2K3BA

Seeing the invisible: structures of excited protein states by relaxation dispersion nmr
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
APWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-binding protein
publication title Structures of invisible, excited protein states by relaxation dispersion NMR spectroscopy
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 11
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k3bA00
4KRTA 1ABOA 2A36A 2EQIA 5IXFA 2BZ8A 4ESRA 3H0IA 2KNBB 3TSWA 1XOVA 2LQNA 1E7OA 2O88A 1UG1A 2EYWA 2MIOA 4J9HA 2KYBA 3ZL7C 3H0FA 3KFVA 1BB9A 4J9FA 1QLYA 3QWXX 3SEMA 1OV3A 2JMCA 3UATA 3TVTA 1KFZA 2FO0A 2AZSA 4RTXA 1NLOC 2CSIA 4RTUA 1UECA 2K2MA 1G83A 2DJQA 4Y92A 2HBWA 1X69A 2NWMA 1CKBA 2EYXA 2KR3A 2O9VA 4AFZC 2CDTA 2RQVA 1AWOA 2RQUA 2FG0A 2PNIA 1T0HA 1AEYA 1GL5A 5GJVB 5IHNA 1SHFA 3I5RA 3JV3A 1MV0B 3M0PA 1U06A 4J9CA 1U5SA 2GTJA 3H41A 2D8HA 2GGRA 2F2WA 2L3QA 1X6BA 2DL4A 4RTZA 1JEGA 1K0XA 2RNAA 1H92A 1X27A 2JS0A 2V1RA 2DRMA 2D8JA 1ABQA 3GBQA 2YUQA 1I0CA 1JXOA 2EYZA 3SHWA 2EBPA 1N5ZA 3M0QA 1M27C 2KXDA 2VVKA 4ZNXA 3VS3A 2DL8A 3M0UA 4Z89A 3FJ5A 2DX1A 3EG3A 2AK5A 4WCIA 1YNZA 2OI3A 1GBQA 1MUZA 4GLMA 2KE9A 2ED1A 2HCKA 2ECZA 4JZ3A 2H8HA 4DEYA 2EVRA 1GRIA 4OMLA 5EC7A 1M3CA 1VYTA 2M0YA 2AZVA 4LUEA 1UE9A 2LP5A 4AG1C 1T3LA 2GQIA 1X43A 3EHQA 1VYUA 4HCKA 1PRMC 1ARKA 4JPBW 1W1FA 1ZUYA 2SRCA 3NPFA 2LZ6B 1PRLC 1JU5C 4LUDA 5GJWB 2AKKA 1UGVA 1HSQA 3PE0A 2DLPA 2DNUA 2XMFA 2CSQA 2BTTA 2GBQA 1SRLA 2ABLA 2RQTA 2JMAA 3M0SA 4OMQA 2C0OA 4M4ZA 3H0HA 2DL7A 3CQTA 1BK2A 2DVJA 2LCSA 1WXUA 2FRWA 1ZUUA 2CREA 1AZGB 1H3HA 2MOXA 3EG1A 1NEGA 2K3BA 4J9IA 4F17A 4HXJA 5IH2A 1YN8A 2O2OA 5IHKA 2CT4A 2DBKA 2ED0A 1QCFA 3EG2A 2DBMA 4Z88A 2F2XA 1NM7A 1JXMA 4X1VA 1OPKA 4JJBA 3LH5A 1QWFA 1UFFA 2FPDA 1UUEA 2KBTA 4QT7A 3NHNA 2JTEA 1SEMA 3VS6A 1KJWA 2ESWA 4CC7A 1TUCA 2DMOA 1X2KA 2B86A 5HCKA 2D1XA 3U23A 4ORZA 4Z8AA 1JQQA 1W70A 2EGEA 1QKWA 4AFUC 3O5ZA 2CH4A 1AD5A 1NLPC 4HVVA 1GCQA 3RNJA 4LN2A 3VS0A 3VRYA 1Y57A 1A0NB 1M3BA 1NG2A 4OMOA 1YP5A 2O31A 1QKXA 4HVWA 4LNPA 4R0KA 2KYMA 3ULRB 2DL5A 1RI9A 3VS7A 2ENMA 1W6XA 2HEQA 1GFDA 2SEMA 1YWOA 2J6KA 2DL3A 1WLPB 2A37A 1ZSGA 2JS2A 4J9EA 2KROA 1K9AA 2V1QA 2O9SA 2IIMA 1UJYA 4IIMA 1AWWA 2A08A 2G6FX 1PKSA 1FMKA 2LJ1A 2JM8A 1HJDA 1M30A 2LJ3A 1CSKA 4JJCA 2K7AA 3EGUA 4CC2A 2P4RA 2KRNA 1Z9QA 2CH4W 3THKA 3UA6A 1EFNA 1FYNA 1OEBA 1GCQC 2L3SA 3QWYA 2YUPA 1GFCA 3M0TA 1NYFA 2HSPA 3R6NA 1AVZC 2J6FA 2LJ0A 1TG0A 2EPDA 2JM9A 1WXBA 2DM1A 1K0SA 4D8KA 1K4US 4RTYA 2C0TA 1MV3A 1I1JA 4J9DA 4AFQC 2DA9A 4OMNA 2DE0X 1WA7A 2K9GA 5FWBA 4LE9A 2BZYA 2ROLA 4GBQA 3REBB 2YT6A 2E5KA 4OMMA 5ECAA 2W0ZA 1WDXA 4F16A 1WYXA 2EW3A 2KEAA 2KT8A 1UDLA 1RLPC 1TUDA 1VA7A 1UHCA 1UHFA 2L2PA 2RF0A 1RLQC 4IIOA 1ZLMA 4E6RA 2YDLA 2J05A 2JT4A 5IXBA 1Y0MA 2RPNA 4D8DA 1WI7A 2PZ1A 2X3WD 2CUDA 3EG0A 3IQLA 4HVUA 3VS4A 4CC3A 2LNHB 1X6GA 1SPKA 3NGPA 4RTWA 1WFWA 2VWFA 1OOTA 1E6HA 1G2BA 1AWXA 2J6OA 2KGTA 3RBBB 2CT3A 5L23A 4RTVA 4AG2C 4A63B 1GCPA 2VKNA 4OMPA 4AFSC 1T0JA 1PWTA 2DRKA 1K76A 1BU1A 3REAB 2X3XD 1U3OA 2FPEA 2K79A 1M3AA 1LCKA 3I35A 1GBRA 5IHIA 2RN8A 2A28A 1SRMA 3UF4A 2GNCA 2EKHA 4J9BA 1YCSB 1PKTA 1J3TA 2RQWA 1SSHA 2I0NA 2DILA 1X2QA 2W10A 2J06A 1T3SA 4RUGA 2OJ2A 1QWEA 2EGCA 2EYYA 1NEBA 3VS5A 2KT1A 2KXCA 1UJ0A 3NMZC 2M51A 2QDLA 1JO8A 1I07A 2F2VA 4JJDA 2MCNA 3EHRA 1AZEA 3VRZA 1NYGA 2L3PA 1WX6A 2DF6A 2KRSA 3I5SA 3VS1A 4F14A 1Z9ZA 1ZUKA 1UTIA 3PVLA 1PHTA 1YWPA 2YUNA 3I9QA 3TSZA 2D0NA 1IO6A 2NUZA 1SHGA 2DYBA 2AKLA 4RTTA 1H8KA 4FSSA 2GTOA 1B07A 2LMJA 2LX7A 3VS2A 2JXBA 1CKAA 5I11A 1PNJA 2FRYA 2HDAA 3M0RA 1RUWA 1AWJA 1ZX6A 2K6DA 4CC4B 1KIKA 4K11A 5FW9A 3UA7A 2LQWA 1S1NA 1B3QA 1HD3A 2ROTA 2JW4A 1AOJA 1WXTA 4DEXA 2PTKA 2YUOA 2CUBA 1V1CA 2RMOA 2J7IA 3PVQA 4EIKA 2YSQA 5FWCA 1E6GA 5I22A 2FPFA 2KRMA 1OPLA 1BBZA 4JZ4A 2C0IA 2RQRA 1KSWA 3A98A 2BZXA 2L0AA 4J9GA 2FEIA 1WIEA 1VYVA 1ZBJA 1K1ZA 1M8MA 2OAWA 2EGAA 3C0CA
chains in the Genus database with same CATH superfamily
3CBPA 3OYBA 1ABOA 1N6AA 1K9MC 4ESRA 3EFOB 4BE1A 3O8VA 1BIAA 2L89A 2O88A 1FMVA 1MGQA 2EYWA 4JRQA 4N0AC 3OYDA 4PJOE 3EGDB 4J9FA 4M75D 3META 4F7UA 4WF2A 1M2OA 2GCXA 5LJ5h 2OTJQ 2E1HA 3QHSA 1OV3A 4MMLA 3TVTA 2FO0A 4KGXB 1WHGA 4RTXA 2HSEB 4RTUA 3CMEQ 2KR3A 2QQ9A 2AT1B 4M78A 2NLUA 3CCLT 1GL5A 4B6MA 3N5BB 2X4WA 3I5RA 3JV3A 1QVFP 1U06A 1U5SA 2DZ9A 2CP5A 2F2WA 4M7DF 1X6BA 4NS5A 4KBMB 5GAN7 4XU1A 1FMWA 1K0XA 1QVGP 2D8JA 4M77F 1IHWA 3RIRA 2LT1A 3M4GA 2EYZA 3G4ST 2VVKA 3BW1A 1LVKA 4Z89A 1KC8U 2AK5A 2OI3A 4M78C 3S3NA 3CCUA 2ED1A 1YJWT 3JB9D 3OMGA 1FWZA 3E2UA 2EVRA 3TREA 3CMAA 1GRIA 1RAEB 1RL2A 5CQYA 2GF7A 2M0YA 4C5EA 3PIPA 3ASKA 3NTHA 4AG1C 1T3LA 2MK5A 1X43A 3A8OB 2LCLA 3M59A 3RR6A 4BDYA 1D1AA 3GF5A 4HCKA 3M9QA 3GP8A 1W1FA 2SRCA 4FL6A 1VQMA 3LGFA 2XHCA 1GXIE 1HSQA 2WSEE 2CS7A 2F5TX 4RMOA 2DJZA 2DLPA 2FZKB 1RABB 5LJ5j 2ABLA 1TS9A 2K4YA 2E65A 3M58A 5CAIA 1Q7YC 2E41A 1IHVA 3M56A 3L1AA 2LT4A 1VUBA 2QA4T 2LNVA 3V8KA 1PG5B 2JVVA 2DL7A 1OULA 4P5NA 3I56T 3GOXA 2X4YA 1ZUUA 1V76A 1AZGB 1IGUA 2MOXA 1H3HA 4EPCA 4M7AF 4Y28E 4TVRA 5CKDA 5IH2A 2RJDA 4ZTFA 1QP3A 2O2OA 1K73C 2DIGA 1XQHA 3CCLA 4Z88A 2KMTA 2VASA 3OYMA 3X26B 4ATOA 4X1VA 5J3BA 2LVMA 1K8AC 4FW1A 5GANh 2K5FA 4QQDA 3TCJA 1P92A 2AHJB 2JJ9A 2VUBA 2D1XA 1D0YA 1MNDA 3U23A 1W70A 2EGEA 3G4SA 3O5ZA 3QKJA 1NLPC 3RNJA 5M9OA 3VS0A 5FU7B 4FSXA 1A0NB 4KH0B 4ELYC 1M3BA 1NG2A 2G3RA 1YP5A 5FRNA 4QVCA 3DKMA 4QW2A 3ULRB 2QQRA 3VS7A 2ENMA 1W6XA 3HRSA 4ELZC 2VGMA 1YWOA 1WLPB 4E7KA 1ZSGA 2BE7D 2HKNA 1N9RA 1VQKA 2V1QA 4IIMA 2G6FX 1N8RR 1FMKA 2LJ1A 2JM8A 1HJDA 1M30A 3MP1A 4FT4A 1Q86U 3VKIA 4BE2A 1Z9QA 3THKA 1EFNA 1PD1A 3QO3A 1TXQA 3A8GB 2C06A 3BE3A 1TG0A 1VQ6Q 4HT9A 4M7DG 1K0SA 2VB6A 3HKSA 4A4EA 3CCQT 2C0TA 1MV3A 5CR2A 4AFQC 3I56A 1NJIU 3LX7A 2RHXA 4LE9A 2COWA 2BZYA 3J81E 3MEWA 2RA2A 3REBB 2E5KA 4OMMA 3PMTA 3BDUA 4FU6A 5LJ3d 3JCMX 3C95A 3UDCA 3JB9F 2KEAA 1KC8R 2QEXQ 4R55A 2RM4A 4RCCA 3VJPA 1UHCA 2L2PA 1KD1U 2GQVA 5GANj 2RK2A 4E6RA 3I55T 2XICA 2QI2A 4PFOA 4HA8A 1W2BS 2J05A 1VQPT 2JT4A 5IXBA 1Y0MA 2RPNA 5GAMh 4WTOB 2PZ1A 4RG8A 1VOMA 3EG0A 2LC4A 4HVUA 3VS4A 1Q7YU 2DTOA 4BI4A 3L42A 