW A;  4D8K A;  4OB2 B;  3UAT A;  2HEQ A;  2A7Y A;  2NUZ A;  1N8R U;  2YDL A;  3JCM X;  3CXC P;  4XU3 A;  2CZ6 B;  2YRD A;  4FM4 B;  2F1L A;  3GNF B;  4CC7 A;  1A0N B;  1VUB A;  1QWF A;  3CBM A;  1FYN A;  2F69 A;  4QW2 A;  1KC8 C;  2PVO B;  4J6Y A;  1YJW T;  3I56 Q;  3CCM T;  2QAZ A;  1ZA2 B;  1C1A A;  4PJM A;  4MDW A;  1UGS B;  2CSQ A;  1SEM A;  1BCM A;  2EIF A;  3G4S Q;  1RAB B;  1YIJ Q;  4KGX B;  3X26 B;  1XQH A;  2COY A;  1TXQ A;  3BDL A;  3CMA A;  1LNX A;  1PWT A;  4LUD A;  1VQK A;  1Q7Y U;  2LCS A;  3NHN A;  3MPU B;  1X6B A;  3GBQ A;  3LYI A;  4MZM A;  5GAO l;  4IUV A;  2RHZ A;  2ZCF B;  3G4S A;  3EHQ A;  2Y90 A;  1XTD A;  1UDL A;  2MMP A;  1MMG A;  2VUB A;  4DBH A;  4FYV B;  3JSC A;  4OMN A;  4FW1 A;  3PTA A;  1JJ2 P;  3GF5 A;  4QKU A;  1WI7 A;  2G6F X;  2ED0 A;  2KGT A;  3ME9 A;  4CRI A;  2DA9 A;  3GLX A;  4OB0 B;  4KT0 E;  3EH2 A;  3HPW A;  3GPL A;  4ZTF A;  1SKU B;  1QMC A;  1SG5 A;  4FU6 A;  4BD3 A;  3LWI A;  1VQM Q;  3OYF A;  4M78 B;  4OMF B;  2VGN A;  1VQN Q;  5CO7 A;  3QYG B;  1LPL A;  4PJO G;  2JN0 A;  4ZN3 A;  1YJN T;  1GBR A;  1WLP B;  3L2R A;  1QVG S;  2P0Q A;  1O9S A;  2JW4 A;  4C5I A;  5LJ5 h;  3FB9 A;  3CCR A;  1WHG A;  5KCH A;  3OYY A;  1M2V A;  5KYY A;  4BDY A;  2ZPG B;  2COZ A;  4C5H A;  4M7D G;  2QEX T;  2JOY A;  3M58 A;  1VYU A;  3OS1 A;  2GQV A;  1QVP A;  2EKH A;  2VGM A;  1TS9 A;  2CZ0 B;  1I4K 1;  2BE7 D;  3L2Q A;  1I5O B;  1Y0M A;  3H0I A;  5IHN A;  5KYW A;  1AWJ A;  1VQN T;  3I9Q A;  1RAE B;  1ZSZ A;  1J3T A;  3HRU A;  4QVC A;  1Q86 C;  1VQ7 T;  2MOX A;  2O9V A;  4DBF A;  4ME7 A;  1YJ9 Q;  5CVI A;  2JMA A;  1ZSZ C;  2RD1 A;  1K0X A;  2J6F A;  2LC4 A;  3JB9 J;  2JMC A;  2H3E B;  4M78 D;  1OZ3 A;  4JS4 A;  2VXE A;  1YNZ A;  2FRW A;  4HCZ A;  1I8F A;  2ED1 A;  4C8Q A;  5IH2 A;  4PFZ A;  3TU4 K;  4BUG A;  3SFM A;  3TSZ A;  3RIR A;  3M55 A;  2J6K A;  3RKY A;  1U1S A;  4HT9 A;  5HCK A;  3Q1J A;  4JJC A;  2AHJ B;  1TTH B;  1G3S A;  1WJS A;  1HJD A;  1WXT A;  5KYU B;  3M5A A;  1U1T A;  4F7U B;  2JS2 A;  2MI6 A;  2ZGW A;  2GGR A;  5KE3 A;  3CPF A;  1YHQ Q;  2M0Y A;  5GAO q;  4PJO F;  5CKF A;  4FYX