2K3DA

Solution nmr structure of the folded 79 residue fragment of lin0334 from listeria innocua. northeast structural genomics consortium target lkr15
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
b'AFFNEQKEKVTLYLKHNIPDFNTVTFTNEEFNPIGISIDGYINNDKNLSFTAGKDVKIFSSSEELDKMFQEPRKGYDEILEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin0334 protein
molecule tags Structural genomics, unknown function
source organism Listeria innocua clip11262
publication title Solution NMR structure of the folded 79 residue fragment of Lin0334 from Listeria innocua. Northeast Structural Genomics Consortium target LkR15.
rcsb
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.130 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, folded 79 residue fragment of lin0334 like domains 2k3dA00
2K3DA
chains in the Genus database with same CATH superfamily
3AHWA 1IVUA 1GMRA 2RFRA 1KQS2 1FA3A 5JPUA 1DMMA 1BRHA 1RGGA 2CWTA 3LMLA 1VQ53 4TX4A 4LEHA 4FMAA 1MGRA 1RRHA 1V57A 1VQN3 3PXMA 4WYKB 2BO9B 2MF7A 1BNGA 4FMCA 1BANA 3X41A 2YX9A 4MEIA 1N9JA 2XSHB 1NJI4 1NB5I 3MYTA 4O2HA 1STDA 1DVCA 1Z1SA 1BGSA 2CW9A 2H0HA 2D42A 1HZ1A 3HZPA 1CYVA 1STFI 4HZBB 2F98A 1NNVA 2AAEA 2GBWB 4GL6A 4EW5A 3EBTA 2OOVA 2IYJA 1NDOB 1RN7A 3CCE3 1O7NB 1O7HB 2Z6BA 1DMNA 2OTL3 3LYGA 4MMXB 3VSYA 1VQ63 1IDPA 4KFEA 3BNEA 4MMZB 3HIGA 3I563 1OACA 2CK3H 2XH9A 1DETA 2KCDA 4ILFA 1BNFA 3ZFZA 5IW9A 3LT8A 1YI23 3FH1A 3PCRA 1BRNL 5LC7A 1BNJA 3LTCA 3JUMA 4HM0B 2M7OA 1YHQ3 5AIIA 1OGZA 1A2KA 1UI7A 3MSOA 1B2MA 2F56A 3DGLA 4XB5A 1B20A 1ISKA 1BSBA 1RDSA 1RGCA 3X42A 1W6YA 2OWPA 1LQGC 1YVSA 5G2GA 1HYFA 4PEJA 1ZS7A 1UCLA 9RNTA 3SVAA 2W9PA 4R80A 5LC6A 5JBSA 1DE3A 1LQMB 2HMJB 3FGYA 2XFTA 4HBRA 2Z77A 1T5YA 2L4VA 2KF3A 1DVDA 2SARA 4N6OB 3EQQB 3KN4A 1O7PB 3U1WA 1CYUA 1JNQA 3SOAA 1TRPA 2D1WA 3O8YA 4XM4A 3QRDA 3LZAA 1X1YA 1IV7A 4LGQA 5TGNA 3BU4A 4K1UA 5G1LA 1VQ93 3FF2A 1I3IA 3LTDA 1QJGA 3F40A 2F4YA 2YFJB 2XGNA 1BIRA 1TP6A 2WO0A 1W2B2 3JUOA 4HM7B 1O7WB 1IU7A 3K9MC 1GSPA 3X3ZA 1BRSA 3CCV3 1RHLA 3NXJA 4BU4A 2CFLA 1VQ73 2FXTA 3G713 1UW1A 2Z7AA 1SARA 3WMDA 1MNLA 1YVBI 4RBNA 1RKYA 5D83A 1GY7A 