2K3DA

Solution nmr structure of the folded 79 residue fragment of lin0334 from listeria innocua. northeast structural genomics consortium target lkr15
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
AFFNEQKEKVTLYLKHNIPDFNTVTFTNEEFNPIGISIDGYINNDKNLSFTAGKDVKIFSSSEELDKMFQEPRKGYDEILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin0334 protein
publication title Solution NMR structure of the folded 79 residue fragment of Lin0334 from Listeria innocua. Northeast Structural Genomics Consortium target LkR15.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.130 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, folded 79 residue fragment of lin0334 like domains 2k3dA00
2K3DA
chains in the Genus database with same CATH superfamily
3L0RA 1TFKA 1GY5A 1ROAA 1GS3A 2CKFB 1GD4A 3STDA 3G713 1VQN3 3WODG 2ML5A 3LT9A 1MGWA 1RLSA 1DE3A 3K63A 1R4YA 1AV4A 1E3RA 1JZDA 1HKXA 2XEPA 4N6NB 5IG4A 3OWUA 1EEJA 4O02B 3H51A 1BNJA 1OHOA 1W01A 2W9QA 4ORLA 4HM3B 1RCKA 1NU3A 1ULIB 1MWTA 2F86B 2KAAA 2AADA 4J8TA 2CG1A 1RGGA 5BVBA 4N3VA 2CFKA 1BSEA 1OH0A 9RNTA 1RNBA 4BTYA 1TFOA 3S67A 3GRDA 3T8UA 1E97A 1DVDA 2CC3A 3I0YA 3B4OA 1STFI 3EHCA 3N9HA 4LZIA 3SEDA 3CCV3 1I0VA 1VQQA 4LGQA 4KFFA 1FZUA 2A15A 1L5GB 1W7CA 2ZL8A 5AEWB 1GOYA 2CFGA 2F4YA 4WP5A 1BGSA 1N5HA 5AIFA 2RFRA 1W2B2 1A90A 3URPA 3K0ZA 3FSDA 3CC23 1BOXA 3D9RA 4STDA 3M8CA 5ELJA 3A76A 3DMCA 3Q90A 3EF8A 2ZHXB 2ML6A 2CW9A 3B8LA 4WYKA 3RGRA 3NV0B 1BU4A 1S723 5AIIA 2V1LA 4X2HA 2GSPA 4KZ1A 4R4KA 2F56A 2B1XB 2UUGC 1LRAA 4L8OA 1Q7Y4 5I97A 1MOLA 3VSYA 3CD63 1LOWA 2OCTA 3S29A 2BMRB 1IQ8A 1BNIA 2OWPA 3FF0A 2XGNA 1YJW3 1N8R4 2OOVA 3LT8A 1RGCA 5EQLA 1WMOA 1BRGA 3CNXA 1IDPA 2BMQB 2W2CA 1ULJB 5FW5A 2XH9A 3OWYA 3CCQ3 1NB5I 4FMBA 4FMAA 1PU4A 1JBTA 2OOVC 3QRDA 2L1SA 1JB2A 2QEX3 5FGOA 1YJ93 3F8HA 1BUJA 1B2MA 4XM4A 1M9GA 2B24B 3AMOB 3OWSA 1WQLB 2HMOB 2JDIH 2RGQA 3BB9A 2K0MA 5D82A 1I70A 4GSPA 2XF3A 2HMJB 1SIIA 4XBXA 5LC6A 2CH9A 1LQGC 3X42A 3DUKA 3TDGA 1LXEA 1JBRA 3F8XA 3MG3A 3FZWA 1JV2B 1RMSA 4KT3B 1UCLA 3DH2A 4N6TA 1AVLA 5ELUA 1G96A 5D83A 5CLKA 1CYUA 7STDA 1I2EA 1T3BA 3DZLA 1EUIC 