1SPKA 4M7DA 2H3EB 2OTLT 1WFWA 2QGGA 4M77A 2JNGA 1OOTA 3EFSA 1M1FA 3CC7Q 2MMPA 1E6HA 3SWNB 4XAXB 3RBBB 2CT3A 4OMPA 2VXFA 3JCMc 1Y07A 2R5MA 3OS2A 1BU1A 4JRIA 3REAB 5CKFA 2RB6A 5KYWA 1ZBXA 4E7LA 1U3OA 1QCNA 1JJ2A 3PGGA 5HKCA 1JJ2P 2MWOA 2RN8A 2MPXC 3HPWA 1SRMA 1B7TA 1NPPA 1J3TA 2RQWA 1SSHA 3FB9A 4M7DC 2DILA 1X2QA 1MMDA 4DBQA 2PVGB 4PLLA 5KCHA 5GAMe 1PD0A 3FIFA 1QWEA 4M77C 3VS5A 2ZPEB 3LH0A 2RI2A 1UJ0A 4HCBA 4C92B 2FZCB 4KUDK 3NMZC 2M51A 2QDLA 1VQ9Q 5C6SA 5LJ5g 2VV5A 4LDXA 3CCEQ 3CCQA 5FROA 1WX6A 2R5AA 1M1KC 2DF6A 3OYIA 4C5GA 4M7AE 1K9MR 1ZUKA 4E47A 4J7FA 5GAN2 2JOYA 4BY6C 1VQ7Q 3CCMQ 1H8KA 4FSSA 2JTMA 2M02A 1YITT 1CKAA 5I11A 3CC2A 3EG9B 4C8QG 2NUTA 2CZ7B 1C6VX 1JRIA 2K6DA 3L2RA 2YRVA 1KIKA 5DY9A 1U1SA 1I5OB 1ZA1B 4E7SA 3RKXA 4M7AA 5GAMj 1S1NA 4M75G 3CD6T 4XU0A 1AOJA 3P8HA 4DEXA 1IXDA 4BD3A 1VQPA 2CUBA 1V1CA 2E10A 2J7IA 2L8DA 4EIKA 1E6GA 1PCXA 1M1GA 2RHUA 3X25B 2RQRA 3X20B 1WJRA 8AT1B 1YJ9Q 1VIEA 2NYSA 2K5IA 5D6WA 2OAWA 3UT1A 5J26A 2EGAA 2X51A 1YI2Q 4KRTA 2RD1A 1FXXA 2A36A 4PJLA 3OYKA 2K5LA 4C8QB 4OB3B 1MMNA 3OW2A 1XOVA 1E7OA 1UG1A 1VQLT 4FCYA 5KYXB 1BB9A 4CI0C 3G6EQ 3P8BB 3TQ7P 1QLYA 1WHJA 3J80E 2XDDA 1D1BA 3CC4Q 4N4HA 3PFSA 1KFZA 2YRCA 4XU2A 2AZSA 2D9TA 1I8FA 5CKHA 3VYGA 1UECA 2K2MA 1G83A 3MP8A 1LJOA 2EYXA 1AWOA 4KH1B 2RQUA 1WZOA 3JCMJ 3HFOA 5D6YA 3CCJA 1T0HA 3JCMb 1AEYA 4EMGA 1SHFA 2IVWA 3M0PA 3OYFA 1R0BG 2GTJA 2EFIA 3H41A 1YIJT 2PUOB 2X4JA 2L3QA 2LDMA 2DTIA 4JDSA 2LQKA 1BYMA 3FRNA 2EJ9A 1X27A 2JS0A 2V1RA 4E7HA 4JS5A 1Q7YR 4C92D 1YITA 1XNIA 3M0QA 3RDVA 4C0DC 2DL8A 1WHHA 2CKKA 3M0UA 5GAOn 3FJ5A 4WCIA 1YNZA 3CD6A 4N4IA 4L6V5 4GLMA 2DEQA 1ZSZA 1M4ZA 4MZPA 2HCKA 3EH2A 5GANg 1K73R 2V8JA 4DEYA 2E12A 2ATCB 2EJFA 5CKEA 3LWHA 5EC7A 5GAN8 3DLMA 4PLIA 2HQXA 1YJNT 4LUEA 4PJNA 3PIOA 4XTXA 4XK8E 1WQ7A 2GQIA 3CEYA 2VXEA 3QIIA 3JCMe 1VYUA 1K8AR 2QXFA 5GAN6 2LZ6B 1JU5C 3FDRA 5GJWB 4LDVA 3PE0A 3L2VA 3HP9A 2DNUA 2EQUA 1UEBA 1ZSZC 2BTTA 1KQ1A 2RQTA 1OX9A 1VQLA 3EGXA 3J7AF 4F7UE 5HK3A 1NE8A 3CBOA 1PC0A 3CPWP 2K57A 2NUPB 1VQMT 3A8LB 4PJOG 5KYYB 4C8QD 1Q81U 2K3BA 3S6WA 3QUIA 3WVEB 3OW2S 4M78E 1YN8A 2LX9A 2PU9B 3KXTA 2ZPGB 3EGDA 4ZTJA 4C0ZA 1QCFA 4EMHA 1O75A 2DD4A 3LW5E 1WJQA 1JXMA 1OPKA 3CCUQ 1QWFA 4ZGDB 1UUEA 1YIJA 4QT7A 4AMCA 3NHNA 2JTEA 5D6XA 3VS6A 4DOVA 1SKUB 2ESWA 3CMAQ 4NL3A 5IT9E 4CC7A 1X2KA 5DLOA 4ORZA 1QVFA 4PKCC 1JQQA 5GAOp 1Q86C 4PJOB 4OMOA 1D3BB 3MPUB 2L3RA 2O31A 1QVGA 4MDXA 5GAMg 3OSSC 2KYMA 2DIQA 2DL5A 1RI9A 2J6KA 2DL3A 2JS2A 3DLLA 3QYGB 2KROA 1YJNA 1UJYA 2IIMA 5LJ5e 1NJIC 3OYCA 2ZCFB 2CZ1B 3QZ9B 3MEVA 4JJCA 3E1SA 4VUBA 2D6FA 1S72Q 4KULA 2P4RA 4GY5A 4CC2A 4PFPA 2CH4W 1OEBA 4LD9K 2L3SA 2XIDA 4N4GA 2YUPA 1VQKT 1GFCA 1NYFA 3OYJA 4E7JA 1AVZC 2J6FA 2PVDB 2LJ0A 3CCLQ 2PVOB 1KD1C 4O5VA 2KSSA 1Q82R 5CO7A 1K4US 1I1JA 4C92F 1Y96B 2DA9A 4IUVA 4J6YA 2BUDA 2ROLA 1BKBA 1BI2A 2CP3A 2JZ2A 4C0GA 2P84A 3MHXA 3OYNA 1TUGB 2JUFA 3JAME 2KI7A 4F16A 4BDZA 3G4SQ 2EW3A 4QVZA 2EQKA 1KHCA 3H9NA 3X28B 1TUDA 1VA7A 3JSCA 4OMFB 4J6WA 1RLQC 5A0DA 2LCCA 1YJWQ 3JB9I 3X24B 2KK4A 4D8DA 3FC3A 2H3JA 1WI7A 4O6JA 3RKWA 1VQ8T 1UGRB 1VQ5T 2YRDA 2K2VA 1Y7XA 1G3YA 1OYXA 1ZQ1A 1M1KR 2FZGB 1WHMA 5GAOr 3NFCA 2QDYB 2MAMA 2I2LA 2DERA 1AWXA 1VQ4Q 4OVAA 5L23A 3JB9J 5C0MA 4RTVA 1QVPA 2VKNA 4FIBA 3JCMQ 1QVFS 3PTAA 1PWTA 1K76A 5KYUA 4RCBA 2CYZB 4UC4A 4C8QF 2QA4Q 4PJOD 1QP2A 2K79A 5IHIA 3VU3C 3I56Q 1D1CA 1QVGS 2EKHA 2EAYA 4LDYA 1VQ6T 4JLGA 4M75F 4EMKB 1M90C 1QCOA 2I0NA 5L8RE 2W10A 5I21A 2DFUA 2RJEA 2EGCA 2EYYA 5KE2A 2KT1A 5A2QE 1I07A 2F2VA 3KBGA 4JJDA 5A0GA 1AZEA 1WHKA 2KRSA 3I5SA 3VS1A 3SB2A 2LRQA 3OBWA 5GANe 2V8KA 1PHTA 2B8AA 3TSZA 5FU7C 1SHGA 4IUUA 1B07A 3VS2A 3A8MB 2EYQA 3M0RA 3JCMg 1AWJA 4CC4B 2L5QA 4PJJA 1KQSA 2A0FB 1KQSP 2DVEA 2ZAEA 3V7RA 5LL6S 2CP2A 4C5HA 3CC2T 3CXCP 2KQWA 2Y4XA 2FL7A 2YSQA 2WSCE 1SF9A 1VQ8A 1R0CB 3VV0A 5I22A 3CBMA 5LJ3h 1VQ5A 4DBFA 2RHZA 3GIBA 4M7DE 2C0IA 2QASA 1M2VB 3A98A 3SFMA 1G3WA 3PT9A 2L0AA 2FEIA 4M77E 5CIUA 2RHYA 2HAXA 3UPUA 2ZGWA 3QJYA 2OAUA 5CK9A 2DETA 3QDFA 3CPFA 4FT2A 1HXDA 2EQIA 2BZ8A 3H0IA 2KNBB 1UGPB 2EIFA 5LJ5f 5GAN3 1LOJA 4C92G 4NOYA 2MIOA 3OYLA 4J9HA 3ZL7C 3CCST 4C0FA 5KYNA 3KFVA 3L2WA 2HQEA 3CCQQ 4JRPA 1VQOT 3MEAA 2RJCA 3AT1B 2A3LA 4MZMA 3BDLA 4E7IA 1VQ6A 5J39A 3SDZA 3HTRA 1NLOC 1AT1B 3D7SB 2QTXA 3V8JA 2DJQA 4Y92A 2HBWA 1X01A 1X69A 1IGQA 4M77B 1CKBA 2O9VA 1O9SA 3V8LA 2FG0A 2YHTA 4QKUA 5LJ3e 2HD0A 5GJVB 1MV0B 1WHLA 4J5YA 2DO3A 3I55Q 9ATCB 1VQPQ 4BY6B 1VQNT 2XK0A 1TTHB 2DL4A 2XKOC 4RTZA 1JEGA 2RNAA 1H92A 2LTOA 3INZA 3CCJT 3GBQA 3SWNC 1WJSA 1I0CA 1JXOA 4C92A 3SHWA 2X9HA 3QDRB 2KY9A 2IG0A 1M27C 4A4KA 2E6NA 2OTLQ 3H8ZA 4IUPA 4DA4A 5I2SA 3WVDB 3DB4A 1GBQA 1U8RA 1M90U 1OU9A 2HMAA 4OF1A 3RKYA 2ECZA 4JZ3A 4ME7A 5LJ3j 4PJOF 1D09B 2DKGA 3OBYA 4OMLA 4E2FB 3M5AA 3CC7A 3WXMB 2AZVA 1RACB 1UE9A 1WQWA 2KAFA 2LP5A 2FB7A 1QMCA 1SG5A 4DBRA 1DJ7B 4PFZA 4OGEA 1PM3A 3EHQA 3BY7A 4C92C 1Q81C 1BCOA 1ARKA 4JPBW 3OSVA 2PUKB 2O4XA 4BB7A 4QQ6A 3A1PA 5GMKi 3F70A 4M7AB 1KHIA 3MO8A 4LUDA 2X4XA 2AKKA 4BUGA 1UGVA 4RKUE 1Q86R 1F1BB 2E3HA 2XMFA 2CSQA 2GBQA 3H6ZA 4LDWA 5I2MA 3CCSA 1D0ZA 1HYOA 2QQBA 3EFRA 4M75E 4M4ZA 1VQOA 3H0HA 1BK2A 1D0XA 1WXUA 1VQ9A 2FRWA 1C0MA 4KGZB 1G8XA 3CCEA 3M53A 2HL5C 1N8RC 1NEGA 4J9IA 4C8QA 4V2SA 3EH1A 5GAOl 4HXJA 1YITQ 2Y4YA 5IHKA 1NJIR 4RG2A 5GMKh 2QK0A 4J7IA 4M75A 3EG2A 2DBMA 5DLQE 4NL2A 4XTWA 2RHIA 1OI1A 4IURA 5GANf 2F2XA 1NM7A 3CD6Q 4HT8A 1RAHB 1UFFA 2FPDA 1IZ6A 4J6XA 3OYHA 1KJWA 4M77D 1VQNA 4IUQA 1JJ2S 1X6OA 1KD1R 1HK9A 3HRTA 5FRMA 1IREB 2P4TA 5HCKA 4Z8AA 4KUIA 1QKWA 4ZGJB 4QVDA 1LPLA 1AD5A 3MKDA 4B9WA 4C8QC 4HVVA 1GCQA 3SD4A 3VRYA 3CCRT 2RJFA 5AT1B 3VUBA 4HVWA 3G71Q 4LNPA 4JJNK 4M75C 2XI9A 4XTUA 3JCMV 1GFDA 5GAOq 1YHQT 2A7YA 1EX4A 2A37A 2YWWA 5CVIA 4J9EA 2E70A 1VQLQ 1K9AA 3PNWC 3CCVT 5D7UA 2O9SA 1B34B 5FU6C 3TU4K 1RAGB 2A08A 1PKSA 4A4HA 1CSKA 2K7AA 2JN0A 3EGUA 2DXUA 4XU3A 5HY6A 1EZZB 2KRNA 3UA6A 1BCMA 3RESA 3G6EA 1M5Q1 2CGHA 2VYTA 1GCQC 3QWYA 2HKQB 2D0QB 2HSPA 3ZBDA 2E3IA 2DXBA 1R8OB 4DBHA 5AYFA 3NTIA 4OGCA 2QGFB 4OB2B 1KG1A 7AT1B 2DM1A 1XJWB 4RTYA 4F04B 4HCZA 2OTJT 3PMIA 2DE0X 4XTYA 4E7ZA 3E9GA 4M7AD 3QBYA 4GBQA 4ZN3A 1I5LA 