1JBRA 2PZVA 1UCKA 3PCSA 3DZLA 2W2CA 1EG9B 4OK0A 1G02A 1YJN3 1A90A 1OHSA 2ZL8A 5IG4A 3K7CA 4RZMA 1OHOA 2CKFB 3BIRA 3F7SA 3S28A 1QALA 1C54A 2BT3A 1ZX2A 1EKMA 1RGKA 1BSDA 2BIRA 3KSPA 3MG3A 1Q9EA 3N54B 3WA3A 5D81A 3DY5A 2W56B 5AIHA 1I0VA 2K0MA 1G96A 4XBTA 4K1VA 1K734 3WOFB 2CG0A 2P09A 4WWUC 2XR8B 3IJEB 3V99A 3AGNA 2BHMA 1LNHA 4STDA 1KSIA 3L0RA 3ZG0A 5ELUA 1OCVA 2CFWA 5GSPA 3DGYA 4N3VA 2QGUA 3EC9A 2CH9A 4N6NB 5HGRA 4N6LA 1I70A 1OF5B 2XF3A 1WMOA 3HX8A 1BNEA 1B2SA 4HM2B 3B4OA 3SOYA 3G8ZA 3MHEA 3D5IA 4BIRA 1N8QA 4GB5A 4RNTA 2OQEC 3UL6A 1JB2A 3FF0A 4LYLB 5HOHA 3NUVA 1N8R4 2I9WA 3GSPA 4LSOA 2GBXB 4N6UA 1HU9A 2INXA 3S27A 2CHCA 4BTWA 3S5CA 8RNTA 4WYKA 1TRQA 2XEPA 1Q864 3OWSA 2E2UA 1UI8A 4R4KA 1A2VA 1IVVA 1MWSA 4KT3B 1QAKA 1M1K4 2KF6A 2OCTA 1LXEA 3MKIA 3NQZA 1YGWA 5CXOA 3EHCA 2FNQA 4R9LA 4BL2A 1RMSA 3KE7A 2W0QA 4XDVA 5M18A 5BXQA 4FCZA 3CCL3 4L8PA 4AKYA 1ROVA 1W00A 1W4NA 1Q814 1JJ22 2B1XB 2CX0A 4J9AA 1OPYA 1I0XA 8CHOA 1DYUA 3OW22 2WOHA 3CNMA 3X3XA 5RNTA 1D6YA 3I0YA 5IENA 1SPUA 2E2VA 3SYUA 1O7GB 1Q7Y4 3DH2A 1JN5B 2CWVA 3Q2PA 3MWZA 1W6GA 1VQL3 2OQEA 3CCU3 2FGTA 1RN1A 4EBGA 2IA7A 3M8CA 4HM3B 1ZGXA 1JB5A 1RCKA 3SLUA 2Z76A 2UGIA 1K41A 2YFLB 3DMCA 5DRVA 1QVG2 3ZG5A 5M19A 1RNTA 3G16A 4RNZA 3SX1A 1JB4A 2ZA4A 1B2ZA 4L7KA 3T8NA 3DXOA 1W5ZA 3CNXA 2CFKA 1RNBA 3NBRA 3BB9A 3SEDA 3LTBA 3WDGB 1BNSA 1JN5A 2RCDA 4I5QA 4HM5B 1IT7A 1JZDA 2ZDJA 3KIIA 1UUGB 2F5WA 1RLSA 3ROBA 1FUWA 5KP4A 1RN4A 1T2IA 1TJDA 2ML5A 4N6TA 1IK3A 3ALAA 1A2PA 2C10A 3CCM3 3A76A 3LTAA 4WFOA 1BSCA 1NB3I 1T3BA 3KZTA 5CK6A 1NU3A 4NREA 3G0KA 4FCJA 1BNRA 1GY5A 1LRAA 3BLZA 4HYZA 4HM1B 3T0UA 3NM2A 2P0MA 1RGAA 1VQ83 2B24B 5FGOA 3NQYA 1FUTA 1CH0A 3DUKA 3PGBA 1BRIA 1V58A 4NHFA 4QWTA 1JBSA 1GY6A 3NV0A 1TU5A 3OX9A 5M1AA 7STDA 3Q1CA 1BAOA 2O3OA 3CCS3 3CXC2 1SJWA 3AMOB 2RBIA 1K8A4 5FW5A 3CPW2 3GWRA 4O3VA 3OWUA 3UJMA 3GAXA 1M9GA 4IPBA 1ULIB 3K5TA 1Q40A 4J5KA 3PZWA 1KC84 4H61A 4RNYA 4WHAA 3S29A 1US1A 4MJDA 4WP5A 5CF1A 3RNTA 5BIRA 7RNTA 4AEQA 1FZUA 1JRQA 2IMJA 3EE1A 1BUQA 3F9SA 1KD14 3N9HA 1S5AA 1V74A 1YGEA 2CIUA 3MPHA 2P0XA 1SQWA 5A0OB 1YJW3 1OH0A 4J5GA 6GSPA 3GZYB 1S723 1PY3A 2CFGA 