3FH1A 1X1YA 3IJEB 1MWSA 1A2VA 1JNQA 1QJGA 2RSXA 3EBYA 4J9AA 3T0UA 2C11A 1A67A 2XFSA 3LTCA 1V74A 1JKGA 4ZM8A 3WA3A 4GB5A 1VQO3 1Z1SA 7GSPA 1O7GB 4NREA 3EN8A 4WFOA 3FG3A 2CHCA 3G4S3 3SVAA 1KD14 2R4IA 1IT7A 2QGUA 4HM6B 4HM7B 4MEIA 2XFTA 6RNTA 4EV5A 1VQP3 1DETA 1RTUA 1VQ43 1RRLA 4HKVB 2QA43 1PYLA 3EC9A 4OVMA 1RSNA 1I0XA 2KF5A 1D6YA 3CMA3 1LVNA 3RDEA 4R9KA 3CCM3 1N9EA 1RGAA 1OPYA 3AGNA 1GOUA 3SYUA 1JBSA 1W6YA 5IERA 5JPUA 2GBWB 2CX0A 3D79A 3FGYA 1QAFA 4HM8B 4WWUC 1BNFA 1OF5B 2YFJB 3MPHA 5IG0A 2YX9A 1BNEA 2L4VA 3KIIA 4GHOA 3K7CA 1FGMA 3DGMA 4R1KA 4KVHA 2BMOB 2R41A 5G2GA 3VF1A 3CXC2 2BHMA 3DGNA 3UB1A 2WGOA 1YGEA 4J5KA 2RCDA 3V92A 1VQK3 2WOFA 4RNTA 1FGQA 1Q42A 1GMPA 4N6OB 3RGAA 2P09A 3X40A 1BSAA 1GOVA 3QK9A 1RCLA 2WOHA 4L8PA 3SOAA 1WTHA 3HZPA 3ZFZA 3NBJA 6STDA 3CCJ3 1JN5B 3F9SA 1HZ1A 2H0GA 3G8ZA 3LTAA 1BSDA 1G0TA 3MHEA 5DRVA 3MG1A 3CC73 3PXMA 3DXOA 1Q7HA 2GU1A 1TUHA 2XRXB 2P0MA 1Q9EA 1BNGA 3GZRA 4K61A 1X1WA 4EBGA 2K54A 4EXRA 5BIRA 3S27A 3B7CA 3SXXA 2KF3A 3X41A 2IMJA 4JRFA 1W5ZA 3NUVA 2YFLB 3HX8A 1BAOA 4XBTA 3I563 1W6CA 3WR2A 1WNHA 3S28A 3PCRA 2F98A 1BRIA 4CJNA 7RNTA 2CWVA 3B4PA 1YI23 2CG0A 2F5MA 1RHLA 1OGZA 2Z76A 4G1MB 4FMCA 2ZA4A 3V99A 3F7SA 3EX9A 2E2VA 4HM2B 1O7HB 3OV4A 2STDA 1RNTA 2GEXA 8RNTA 1A2PA 1CEWI 3FG1A 4X2OA 3UL5A 3WA2X 1EA2A 1MWRA 1TRQA 2E2TA 4DKIA 1YIJ3 1FYSA 1IVWA 1X1XA 1Q40B 2FGTA 2JQ5A 3CCU3 2O9UX 1ASKA 2CFDA 2HMKB 3KSED 3KKGA 3NBRA 3OW22 3GZXB 2HOHA 1BRHA 1U5OA 1B2UA 1UUGB 1B3SA 2LQVA 2W56A 3K9MC 1OHPA 3KZTA 2MC8A 4HBRA 3CCE3 1UCKA 3CPOA 2MF7A 1U8CB 3BNCA 4CPKA 1BSCA 5RNTA 1VQ73 3D4AA 1PY3A 1YHQ3 2Z7AA 3FCSB 3V98A 1YGWA 1RGEA 3X3XA 5BXQA 1Q824 2H0HA 1KC84 1K8A4 3BNDA 3AMOA 3EB8A 1C7HA 4FR9A 3X3YA 1DYUA 2D1WA 1W6GA 5STDA 5GSPA 5G1KA 1M904 1VQ93 5TGNA 1BIRA 1FGRA 2INXA 1N9JA 2W0QA 1BRNL 4KFDA 1ZGXA 1YVSA 2W03A 3PYJA 2E2UA 1GD3A 1ZS7A 1YVBI 5KP1A 1K9M4 2UGIA 3VGNA 1ZX2A 3OXAA 1GYBA 1VQ63 2C10A 3PCSA 1EG9B 4HYZA 4K1UA 2Z77A 1JJ22 4MMYB 2P0XA 1UW1A 3G16A 2GXFA 3AGOA 4BU4A 3LMLA 2BT3A 1IT8A 1CH0A 1O7PB 4I5QA 5CF1A 3IMAB 3Q1CA 3ER7A 1NB3I 2WO0A 3NX0A 3F7XA 1M1XB 1RKYA 3MKIA 8CHOA 1VQ83 1IYYA 