5GMKj 3GPLA 5ECAA 3CMET 2ZZDA 3CPWA 1WYXA 3M4YA 4LXCA 4AT1B 4B9XA 3OQ5A 4DQ2A 2KVQG 1UDLA 1I81A 2M0OA 2NUPA 3QPHA 5GAMf 3L2QA 1MMAA 1RLPC 3JCMW 1UHFA 2RF0A 3EFOA 2MYSA 4BI8B 2EQMA 1ZLMA 5KYYA 1OU8A 8ATCB 2YDLA 2Y90A 2HL3A 2WSFE 4XTZA 2CUDA 2RO0A 3C94A 2ZPFB 1YJNQ 2DPPB 2Z0WA 1C1AA 2CP6A 4DOWA 4Q5WA 1YCYA 2XG8D 3OYYA 1PSFA 5LJ5d 1N27A 1UGQB 2HZYA 3CCRA 3OB9A 3OYGA 4F7UB 1WPYA 3T9NA 2J6OA 1N8RU 1YHQA 1S72T 4AG2C 1IRXA 4A63B 5LJ3g 4J8OA 3OYEA 2DRKA 3FJPA 1TOVA 1Y71A 3CCVA 4M78B 5GAOm 2ZPHB 1RAFB 4PJOA 2HNIA 1D3BA 1VQMQ 1FX7A 2A28A 4PK4A 3E19A 3UF4A 2GFAA 4J9BA 1YCSB 3RMSA 3OA6A 4JUVA 3LGLA 4RUGA 4CRIA 3EAEA 1XTDA 1NEBA 4X9DA 1Q95G 3TEEA 3V7SA 2DAQA 3G1JA 2MCNA 4IKFA 2VC8A 1RADB 3VRZA 2L3PA 2ZPIB 5A0LA 5GAN5 4F14A 2OTJA 2YLBA 1Z9ZA 1NBEB 3A5ZB 1YWPA 2YUNA 1IO6A 2NUZA 3HHTB 3LLRA 4PJOC 3S3OA 2CZ6B 3BFMA 2LX7A 1EIFA 3M54A 3CMEA 4X34A 4J83A 2FRYA 2HDAA 4QQGA 2IPOB 1RUWA 2QYZA 4K11A 5FW9A 1Y96A 2LQWA 4MDWA 4EDUA 1HD3A 2ROTA 2QAZA 2JW4A 2M1HA 2PTKA 2PQWA 1TWBA 2RMOA 2YLCA 3MCAB 3CPWS 1VQ4T 2FHDA 1UB4A 1OPLA 2YXYA 4JZ4A 1ZHIA 1KSWA 3G7ZA 3MJXA 1ZA2B 2BZXA 4J9GA 3S3MA 2F1LA 4X9CA 3GNFB 1K1ZA 1SSFA 2V8IA 1BIBA 2R57A 3ME9A 4FYVB 4II1A 1VQKQ 2P0KA 5IXFA 5GAN4 1S72A 1PSEA 2XU8A 4L59A 2DTHA 3TSWA 2LQNA 1W2BA 2E6ZA 1W2BP 4L5GA 2KYBA 3H0FA 1BI1A 2BIVA 2X35A 3L2UA 3OS1A 3QWXX 3SEMA 5KH6A 2JMCA 3UATA 2CSIA 5GANd 2NWMA 2EQJA 2CZ0B 3JCMf 4M78D 4AFZC 2CDTA 2RQVA 2MI6A 1KK7A 1K9MU 2PNIA 3R6OA 1Q81R 5IHNA 2DEUA 4J9CA 4EMKA 5KYUB 2D8HA 2GGRA 3QZ5B 3RERA 2DRMA 1VQ8Q 3FLGA 3V7CA 1YJWA 1ABQA 2CP0A 2YUQA 1VQ5Q 2HBPA 2EBPA 1N5ZA 2KXDA 4ZNXA 3VS3A 2QEXT 5GMKl 4ANJA 2DX1A 3EG3A 1MUZA 1WGSA 1AHJB 2DD5A 2CP7A 2KE9A 1V29B 4LD6A 2H8HA 2COZA 2GFUA 4IUTA 4EMKC 1M3CA 5CQXA 1VYTA 1VQ4A 3C12A 1QQJA 3OMCA 3OS0A 2BE9B 2WACA 3JCMP 3CXCA 1PRMC 2QA4A 1IB8A 3LWIA 3CC7T 4C5IA 1ZUYA 3NPFA 1PRLC 4GLKA 1LNXA 4M77G 3MP6A 2M9UA 2OX7A 2FVUA 1G3SA 1SRLA 1M2VA 2JMAA 3M0SA 4OMQA 2C0OA 3RUXA 4OB0B 1QW1A 1KQ2A 3ER0A 3JRZA 1OX8A 3CQTA 2XD0A 2DVJA 2LCSA 1TH7A 4BACA 2CREA 1BI3A 4OP0A 3JB9H 3EG1A 5GAMd 1M8VA 2P0QA 4F17A 2ZPBB 1N9SA 5HK0A 4BI3A 2CT4A 4ZN1A 1RAAB 4FM4B 2P0PA 2DBKA 2ED0A 1RAIB 3SWNA 1VQ9T 3HFNA 4M7DB 3CCET 3MEUA 4JJBA 3LH5A 1R77A 4R56A 2KBTA 1SEMA 3CC2Q 1WNLA 1Q82C 2EWNA 1TUCA 5CCAA 4HCCA 2EJGA 1VQ7T 4C92E 3CCMT 1JB0E 2DMOA 4JLIA 1G3TA 2QQAA 2B86A 1X75C 2K3YA 4AFUC 2CH4A 1K73U 1H3ZA 2JTFA 5KYWB 1TU0B 4LN2A 2QEXA 1Y57A 3VYHB 3Q1JA 4Z02A 1G5VA 3L2ZA 5KCOA 3LYIA 1QKXA 2VGNA 4R0KA 4M7AG 1YFNA 4BE0A 2HEQA 3KUFA 4F7UF 2SEMA 2R58A 3C4SA 3AHUA 1MHNA 1K8AU 2XDPA 2DK3A 4LDUA 2RK1A 3CCSQ 1AWWA 3QSUA 3NTKA 4FYXB 1VQOQ 1I4K1 4PL6A 1YJ9T 2LJ3A 4M78F 4FW2A 5FLXE 1FYNA 3E9FA 3EG9A 1YBYA 1YI2T 2MF2A 3HSBA 4FYWB 3M0TA 1H641 4MMKA 4YTLA 1KQSS 3R6NA 2BKDN 5KE3A 2NUTB 2EPDA 2JM9A 1WXBA 2KDSA 3CXCS 4D8KA 4OB1B 4J9DA 3G6ET 4A4FA 4OMNA 3CC4T 1WA7A 2DZCA 2K9GA 5FWBA 1VQNQ 4C8QE 4JRKA 3URGA 3OS5A 3UWNA 5GMKm 3CCJQ 3DB3A 3I55A 2YT6A 2COYA 4ZGEB 2W0ZA 1WDXA 2O4XB 3GNGA 3ZEHA 2KT8A 4A53A 4KGVB 4MZTA 1OZ3A 4IIOA 4KT0E 2OTLA 3A8HB 1OZ2A 4HKEA 2V26A 1VQ7A 3CCMA 3G71T 5KYXA 2X3WD 4FYYB 2QQSA 3IQLA 4M7AC 3ZFJA 4CC3A 2QTVA 4XTVA 2LNHB 4M7DD 1UGSB 1X6GA 3NGPA 4D6WA 4RTWA 3OW2P 5IAYA 2VWFA 3M57A 2MWPA 4M75B 1VIFA 1G2BA 2K3XA 2KGTA 4A54A 2RI5A 4PJMA 3GLXA 1GCPA 4AFSC 2EKOA 1T0JA 3JB9G 4C0DB 5FU6B 5CKBA 3QXEB 2X3XD 3RMQA 3OY9A 2FPEA 1BI0A 1MMGA 1M3AA 1LCKA 3I35A 3JCMd 1YJ9A 1GBRA 1KC8C 2GNCA 4JS4A 1PKTA 2F5KA 3JCMh 1YI2A 2J06A 1T3SA 1Q82U 2OJ2A 2M16A 4XQ3A 5GMKe 1NZ9A 4A4GA 1B34A 3QG1A 2KXCA 2DXCA 2AIRB 1JO8A 3VUZA 2XDBA 3EHRA 5IN1A 1NYGA 2F69A 3CC4A 1UTIA 3PVLA 1ACMB 3I9QA 1ZSZB 2D0NA 2DYBA 2AKLA 4RTTA 5EG2A 2GTOA 3HRUA 2LMJA 2JXBA 2DXTA 1PNJA 3OYAA 1YIJQ 2E64A 1ZX6A 3M55A 1RI0A 3CCRQ 3UA7A 4F7UG 1JBMA 2DYIA 2HQHA 1B3QA 3QYHB 3CCUT 5LJ3f 1WXTA 2YUOA 3HL8A 4N0AA 1YHQQ 1TSFA 4Y91A 1M1KU 1OQKA 3FEOA 3CMAT 3PVQA 6AT1B 1NPRA 1MNEA 1U1TA 2RH2A 1W4SA 3G71A 2E5QA 5FWCA 2FPFA 2KRMA 2RI3A 5DM7R 4M78G 3CCVQ 1M90R 2FYKA 1BBZA 2QG9B 2LQ8A 2E4HA 1WIEA 3EGXB 1VYVA 1ZBJA 3P8DA 2O01E 1M8MA 4PNOA 3C0CA 1M9SA 3QJ6A
chains in the Genus database with same CATH topology
4KRTA 1ABOA 2A36A 2EQIA 5IXFA 2BZ8A 4ESRA 3H0IA 2KNBB 3TSWA 1XOVA 2LQNA 1E7OA 2O88A 1UG1A 2EYWA 2MIOA 4J9HA 2KYBA 3ZL7C 3H0FA 3KFVA 1BB9A 4J9FA 1QLYA 3QWXX 3SEMA 1OV3A 2JMCA 3UATA 3TVTA 1KFZA 2FO0A 2AZSA 4RTXA 1NLOC 2CSIA 4RTUA 1UECA 2K2MA 1G83A 2DJQA 4Y92A 2HBWA 1X69A 2NWMA 1CKBA 2EYXA 2KR3A 2O9VA 4AFZC 2CDTA 2RQVA 1AWOA 2RQUA 2FG0A 2PNIA 1T0HA 1AEYA 1GL5A 5GJVB 5IHNA 1SHFA 3I5RA 3JV3A 1MV0B 3M0PA 1U06A 4J9CA 1U5SA 2GTJA 3H41A 2D8HA 2GGRA 2F2WA 2L3QA 1X6BA 2DL4A 4RTZA 1JEGA 1K0XA 2RNAA 1H92A 1X27A 2JS0A 2V1RA 2DRMA 2D8JA 1ABQA 3GBQA 2YUQA 1I0CA 1JXOA 2EYZA 3SHWA 2EBPA 1N5ZA 3M0QA 1M27C 2KXDA 2VVKA 4ZNXA 3VS3A 2DL8A 3M0UA 4Z89A 3FJ5A 2DX1A 3EG3A 2AK5A 4WCIA 1YNZA 2OI3A 1GBQA 1MUZA 4GLMA 2KE9A 2ED1A 2HCKA 2ECZA 4JZ3A 2H8HA 4DEYA 2EVRA 1GRIA 4OMLA 5EC7A 1M3CA 1VYTA 2M0YA 2AZVA 4LUEA 1UE9A 2LP5A 4AG1C 1T3LA 2GQIA 1X43A 3EHQA 1VYUA 4HCKA 1PRMC 1ARKA 4JPBW 1W1FA 1ZUYA 2SRCA 3NPFA 2LZ6B 1PRLC 1JU5C 4LUDA 5GJWB 2AKKA 1UGVA 1HSQA 3PE0A 2DLPA 2DNUA 2XMFA 2CSQA 2BTTA 2GBQA 1SRLA 2ABLA 2RQTA 2JMAA 3M0SA 4OMQA 2C0OA 4M4ZA 3H0HA 2DL7A 3CQTA 1BK2A 2DVJA 2LCSA 1WXUA 2FRWA 1ZUUA 2CREA 1AZGB 1H3HA 2MOXA 3EG1A 1NEGA 2K3BA 4J9IA 4F17A 4HXJA 5IH2A 1YN8A 2O2OA 5IHKA 2CT4A 2DBKA 2ED0A 1QCFA 3EG2A 2DBMA 4Z88A 2F2XA 1NM7A 1JXMA 4X1VA 1OPKA 4JJBA 3LH5A 1QWFA 1UFFA 2FPDA 1UUEA 2KBTA 4QT7A 3NHNA 2JTEA 1SEMA 3VS6A 1KJWA 2ESWA 4CC7A 1TUCA 2DMOA 1X2KA 2B86A 5HCKA 2D1XA 3U23A 4ORZA 4Z8AA 1JQQA 1W70A 2EGEA 1QKWA 4AFUC 3O5ZA 2CH4A 1AD5A 1NLPC 4HVVA 1GCQA 3RNJA 4LN2A 3VS0A 3VRYA 1Y57A 1A0NB 1M3BA 1NG2A 4OMOA 1YP5A 2O31A 1QKXA 4HVWA 4LNPA 4R0KA 2KYMA 3ULRB 2DL5A 1RI9A 3VS7A 2ENMA 1W6XA 2HEQA 1GFDA 2SEMA 1YWOA 2J6KA 2DL3A 1WLPB 2A37A 1ZSGA 2JS2A 4J9EA 2KROA 1K9AA 2V1QA 2O9SA 2IIMA 1UJYA 4IIMA 1AWWA 2A08A 2G6FX 1PKSA 1FMKA 2LJ1A 2JM8A 1HJDA 1M30A 2LJ3A 1CSKA 4JJCA 2K7AA 3EGUA 4CC2A 2P4RA 2KRNA 1Z9QA 2CH4W 3THKA 3UA6A 1EFNA 1FYNA 1OEBA 1GCQC 2L3SA 3QWYA 2YUPA 1GFCA 3M0TA 1NYFA 