2V1LA 4BL3A 5D82A 5CF2A 4EXRA 2XFSA 3HOHA 3H3HA 3EF8A 1JBTA 3EN1B 3X40A 1BRKA 1NWWA 2WGQA 1LVNA 3GZBA 4HM4B 3NV0B 1PU4A 1F8NA 2GU1A 2JDIH 2GU3A 3EN8A 2HMNB 3IMAB 1EA2A 5KP3A 3CCJ3 2KRTA 3VGNA 1RSNA 5AYRB 1YIJ3 1MWRA 1X1XA 5IG5A 1D6UA 5EVHA 3FG3A 3GRDA 1BVIA 3RDEA 4FMBA 1WTHA 4L8OA 4JF8A 2Q07A 3CD63 2F86B 3AGOA 1FYSA 1EQKA 4O8SA 3RGRA 4EV5A 1QVF2 3K0ZA 1WQLB 4XBYA 3G6E3 3CMA3 5AEUB 2WOFA 1IT8A 2HMOB 1KWIA 1ULJB 3DGNA 1EUIC 1RGHA 4IT7A 1CQSA 5DREA 3CC43 1UCJA 1QAFA 3D4AA 1AVLA 3Q3FA 5AI1A 1IV9A 6RNTA 4I4KA 2AADA 3D9RA 5IF6A 1VQQA 3PYJA 4X2HA 3UB1A 2J8XB 1GOVA 5BU4A 1FGRA 1RTUA 2GEYA 2XGLA 1B2XA 3A5EA 1UDII 1LOYA 1Q42A 3DGOA 3HK4A 1J2BA 3U97A 4R1KA 2HMMB 1JZOA 4G1MB 3SXXA 2UX0A 2K3DA 2STDA 5ELJA 3OV4A 5AYSC 1BSAA 3I553 2QA43 1Q40B 1R4CA 3EB8A 2R4IA 3GZXB 2BMRB 1IQYA 1SIHA 1YIT3 3FG1A 1MOLA 2MC8A 2ML6A 1N5PA 3KCHA 4CDLA 3FG4A 3KSED 2P38A 1AV4A 3NX0A 5EEOA 3V98A 1TIJA 1IYYA 1FGTA 1LOXA 1U8CB 1W01A 2BU4A 2CX1A 3LOYA 3OXAA 4Q53A 4XBXA 2UUGC 5AIFA 3S67A 2Y73A 1Y4KA 2O9UX 3CPOA 4HVNA 1FGOA 3RGAA 2RNTA 4EC6A 1ASKA 1BSEA 3CCQ3 1U5OA 4X2OA 2H0GA 4GHOA 1RGLA 3G4S3 3V92A 1I2FA 4HOHA 1CEWI 4KVHA 5AIGA 5BVBA 1TFKA 2CFDA 3BNBA 2QIYA 2QEX3 1LOWA 1IVXA 1Q824 1T2HA 2A15A 2C4BA 2RGQA 5STDA 1E3VA 1BOXA 1LOVA 1I8VA 1W2ZA 1W6CA 2ZHXB 1UGHI 4EV2A 2W03A 4GSPA 3VF1A 3CC23 1JKGA 3LT9A 1B3SA 3IPTA 4AKZA 2BNGA 2W56A 4ORLA 4BTYA 4OVMA 2OOVC 3FKAA 2XRXB 3BNDA 1TTOA 3KFQC 3NM7A 1C7HA 1O7MB 1SIIA 3HIIA 4FMDA 1W7CA 4LZIA 4NPBA 4JRFA 4XDWA 5CLKA 5IEOA 1N9EA 3ER7A 1VQK3 3F14A 2XSOB 1OHPA 1FGQA 2L1SA 4IIAA 2P05A 1L5GB 3K63A 1WMPA 2IUJA 3FLJA 3UNLA 1IVWA 1UGIA 2CWUA 1YJ93 4U13A 4HZ9B 1AR0A 1K28A 1RCLA 1MGWA 4KZ1A 1IQXA 3D79A 2GSPA 4HAAA 2GXFA 4O02B 1B27A 1I2GA 1ZO2A 3JUQA 3B4PA 2KF4A 1MWTA 1OUNA 2WGOA 1GOYA 2SBLA 3OWYA 1NO3A 1YNVX 4K61A 2E2TA 1VQO3 2CC3A 1B21A 3D5GA 3WOEB 2OTJ3 3AHSA 2CG1A 1VQP3 4DKIA 3BNCA 4H3UA 2BMQB 3PS8A 5IEPA 1M1XB 3WHOA 4R9KA 4HKVB 4CCVA 1EEJA 3NHXA 1AQZA 1A67A 2KF5A 3MG2A 3UL5A 1E3RA 1GMPA 1WNHA 1R4YA 3KKGA 1RRLA 3J7Yd 2F99A 1N5HA 3FCSB 1OF5A 4KFDA 3JUPA 2RSXA 3B8LA 3STDA 2JQ5A 4HJLB 1PFPA 5IG3A 1D6ZA 5IG0A 1RJOA 1GYBA 