1UI8A 4L7KA 1UUVB 2W9PA 3GWRA 1J2BA 1FW7A 2KXGA 3SOYA 3OX9A 3NBBA 1LOXA 2IUJA 1YNVX 1RN7A 2I9WA 3KSPA 1RGFA 1T5YA 2WGQA 3NQZA 5G1LA 1UI7A 5BU4A 4LEHA 3CCS3 1W02A 4EW5A 3HIIA 1W00A 4FMDA 1RN1A 3NXJA 1BUQA 3HOHA 1B2SA 3DGOA 3FF2A 3FG4A 4IIAA 4MJDA 3DGLA 1W2ZA 1T2HA 2GU3A 3S5CA 1OF5A 4NPBA 1SQWA 1AY7A 1EKMA 5D81A 2HMMB 1GMRA 3WOFB 1STDA 1IK3A 1B21A 3O8YA 4NHFA 4U13A 2RNTA 4Q53A 2Z6BA 4HVNA 4BTXA 4I4KA 3WDGB 2FXTA 3PZWA 3CCR3 2KCDA 1RDSA 1V58A 5CXOA 1FUSA 1RGLA 1W4NA 5IEPA 4HAAA 2HMNB 2BIRA 2XSHB 3N8BA 4JF8A 1SPUA 3F40A 5CF2A 5JBSA 1B27A 3RNTA 5AI1A 4HZBB 1VQM3 1JZOA 1GMQA 3MYTA 1IV7A 2CK3H 1TTOA 3LH4A 1IVUA 1JN5A 3DY5A 3HIGA 3PS8A 3KN4A 1K734 4OUQA 4RBNA 1TIJA 3GZBA 2HMLB 2IY2A 2SARA 1WMPA 3MWZA 4PEJA 3LYGA 4KFEA 3SX1A 3UL6A 4AKZA 1AR0A 5IW9A 1LQMB 1R4CA 3LZAA 4N6UA 3CCL3 2LYXA 2Y74A 1OUNA 3KFQC 4HZ9B 4HM0B 1LNHA 3H3HA 1DVCA 3A5EA 3U97A 1RGHA 1SJWA 2CWUA 2SBLA 3CU3A 3EN1B 2J8XB 3KE7A 4FCMA 3UJMA 3WHOA 1X1UA 2RBIA 1F8NA 1I3FA 2P38A 3U1WA 3G6E3 4EC6A 2ZDJA 3ZG0A 2GEYA 5EEOA 1CYVA 3Q2PA 4R80A 1UCIA 4IT7A 1A2KA 1OHSA 3JUNA 3LTBA 1BRSA 1I3IA 4N6MA 4QWTA 1QALA 3JUMA 1O7WB 2KF6A 3CC43 1K28A 1LOVA 1HYFA 4BL3A 3NV0A 4R9LA 4GL6A 1JB5A 2FNQA 3GAXA 1K41A 1UDII 1QAKA 3D3LA 5IG3A 1BRKA 1JRQA 1C54A 3FLJA 1TP6A 3WMDA 2AAEA 3MG2A 5IENA 3BLZA 2XSOB 1Q40A 3EJVA 4RZMA 1GSPA 4BIRA 1FUTA 1O7NB 1PFPA 1GY7A 1T2IA 4MMXB 2C4BA 3EBTA 2IUKA 3HK4A 1GY6A 2BNGA 2W04A 2XR8B 3NM2A 4K90B 4LSOA 1IQXA 4AEQA 1I8VA 1Q864 1DMQA 1EQKA 1FGTA 1B2ZA 4N6LA 5AEUB 3CPW2 1VQ53 1BSBA 4K1VA 3DM8A 4HM1B 3K5TA 1IVXA 4WYKB 4RNZA 2BO9B 3BIRA 3EE1A 4IPBA 1B20A 2XGLA 2IYJA 3LTDA 1RN4A 2K3DA 4XB5A 2OQEA 4XBYA 1OACA 3NQYA 4AKYA 2UX0A 2IA7A 1MWUA 5IF6A 5M1AA 1NNVA 2Q07A 3DGYA 1IVVA 4BL2A 3AHSA 1FA3A 4MMZB 1BRJA 3IPTA 3LXUX 2KF4A 3GZYB 2OQEC 4WHAA 2YFIB 1BANA 2O3OA 3JUOA 1YIT3 2CX1A 4RNYA 2CFLA 2F5WA 3BNBA 5AYRB 5HOHA 1LNIA 3AHWA 3NM7A 5AYSC 2W56B 5LC7A 1Q814 1YJN3 3ECFA 3G0KA 4H3UA 1UUWB 2PNCA 3GSPA 1NWWA 2GBXB 1ZO2A 1UGIA 3JVCA 5IEOA 4O8SA 3F14A 1NO3A 1D6UA 3SLUA 3JUPA 3FKAA 2OTJ3 3WOEB 3J7Yd 2BU4A 1TU5A 1UGHI 4LMIA 3JUQA 4O3VA 3D5GA 3Q3FA 4CDLA 1AVKA 