2HSPA 3R6NA 1AVZC 2J6FA 2LJ0A 1TG0A 2EPDA 2JM9A 1WXBA 2DM1A 1K0SA 4D8KA 1K4US 4RTYA 2C0TA 1MV3A 1I1JA 4J9DA 4AFQC 2DA9A 4OMNA 2DE0X 1WA7A 2K9GA 5FWBA 4LE9A 2BZYA 2ROLA 4GBQA 3REBB 2YT6A 2E5KA 4OMMA 5ECAA 2W0ZA 1WDXA 4F16A 1WYXA 2EW3A 2KEAA 2KT8A 1UDLA 1RLPC 1TUDA 1VA7A 1UHCA 1UHFA 2L2PA 2RF0A 1RLQC 4IIOA 1ZLMA 4E6RA 2YDLA 2J05A 2JT4A 5IXBA 1Y0MA 2RPNA 4D8DA 1WI7A 2PZ1A 2X3WD 2CUDA 3EG0A 3IQLA 4HVUA 3VS4A 4CC3A 2LNHB 1X6GA 1SPKA 3NGPA 4RTWA 1WFWA 2VWFA 1OOTA 1E6HA 1G2BA 1AWXA 2J6OA 2KGTA 3RBBB 2CT3A 5L23A 4RTVA 4AG2C 4A63B 1GCPA 2VKNA 4OMPA 4AFSC 1T0JA 1PWTA 2DRKA 1K76A 1BU1A 3REAB 2X3XD 1U3OA 2FPEA 2K79A 1M3AA 1LCKA 3I35A 1GBRA 5IHIA 2RN8A 2A28A 1SRMA 3UF4A 2GNCA 2EKHA 4J9BA 1YCSB 1PKTA 1J3TA 2RQWA 1SSHA 2I0NA 2DILA 1X2QA 2W10A 2J06A 1T3SA 4RUGA 2OJ2A 1QWEA 2EGCA 2EYYA 1NEBA 3VS5A 2KT1A 2KXCA 1UJ0A 3NMZC 2M51A 2QDLA 1JO8A 1I07A 2F2VA 4JJDA 2MCNA 3EHRA 1AZEA 3VRZA 1NYGA 2L3PA 1WX6A 2DF6A 2KRSA 3I5SA 3VS1A 4F14A 1Z9ZA 1ZUKA 1UTIA 3PVLA 1PHTA 1YWPA 2YUNA 3I9QA 3TSZA 2D0NA 1IO6A 2NUZA 1SHGA 2DYBA 2AKLA 4RTTA 1H8KA 4FSSA 2GTOA 1B07A 2LMJA 2LX7A 3VS2A 2JXBA 1CKAA 5I11A 1PNJA 2FRYA 2HDAA 3M0RA 1RUWA 1AWJA 1ZX6A 2K6DA 4CC4B 1KIKA 4K11A 5FW9A 3UA7A 2LQWA 1S1NA 1B3QA 1HD3A 2ROTA 2JW4A 1AOJA 1WXTA 4DEXA 2PTKA 2YUOA 2CUBA 1V1CA 2RMOA 2J7IA 3PVQA 4EIKA 2YSQA 5FWCA 1E6GA 5I22A 2FPFA 2KRMA 1OPLA 1BBZA 4JZ4A 2C0IA 2RQRA 1KSWA 3A98A 2BZXA 2L0AA 4J9GA 2FEIA 1WIEA 1VYVA 1ZBJA 1K1ZA 1M8MA 2OAWA 2EGAA 3C0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KRT A;  1ABO A;  2A36 A;  2EQI A;  5IXF A;  2BZ8 A;  4ESR A;  3H0I A;  2KNB B;  3TSW A;  1XOV A;  2LQN A;  1E7O A;  2O88 A;  1UG1 A;  2EYW A;  2MIO A;  4J9H A;  2KYB A;  3ZL7 C;  3H0F A;  3KFV A;  1BB9 A;  4J9F A;  1QLY A;  3QWX X;  3SEM A;  1OV3 A;  2JMC A;  3UAT A;  3TVT A;  1KFZ A;  2FO0 A;  2AZS A;  4RTX A;  1NLO C;  2CSI A;  4RTU A;  1UEC A;  2K2M A;  1G83 A;  2DJQ A;  4Y92 A;  2HBW A;  1X69 A;  2NWM A;  1CKB A;  2EYX A;  2KR3 A;  2O9V A;  4AFZ C;  2CDT A;  2RQV A;  1AWO A;  2RQU A;  2FG0 A;  2PNI A;  1T0H A;  1AEY A;  1GL5 A;  5GJV B;  5IHN A;  1SHF A;  3I5R A;  3JV3 A;  1MV0 B;  3M0P A;  1U06 A;  4J9C A;  1U5S A;  2GTJ A;  3H41 A;  2D8H A;  2GGR A;  2F2W A;  2L3Q A;  1X6B A;  2DL4 A;  4RTZ A;  1JEG A;  1K0X A;  2RNA A;  1H92 A;  1X27 A;  2JS0 A;  2V1R A;  2DRM A;  2D8J A;  1ABQ A;  3GBQ A;  2YUQ A;  1I0C A;  1JXO A;  2EYZ A;  3SHW A;  2EBP A;  1N5Z A;  3M0Q A;  1M27 C;  2KXD A;  2VVK A;  4ZNX A;  3VS3 A;  2DL8 A;  3M0U A;  4Z89 A;  3FJ5 A;  2DX1 A;  3EG3 A;  2AK5 A;  4WCI A;  1YNZ A;  2OI3 A;  1GBQ A;  1MUZ A;  4GLM A;  2KE9 A;  2ED1 A;  2HCK A;  2ECZ A;  4JZ3 A;  2H8H A;  4DEY A;  2EVR A;  1GRI A;  4OML A;  5EC7 A;  1M3C A;  1VYT A;  2M0Y A;  2AZV A;  4LUE A;  1UE9 A;  2LP5 A;  4AG1 C;  1T3L A;  2GQI A;  1X43 A;  3EHQ A;  1VYU A;  4HCK A;  1PRM C;  1ARK A;  4JPB W;  1W1F A;  1ZUY A;  2SRC A;  3NPF A;  2LZ6 B;  1PRL C;  1JU5 C;  4LUD A;  5GJW B;  2AKK A;  1UGV A;  1HSQ A;  3PE0 A;  2DLP A;  2DNU A;  2XMF A;  2CSQ A;  2BTT A;  2GBQ A;  1SRL A;  2ABL A;  2RQT A;  2JMA A;  3M0S A;  4OMQ A;  2C0O A;  4M4Z A;  3H0H A;  2DL7 A;  3CQT A;  1BK2 A;  2DVJ A;  2LCS A;  1WXU A;  2FRW A;  1ZUU A;  2CRE A;  1AZG B;  1H3H A;  2MOX A;  3EG1 A;  1NEG A;  2K3B A;  4J9I A;  4F17 A;  4HXJ A;  5IH2 A;  1YN8 A;  2O2O A;  5IHK A;  2CT4 A;  2DBK A;  2ED0 A;  1QCF A;  3EG2 A;  2DBM A;  4Z88 A;  2F2X A;  1NM7 A;  1JXM A;  4X1V A;  1OPK A;  4JJB A;  3LH5 A;  1QWF A;  1UFF A;  2FPD A;  1UUE A;  2KBT A;  4QT7 A;  3NHN A;  2JTE A;  1SEM A;  3VS6 A;  1KJW A;  2ESW A;  4CC7 A;  1TUC A;  2DMO A;  1X2K A;  2B86 A;  5HCK A;  2D1X A;  3U23 A;  4ORZ A;  4Z8A A;  1JQQ A;  1W70 A;  2EGE A;  1QKW A;  4AFU C;  3O5Z A;  2CH4 A;  1AD5 A;  1NLP C;  4HVV A;  1GCQ A;  3RNJ A;  4LN2 A;  3VS0 A;  3VRY A;  1Y57 A;  1A0N B;  1M3B A;  1NG2 A;  4OMO A;  1YP5 A;  2O31 A;  1QKX A;  4HVW A;  4LNP A;  4R0K A;  2KYM A;  3ULR B;  2DL5 A;  1RI9 A;  3VS7 A;  2ENM A;  1W6X A;  2HEQ A;  1GFD A;  2SEM A;  1YWO A;  2J6K A;  2DL3 A;  1WLP B;  2A37 A;  1ZSG A;  2JS2 A;  4J9E A;  2KRO A;  1K9A A;  2V1Q A;  2O9S A;  2IIM A;  1UJY A;  4IIM A;  1AWW A;  2A08 A;  2G6F X;  1PKS A;  1FMK A;  2LJ1 A;  2JM8 A;  1HJD A;  1M30 A;  2LJ3 A;  1CSK A;  4JJC A;  2K7A A;  3EGU A;  4CC2 A;  2P4R A;  2KRN A;  1Z9Q A;  2CH4 W;  3THK A;  3UA6 A;  1EFN A;  1FYN A;  1OEB A;  1GCQ C;  2L3S A;  3QWY A;  2YUP A;  1GFC A;  3M0T A;  1NYF A;  2HSP A;  3R6N A;  1AVZ C;  2J6F A;  2LJ0 A;  1TG0 A;  2EPD A;  2JM9 A;  1WXB A;  2DM1 A;  1K0S A;  4D8K A;  1K4U S;  4RTY A;  2C0T A;  1MV3 A;  1I1J A;  4J9D A;  4AFQ C;  2DA9 A;  4OMN A;  2DE0 X;  1WA7 A;  2K9G A;  5FWB A;  4LE9 A;  2BZY A;  2ROL A;  4GBQ A;  3REB B;  2YT6 A;  2E5K A;  4OMM A;  5ECA A;  2W0Z A;  1WDX A;  4F16 A;  1WYX A;  2EW3 A;  2KEA A;  2KT8 A;  1UDL A;  1RLP C;  1TUD A;  1VA7 A;  1UHC A;  1UHF A;  2L2P A;  2RF0 A;  1RLQ C;  4IIO A;  1ZLM A;  4E6R A;  2YDL A;  2J05 A;  2JT4 A;  5IXB A;  1Y0M A;  2RPN A;  4D8D A;  1WI7 A;  2PZ1 A;  2X3W D;  2CUD A;  3EG0 A;  3IQL A;  4HVU A;  3VS4 A;  4CC3 A;  2LNH B;  1X6G A;  1SPK A;  3NGP A;  4RTW A;  1WFW A;  2VWF A;  1OOT A;  1E6H A;  1G2B A;  1AWX A;  2J6O A;  2KGT A;  3RBB B;  2CT3 A;  5L23 A;  4RTV A;  4AG2 C;  4A63 B;  1GCP A;  2VKN A;  4OMP A;  4AFS C;  1T0J A;  1PWT A;  2DRK A;  1K76 A;  1BU1 A;  3REA B;  2X3X D;  1U3O A;  2FPE A;  2K79 A;  1M3A A;  1LCK A;  3I35 A;  1GBR A;  5IHI A;  2RN8 A;  2A28 A;  1SRM A;  3UF4 A;  2GNC A;  2EKH A;  4J9B A;  1YCS B;  1PKT A;  1J3T A;  2RQW A;  1SSH A;  2I0N A;  2DIL A;  1X2Q A;  2W10 A;  2J06 A;  1T3S A;  4RUG A;  2OJ2 A;  1QWE A;  2EGC A;  2EYY A;  1NEB A;  3VS5 A;  2KT1 A;  2KXC A;  1UJ0 A;  3NMZ C;  2M51 A;  2QDL A;  1JO8 A;  1I07 A;  2F2V A;  4JJD A;  2MCN A;  3EHR A;  1AZE A;  3VRZ A;  1NYG A;  2L3P A;  1WX6 A;  2DF6 A;  2KRS A;  3I5S A;  3VS1 A;  4F14 A;  1Z9Z A;  1ZUK A;  1UTI A;  3PVL A;  1PHT A;  1YWP A;  2YUN A;  3I9Q A;  3TSZ A;  2D0N A;  1IO6 A;  2NUZ A;  1SHG A;  2DYB A;  2AKL A;  4RTT A;  1H8K A;  4FSS A;  2GTO A;  1B07 A;  2LMJ A;  2LX7 A;  3VS2 A;  2JXB A;  1CKA A;  5I11 A;  1PNJ A;  2FRY A;  2HDA A;  3M0R A;  1RUW A;  1AWJ A;  1ZX6 A;  2K6D A;  4CC4 B;  1KIK A;  4K11 A;  5FW9 A;  3UA7 A;  2LQW A;  1S1N A;  1B3Q A;  1HD3 A;  2ROT A;  2JW4 A;  1AOJ A;  1WXT A;  4DEX A;  2PTK A;  2YUO A;  2CUB A;  1V1C A;  2RMO A;  2J7I A;  3PVQ A;  4EIK A;  2YSQ A;  5FWC A;  1E6G A;  5I22 A;  2FPF A;  2KRM A;  1OPL A;  1BBZ A;  4JZ4 A;  2C0I A;  2RQR A;  1KSW A;  3A98 A;  2BZX A;  2L0A A;  4J9G A;  2FEI A;  1WIE A;  1VYV A;  1ZBJ A;  1K1Z A;  1M8M A;  2OAW A;  2EGA A;  3C0C A; 