1VZZA 3MG1A 2PNCA 1VQM3 1GD4A 3N8BA 3NBBA 3EX9A 1ROAA 3LH4A 1TUHA 1RGEA 3CC73 1Q7HA 3FZWA 2KXGA 1E97A 2K54A 1G0TA 3T8UA 4BTXA 1BUJA 3HI7A 3WR2A 3B7CA 3DM8A 4CPKA 4N6MA 1B2UA 3JUNA 3Q90A 1AVKA 1HKXA 2W6JH 2LYXA 3H51A 4FCMA 6STDA 3LXUX 4HM8B 3EJVA 4LMIA 1MWUA 1LNIA 1JV2B 4EYCA 3AMOA 3DGMA 4FR9A 2HMLB 3QK9A 3WA2X 4KFFA 2F5MA 4N6V0 3WODG 5I97A 2H0IA 1BU4A 1K9M4 1VQ43 2W04A 2HOHA 1FW7A 1QMAA 1FGMA 3E99A 1AY7A 1UCIA 3EBYA 4MMYB 3F7XA 5G1KA 1WMNA 4OUQA 1DMQA 1BNIA 1I3FA 3F8XA 3JVCA 3NBJA 1RGFA 1JKGB 1FUSA 1GS3A 3TDGA 2Y74A 2GEXA 5KP1A 4CJNA 1BRJA 1OGXA 1BRGA 3CCR3 1GD3A 3D3LA 1W02A 3CME3 1GOUA 2HMKB 2R41A 2W9QA 3GZRA 2IY2A 5IERA 1TFOA 1X1WA 3X3YA 2BMOB 1GMQA 1UUVB 1I2EA 1PYLA 1IQ8A 4HM6B 3CU3A 1X1UA 4ZM8A 3F8HA 3URPA 5JPPA 1M904 2YFIB 3FSDA 4J8TA 3ECFA 5EQLA 1UUWB 5AEWB 2KAAA 2IUKA 7GSPA 2LQVA 2C11A 4K90B
chains in the Genus database with same CATH topology
2K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3D A; 
#chains in the Genus database with same CATH topology
 3AHW A;  1IVU A;  1GMR A;  2RFR A;  1KQS 2;  1FA3 A;  5JPU A;  1DMM A;  1BRH A;  1RGG A;  2CWT A;  3LML A;  1VQ5 3;  4TX4 A;  4LEH A;  4FMA A;  1MGR A;  1RRH A;  1V57 A;  1VQN 3;  3PXM A;  4WYK B;  2BO9 B;  2MF7 A;  1BNG A;  4FMC A;  1BAN A;  3X41 A;  2YX9 A;  4MEI A;  1N9J A;  2XSH B;  1NJI 4;  1NB5 I;  3MYT A;  4O2H A;  1STD A;  1DVC A;  1Z1S A;  1BGS A;  2CW9 A;  2H0H A;  2D42 A;  1HZ1 A;  3HZP A;  1CYV A;  1STF I;  4HZB B;  2F98 A;  1NNV A;  2AAE A;  2GBW B;  4GL6 A;  4EW5 A;  3EBT A;  2OOV A;  2IYJ A;  1NDO B;  1RN7 A;  3CCE 3;  1O7N B;  1O7H B;  2Z6B A;  1DMN A;  2OTL 3;  3LYG A;  4MMX B;  3VSY A;  1VQ6 3;  1IDP A;  4KFE A;  3BNE A;  4MMZ B;  3HIG A;  3I56 3;  1OAC A;  2CK3 H;  2XH9 A;  1DET A;  2KCD A;  4ILF A;  1BNF A;  3ZFZ A;  5IW9 A;  3LT8 A;  1YI2 3;  3FH1 A;  3PCR A;  1BRN L;  5LC7 A;  1BNJ A;  3LTC A;  3JUM A;  4HM0 B;  2M7O A;  1YHQ 3;  5AII A;  1OGZ A;  1A2K A;  1UI7 A;  3MSO A;  1B2M A;  2F56 A;  3DGL A;  4XB5 A;  1B20 A;  1ISK A;  1BSB A;  1RDS A;  1RGC A;  3X42 A;  1W6Y A;  2OWP A;  1LQG C;  1YVS A;  5G2G A;  1HYF A;  4PEJ A;  