2K3DA

Solution nmr structure of the folded 79 residue fragment of lin0334 from listeria innocua. northeast structural genomics consortium target lkr15
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
AFFNEQKEKVTLYLKHNIPDFNTVTFTNEEFNPIGISIDGYINNDKNLSFTAGKDVKIFSSSEELDKMFQEPRKGYDEILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin0334 protein
publication title Solution NMR structure of the folded 79 residue fragment of Lin0334 from Listeria innocua. Northeast Structural Genomics Consortium target LkR15.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.130 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, folded 79 residue fragment of lin0334 like domains 2k3dA00
2K3DA
chains in the Genus database with same CATH superfamily
5M18A 2P09A 2OQEA 2WGQA 4GSPA 1MGRA 1KQS2 2ZA4A 3JUNA 3ZFZA 4BIRA 2F4YA 1HKXA 4U13A 3DGMA 4XBXA 2BMRB 1JJ22 5D83A 4L8PA 1OCVA 4RZMA 3OWSA 1BVIA 1YGEA 3SVAA 4CPKA 1NJI4 1RJOA 4OVMA 4L7KA 1DE3A 2L1SA 1DVCA 2P05A 4FR9A 3NBJA 1A2PA 3GSPA 1YJN3 1B2ZA 3BU4A 2IMJA 1R4CA 1D6UA 1SPUA 3U97A 2CK3H 3I0YA 3G8ZA 3CC73 4FCMA 4HM5B 1BSEA 1AV4A 1BSAA 4EW5A 1W4NA 1W2ZA 1OPYA 4L8OA 3OW22 3E99A 4XDVA 1W6YA 3WA3A 3DGYA 3IMAB 1OUNA 4KZ1A 3JUOA 3DUKA 2ZL8A 2CHCA 3H3HA 4BTWA 1B2XA 1VQ43 1T2HA 1RGEA 1C54A 2W6JH 3DM8A 4GHOA 1EKMA 3PYJA 2F56A 3NBRA 4CCVA 1YVBI 5G2GA 3JVCA 1BU4A 3A5EA 4H3UA 1U8CB 4Q53A 1LOVA 3LYGA 2W03A 3KSPA 5IF6A 2RSXA 1GS3A 1I2EA 1TJDA 3BB9A 3F14A 1YVSA 3LH4A 1U5OA 1I3IA 3D3LA 5AI1A 3LTBA 2KXGA 1BNRA 2XFSA 1BUQA 1KWIA 2BT3A 1VQN3 2GU1A 1O7MB 4FCZA 4ILFA 4EV5A 1BSCA 3HOHA 2RCDA 1LVNA 1GYBA 2XH9A 1Q40A 1ROVA 2O9UX 1G0TA 1JRQA 1O7PB 3B7CA 2CWVA 3B8LA 4MJDA 3JUMA 8CHOA 4N6OB 5RNTA 1R4YA 1SIIA 5D81A 2ZDJA 1GY5A 1BIRA 1ULJB 3F8HA 2BMOB 3MHEA 2CWTA 3F40A 1SARA 1W01A 2C10A 1TP6A 1NNVA 3NX0A 