#chains in the Genus database with same CATH topology
 3CBP A;  3OYB A;  1ABO A;  1N6A A;  1K9M C;  4ESR A;  3EFO B;  4BE1 A;  3O8V A;  1BIA A;  2L89 A;  2O88 A;  1FMV A;  1MGQ A;  2EYW A;  4JRQ A;  4N0A C;  3OYD A;  4PJO E;  3EGD B;  4J9F A;  4M75 D;  3MET A;  4F7U A;  4WF2 A;  1M2O A;  2GCX A;  5LJ5 h;  2OTJ Q;  2E1H A;  3QHS A;  1OV3 A;  4MML A;  3TVT A;  2FO0 A;  4KGX B;  1WHG A;  4RTX A;  2HSE B;  4RTU A;  3CME Q;  2KR3 A;  2QQ9 A;  2AT1 B;  4M78 A;  2NLU A;  3CCL T;  1GL5 A;  4B6M A;  3N5B B;  2X4W A;  3I5R A;  3JV3 A;  1QVF P;  1U06 A;  1U5S A;  2DZ9 A;  2CP5 A;  2F2W A;  4M7D F;  1X6B A;  4NS5 A;  4KBM B;  5GAN 7;  4XU1 A;  1FMW A;  1K0X A;  1QVG P;  2D8J A;  4M77 F;  1IHW A;  3RIR A;  2LT1 A;  3M4G A;  2EYZ A;  3G4S T;  2VVK A;  3BW1 A;  1LVK A;  4Z89 A;  1KC8 U;  2AK5 A;  2OI3 A;  4M78 C;  3S3N A;  3CCU A;  2ED1 A;  1YJW T;  3JB9 D;  3OMG A;  1FWZ A;  3E2U A;  2EVR A;  3TRE A;  3CMA A;  1GRI A;  1RAE B;  1RL2 A;  5CQY A;  2GF7 A;  2M0Y A;  4C5E A;  3PIP A;  3ASK A;  3NTH A;  4AG1 C;  1T3L A;  2MK5 A;  1X43 A;  3A8O B;  2LCL A;  3M59 A;  3RR6 A;  4BDY A;  1D1A A;  3GF5 A;  4HCK A;  3M9Q A;  3GP8 A;  1W1F A;  2SRC A;  4FL6 A;  1VQM A;  3LGF A;  2XHC A;  1GXI E;  1HSQ A;  2WSE E;  2CS7 A;  2F5T X;  4RMO A;  2DJZ A;  2DLP A;  2FZK B;  1RAB B;  5LJ5 j;  2ABL A;  1TS9 A;  2K4Y A;  2E65 A;  3M58 A;  5CAI A;  1Q7Y C;  2E41 A;  1IHV A;  3M56 A;  3L1A A;  2LT4 A;  1VUB A;  2QA4 T;  2LNV A;  3V8K A;  1PG5 B;  2JVV A;  2DL7 A;  1OUL A;  4P5N A;  3I56 T;  3GOX A;  2X4Y A;  1ZUU A;  1V76 A;  1AZG B;  1IGU A;  2MOX A;  1H3H A;  4EPC A;  4M7A F;  4Y28 E;  4TVR A;  5CKD A;  5IH2 A;  2RJD A;  4ZTF A;  1QP3 A;  2O2O A;  1K73 C;  2DIG A;  1XQH A;  3CCL A;  4Z88 A;  2KMT A;  2VAS A;  3OYM A;  3X26 B;  4ATO A;  4X1V A;  5J3B A;  2LVM A;  1K8A C;  4FW1 A;  5GAN h;  2K5F A;  4QQD A;  3TCJ A;  1P92 A;  2AHJ B;  2JJ9 A;  2VUB A;  2D1X A;  1D0Y A;  1MND A;  3U23 A;  1W70 A;  2EGE A;  3G4S A;  3O5Z A;  3QKJ A;  1NLP C;  3RNJ A;  5M9O A;  3VS0 A;  5FU7 B;  4FSX A;  1A0N B;  4KH0 B;  4ELY C;  1M3B A;  1NG2 A;  2G3R A;  1YP5 A;  5FRN A;  4QVC A;  3DKM A;  4QW2 A;  3ULR B;  2QQR A;  3VS7 A;  2ENM A;  1W6X A;  3HRS A;  4ELZ C;  2VGM A;  1YWO A;  1WLP B;  4E7K A;  1ZSG A;  2BE7 D;  2HKN A;  1N9R A;  1VQK A;  2V1Q A;  4IIM A;  2G6F X;  1N8R R;  1FMK A;  2LJ1 A;  2JM8 A;  1HJD A;  1M30 A;  3MP1 A;  4FT4 A;  1Q86 U;  3VKI A;  4BE2 A;  1Z9Q A;  3THK A;  1EFN A;  1PD1 A;  3QO3 A;  1TXQ A;  3A8G B;  2C06 A;  3BE3 A;  1TG0 A;  1VQ6 Q;  4HT9 A;  4M7D G;  1K0S A;  2VB6 A;  3HKS A;  4A4E A;  3CCQ T;  2C0T A;  1MV3 A;  5CR2 A;  4AFQ C;  3I56 A;  1NJI U;  3LX7 A;  2RHX A;  4LE9 A;  2COW A;  2BZY A;  3J81 E;  3MEW A;  2RA2 A;  3REB B;  2E5K A;  4OMM A;  3PMT A;  3BDU A;  4FU6 A;  5LJ3 d;  3JCM X;  3C95 A;  3UDC A;  3JB9 F;  2KEA A;  1KC8 R;  2QEX Q;  4R55 A;  2RM4 A;  4RCC A;  3VJP A;  1UHC A;  2L2P A;  1KD1 U;  2GQV A;  5GAN j;  2RK2 A;  4E6R A;  3I55 T;  2XIC A;  2QI2 A;  4PFO A;  4HA8 A;  1W2B S;  2J05 A;  1VQP T;  2JT4 A;  5IXB A;  1Y0M A;  2RPN A;  5GAM h;  4WTO B;  2PZ1 A;  4RG8 A;  1VOM A;  3EG0 A;  2LC4 A;  4HVU A;  3VS4 A;  1Q7Y U;  2DTO A;  4BI4 A;  3L42 A;  1SPK A;  4M7D A;  2H3E B;  2OTL T;  1WFW A;  2QGG A;  4M77 A;  2JNG A;  1OOT A;  3EFS A;  1M1F A;  3CC7 Q;  2MMP A;  1E6H A;  3SWN B;  4XAX B;  3RBB B;  2CT3 A;  4OMP A;  2VXF A;  3JCM c;  1Y07 A;  2R5M A;  3OS2 A;  1BU1 A;  4JRI A;  3REA B;  5CKF A;  2RB6 A;  5KYW A;  1ZBX A;  4E7L A;  1U3O A;  1QCN A;  1JJ2 A;  3PGG A;  5HKC A;  1JJ2 P;  2MWO A;  2RN8 A;  2MPX C;  3HPW A;  1SRM A;  1B7T A;  1NPP A;  1J3T A;  2RQW A;  1SSH A;  3FB9 A;  4M7D C;  2DIL A;  1X2Q A;  1MMD A;  4DBQ A;  2PVG B;  4PLL A;  5KCH A;  5GAM e;  1PD0 A;  3FIF A;  1QWE A;  4M77 C;  3VS5 A;  2ZPE B;  3LH0 A;  2RI2 A;  1UJ0 A;  4HCB A;  4C92 B;  2FZC B;  4KUD K;  3NMZ C;  2M51 A;  2QDL A;  1VQ9 Q;  5C6S A;  5LJ5 g;  2VV5 A;  4LDX A;  3CCE Q;  3CCQ A;  5FRO A;  1WX6 A;  2R5A A;  1M1K C;  2DF6 A;  3OYI A;  4C5G A;  4M7A E;  1K9M R;  1ZUK A;  4E47 A;  4J7F A;  5GAN 2;  2JOY A;  4BY6 C;  1VQ7 Q;  3CCM Q;  1H8K A;  4FSS A;  2JTM A;  2M02 A;  1YIT T;  1CKA A;  5I11 A;  3CC2 A;  3EG9 B;  4C8Q G;  2NUT A;  2CZ7 B;  1C6V X;  1JRI A;  2K6D A;  3L2R A;  2YRV A;  1KIK A;  5DY9 A;  1U1S A;  1I5O B;  1ZA1 B;  4E7S A;  3RKX A;  4M7A A;  5GAM j;  1S1N A;  4M75 G;  3CD6 T;  4XU0 A;  1AOJ A;  3P8H A;  4DEX A;  1IXD A;  4BD3 A;  1VQP A;  2CUB A;  1V1C A;  2E10 A;  2J7I A;  2L8D A;  4EIK A;  1E6G A;  1PCX A;  1M1G A;  2RHU A;  3X25 B;  2RQR A;  3X20 B;  1WJR A;  8AT1 B;  1YJ9 Q;  1VIE A;  2NYS A;  2K5I A;  5D6W A;  2OAW A;  3UT1 A;  5J26 A;  2EGA A;  2X51 A;  1YI2 Q;  4KRT A;  2RD1 A;  1FXX A;  2A36 A;  4PJL A;  3OYK A;  2K5L A;  4C8Q B;  4OB3 B;  1MMN A;  3OW2 A;  1XOV A;  1E7O A;  1UG1 A;  1VQL T;  4FCY A;  5KYX B;  1BB9 A;  4CI0 C;  3G6E Q;  3P8B B;  3TQ7 P;  1QLY A;  1WHJ A;  3J80 E;  2XDD A;  1D1B A;  3CC4 Q;  4N4H A;  3PFS A;  1KFZ A;  2YRC A;  4XU2 A;  2AZS A;  2D9T A;  1I8F A;  5CKH A;  3VYG A;  1UEC A;  2K2M A;  1G83 A;  3MP8 A;  1LJO A;  2EYX A;  1AWO A;  4KH1 B;  2RQU A;  1WZO A;  3JCM J;  3HFO A;  5D6Y A;  3CCJ A;  1T0H A;  3JCM b;  1AEY A;  4EMG A;  1SHF A;  2IVW A;  3M0P A;  3OYF A;  1R0B G;  2GTJ A;  2EFI A;  3H41 A;  1YIJ T;  2PUO B;  2X4J A;  2L3Q A;  2LDM A;  2DTI A;  4JDS A;  2LQK A;  1BYM A;  3FRN A;  2EJ9 A;  1X27 A;  2JS0 A;  2V1R A;  