1ZS7 A;  1UCL A;  9RNT A;  3SVA A;  2W9P A;  4R80 A;  5LC6 A;  5JBS A;  1DE3 A;  1LQM B;  2HMJ B;  3FGY A;  2XFT A;  4HBR A;  2Z77 A;  1T5Y A;  2L4V A;  2KF3 A;  1DVD A;  2SAR A;  4N6O B;  3EQQ B;  3KN4 A;  1O7P B;  3U1W A;  1CYU A;  1JNQ A;  3SOA A;  1TRP A;  2D1W A;  3O8Y A;  4XM4 A;  3QRD A;  3LZA A;  1X1Y A;  1IV7 A;  4LGQ A;  5TGN A;  3BU4 A;  4K1U A;  5G1L A;  1VQ9 3;  3FF2 A;  1I3I A;  3LTD A;  1QJG A;  3F40 A;  2F4Y A;  2YFJ B;  2XGN A;  1BIR A;  1TP6 A;  2WO0 A;  1W2B 2;  3JUO A;  4HM7 B;  1O7W B;  1IU7 A;  3K9M C;  1GSP A;  3X3Z A;  1BRS A;  3CCV 3;  1RHL A;  3NXJ A;  4BU4 A;  2CFL A;  1VQ7 3;  2FXT A;  3G71 3;  1UW1 A;  2Z7A A;  1SAR A;  3WMD A;  1MNL A;  1YVB I;  4RBN A;  1RKY A;  5D83 A;  1GY7 A;  1JBR A;  2PZV A;  1UCK A;  3PCS A;  3DZL A;  2W2C A;  1EG9 B;  4OK0 A;  1G02 A;  1YJN 3;  1A90 A;  1OHS A;  2ZL8 A;  5IG4 A;  3K7C A;  4RZM A;  1OHO A;  2CKF B;  3BIR A;  3F7S A;  3S28 A;  1QAL A;  1C54 A;  2BT3 A;  1ZX2 A;  1EKM A;  1RGK A;  1BSD A;  2BIR A;  3KSP A;  3MG3 A;  1Q9E A;  3N54 B;  3WA3 A;  5D81 A;  3DY5 A;  2W56 B;  5AIH A;  1I0V A;  2K0M A;  1G96 A;  4XBT A;  4K1V A;  1K73 4;  3WOF B;  2CG0 A;  2P09 A;  4WWU C;  2XR8 B;  3IJE B;  3V99 A;  3AGN A;  2BHM A;  1LNH A;  4STD A;  1KSI A;  3L0R A;  3ZG0 A;  5ELU A;  1OCV A;  2CFW A;  5GSP A;  3DGY A;  4N3V A;  2QGU A;  3EC9 A;  2CH9 A;  4N6N B;  5HGR A;  4N6L A;  1I70 A;  1OF5 B;  2XF3 A;  1WMO A;  3HX8 A;  1BNE A;  1B2S A;  4HM2 B;  3B4O A;  3SOY A;  3G8Z A;  3MHE A;  3D5I A;  4BIR A;  1N8Q A;  4GB5 A;  4RNT A;  2OQE C;  3UL6 A;  1JB2 A;  3FF0 A;  4LYL B;  5HOH A;  3NUV A;  1N8R 4;  2I9W A;  3GSP A;  4LSO A;  2GBX B;  4N6U A;  1HU9 A;  2INX A;  3S27 A;  2CHC A;  4BTW A;  3S5C A;  8RNT A;  4WYK A;  1TRQ A;  2XEP A;  1Q86 4;  3OWS A;  2E2U A;  1UI8 A;  4R4K A;  1A2V A;  1IVV A;  1MWS A;  4KT3 B;  1QAK A;  1M1K 4;  2KF6 A;  2OCT A;  1LXE A;  3MKI A;  3NQZ A;  1YGW A;  5CXO A;  3EHC A;  2FNQ A;  4R9L A;  4BL2 A;  1RMS A;  3KE7 A;  2W0Q A;  4XDV A;  5M18 A;  5BXQ A;  4FCZ A;  3CCL 3;  4L8P A;  4AKY A;  1ROV A;  1W00 A;  1W4N A;  1Q81 4;  1JJ2 2;  