B;  1XOV A;  5KH6 A;  4KGZ B;  2RK1 A;  1KHI A;  5FU6 C;  2PZ1 A;  5GAN 8;  3I55 A;  2V1Q A;  3TEE A;  4N4G A;  1VQ6 T;  4OF1 A;  4FCY A;  2XIC A;  1EIF A;  2QK0 A;  3CXC S;  1R77 A;  1VQL Q;  2KQW A;  2P0K A;  5CKE A;  4K11 A;  5KYX B;  4HKE A;  2V8I A;  3PMI A;  3ASK A;  4J9D A;  1GRI A;  1JRI A;  2BIV A;  4A63 B;  3HRT A;  2DD5 A;  2LVM A;  4MZP A;  4MZT A;  4J9B A;  5LJ3 f;  2WAC A;  1JQQ A;  1BB9 A;  1T3L A;  4YTL A;  2KY9 A;  1OOT A;  1S72 Q;  1VQ4 T;  2ATC B;  4M75 G;  1YJN Q;  2EJG A;  3PE0 A;  5EC7 A;  1VYT A;  4J7F A;  5A0G A;  5GAN d;  2K4Y A;  2QA4 A;  4XTW A;  3M0T A;  5FW9 A;  1AWX A;  2QA4 T;  3A8G B;  2W0Z A;  2KI7 A;  4IUP A;  2DF6 A;  3OS5 A;  4E2F B;  2EYW A;  4M7D B;  3SWN C;  1V29 B;  3MEV A;  1Q95 G;  3TRE A;  2QDL A;  4A53 A;  4BE0 A;  4F04 B;  2CUD A;  5GAM h;  2FZC B;  3H0H A;  2DLP A;  4ZTJ A;  3NTH A;  1NLO C;  3OSV A;  3J80 E;  1F1B B;  3N5B B;  3DB3 A;  2AK5 A;  2LNH B;  3QWY A;  2YLC A;  3RKW A;  4F14 A;  2VAS A;  4FSS A;  5GMK i;  1K8A R;  2CP3 A;  4J9E A;  3PMT A;  4M75 B;  3FJP A;  4N0A C;  4R0K A;  3HL8 A;  5LL6 S;  3CCR T;  1RL2 A;  1I81 A;  1FMV A;  1RAI B;  4HCK A;  3E2U A;  3QZ9 B;  2GBQ A;  1YIT Q;  3M0Q A;  1Q86 R;  1MMA A;  2EQI A;  4CC2 A;  1VQK Q;  2V8J A;  2GTJ A;  5KYU A;  2E1H A;  4IUT A;  4RTU A;  5CKH A;  2OJ2 A;  1YP5 A;  3PT9 A;  2PVD B;  3OW2 P;  3QPH A;  1R0B G;  2DVJ A;  3NTK A;  4OP0 A;  3I5S A;  3CCU Q;  1TG0 A;  1ZHI A;  2FEI A;  2DTI A;  4C0F A;  2KEA A;  4QQG A;  3CBP A;  1K9M R;  4Y92 A;  4E47 A;  1KQS A;  2VVK A;  1IZ6 A;  2IIM A;  3RUX A;  2QGG A;  1H3H A;  4D8D A;  3V7C A;  5LJ3 d;  3H41 A;  1TSF A;  3JCM J;  2VKN A;  5KE2 A;  2KRN A;  1PD1 A;  2RM4 A;  5IN1 A;  1PCX A;  2A37 A;  1UGR B;  4QT7 A;  3INZ A;  2KR3 A;  2LTO A;  3C94 A;  2QQB A;  1KC8 R;  4M7A E;  1M8V A;  2L3Q A;  3OYL A;  4OMO A;  4M78 C;  1UJY A;  4JZ3 A;  5HKC A;  1MGQ A;  1N9R A;  1MMD A;  2ZAE A;  4JRK A;  2BZX A;  2NUT A;  4GBQ A;  2YUQ A;  4RG2 A;  1K8A C;  4V2S A;  3CC4 Q;  2C06 A;  1GXI E;  2X4X A;  2LDM A;  3PVQ A;  2DNU A;  1K9A A;  3EFO B;  2XMF A;  3RER A;  1K73 C;  1K4U S;  1QP3 A;  