4E7H A;  4JS5 A;  1Q7Y R;  4C92 D;  1YIT A;  1XNI A;  3M0Q A;  3RDV A;  4C0D C;  2DL8 A;  1WHH A;  2CKK A;  3M0U A;  5GAO n;  3FJ5 A;  4WCI A;  1YNZ A;  3CD6 A;  4N4I A;  4L6V 5;  4GLM A;  2DEQ A;  1ZSZ A;  1M4Z A;  4MZP A;  2HCK A;  3EH2 A;  5GAN g;  1K73 R;  2V8J A;  4DEY A;  2E12 A;  2ATC B;  2EJF A;  5CKE A;  3LWH A;  5EC7 A;  5GAN 8;  3DLM A;  4PLI A;  2HQX A;  1YJN T;  4LUE A;  4PJN A;  3PIO A;  4XTX A;  4XK8 E;  1WQ7 A;  2GQI A;  3CEY A;  2VXE A;  3QII A;  3JCM e;  1VYU A;  1K8A R;  2QXF A;  5GAN 6;  2LZ6 B;  1JU5 C;  3FDR A;  5GJW B;  4LDV A;  3PE0 A;  3L2V A;  3HP9 A;  2DNU A;  2EQU A;  1UEB A;  1ZSZ C;  2BTT A;  1KQ1 A;  2RQT A;  1OX9 A;  1VQL A;  3EGX A;  3J7A F;  4F7U E;  5HK3 A;  1NE8 A;  3CBO A;  1PC0 A;  3CPW P;  2K57 A;  2NUP B;  1VQM T;  3A8L B;  4PJO G;  5KYY B;  4C8Q D;  1Q81 U;  2K3B A;  3S6W A;  3QUI A;  3WVE B;  3OW2 S;  4M78 E;  1YN8 A;  2LX9 A;  2PU9 B;  3KXT A;  2ZPG B;  3EGD A;  4ZTJ A;  4C0Z A;  1QCF A;  4EMH A;  1O75 A;  2DD4 A;  3LW5 E;  1WJQ A;  1JXM A;  1OPK A;  3CCU Q;  1QWF A;  4ZGD B;  1UUE A;  1YIJ A;  4QT7 A;  4AMC A;  3NHN A;  2JTE A;  5D6X A;  3VS6 A;  4DOV A;  1SKU B;  2ESW A;  3CMA Q;  4NL3 A;  5IT9 E;  4CC7 A;  1X2K A;  5DLO A;  4ORZ A;  1QVF A;  4PKC C;  1JQQ A;  5GAO p;  1Q86 C;  4PJO B;  4OMO A;  1D3B B;  3MPU B;  2L3R A;  2O31 A;  1QVG A;  4MDX A;  5GAM g;  3OSS C;  2KYM A;  2DIQ A;  2DL5 A;  1RI9 A;  2J6K A;  2DL3 A;  2JS2 A;  3DLL A;  3QYG B;  2KRO A;  1YJN A;  1UJY A;  2IIM A;  5LJ5 e;  1NJI C;  3OYC A;  2ZCF B;  2CZ1 B;  3QZ9 B;  3MEV A;  4JJC A;  3E1S A;  4VUB A;  2D6F A;  1S72 Q;  4KUL A;  2P4R A;  4GY5 A;  4CC2 A;  4PFP A;  2CH4 W;  1OEB A;  4LD9 K;  2L3S A;  2XID A;  4N4G A;  2YUP A;  1VQK T;  1GFC A;  1NYF A;  3OYJ A;  4E7J A;  1AVZ C;  2J6F A;  2PVD B;  2LJ0 A;  3CCL Q;  2PVO B;  1KD1 C;  4O5V A;  2KSS A;  1Q82 R;  5CO7 A;  1K4U S;  1I1J A;  4C92 F;  1Y96 B;  2DA9 A;  4IUV A;  4J6Y A;  2BUD A;  2ROL A;  1BKB A;  1BI2 A;  2CP3 A;  2JZ2 A;  4C0G A;  2P84 A;  3MHX A;  3OYN A;  1TUG B;  2JUF A;  3JAM E;  2KI7 A;  4F16 A;  4BDZ A;  3G4S Q;  2EW3 A;  4QVZ A;  2EQK A;  1KHC A;  3H9N A;  3X28 B;  1TUD A;  1VA7 A;  3JSC A;  4OMF B;  4J6W A;  1RLQ C;  5A0D A;  2LCC A;  1YJW Q;  3JB9 I;  3X24 B;  2KK4 A;  4D8D A;  3FC3 A;  2H3J A;  1WI7 A;  4O6J A;  3RKW A;  1VQ8 T;  1UGR B;  1VQ5 T;  2YRD A;  2K2V A;  1Y7X A;  1G3Y A;  1OYX A;  1ZQ1 A;  1M1K R;  2FZG B;  1WHM A;  5GAO r;  3NFC A;  2QDY B;  2MAM A;  2I2L A;  2DER A;  1AWX A;  1VQ4 Q;  4OVA A;  5L23 A;  3JB9 J;  5C0M A;  4RTV A;  1QVP A;  2VKN A;  4FIB A;  3JCM Q;  1QVF S;  3PTA A;  1PWT A;  1K76 A;  5KYU A;  4RCB A;  2CYZ B;  4UC4 A;  4C8Q F;  2QA4 Q;  4PJO D;  1QP2 A;  2K79 A;  5IHI A;  3VU3 C;  3I56 Q;  1D1C A;  1QVG S;  2EKH A;  2EAY A;  4LDY A;  1VQ6 T;  4JLG A;  4M75 F;  4EMK B;  1M90 C;  1QCO A;  2I0N A;  5L8R E;  2W10 A;  5I21 A;  2DFU A;  2RJE A;  2EGC A;  2EYY A;  5KE2 A;  2KT1 A;  5A2Q E;  1I07 A;  2F2V A;  3KBG A;  4JJD A;  5A0G A;  1AZE A;  1WHK A;  2KRS A;  3I5S A;  3VS1 A;  3SB2 A;  2LRQ A;  3OBW A;  5GAN e;  2V8K A;  1PHT A;  2B8A A;  3TSZ A;  5FU7 C;  1SHG A;  4IUU A;  1B07 A;  3VS2 A;  3A8M B;  2EYQ A;  3M0R A;  3JCM g;  1AWJ A;  4CC4 B;  2L5Q A;  4PJJ A;  1KQS A;  2A0F B;  1KQS P;  2DVE A;  2ZAE A;  3V7R A;  5LL6 S;  2CP2 A;  4C5H A;  3CC2 T;  3CXC P;  2KQW A;  2Y4X A;  2FL7 A;  2YSQ A;  2WSC E;  1SF9 A;  1VQ8 A;  1R0C B;  3VV0 A;  5I22 A;  3CBM A;  5LJ3 h;  1VQ5 A;  4DBF A;  2RHZ A;  3GIB A;  4M7D E;  2C0I A;  2QAS A;  1M2V B;  3A98 A;  3SFM A;  1G3W A;  3PT9 A;  2L0A A;  2FEI A;  4M77 E;  5CIU A;  2RHY A;  2HAX A;  3UPU A;  2ZGW A;  3QJY A;  2OAU A;  5CK9 A;  2DET A;  3QDF A;  3CPF A;  4FT2 A;  1HXD A;  2EQI A;  2BZ8 A;  3H0I A;  2KNB B;  1UGP B;  2EIF A;  5LJ5 f;  5GAN 3;  1LOJ A;  4C92 G;  4NOY A;  2MIO A;  3OYL A;  4J9H A;  3ZL7 C;  3CCS T;  4C0F A;  5KYN A;  3KFV A;  3L2W A;  2HQE A;  3CCQ Q;  4JRP A;  1VQO T;  3MEA A;  2RJC A;  3AT1 B;  2A3L A;  4MZM A;  3BDL A;  4E7I A;  1VQ6 A;  5J39 A;  3SDZ A;  3HTR A;  1NLO C;  1AT1 B;  3D7S B;  2QTX A;  3V8J A;  2DJQ A;  4Y92 A;  2HBW A;  1X01 A;  1X69 A;  1IGQ A;  4M77 B;  1CKB A;  2O9V A;  1O9S A;  3V8L A;  2FG0 A;  2YHT A;  4QKU A;  5LJ3 e;  2HD0 A;  5GJV B;  1MV0 B;  1WHL A;  4J5Y A;  2DO3 A;  3I55 Q;  9ATC B;  1VQP Q;  4BY6 B;  1VQN T;  2XK0 A;  1TTH B;  2DL4 A;  2XKO C;  4RTZ A;  1JEG A;  2RNA A;  1H92 A;  2LTO A;  3INZ A;  3CCJ T;  3GBQ A;  3SWN C;  1WJS A;  1I0C A;  1JXO A;  4C92 A;  3SHW A;  2X9H A;  3QDR B;  2KY9 A;  2IG0 A;  1M27 C;  4A4K A;  2E6N A;  2OTL Q;  3H8Z A;  4IUP A;  4DA4 A;  5I2S A;  3WVD B;  3DB4 A;  1GBQ A;  1U8R A;  1M90 U;  1OU9 A;  2HMA A;  4OF1 A;  3RKY A;  2ECZ A;  4JZ3 A;  4ME7 A;  5LJ3 j;  4PJO F;  1D09 B;  2DKG A;  3OBY A;  4OML A;  4E2F B;  3M5A A;  3CC7 A;  3WXM B;  2AZV A;  1RAC B;  1UE9 A;  1WQW A;  2KAF A;  2LP5 A;  2FB7 A;  1QMC A;  1SG5 A;  4DBR A;  1DJ7 B;  4PFZ A;  4OGE A;  1PM3 A;  3EHQ A;  3BY7 A;  4C92 C;  1Q81 C;  1BCO A;  1ARK A;  4JPB W;  3OSV A;  2PUK B;  2O4X A;  4BB7 A;  4QQ6 A;  3A1P A;  5GMK i;  3F70 A;  4M7A B;  1KHI A;  3MO8 A;  4LUD A;  2X4X A;  2AKK A;  4BUG A;  1UGV A;  4RKU E;  1Q86 R;  1F1B B;  2E3H A;  2XMF A;  2CSQ A;  2GBQ A;  3H6Z A;  4LDW A;  5I2M A;  3CCS A;  1D0Z A;  1HYO A;  2QQB A;  3EFR A;  4M75 E;  4M4Z A;  1VQO A;  3H0H A;  1BK2 A;  1D0X A;  1WXU A;  1VQ9 A;  2FRW A;  1C0M A;  4KGZ B;  1G8X A;  3CCE A;  3M53 A;  2HL5 C;  1N8R C;  1NEG A;  4J9I A;  4C8Q A;  4V2S A;  3EH1 A;  5GAO l;  4HXJ A;  1YIT Q;  2Y4Y A;  5IHK A;  1NJI R;  4RG2 A;  5GMK h;  2QK0 A;  4J7I A;  4M75 A;  3EG2 A;  2DBM A;  5DLQ E;  4NL2 A;  4XTW A;  2RHI A;  1OI1 A;  4IUR A;  5GAN f;  2F2X A;  1NM7 A;  3CD6 Q;  4HT8 A;  1RAH B;  1UFF A;  2FPD A;  1IZ6 A;  4J6X A;  3OYH A;  1KJW A;  4M77 D;  1VQN A;  4IUQ A;  1JJ2 S;  1X6O A;  1KD1 R;  1HK9 A;  3HRT A;  5FRM A;  1IRE B;  2P4T A;  5HCK A;  4Z8A A;  4KUI A;  1QKW A;  4ZGJ B;  4QVD A;  1LPL A;  1AD5 A;  3MKD A;  4B9W A;  4C8Q C;  4HVV A;  1GCQ A;  3SD4 A;  