2B1X B;  2CX0 A;  4J9A A;  1OPY A;  1I0X A;  8CHO A;  1DYU A;  3OW2 2;  2WOH A;  3CNM A;  3X3X A;  5RNT A;  1D6Y A;  3I0Y A;  5IEN A;  1SPU A;  2E2V A;  3SYU A;  1O7G B;  1Q7Y 4;  3DH2 A;  1JN5 B;  2CWV A;  3Q2P A;  3MWZ A;  1W6G A;  1VQL 3;  2OQE A;  3CCU 3;  2FGT A;  1RN1 A;  4EBG A;  2IA7 A;  3M8C A;  4HM3 B;  1ZGX A;  1JB5 A;  1RCK A;  3SLU A;  2Z76 A;  2UGI A;  1K41 A;  2YFL B;  3DMC A;  5DRV A;  1QVG 2;  3ZG5 A;  5M19 A;  1RNT A;  3G16 A;  4RNZ A;  3SX1 A;  1JB4 A;  2ZA4 A;  1B2Z A;  4L7K A;  3T8N A;  3DXO A;  1W5Z A;  3CNX A;  2CFK A;  1RNB A;  3NBR A;  3BB9 A;  3SED A;  3LTB A;  3WDG B;  1BNS A;  1JN5 A;  2RCD A;  4I5Q A;  4HM5 B;  1IT7 A;  1JZD A;  2ZDJ A;  3KII A;  1UUG B;  2F5W A;  1RLS A;  3ROB A;  1FUW A;  5KP4 A;  1RN4 A;  1T2I A;  1TJD A;  2ML5 A;  4N6T A;  1IK3 A;  3ALA A;  1A2P A;  2C10 A;  3CCM 3;  3A76 A;  3LTA A;  4WFO A;  1BSC A;  1NB3 I;  1T3B A;  3KZT A;  5CK6 A;  1NU3 A;  4NRE A;  3G0K A;  4FCJ A;  1BNR A;  1GY5 A;  1LRA A;  3BLZ A;  4HYZ A;  4HM1 B;  3T0U A;  3NM2 A;  2P0M A;  1RGA A;  1VQ8 3;  2B24 B;  5FGO A;  3NQY A;  1FUT A;  1CH0 A;  3DUK A;  3PGB A;  1BRI A;  1V58 A;  4NHF A;  4QWT A;  1JBS A;  1GY6 A;  3NV0 A;  1TU5 A;  3OX9 A;  5M1A A;  7STD A;  3Q1C A;  1BAO A;  2O3O A;  3CCS 3;  3CXC 2;  1SJW A;  3AMO B;  2RBI A;  1K8A 4;  5FW5 A;  3CPW 2;  3GWR A;  4O3V A;  3OWU A;  3UJM A;  3GAX A;  1M9G A;  4IPB A;  1ULI B;  3K5T A;  1Q40 A;  4J5K A;  3PZW A;  1KC8 4;  4H61 A;  4RNY A;  4WHA A;  3S29 A;  1US1 A;  4MJD A;  4WP5 A;  5CF1 A;  3RNT A;  5BIR A;  7RNT A;  4AEQ A;  1FZU A;  1JRQ A;  2IMJ A;  3EE1 A;  1BUQ A;  3F9S A;  1KD1 4;  3N9H A;  1S5A A;  1V74 A;  1YGE A;  2CIU A;  3MPH A;  2P0X A;  1SQW A;  5A0O B;  1YJW 3;  1OH0 A;  4J5G A;  6GSP A;  3GZY B;  1S72 3;  1PY3 A;  2CFG A;  2V1L A;  4BL3 A;  5D82 A;  5CF2 A;  4EXR A;  2XFS A;  3HOH A;  3H3H A;  3EF8 A;  1JBT A;  3EN1 B;  3X40 A;  1BRK A;  1NWW A;  2WGQ A;  1LVN A;  3GZB A;  4HM4 B;  3NV0 B;  1PU4 A;  1F8N A;  2GU1 A;  2JDI H;  2GU3 A;  3EN8 A;  2HMN B;  3IMA B;  1EA2 A;  5KP3 A;  3CCJ 3;  2KRT A;  3VGN A;  1RSN A;  5AYR B;  