2X51 A;  1K73 U;  3S3N A;  5D6W A;  1BBZ A;  5A0L A;  3CCM A;  3QII A;  4C5E A;  3CCQ Q;  1I07 A;  1D0Y A;  2XD0 A;  3A5Z B;  4XTU A;  1H64 1;  4N0A A;  1Z9Q A;  2L0A A;  3L2V A;  2JM8 A;  4HCC A;  6AT1 B;  2RF0 A;  2GFU A;  2R5A A;  2R57 A;  4RUG A;  4M77 D;  5GMK j;  3M59 A;  3CXC A;  4M78 G;  5LJ5 e;  1M9S A;  4HXJ A;  1T0H A;  4M78 A;  3QHS A;  4A4G A;  1BYM A;  2K5F A;  3QJ6 A;  4KUD K;  3EGD B;  2KNB B;  3VU3 C;  3EG2 A;  2RQR A;  3CC7 T;  4PL6 A;  4X9C A;  3UA7 A;  3UA6 A;  4RG8 A;  5D6X A;  2E6Z A;  2PTK A;  3EAE A;  1R0C B;  3CCV T;  2GCX A;  4M77 E;  2CH4 A;  4J9F A;  4KBM B;  2B8A A;  2CZ7 B;  1M90 U;  5LJ3 e;  4FYW B;  1BU1 A;  4LDW A;  2NUT B;  1BIA A;  2DTH A;  3PIO A;  1QKX A;  1M1F A;  5KCO A;  1VIF A;  4Y28 E;  4FT2 A;  2X4J A;  3M0R A;  2OTL T;  1WQW A;  4X9D A;  2EQM A;  3RMQ A;  2DL4 A;  3GIB A;  4MMK A;  1VQK T;  1AZG B;  2QI2 A;  2R58 A;  2JTF A;  3CME Q;  1W70 A;  3CC2 T;  2GNC A;  3RES A;  3M56 A;  1VQ9 Q;  2X4Y A;  2P0P A;  2PU9 B;  3SDZ A;  2GQI A;  3JCM d;  1WJQ A;  4M7A D;  3LX7 A;  4CC3 A;  2J06 A;  2HQE A;  3FEO A;  3JCM Q;  1M90 C;  3LW5 E;  2EYZ A;  3HFN A;  2O2O A;  1IGQ A;  2DVE A; 
#chains in the Genus database with same CATH homology
 4HVU A;  1UTI A;  1W6X A;  1GBR A;  4HVW A;  2L3P A;  1M27 C;  1NLP C;  1WLP B;  1ZUK A;  1Y57 A;  3VS5 A;  2YUN A;  1JXO A;  2JW4 A;  2A28 A;  2DBM A;  1MUZ A;  1RUW A;  5FWB A;  1M3C A;  3REA B;  1PRM C;  2FRY A;  3NMZ C;  1AWO A;  1TUD A;  4JZ4 A;  2HSP A;  1VYU A;  1OEB A;  2EKH A;  3JV3 A;  1YN8 A;  5IXF A;  1WYX A;  2MCN A;  5IHI A;  1E6H A;  1Y0M A;  3H0I A;  1UJ0 A;  1G83 A;  1UEC A;  2K2M A;  5IHN A;  1U06 A;  3H0F A;  2RPN A;  1AWJ A;  3EG1 A;  3I9Q A;  1K0S A;  2HCK A;  1J3T A;  4AG1 C;  2CT3 A;  3R6N A;  2MOX A;  4AFQ C;  2O9V A;  1QLY A;  2P4R A;  2KT1 A;  2DBK A;  4DEX A;  1JU5 C;  4AFS C;  2JMA A;  2YUO A;  1K1Z A;  5I22 A;  4Z88 A;  2AZV A;  1K0X A;  1PRL C;  2J6F A;  1X2Q A;  4LN2 A;  3THK A;  2DL5 A;  2CH4 W;  2C0T A;  3EG0 A;  1SHG A;  1RLQ C;  2JMC A;  1NEB A;  1NYG A;  2F2V A;  4AFU C;  1YCS B;  1YNZ A;  3TVT A;  1GFC A;  2FRW A;  