2F99A 4HM4B 3ZG5A 4EV2A 2P05A 1FUWA 1O7MB 3D5IA 3I553 1SARA 3X3ZA 1S5AA 1Y4KA 5EVHA 1LOYA 3UNLA 2H0IA 1JB4A 1QMAA 1RRHA 2Y73A 3KCHA 5DREA 2CIUA 5AIGA 1OGXA 3E99A 1FGOA 1ROVA 1VZZA 1TRPA 1CQSA 3NHXA 4TX4A 1MGRA 1UCJA 1BNRA 4OK0A 1HU9A 1VQL3 4CCVA 5A0OB 3ALAA 1BVIA 3ROBA 1B2XA 1D6ZA 5JPPA 1BNSA 4BTWA 1JKGB 4HOHA 3BU4A 4N6V0 4O2HA 1NDOB 1V57A 5KP4A 4H61A 5M19A 1MNLA 4FCZA 2M7OA 5HGRA 1TJDA 1I2FA 4EYCA 3EQQB 1SIHA 5IG5A 1KQS2 1ISKA 4HM5B 1I2GA 1AQZA 2QIYA 1E3VA 5M18A 6GSPA 1OCVA 4J5GA 1US1A 4XDWA 2CWTA 3HI7A 3T8NA 4LYLB 2PZVA 3LOYA 2OTL3 3MSOA 2KRTA 1KWIA 1NJI4 3CNMA 1DMMA 2D42A 2W6JH 1G02A 5CK6A 1M1K4 1IV9A 1WMNA 3N54B 3BNEA 4HJLB 1DMNA 1QVG2 3PGBA 5AIHA 2CFWA 3CME3 1N8QA 1QVF2 1IU7A 1KSIA 1RJOA 5KP3A 1RGKA 1IQYA 4ILFA 4XDVA 4FCJA 1N5PA
chains in the Genus database with same CATH topology
2K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3D A; 
#chains in the Genus database with same CATH topology
 3L0R A;  1TFK A;  1GY5 A;  1ROA A;  1GS3 A;  2CKF B;  1GD4 A;  3STD A;  3G71 3;  1VQN 3;  3WOD G;  2ML5 A;  3LT9 A;  1MGW A;  1RLS A;  1DE3 A;  3K63 A;  1R4Y A;  1AV4 A;  1E3R A;  1JZD A;  1HKX A;  2XEP A;  4N6N B;  5IG4 A;  3OWU A;  1EEJ A;  4O02 B;  3H51 A;  1BNJ A;  1OHO A;  1W01 A;  2W9Q A;  4ORL A;  4HM3 B;  1RCK A;  1NU3 A;  1ULI B;  1MWT A;  2F86 B;  2KAA A;  2AAD A;  4J8T A;  2CG1 A;  1RGG A;  5BVB A;  4N3V A;  2CFK A;  1BSE A;  1OH0 A;  9RNT A;  1RNB A;  4BTY A;  1TFO A;  3S67 A;  3GRD A;  3T8U A;  1E97 A;  1DVD A;  2CC3 A;  3I0Y A;  3B4O A;  1STF I;  3EHC A;  3N9H A;  4LZI A;  3SED A;  3CCV 3;  1I0V A;  1VQQ A;  4LGQ A;  4KFF A;  1FZU A;  2A15 A;  1L5G B;  1W7C A;  2ZL8 A;  5AEW B;  1GOY A;  2CFG A;  2F4Y A;  4WP5 A;  1BGS A;  1N5H A;  5AIF A;  2RFR A;  1W2B 2;  1A90 A;  3URP A;  3K0Z A;  3FSD A;  3CC2 3;  1BOX A;  3D9R A;  4STD A;  3M8C A;  5ELJ A;  3A76 A;  3DMC A;  3Q90 A;  3EF8 A;  2ZHX B;  2ML6 A;  2CW9 A;  3B8L A;  4WYK A;  3RGR A;  3NV0 B;  1BU4 A;  1S72 3;  5AII A;  2V1L A;  4X2H A;  2GSP A;  4KZ1 A;  4R4K A;  2F56 A;  2B1X B;  2UUG C;  1LRA A;  4L8O A;  1Q7Y 4;  5I97 A;  1MOL A;  