3VRY A;  3CCR T;  2RJF A;  5AT1 B;  3VUB A;  4HVW A;  3G71 Q;  4LNP A;  4JJN K;  4M75 C;  2XI9 A;  4XTU A;  3JCM V;  1GFD A;  5GAO q;  1YHQ T;  2A7Y A;  1EX4 A;  2A37 A;  2YWW A;  5CVI A;  4J9E A;  2E70 A;  1VQL Q;  1K9A A;  3PNW C;  3CCV T;  5D7U A;  2O9S A;  1B34 B;  5FU6 C;  3TU4 K;  1RAG B;  2A08 A;  1PKS A;  4A4H A;  1CSK A;  2K7A A;  2JN0 A;  3EGU A;  2DXU A;  4XU3 A;  5HY6 A;  1EZZ B;  2KRN A;  3UA6 A;  1BCM A;  3RES A;  3G6E A;  1M5Q 1;  2CGH A;  2VYT A;  1GCQ C;  3QWY A;  2HKQ B;  2D0Q B;  2HSP A;  3ZBD A;  2E3I A;  2DXB A;  1R8O B;  4DBH A;  5AYF A;  3NTI A;  4OGC A;  2QGF B;  4OB2 B;  1KG1 A;  7AT1 B;  2DM1 A;  1XJW B;  4RTY A;  4F04 B;  4HCZ A;  2OTJ T;  3PMI A;  2DE0 X;  4XTY A;  4E7Z A;  3E9G A;  4M7A D;  3QBY A;  4GBQ A;  4ZN3 A;  1I5L A;  5GMK j;  3GPL A;  5ECA A;  3CME T;  2ZZD A;  3CPW A;  1WYX A;  3M4Y A;  4LXC A;  4AT1 B;  4B9X A;  3OQ5 A;  4DQ2 A;  2KVQ G;  1UDL A;  1I81 A;  2M0O A;  2NUP A;  3QPH A;  5GAM f;  3L2Q A;  1MMA A;  1RLP C;  3JCM W;  1UHF A;  2RF0 A;  3EFO A;  2MYS A;  4BI8 B;  2EQM A;  1ZLM A;  5KYY A;  1OU8 A;  8ATC B;  2YDL A;  2Y90 A;  2HL3 A;  2WSF E;  4XTZ A;  2CUD A;  2RO0 A;  3C94 A;  2ZPF B;  1YJN Q;  2DPP B;  2Z0W A;  1C1A A;  2CP6 A;  4DOW A;  4Q5W A;  1YCY A;  2XG8 D;  3OYY A;  1PSF A;  5LJ5 d;  1N27 A;  1UGQ B;  2HZY A;  3CCR A;  3OB9 A;  3OYG A;  4F7U B;  1WPY A;  3T9N A;  2J6O A;  1N8R U;  1YHQ A;  1S72 T;  4AG2 C;  1IRX A;  4A63 B;  5LJ3 g;  4J8O A;  3OYE A;  2DRK A;  3FJP A;  1TOV A;  1Y71 A;  3CCV A;  4M78 B;  5GAO m;  2ZPH B;  1RAF B;  4PJO A;  2HNI A;  1D3B A;  1VQM Q;  1FX7 A;  2A28 A;  4PK4 A;  3E19 A;  3UF4 A;  2GFA A;  4J9B A;  1YCS B;  3RMS A;  3OA6 A;  4JUV A;  3LGL A;  4RUG A;  4CRI A;  3EAE A;  1XTD A;  1NEB A;  4X9D A;  1Q95 G;  3TEE A;  3V7S A;  2DAQ A;  3G1J A;  2MCN A;  4IKF A;  2VC8 A;  1RAD B;  3VRZ A;  2L3P A;  2ZPI B;  5A0L A;  5GAN 5;  4F14 A;  2OTJ A;  2YLB A;  1Z9Z A;  1NBE B;  3A5Z B;  1YWP A;  2YUN A;  1IO6 A;  2NUZ A;  3HHT B;  3LLR A;  4PJO C;  3S3O A;  2CZ6 B;  3BFM A;  2LX7 A;  1EIF A;  3M54 A;  3CME A;  4X34 A;  4J83 A;  2FRY A;  2HDA A;  4QQG A;  2IPO B;  1RUW A;  2QYZ A;  4K11 A;  5FW9 A;  1Y96 A;  2LQW A;  4MDW A;  4EDU A;  1HD3 A;  2ROT A;  2QAZ A;  2JW4 A;  2M1H A;  2PTK A;  2PQW A;  1TWB A;  2RMO A;  2YLC A;  3MCA B;  3CPW S;  1VQ4 T;  2FHD A;  1UB4 A;  1OPL A;  2YXY A;  4JZ4 A;  1ZHI A;  1KSW A;  3G7Z A;  3MJX A;  1ZA2 B;  2BZX A;  4J9G A;  3S3M A;  2F1L A;  4X9C A;  3GNF B;  1K1Z A;  1SSF A;  2V8I A;  1BIB A;  2R57 A;  3ME9 A;  4FYV B;  4II1 A;  1VQK Q;  2P0K A;  5IXF A;  5GAN 4;  1S72 A;  1PSE A;  2XU8 A;  4L59 A;  2DTH A;  3TSW A;  2LQN A;  1W2B A;  2E6Z A;  1W2B P;  4L5G A;  2KYB A;  3H0F A;  1BI1 A;  2BIV A;  2X35 A;  3L2U A;  3OS1 A;  3QWX X;  3SEM A;  5KH6 A;  2JMC A;  3UAT A;  2CSI A;  5GAN d;  2NWM A;  2EQJ A;  2CZ0 B;  3JCM f;  4M78 D;  4AFZ C;  2CDT A;  2RQV A;  2MI6 A;  1KK7 A;  1K9M U;  2PNI A;  3R6O A;  1Q81 R;  5IHN A;  2DEU A;  4J9C A;  4EMK A;  5KYU B;  2D8H A;  2GGR A;  3QZ5 B;  3RER A;  2DRM A;  1VQ8 Q;  3FLG A;  3V7C A;  1YJW A;  1ABQ A;  2CP0 A;  2YUQ A;  1VQ5 Q;  2HBP A;  2EBP A;  1N5Z A;  2KXD A;  4ZNX A;  3VS3 A;  2QEX T;  5GMK l;  4ANJ A;  2DX1 A;  3EG3 A;  1MUZ A;  1WGS A;  1AHJ B;  2DD5 A;  2CP7 A;  2KE9 A;  1V29 B;  4LD6 A;  2H8H A;  2COZ A;  2GFU A;  4IUT A;  4EMK C;  1M3C A;  5CQX A;  1VYT A;  1VQ4 A;  3C12 A;  1QQJ A;  3OMC A;  3OS0 A;  2BE9 B;  2WAC A;  3JCM P;  3CXC A;  1PRM C;  2QA4 A;  1IB8 A;  3LWI A;  3CC7 T;  4C5I A;  1ZUY A;  3NPF A;  1PRL C;  4GLK A;  1LNX A;  4M77 G;  3MP6 A;  2M9U A;  2OX7 A;  2FVU A;  1G3S A;  1SRL A;  1M2V A;  2JMA A;  3M0S A;  4OMQ A;  2C0O A;  3RUX A;  4OB0 B;  1QW1 A;  1KQ2 A;  3ER0 A;  3JRZ A;  1OX8 A;  3CQT A;  2XD0 A;  2DVJ A;  2LCS A;  1TH7 A;  4BAC A;  2CRE A;  1BI3 A;  4OP0 A;  3JB9 H;  3EG1 A;  5GAM d;  1M8V A;  2P0Q A;  4F17 A;  2ZPB B;  1N9S A;  5HK0 A;  4BI3 A;  2CT4 A;  4ZN1 A;  1RAA B;  4FM4 B;  2P0P A;  2DBK A;  2ED0 A;  1RAI B;  3SWN A;  1VQ9 T;  3HFN A;  4M7D B;  3CCE T;  3MEU A;  4JJB A;  3LH5 A;  1R77 A;  4R56 A;  2KBT A;  1SEM A;  3CC2 Q;  1WNL A;  1Q82 C;  2EWN A;  1TUC A;  5CCA A;  4HCC A;  2EJG A;  1VQ7 T;  4C92 E;  3CCM T;  1JB0 E;  2DMO A;  4JLI A;  1G3T A;  2QQA A;  2B86 A;  1X75 C;  2K3Y A;  4AFU C;  2CH4 A;  1K73 U;  1H3Z A;  2JTF A;  5KYW B;  1TU0 B;  4LN2 A;  2QEX A;  1Y57 A;  3VYH B;  3Q1J A;  4Z02 A;  1G5V A;  3L2Z A;  5KCO A;  3LYI A;  1QKX A;  2VGN A;  4R0K A;  4M7A G;  1YFN A;  4BE0 A;  2HEQ A;  3KUF A;  4F7U F;  2SEM A;  2R58 A;  3C4S A;  3AHU A;  1MHN A;  1K8A U;  2XDP A;  2DK3 A;  4LDU A;  2RK1 A;  3CCS Q;  1AWW A;  3QSU A;  3NTK A;  4FYX B;  1VQO Q;  1I4K 1;  4PL6 A;  1YJ9 T;  2LJ3 A;  4M78 F;  4FW2 A;  5FLX E;  1FYN A;  3E9F A;  3EG9 A;  1YBY A;  1YI2 T;  2MF2 A;  3HSB A;  4FYW B;  3M0T A;  1H64 1;  4MMK A;  4YTL A;  1KQS S;  3R6N A;  2BKD N;  5KE3 A;  2NUT B;  2EPD A;  2JM9 A;  1WXB A;  2KDS A;  3CXC S;  4D8K A;  4OB1 B;  4J9D A;  3G6E T;  4A4F A;  4OMN A;  3CC4 T;  1WA7 A;  2DZC A;  2K9G A;  5FWB A;  1VQN Q;  4C8Q E;  4JRK A;  3URG A;  3OS5 A;  3UWN A;  5GMK m;  3CCJ Q;  3DB3 A;  3I55 A;  2YT6 A;  2COY A;  4ZGE B;  2W0Z A;  1WDX A;  2O4X B;  3GNG A;  3ZEH A;  2KT8 A;  4A53 A;  4KGV B;  4MZT A;  1OZ3 A;  4IIO A;  4KT0 E;  2OTL A;  3A8H B;  1OZ2 A;  4HKE A;  2V26 A;  1VQ7 A;  3CCM A;  3G71 T;  5KYX A;  2X3W D;  4FYY B;  2QQS A;  3IQL A;  4M7A C;  3ZFJ A;  4CC3 A;  2QTV A;  4XTV A;  2LNH B;  4M7D D;  1UGS B;  1X6G A;  3NGP A;  4D6W A;  4RTW A;  3OW2 P;  5IAY A;  2VWF A;  3M57 A;  2MWP A;  4M75 B;  1VIF A;  1G2B A;  2K3X A;  2KGT A;  4A54 A;  2RI5 A;  4PJM A;  3GLX A;  1GCP A;  4AFS C;  2EKO A;  1T0J A;  3JB9 G;  4C0D B;  5FU6 B;  5CKB A;  3QXE B;  2X3X D;  3RMQ A;  3OY9 A;  2FPE A;  1BI0 A;  1MMG A;  1M3A A;  1LCK A;  3I35 A;  3JCM d;  1YJ9 A;  1GBR A;  1KC8 C;  2GNC A;  4JS4 A;  1PKT A;  2F5K A;  3JCM h;  1YI2 A;  2J06 A;  1T3S A;  1Q82 U;  2OJ2 A;  2M16 A;  4XQ3 A;  5GMK e;  1NZ9 A;  4A4G A;  1B34 A;  3QG1 A;  2KXC A;  2DXC A;  2AIR B;  1JO8 A;  3VUZ A;  2XDB A;  3EHR A;  5IN1 A;  1NYG A;  2F69 A;  3CC4 A;  1UTI A;  3PVL A;  1ACM B;  3I9Q A;  1ZSZ B;  2D0N A;  2DYB A;  2AKL A;  4RTT A;  5EG2 A;  2GTO A;  3HRU A;  2LMJ A;  2JXB A;  2DXT A;  1PNJ A;  3OYA A;  1YIJ Q;  2E64 A;  1ZX6 A;  3M55 A;  1RI0 A;  3CCR Q;  3UA7 A;  4F7U G;  1JBM A;  2DYI A;  2HQH A;  1B3Q A;  3QYH B;  3CCU T;  5LJ3 f;  1WXT A;  2YUO A;  3HL8 A;  4N0A A;  1YHQ Q;  1TSF A;  4Y91 A;  1M1K U;  1OQK A;  3FEO A;  3CMA T;  3PVQ A;  6AT1 B;  1NPR A;  1MNE A;  1U1T A;  2RH2 A;  1W4S A;  3G71 A;  2E5Q A;  5FWC A;  2FPF A;  2KRM A;  2RI3 A;  5DM7 R;  4M78 G;  3CCV Q;  1M90 R;  2FYK A;  1BBZ A;  2QG9 B;  2LQ8 A;  2E4H A;  1WIE A;  3EGX B;  1VYV A;  1ZBJ A;  3P8D A;  2O01 E;  1M8M A;  4PNO A;  3C0C A;  1M9S A;  3QJ6 A; 