2XEPA 2K0MA 3X40A 1FYSA 1E97A 3ZG0A 3N9HA 1JB4A 2F98A 5KP1A 3EB8A 3KFQC 3PZWA 4CJNA 1UI8A 3AGNA 1BRJA 1N9JA 1UUGB 5IG3A 1JNQA 2B1XB 1IVWA 1UCJA 4FMAA 2LYXA 1Q7HA 1ZS7A 2W9PA 1N5PA 2F5MA 1SJWA 1EA2A 4HM6B 1BNSA 1IQXA 1UI7A 3V92A 3CXC2 1LNHA 3ER7A 4HM7B 3A76A 3G0KA 3FG1A 3S27A 3S28A 3L0RA 3PCRA 1PFPA 1JZOA 3KIIA 3ROBA 4DKIA 4NPBA 1A2KA 1RRHA 3CC23 4EXRA 3CCR3 1DETA 1MWRA 1C7HA 2CX0A 4LSOA 5AIGA 3DGOA 1OHOA 1TFKA 1IQ8A 3DMCA 4KFEA 1SQWA 5CF1A 2SBLA 4I5QA 4FCJA 2A15A 4FMBA 4CDLA 3GZRA 1Q42A 4AKZA 1RN7A 1JKGA 1NB3I 4K1VA 5IG4A 1O7WB 1N8R4 1S5AA 3EBYA 3N54B 2RGQA 3MKIA 2YFIB 4XM4A 5AYSC 3VSYA 1TRPA 1RGCA 3GAXA 1VQK3 1BSBA 2W04A 4LZIA 4N6LA 3HIIA 1BRIA 1RNTA 3WHOA 3EN8A 4JRFA 4N6TA 3CPW2 1CEWI 3NV0A 1Q9EA 1NDOB 2PNCA 1OGZA 4O2HA 1TUHA 1QVF2 1IU7A 1FUTA 3V98A 2J8XB 3T0UA 2Z76A 4O8SA 1VQQA 2OTJ3 1US1A 3EJVA 3WMDA 1MGWA 3CU3A 1WQLB 1HZ1A 3ZG5A 5A0OB 1V58A 2IYJA 2UUGC 3D79A 1N9EA 1YNVX 3AMOA 3OWYA 3CCQ3 5JPPA 3FZWA 3HI7A 1DMNA 1I8VA 2IY2A 5IEPA 5G1KA 2WOFA 5JBSA 1QVG2 2FGTA 5BIRA 1BNGA 1UDII 1YI23 2V1LA 1IVUA 5AIFA 1OACA 2ZHXB 3B4OA 3BNCA 3LTCA 4GB5A 3KZTA 1W6CA 5FW5A 3DH2A 2CW9A 1T2IA 4XBYA 5IW9A 2HMMB 1QMAA 1YJ93 1GD3A 4N6UA 2RNTA 5EVHA 5STDA 1ZGXA 4H61A 3AMOB 1AVLA 2GU3A 1O7GB 1NO3A 1RN1A 3JUQA 1RTUA 1Q864 4HM2B 3NQZA 2RBIA 2D42A 1QAFA 2BIRA 3B4PA 3LT8A 4HM0B 5IERA 1AQZA 3CME3 3CCV3 2QGUA 3I563 2P0MA 2QIYA 3D5GA 1EG9B 2Z77A 4LEHA 3D9RA 1FW7A 2CFLA 1RGLA 1FGTA 3SOYA 3UJMA 3CCS3 2CG0A 4MMXB 1RDSA 3N8BA 1W5ZA 3CCE3 1B20A 2YX9A 1QAKA 3S67A 1G96A 3K63A 2F5WA 2HMNB 3KE7A 4HKVB 1W02A 2XGNA 4KFDA 1FZUA 2OOVA 1BRHA 1RNBA 4R9KA 3FSDA 3CCJ3 2HMLB 5CF2A 1AY7A 1RLSA 4BTYA 1WMPA 4HM3B 2I9WA 1VQL3 4IIAA 1CQSA 2SARA 4MMYB 1KC84 2CFGA 1BUJA 1ULIB 1RGAA 2L4VA 1M904 3HZPA 1JZDA 1I0VA 3BIRA 3K0ZA 3FCSB 4KT3B 2OWPA 1A90A 3ALAA 3QK9A 3FH1A 