3VSY A;  3CD6 3;  1LOW A;  2OCT A;  3S29 A;  2BMR B;  1IQ8 A;  1BNI A;  2OWP A;  3FF0 A;  2XGN A;  1YJW 3;  1N8R 4;  2OOV A;  3LT8 A;  1RGC A;  5EQL A;  1WMO A;  1BRG A;  3CNX A;  1IDP A;  2BMQ B;  2W2C A;  1ULJ B;  5FW5 A;  2XH9 A;  3OWY A;  3CCQ 3;  1NB5 I;  4FMB A;  4FMA A;  1PU4 A;  1JBT A;  2OOV C;  3QRD A;  2L1S A;  1JB2 A;  2QEX 3;  5FGO A;  1YJ9 3;  3F8H A;  1BUJ A;  1B2M A;  4XM4 A;  1M9G A;  2B24 B;  3AMO B;  3OWS A;  1WQL B;  2HMO B;  2JDI H;  2RGQ A;  3BB9 A;  2K0M A;  5D82 A;  1I70 A;  4GSP A;  2XF3 A;  2HMJ B;  1SII A;  4XBX A;  5LC6 A;  2CH9 A;  1LQG C;  3X42 A;  3DUK A;  3TDG A;  1LXE A;  1JBR A;  3F8X A;  3MG3 A;  3FZW A;  1JV2 B;  1RMS A;  4KT3 B;  1UCL A;  3DH2 A;  4N6T A;  1AVL A;  5ELU A;  1G96 A;  5D83 A;  5CLK A;  1CYU A;  7STD A;  1I2E A;  1T3B A;  3DZL A;  1EUI C;  3FH1 A;  1X1Y A;  3IJE B;  1MWS A;  1A2V A;  1JNQ A;  1QJG A;  2RSX A;  3EBY A;  4J9A A;  3T0U A;  2C11 A;  1A67 A;  2XFS A;  3LTC A;  1V74 A;  1JKG A;  4ZM8 A;  3WA3 A;  4GB5 A;  1VQO 3;  1Z1S A;  7GSP A;  1O7G B;  4NRE A;  3EN8 A;  4WFO A;  3FG3 A;  2CHC A;  3G4S 3;  3SVA A;  1KD1 4;  2R4I A;  1IT7 A;  2QGU A;  4HM6 B;  4HM7 B;  4MEI A;  2XFT A;  6RNT A;  4EV5 A;  1VQP 3;  1DET A;  1RTU A;  1VQ4 3;  1RRL A;  4HKV B;  2QA4 3;  1PYL A;  3EC9 A;  4OVM A;  1RSN A;  1I0X A;  2KF5 A;  1D6Y A;  3CMA 3;  1LVN A;  3RDE A;  4R9K A;  3CCM 3;  1N9E A;  1RGA A;  1OPY A;  3AGN A;  1GOU A;  3SYU A;  1JBS A;  1W6Y A;  5IER A;  5JPU A;  2GBW B;  2CX0 A;  3D79 A;  3FGY A;  1QAF A;  4HM8 B;  4WWU C;  1BNF A;  1OF5 B;  2YFJ B;  3MPH A;  5IG0 A;  2YX9 A;  1BNE A;  2L4V A;  3KII A;  4GHO A;  3K7C A;  1FGM A;  3DGM A;  4R1K A;  4KVH A;  2BMO B;  2R41 A;  5G2G A;  3VF1 A;  3CXC 2;  2BHM A;  3DGN A;  3UB1 A;  2WGO A;  1YGE A;  4J5K A;  2RCD A;  3V92 A;  1VQK 3;  2WOF A;  4RNT A;  1FGQ A;  1Q42 A;  1GMP A;  4N6O B;  3RGA A;  2P09 A;  3X40 A;  1BSA A;  1GOV A;  3QK9 A;  1RCL A;  2WOH A;  4L8P A;  3SOA A;  1WTH A;  3HZP A;  3ZFZ A;  3NBJ A;  6STD A;  3CCJ 3;  1JN5 B;  3F9S A;  1HZ1 A;  2H0G A;  3G8Z A;  3LTA A;  1BSD A;  1G0T A;  3MHE