2ED1 A;  1WXB A;  5IH2 A;  1JO8 A;  4OMQ A;  2O88 A;  1V1C A;  2HDA A;  1NM7 A;  3TSZ A;  1GL5 A;  2ABL A;  4RTZ A;  4X1V A;  2J6K A;  4RTY A;  2AKL A;  5HCK A;  1MV0 B;  1I0C A;  5GJW B;  4JJC A;  1ZLM A;  1HJD A;  1WXT A;  2I0N A;  2DL8 A;  1ABQ A;  2JS2 A;  1W1F A;  2LJ1 A;  2DMO A;  1CKA A;  2GGR A;  2KT8 A;  4OMP A;  2C0O A;  2M0Y A;  1UFF A;  1AD5 A;  2KXC A;  3C0C A;  2NWM A;  1EFN A;  2FPF A;  1U5S A;  1XOV A;  3EG3 A;  2LZ6 B;  1MV3 A;  2PZ1 A;  2K7A A;  1E7O A;  2V1Q A;  5FWC A;  1PKT A;  4OML A;  3REB B;  2DYB A;  1K76 A;  2CDT A;  2CRE A;  1AEY A;  1IO6 A;  2EYY A;  3I35 A;  3M0P A;  2F2X A;  5IHK A;  1VA7 A;  4K11 A;  2B86 A;  1WDX A;  2AZS A;  2DL3 A;  4J9D A;  1GRI A;  1RLP C;  3VS2 A;  3ULR B;  1UHC A;  4GLM A;  1RI9 A;  4A63 B;  3VS1 A;  1FMK A;  4RTW A;  2JS0 A;  4J9B A;  2BTT A;  1JQQ A;  1BB9 A;  1T3L A;  2D8J A;  2LX7 A;  2ROT A;  2E5K A;  1SRM A;  1ARK A;  1OOT A;  3NPF A;  1WXU A;  4EIK A;  4E6R A;  4IIM A;  1PNJ A;  4F17 A;  3PE0 A;  3TSW A;  5EC7 A;  1ZSG A;  1VYT A;  2C0I A;  1UE9 A;  1U3O A;  4J9H A;  2RQW A;  1NG2 A;  4IIO A;  3M0T A;  2BZY A;  5FW9 A;  1AWX A;  2JXB A;  2W0Z A;  2X3W D;  2DF6 A;  2RQV A;  2D1X A;  2W10 A;  2EYW A;  2DIL A;  3I5R A;  2VWF A;  3QWX X;  2F2W A;  1X2K A;  1M8M A;  2ENM A;  2LP5 A;  1WFW A;  2DRK A;  1ABO A;  3CQT A;  1M3B A;  1NEG A;  1S1N A;  2QDL A;  1WIE A;  2FO0 A;  4HVV A;  2DX1 A;  3VS6 A;  3SEM A;  2FPE A;  3IQL A;  2RNA A;  2CUD A;  1SSH A;  1KJW A;  3H0H A;  1WA7 A;  3M0S A;  2RMO A;  1VYV A;  2RN8 A;  4Z89 A;  2DLP A;  3U23 A;  1QCF A;  1NLO C;  2A08 A;  2KXD A;  2AK5 A;  2LNH B;  2KRM A;  3QWY A;  4F14 A;  1AOJ A;  1N5Z A;  4J9I A;  4FSS A;  1Z9Z A;  3LH5 A;  4J9E A;  1WX6 A;  1B3Q A;  2L2P A;  4AFZ C;  1GBQ A;  1GCQ C;  4R0K A;  2LJ3 A;  1SHF A;  4JJD A;  4LNP A;  2DJQ A;  1T0J A;  1ZUU A;  1ZBJ A;  2JM9 A;  4HCK A;  5GJV B;  1KIK A;  1ZUY A;  2GBQ A;  3M0Q A;  3VRZ A;  2EQI A;  4CC2 A;  2JTE A;  2GTJ A;  2MIO A;  4RTU A;  2OJ2 A;  2EVR A;  1YP5 A;  3EGU A;  2EYX A;  2K9G A;  2DVJ A;  2PNI A;  4AG2 C;  5IXB A;  3I5S A;  2LQN A;  1TG0 A;  2FEI A;  1H8K