1YIJ 3;  1MWR A;  1X1X A;  5IG5 A;  1D6U A;  5EVH A;  3FG3 A;  3GRD A;  1BVI A;  3RDE A;  4FMB A;  1WTH A;  4L8O A;  4JF8 A;  2Q07 A;  3CD6 3;  2F86 B;  3AGO A;  1FYS A;  1EQK A;  4O8S A;  3RGR A;  4EV5 A;  1QVF 2;  3K0Z A;  1WQL B;  4XBY A;  3G6E 3;  3CMA 3;  5AEU B;  2WOF A;  1IT8 A;  2HMO B;  1KWI A;  1ULJ B;  3DGN A;  1EUI C;  1RGH A;  4IT7 A;  1CQS A;  5DRE A;  3CC4 3;  1UCJ A;  1QAF A;  3D4A A;  1AVL A;  3Q3F A;  5AI1 A;  1IV9 A;  6RNT A;  4I4K A;  2AAD A;  3D9R A;  5IF6 A;  1VQQ A;  3PYJ A;  4X2H A;  3UB1 A;  2J8X B;  1GOV A;  5BU4 A;  1FGR A;  1RTU A;  2GEY A;  2XGL A;  1B2X A;  3A5E A;  1UDI I;  1LOY A;  1Q42 A;  3DGO A;  3HK4 A;  1J2B A;  3U97 A;  4R1K A;  2HMM B;  1JZO A;  4G1M B;  3SXX A;  2UX0 A;  2K3D A;  2STD A;  5ELJ A;  3OV4 A;  5AYS C;  1BSA A;  3I55 3;  2QA4 3;  1Q40 B;  1R4C A;  3EB8 A;  2R4I A;  3GZX B;  2BMR B;  1IQY A;  1SIH A;  1YIT 3;  3FG1 A;  1MOL A;  2MC8 A;  2ML6 A;  1N5P A;  3KCH A;  4CDL A;  3FG4 A;  3KSE D;  2P38 A;  1AV4 A;  3NX0 A;  5EEO A;  3V98 A;  1TIJ A;  1IYY A;  1FGT A;  1LOX A;  1U8C B;  1W01 A;  2BU4 A;  2CX1 A;  3LOY A;  3OXA A;  4Q53 A;  4XBX A;  2UUG C;  5AIF A;  3S67 A;  2Y73 A;  1Y4K A;  2O9U X;  3CPO A;  4HVN A;  1FGO A;  3RGA A;  2RNT A;  4EC6 A;  1ASK A;  1BSE A;  3CCQ 3;  1U5O A;  4X2O A;  2H0G A;  4GHO A;  1RGL A;  3G4S 3;  3V92 A;  1I2F A;  4HOH A;  1CEW I;  4KVH A;  5AIG A;  5BVB A;  1TFK A;  2CFD A;  3BNB A;  2QIY A;  2QEX 3;  1LOW A;  1IVX A;  1Q82 4;  1T2H A;  2A15 A;  2C4B A;  2RGQ A;  5STD A;  1E3V A;  1BOX A;  1LOV A;  1I8V A;  1W2Z A;  1W6C A;  2ZHX B;  1UGH I;  4EV2 A;  2W03 A;  4GSP A;  3VF1 A;  3CC2 3;  1JKG A;  3LT9 A;  1B3S A;  3IPT A;  4AKZ A;  2BNG A;  2W56 A;  4ORL A;  4BTY A;  4OVM A;  2OOV C;  3FKA A;  2XRX B;  3BND A;  1TTO A;  3KFQ C;  3NM7 A;  1C7H A;  1O7M B;  1SII A;  3HII A;  4FMD A;  1W7C A;  4LZI A;  4NPB A;  4JRF A;  4XDW A;  5CLK A;  5IEO A;  1N9E A;  3ER7 A;  1VQK 3;  3F14 A;  2XSO B;  1OHP A;  1FGQ A;  2L1S A;  4IIA A;  2P05 A;  1L5G B;  3K63 A;  1WMP A;  2IUJ A;  3FLJ A;  3UNL A;  1IVW A;  1UGI A;  2CWU A;  1YJ9 3;  4U13 