A;  5DRV A;  3MG1 A;  3CC7 3;  3PXM A;  3DXO A;  1Q7H A;  2GU1 A;  1TUH A;  2XRX B;  2P0M A;  1Q9E A;  1BNG A;  3GZR A;  4K61 A;  1X1W A;  4EBG A;  2K54 A;  4EXR A;  5BIR A;  3S27 A;  3B7C A;  3SXX A;  2KF3 A;  3X41 A;  2IMJ A;  4JRF A;  1W5Z A;  3NUV A;  2YFL B;  3HX8 A;  1BAO A;  4XBT A;  3I56 3;  1W6C A;  3WR2 A;  1WNH A;  3S28 A;  3PCR A;  2F98 A;  1BRI A;  4CJN A;  7RNT A;  2CWV A;  3B4P A;  1YI2 3;  2CG0 A;  2F5M A;  1RHL A;  1OGZ A;  2Z76 A;  4G1M B;  4FMC A;  2ZA4 A;  3V99 A;  3F7S A;  3EX9 A;  2E2V A;  4HM2 B;  1O7H B;  3OV4 A;  2STD A;  1RNT A;  2GEX A;  8RNT A;  1A2P A;  1CEW I;  3FG1 A;  4X2O A;  3UL5 A;  3WA2 X;  1EA2 A;  1MWR A;  1TRQ A;  2E2T A;  4DKI A;  1YIJ 3;  1FYS A;  1IVW A;  1X1X A;  1Q40 B;  2FGT A;  2JQ5 A;  3CCU 3;  2O9U X;  1ASK A;  2CFD A;  2HMK B;  3KSE D;  3KKG A;  3NBR A;  3OW2 2;  3GZX B;  2HOH A;  1BRH A;  1U5O A;  1B2U A;  1UUG B;  1B3S A;  2LQV A;  2W56 A;  3K9M C;  1OHP A;  3KZT A;  2MC8 A;  4HBR A;  3CCE 3;  1UCK A;  3CPO A;  2MF7 A;  1U8C B;  3BNC A;  4CPK A;  1BSC A;  5RNT A;  1VQ7 3;  3D4A A;  1PY3 A;  1YHQ 3;  2Z7A A;  3FCS B;  3V98 A;  1YGW A;  1RGE A;  3X3X A;  5BXQ A;  1Q82 4;  2H0H A;  1KC8 4;  1K8A 4;  3BND A;  3AMO A;  3EB8 A;  1C7H A;  4FR9 A;  3X3Y A;  1DYU A;  2D1W A;  1W6G A;  5STD A;  5GSP A;  5G1K A;  1M90 4;  1VQ9 3;  5TGN A;  1BIR A;  1FGR A;  2INX A;  1N9J A;  2W0Q A;  1BRN L;  4KFD A;  1ZGX A;  1YVS A;  2W03 A;  3PYJ A;  2E2U A;  1GD3 A;  1ZS7 A;  1YVB I;  5KP1 A;  1K9M 4;  2UGI A;  3VGN A;  1ZX2 A;  3OXA A;  1GYB A;  1VQ6 3;  2C10 A;  3PCS A;  1EG9 B;  4HYZ A;  4K1U A;  2Z77 A;  1JJ2 2;  4MMY B;  2P0X A;  1UW1 A;  3G16 A;  2GXF A;  3AGO A;  4BU4 A;  3LML A;  2BT3 A;  1IT8 A;  1CH0 A;  1O7P B;  4I5Q A;  5CF1 A;  3IMA B;  3Q1C A;  3ER7 A;  1NB3 I;  2WO0 A;  3NX0 A;  3F7X A;  1M1X B;  1RKY A;  3MKI A;  8CHO A;  1VQ8 3;  1IYY A;  1UI8 A;  4L7K A;  1UUV B;  2W9P A;  3GWR A;  1J2B A;  1FW7 A;  2KXG A;  3SOY A;  3OX9 A;  3NBB A;  1LOX A;  2IUJ A;  1YNV X;  1RN7 A;  2I9W A;  3KSP A;  1RGF A;  1T5Y A;  2WGQ A;  3NQZ A;  5G1L A;  1UI7 A;  5BU4 