A;  2SRC A;  2KEA A;  4Y92 A;  2J7I A;  2O31 A;  2VVK A;  2DM1 A;  1UG1 A;  2IIM A;  3ZL7 C;  1T3S A;  1H3H A;  1CKB A;  3VS7 A;  2KRS A;  1QWE A;  2O9S A;  2DRM A;  2EGE A;  4D8D A;  2YSQ A;  2KBT A;  5ECA A;  2DL7 A;  3H41 A;  1AVZ C;  2VKN A;  1X69 A;  3FJ5 A;  1HD3 A;  2CT4 A;  2KRN A;  3EHR A;  2LJ0 A;  2M51 A;  1M3A A;  2SEM A;  1YWO A;  2A37 A;  4QT7 A;  4Z8A A;  3PVL A;  1G2B A;  3VS3 A;  4JPB W;  1ZX6 A;  2KR3 A;  4WCI A;  2KRO A;  3SHW A;  3KFV A;  1X27 A;  2L3Q A;  2KYB A;  3O5Z A;  4F16 A;  3A98 A;  4OMO A;  1UJY A;  1JEG A;  4RTX A;  2EGC A;  4RTV A;  3VRY A;  4JZ3 A;  1OPK A;  1NYF A;  1OPL A;  2H8H A;  2BZX A;  4GBQ A;  2YUQ A;  4ESR A;  4J9G A;  2ROL A;  1OV3 A;  2X3X D;  2EW3 A;  1QKW A;  1B07 A;  2RQT A;  3VS4 A;  2V1R A;  2DNU A;  1K9A A;  3NGP A;  3PVQ A;  2XMF A;  2CSI A;  2LMJ A;  1K4U S;  1JXM A;  4OMM A;  4LE9 A;  2OAW A;  1AWW A;  1BBZ A;  1H92 A;  2KYM A;  2KE9 A;  1I07 A;  1SRL A;  1KFZ A;  2FG0 A;  1E6G A;  4DEY A;  2A36 A;  1UHF A;  1PHT A;  2D8H A;  2RQU A;  1Z9Q A;  2EGA A;  2L0A A;  2ESW A;  4D8K A;  2JM8 A;  3UAT A;  5I11 A;  1HSQ A;  1UGV A;  2RF0 A;  2HEQ A;  2NUZ A;  3RNJ A;  2YDL A;  4KRT A;  4RUG A;  4RTT A;  2YT6 A;  2HBW A;  1GFD A;  2GTO A;  1GCQ A;  2AKK A;  2LQW A;  4HXJ A;  1T0H A;  5L23 A;  1GCP A;  1X43 A;  4CC7 A;  1A0N B;  2BZ8 A;  1QWF A;  2JT4 A;  2KNB B;  3EG2 A;  1FYN A;  1UUE A;  2RQR A;  3UA7 A;  3UA6 A;  2PTK A;  2OI3 A;  2J6O A;  4JJB A;  1BK2 A;  2L3S A;  2CSQ A;  1SEM A;  2CH4 A;  1KSW A;  1PKS A;  4J9F A;  1AZE A;  1M30 A;  2J05 A;  4J9C A;  3VS0 A;  1BU1 A;  1PWT A;  4LUD A;  2LCS A;  1LCK A;  3NHN A;  1QKX A;  4LUE A;  4CC4 B;  1X6B A;  3GBQ A;  2EBP A;  2K3B A;  3RBB B;  3M0R A;  3EHQ A;  1UDL A;  2D0N A;  2DL4 A;  1TUC A;  2FPD A;  4OMN A;  3UF4 A;  1CSK A;  2CUB A;  1YWP A;  1AZG B;  1WI7 A;  2G6F X;  2ED0 A;  1X6G A;  2KGT A;  1W70 A;  2YUP A;  2GNC A;  1I1J A;  2ECZ A;  2DA9 A;  3M0U A;  1SPK A;  4M4Z A;  2GQI A;  4ORZ A;  4CC3 A;  2J06 A;  2K79 A;  2EYZ A;  4ZNX A;  2O2O A;  2K6D A;  2DE0 X;  2EPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...