#chains in the Genus database with same CATH homology
 4KRT A;  1ABO A;  2A36 A;  2EQI A;  5IXF A;  2BZ8 A;  4ESR A;  3H0I A;  2KNB B;  3TSW A;  1XOV A;  2LQN A;  1E7O A;  2O88 A;  1UG1 A;  2EYW A;  2MIO A;  4J9H A;  2KYB A;  3ZL7 C;  3H0F A;  3KFV A;  1BB9 A;  4J9F A;  1QLY A;  3QWX X;  3SEM A;  1OV3 A;  2JMC A;  3UAT A;  3TVT A;  1KFZ A;  2FO0 A;  2AZS A;  4RTX A;  1NLO C;  2CSI A;  4RTU A;  1UEC A;  2K2M A;  1G83 A;  2DJQ A;  4Y92 A;  2HBW A;  1X69 A;  2NWM A;  1CKB A;  2EYX A;  2KR3 A;  2O9V A;  4AFZ C;  2CDT A;  2RQV A;  1AWO A;  2RQU A;  2FG0 A;  2PNI A;  1T0H A;  1AEY A;  1GL5 A;  5GJV B;  5IHN A;  1SHF A;  3I5R A;  3JV3 A;  1MV0 B;  3M0P A;  1U06 A;  4J9C A;  1U5S A;  2GTJ A;  3H41 A;  2D8H A;  2GGR A;  2F2W A;  2L3Q A;  1X6B A;  2DL4 A;  4RTZ A;  1JEG A;  1K0X A;  2RNA A;  1H92 A;  1X27 A;  2JS0 A;  2V1R A;  2DRM A;  2D8J A;  1ABQ A;  3GBQ A;  2YUQ A;  1I0C A;  1JXO A;  2EYZ A;  3SHW A;  2EBP A;  1N5Z A;  3M0Q A;  1M27 C;  2KXD A;  2VVK A;  4ZNX A;  3VS3 A;  2DL8 A;  3M0U A;  4Z89 A;  3FJ5 A;  2DX1 A;  3EG3 A;  2AK5 A;  4WCI A;  1YNZ A;  2OI3 A;  1GBQ A;  1MUZ A;  4GLM A;  2KE9 A;  2ED1 A;  2HCK A;  2ECZ A;  4JZ3 A;  2H8H A;  4DEY A;  2EVR A;  1GRI A;  4OML A;  5EC7 A;  1M3C A;  1VYT A;  2M0Y A;  2AZV A;  4LUE A;  1UE9 A;  2LP5 A;  4AG1 C;  1T3L A;  2GQI A;  1X43 A;  3EHQ A;  1VYU A;  4HCK A;  1PRM C;  1ARK A;  4JPB W;  1W1F A;  1ZUY A;  2SRC A;  3NPF A;  2LZ6 B;  1PRL C;  1JU5 C;  4LUD A;  5GJW B;  2AKK A;  1UGV A;  1HSQ A;  3PE0 A;  2DLP A;  2DNU A;  2XMF A;  2CSQ A;  2BTT A;  2GBQ A;  1SRL A;  2ABL A;  2RQT A;  2JMA A;  3M0S A;  4OMQ A;  2C0O A;  4M4Z A;  3H0H A;  2DL7 A;  3CQT A;  1BK2 A;  2DVJ A;  2LCS A;  1WXU A;  2FRW A;  1ZUU A;  2CRE A;  1AZG B;  1H3H A;  2MOX A;  3EG1 A;  1NEG A;  2K3B A;  4J9I A;  4F17 A;  4HXJ A;  5IH2 A;  1YN8 A;  2O2O A;  5IHK A;  2CT4 A;  2DBK A;  2ED0 A;  1QCF A;  3EG2 A;  2DBM A;  4Z88 A;  2F2X A;  1NM7 A;  1JXM A;  4X1V A;  1OPK A;  4JJB A;  3LH5 A;  1QWF A;  1UFF A;  2FPD A;  1UUE A;  2KBT A;  4QT7 A;  3NHN A;  2JTE A;  1SEM A;  3VS6 A;  1KJW A;  2ESW A;  4CC7 A;  1TUC A;  2DMO A;  1X2K A;  2B86 A;  5HCK A;  2D1X A;  3U23 A;  4ORZ A;  4Z8A A;  1JQQ A;  1W70 A;  2EGE A;  1QKW A;  4AFU C;  3O5Z A;  2CH4 A;  1AD5 A;  1NLP C;  4HVV A;  1GCQ A;  3RNJ A;  4LN2 A;  3VS0 A;  3VRY A;  1Y57 A;  1A0N B;  1M3B A;  1NG2 A;  4OMO A;  1YP5 A;  2O31 A;  1QKX A;  4HVW A;  4LNP A;  4R0K A;  2KYM A;  3ULR B;  2DL5 A;  1RI9 A;  3VS7 A;  2ENM A;  1W6X A;  2HEQ A;  1GFD A;  2SEM A;  1YWO A;  2J6K A;  2DL3 A;  1WLP B;  2A37 A;  1ZSG A;  2JS2 A;  4J9E A;  2KRO A;  1K9A A;  2V1Q A;  2O9S A;  2IIM A;  1UJY A;  4IIM A;  1AWW A;  2A08 A;  2G6F X;  1PKS A;  1FMK A;  2LJ1 A;  2JM8 A;  1HJD A;  1M30 A;  2LJ3 A;  1CSK A;  4JJC A;  2K7A A;  3EGU A;  4CC2 A;  2P4R A;  2KRN A;  1Z9Q A;  2CH4 W;  3THK A;  3UA6 A;  1EFN A;  1FYN A;  1OEB A;  1GCQ C;  2L3S A;  3QWY A;  2YUP A;  1GFC A;  3M0T A;  1NYF A;  2HSP A;  3R6N A;  1AVZ C;  2J6F A;  2LJ0 A;  1TG0 A;  2EPD A;  2JM9 A;  1WXB A;  2DM1 A;  1K0S A;  4D8K A;  1K4U S;  4RTY A;  2C0T A;  1MV3 A;  1I1J A;  4J9D A;  4AFQ C;  2DA9 A;  4OMN A;  2DE0 X;  1WA7 A;  2K9G A;  5FWB A;  4LE9 A;  2BZY A;  2ROL A;  4GBQ A;  3REB B;  2YT6 A;  2E5K A;  4OMM A;  5ECA A;  2W0Z A;  1WDX A;  4F16 A;  1WYX A;  2EW3 A;  2KEA A;  2KT8 A;  1UDL A;  1RLP C;  1TUD A;  1VA7 A;  1UHC A;  1UHF A;  2L2P A;  2RF0 A;  1RLQ C;  4IIO A;  1ZLM A;  4E6R A;  2YDL A;  2J05 A;  2JT4 A;  5IXB A;  1Y0M A;  2RPN A;  4D8D A;  1WI7 A;  2PZ1 A;  2X3W D;  2CUD A;  3EG0 A;  3IQL A;  4HVU A;  3VS4 A;  4CC3 A;  2LNH B;  1X6G A;  1SPK A;  3NGP A;  4RTW A;  1WFW A;  2VWF A;  1OOT A;  1E6H A;  1G2B A;  1AWX A;  2J6O A;  2KGT A;  3RBB B;  2CT3 A;  5L23 A;  4RTV A;  4AG2 C;  4A63 B;  1GCP A;  2VKN A;  4OMP A;  4AFS C;  1T0J A;  1PWT A;  2DRK A;  1K76 A;  1BU1 A;  3REA B;  2X3X D;  1U3O A;  2FPE A;  2K79 A;  1M3A A;  1LCK A;  3I35 A;  1GBR A;  5IHI A;  2RN8 A;  2A28 A;  1SRM A;  3UF4 A;  2GNC A;  2EKH A;  4J9B A;  1YCS B;  1PKT A;  1J3T A;  2RQW A;  1SSH A;  2I0N A;  2DIL A;  1X2Q A;  2W10 A;  2J06 A;  1T3S A;  4RUG A;  2OJ2 A;  1QWE A;  2EGC A;  2EYY A;  1NEB A;  3VS5 A;  2KT1 A;  2KXC A;  1UJ0 A;  3NMZ C;  2M51 A;  2QDL A;  1JO8 A;  1I07 A;  2F2V A;  4JJD A;  2MCN A;  3EHR A;  1AZE A;  3VRZ A;  1NYG A;  2L3P A;  1WX6 A;  2DF6 A;  2KRS A;  3I5S A;  3VS1 A;  4F14 A;  1Z9Z A;  1ZUK A;  1UTI A;  3PVL A;  1PHT A;  1YWP A;  2YUN A;  3I9Q A;  3TSZ A;  2D0N A;  1IO6 A;  2NUZ A;  1SHG A;  2DYB A;  2AKL A;  4RTT A;  1H8K A;  4FSS A;  2GTO A;  1B07 A;  2LMJ A;  2LX7 A;  3VS2 A;  2JXB A;  1CKA A;  5I11 A;  1PNJ A;  2FRY A;  2HDA A;  3M0R A;  1RUW A;  1AWJ A;  1ZX6 A;  2K6D A;  4CC4 B;  1KIK A;  4K11 A;  5FW9 A;  3UA7 A;  2LQW A;  1S1N A;  1B3Q A;  1HD3 A;  2ROT A;  2JW4 A;  1AOJ A;  1WXT A;  4DEX A;  2PTK A;  2YUO A;  2CUB A;  1V1C A;  2RMO A;  2J7I A;  3PVQ A;  4EIK A;  2YSQ A;  5FWC A;  1E6G A;  5I22 A;  2FPF A;  2KRM A;  1OPL A;  1BBZ A;  4JZ4 A;  2C0I A;  2RQR A;  1KSW A;  3A98 A;  2BZX A;  2L0A A;  4J9G A;  2FEI A;  1WIE A;  1VYV A;  1ZBJ A;  1K1Z A;  1M8M A;  2OAW A;  2EGA A;  3C0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...