A;  4LEH A;  3CCS 3;  1W02 A;  4EW5 A;  3HII A;  1W00 A;  4FMD A;  1RN1 A;  3NXJ A;  1BUQ A;  3HOH A;  1B2S A;  3DGO A;  3FF2 A;  3FG4 A;  4IIA A;  4MJD A;  3DGL A;  1W2Z A;  1T2H A;  2GU3 A;  3S5C A;  1OF5 A;  4NPB A;  1SQW A;  1AY7 A;  1EKM A;  5D81 A;  2HMM B;  1GMR A;  3WOF B;  1STD A;  1IK3 A;  1B21 A;  3O8Y A;  4NHF A;  4U13 A;  2RNT A;  4Q53 A;  2Z6B A;  4HVN A;  4BTX A;  4I4K A;  3WDG B;  2FXT A;  3PZW A;  3CCR 3;  2KCD A;  1RDS A;  1V58 A;  5CXO A;  1FUS A;  1RGL A;  1W4N A;  5IEP A;  4HAA A;  2HMN B;  2BIR A;  2XSH B;  3N8B A;  4JF8 A;  1SPU A;  3F40 A;  5CF2 A;  5JBS A;  1B27 A;  3RNT A;  5AI1 A;  4HZB B;  1VQM 3;  1JZO A;  1GMQ A;  3MYT A;  1IV7 A;  2CK3 H;  1TTO A;  3LH4 A;  1IVU A;  1JN5 A;  3DY5 A;  3HIG A;  3PS8 A;  3KN4 A;  1K73 4;  4OUQ A;  4RBN A;  1TIJ A;  3GZB A;  2HML B;  2IY2 A;  2SAR A;  1WMP A;  3MWZ A;  4PEJ A;  3LYG A;  4KFE A;  3SX1 A;  3UL6 A;  4AKZ A;  1AR0 A;  5IW9 A;  1LQM B;  1R4C A;  3LZA A;  4N6U A;  3CCL 3;  2LYX A;  2Y74 A;  1OUN A;  3KFQ C;  4HZ9 B;  4HM0 B;  1LNH A;  3H3H A;  1DVC A;  3A5E A;  3U97 A;  1RGH A;  1SJW A;  2CWU A;  2SBL A;  3CU3 A;  3EN1 B;  2J8X B;  3KE7 A;  4FCM A;  3UJM A;  3WHO A;  1X1U A;  2RBI A;  1F8N A;  1I3F A;  2P38 A;  3U1W A;  3G6E 3;  4EC6 A;  2ZDJ A;  3ZG0 A;  2GEY A;  5EEO A;  1CYV A;  3Q2P A;  4R80 A;  1UCI A;  4IT7 A;  1A2K A;  1OHS A;  3JUN A;  3LTB A;  1BRS A;  1I3I A;  4N6M A;  4QWT A;  1QAL A;  3JUM A;  1O7W B;  2KF6 A;  3CC4 3;  1K28 A;  1LOV A;  1HYF A;  4BL3 A;  3NV0 A;  4R9L A;  4GL6 A;  1JB5 A;  2FNQ A;  3GAX A;  1K41 A;  1UDI I;  1QAK A;  3D3L A;  5IG3 A;  1BRK A;  1JRQ A;  1C54 A;  3FLJ A;  1TP6 A;  3WMD A;  2AAE A;  3MG2 A;  5IEN A;  3BLZ A;  2XSO B;  1Q40 A;  3EJV A;  4RZM A;  1GSP A;  4BIR A;  1FUT A;  1O7N B;  1PFP A;  1GY7 A;  1T2I A;  4MMX B;  2C4B A;  3EBT A;  2IUK A;  3HK4 A;  1GY6 A;  2BNG A;  2W04 A;  2XR8 B;  3NM2 A;  4K90 B;  4LSO A;  1IQX A;  4AEQ A;  1I8V A;  1Q86 4;  1DMQ A;  1EQK A;  1FGT A;  1B2Z A;  4N6L A;  5AEU B;  3CPW 2;  1VQ5 3;  1BSB A;  4K1V A;  3DM8 A;  4HM1 B;  3K5T A;  1IVX A;  4WYK B;  