A;  4HZ9 B;  1AR0 A;  1K28 A;  1RCL A;  1MGW A;  4KZ1 A;  1IQX A;  3D79 A;  2GSP A;  4HAA A;  2GXF A;  4O02 B;  1B27 A;  1I2G A;  1ZO2 A;  3JUQ A;  3B4P A;  2KF4 A;  1MWT A;  1OUN A;  2WGO A;  1GOY A;  2SBL A;  3OWY A;  1NO3 A;  1YNV X;  4K61 A;  2E2T A;  1VQO 3;  2CC3 A;  1B21 A;  3D5G A;  3WOE B;  2OTJ 3;  3AHS A;  2CG1 A;  1VQP 3;  4DKI A;  3BNC A;  4H3U A;  2BMQ B;  3PS8 A;  5IEP A;  1M1X B;  3WHO A;  4R9K A;  4HKV B;  4CCV A;  1EEJ A;  3NHX A;  1AQZ A;  1A67 A;  2KF5 A;  3MG2 A;  3UL5 A;  1E3R A;  1GMP A;  1WNH A;  1R4Y A;  3KKG A;  1RRL A;  3J7Y d;  2F99 A;  1N5H A;  3FCS B;  1OF5 A;  4KFD A;  3JUP A;  2RSX A;  3B8L A;  3STD A;  2JQ5 A;  4HJL B;  1PFP A;  5IG3 A;  1D6Z A;  5IG0 A;  1RJO A;  1GYB A;  1VZZ A;  3MG1 A;  2PNC A;  1VQM 3;  1GD4 A;  3N8B A;  3NBB A;  3EX9 A;  1ROA A;  3LH4 A;  1TUH A;  1RGE A;  3CC7 3;  1Q7H A;  3FZW A;  2KXG A;  1E97 A;  2K54 A;  1G0T A;  3T8U A;  4BTX A;  1BUJ A;  3HI7 A;  3WR2 A;  3B7C A;  3DM8 A;  4CPK A;  4N6M A;  1B2U A;  3JUN A;  3Q90 A;  1AVK A;  1HKX A;  2W6J H;  2LYX A;  3H51 A;  4FCM A;  6STD A;  3LXU X;  4HM8 B;  3EJV A;  4LMI A;  1MWU A;  1LNI A;  1JV2 B;  4EYC A;  3AMO A;  3DGM A;  4FR9 A;  2HML B;  3QK9 A;  3WA2 X;  4KFF A;  2F5M A;  4N6V 0;  3WOD G;  5I97 A;  2H0I A;  1BU4 A;  1K9M 4;  1VQ4 3;  2W04 A;  2HOH A;  1FW7 A;  1QMA A;  1FGM A;  3E99 A;  1AY7 A;  1UCI A;  3EBY A;  4MMY B;  3F7X A;  5G1K A;  1WMN A;  4OUQ A;  1DMQ A;  1BNI A;  1I3F A;  3F8X A;  3JVC A;  3NBJ A;  1RGF A;  1JKG B;  1FUS A;  1GS3 A;  3TDG A;  2Y74 A;  2GEX A;  5KP1 A;  4CJN A;  1BRJ A;  1OGX A;  1BRG A;  3CCR 3;  1GD3 A;  3D3L A;  1W02 A;  3CME 3;  1GOU A;  2HMK B;  2R41 A;  2W9Q A;  3GZR A;  2IY2 A;  5IER A;  1TFO A;  1X1W A;  3X3Y A;  2BMO B;  1GMQ A;  1UUV B;  1I2E A;  1PYL A;  1IQ8 A;  4HM6 B;  3CU3 A;  1X1U A;  4ZM8 A;  3F8H A;  3URP A;  5JPP A;  1M90 4;  2YFI B;  3FSD A;  4J8T A;  3ECF A;  5EQL A;  1UUW B;  5AEW B;  2KAA A;  2IUK A;  7GSP A;  2LQV A;  2C11 A;  4K90 B; 
#chains in the Genus database with same CATH homology
 2K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...