4RNZ A;  2BO9 B;  3BIR A;  3EE1 A;  4IPB A;  1B20 A;  2XGL A;  2IYJ A;  3LTD A;  1RN4 A;  2K3D A;  4XB5 A;  2OQE A;  4XBY A;  1OAC A;  3NQY A;  4AKY A;  2UX0 A;  2IA7 A;  1MWU A;  5IF6 A;  5M1A A;  1NNV A;  2Q07 A;  3DGY A;  1IVV A;  4BL2 A;  3AHS A;  1FA3 A;  4MMZ B;  1BRJ A;  3IPT A;  3LXU X;  2KF4 A;  3GZY B;  2OQE C;  4WHA A;  2YFI B;  1BAN A;  2O3O A;  3JUO A;  1YIT 3;  2CX1 A;  4RNY A;  2CFL A;  2F5W A;  3BNB A;  5AYR B;  5HOH A;  1LNI A;  3AHW A;  3NM7 A;  5AYS C;  2W56 B;  5LC7 A;  1Q81 4;  1YJN 3;  3ECF A;  3G0K A;  4H3U A;  1UUW B;  2PNC A;  3GSP A;  1NWW A;  2GBX B;  1ZO2 A;  1UGI A;  3JVC A;  5IEO A;  4O8S A;  3F14 A;  1NO3 A;  1D6U A;  3SLU A;  3JUP A;  3FKA A;  2OTJ 3;  3WOE B;  3J7Y d;  2BU4 A;  1TU5 A;  1UGH I;  4LMI A;  3JUQ A;  4O3V A;  3D5G A;  3Q3F A;  4CDL A;  1AVK A;  2F99 A;  4HM4 B;  3ZG5 A;  4EV2 A;  2P05 A;  1FUW A;  1O7M B;  3D5I A;  3I55 3;  1SAR A;  3X3Z A;  1S5A A;  1Y4K A;  5EVH A;  1LOY A;  3UNL A;  2H0I A;  1JB4 A;  1QMA A;  1RRH A;  2Y73 A;  3KCH A;  5DRE A;  2CIU A;  5AIG A;  1OGX A;  3E99 A;  1FGO A;  1ROV A;  1VZZ A;  1TRP A;  1CQS A;  3NHX A;  4TX4 A;  1MGR A;  1UCJ A;  1BNR A;  4OK0 A;  1HU9 A;  1VQL 3;  4CCV A;  5A0O B;  3ALA A;  1BVI A;  3ROB A;  1B2X A;  1D6Z A;  5JPP A;  1BNS A;  4BTW A;  1JKG B;  4HOH A;  3BU4 A;  4N6V 0;  4O2H A;  1NDO B;  1V57 A;  5KP4 A;  4H61 A;  5M19 A;  1MNL A;  4FCZ A;  2M7O A;  5HGR A;  1TJD A;  1I2F A;  4EYC A;  3EQQ B;  1SIH A;  5IG5 A;  1KQS 2;  1ISK A;  4HM5 B;  1I2G A;  1AQZ A;  2QIY A;  1E3V A;  5M18 A;  6GSP A;  1OCV A;  4J5G A;  1US1 A;  4XDW A;  2CWT A;  3HI7 A;  3T8N A;  4LYL B;  2PZV A;  3LOY A;  2OTL 3;  3MSO A;  2KRT A;  1KWI A;  1NJI 4;  3CNM A;  1DMM A;  2D42 A;  2W6J H;  1G02 A;  5CK6 A;  1M1K 4;  1IV9 A;  1WMN A;  3N54 B;  3BNE A;  4HJL B;  1DMN A;  1QVG 2;  3PGB A;  5AIH A;  2CFW A;  3CME 3;  1N8Q A;  1QVF 2;  1IU7 A;  1KSI A;  1RJO A;  5KP3 A;  1RGK A;  1IQY A;  4ILF A;  4XDV A;  4FCJ A;  1N5P A; 
#chains in the Genus database with same CATH homology
 2K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...