4LYLB 4NREA 2GEXA 4R80A 3X3ZA 1B27A 1W7CA 5BXQA 2BHMA 1K41A 4HOHA 2KF6A 6STDA 5I97A 2KF3A 2GSPA 3CNMA 1OF5A 4X2OA 1FGQA 1LXEA 2Y74A 3K5TA 3KSED 4N6MA 1GMRA 4O3VA 2MC8A 3CC43 2OQEC 3GRDA 4GL6A 2E2UA 1AVKA 4O02B 3UB1A 1BRSA 5IENA 1VQ53 2KRTA 2STDA 1BNJA 4MMZB 3U1WA 1LOWA 1MWSA 1FGRA 1E3VA 2Y73A 2XF3A 4HVNA 3STDA 1BNIA 1Q40B 4RBNA 2CG1A 3LOYA 3X41A 7STDA 1B2MA 1CH0A 1OF5B 1TRQA 2P38A 3MYTA 1M9GA 1UCLA 1UUVB 2LQVA 3FF0A 2H0GA 3CMA3 1YIT3 1A67A 2E2TA 3VGNA 2H0HA 2QA43 1JN5A 1LRAA 1YHQ3 1RCKA 1F8NA 3UL5A 3AGOA 3D4AA 3MG1A 1IK3A 4N3VA 2C11A 1VQ93 3SYUA 3GWRA 4RNZA 1X1YA 7GSPA 2UGIA 3LZAA 3RDEA 1TTOA 3OV4A 1L5GB 3ECFA 3TDGA 5D82A 1BRNL 4WYKA 5IG0A 4RNYA 3DGNA 3G6E3 3CPOA 1TU5A 2IUKA 4HZBB 5FGOA 1IDPA 3S29A 3G4S3 1K9M4 1BANA 1WNHA 2YFLB 1K734 1BNEA 4KFFA 1STFI 4IPBA 1EQKA 3Q2PA 4I4KA 1JV2B 1IV7A 4OUQA 5EQLA 1O7NB 3EF8A 1BRKA 3EC9A 4J8TA 1BAOA 4IT7A 7RNTA 2XR8B 1JBSA 3Q3FA 1JBRA 1I2GA 1X1UA 1BNFA 2CFWA 4BL2A 1OHPA 1K8A4 2KAAA 1RKYA 3SOAA 1HYFA 1IT8A 1Z1SA 3JUPA 4LGQA 4ZM8A 3G713 1FA3A 2FNQA 1JB5A 1LOYA 1JKGB 1NWWA 3FGYA 3KN4A 3NM2A 3NM7A 4WP5A 3VF1A 5M1AA 1VQP3 5IG5A 1FGMA 2B24B 2INXA 2R4IA 1GOUA 3MG3A 1JB2A 1DVDA 2W9QA 2Z6BA 3IPTA 1ZX2A 2W0QA 4WHAA 1M1XB 1YGWA 1IQYA 1X1XA 2BNGA 5DREA 3UL6A 4BU4A 1V57A 4MEIA 3K9MC 3NV0B 1UGHI 3DZLA 2JQ5A 4K61A 2ML6A 5AEUB 3K7CA 2BU4A 3PGBA 2KCDA 4HZ9B 9RNTA 1IVVA 1VQ63 1LOXA 2UX0A 1N8QA 3QRDA 4R9LA 4LMIA 2ML5A 1Q7Y4 1UGIA 3H51A 3NQYA 1VQ73 1IYYA 2E2VA 4K1UA 3GZXB 2CFKA 1A2VA 1O7HB 5IEOA 2IA7A 1OGXA 5KP4A 2XSOB 3T8NA 3G16A 5GSPA 1EUIC 3EQQB 1GMQA 1WTHA 4K90B 2F86B 2JDIH 2CIUA 3MSOA 5HGRA 5DRVA 1IT7A 1RGFA 3CNXA 1SIHA 3F8XA 1G02A 6GSPA 4FMCA 1N5HA 1T3BA 3WOEB 4HM8B 1M1K4 3FLJA 1UCKA 3LMLA 1GOVA 1ASKA 2GEYA 1Q814 1GSPA 3IJEB 4OK0A 2GBWB 3FKAA 2MF7A 4G1MB 5AEWB 3NBBA 1V74A 3URPA 5HOHA 1E3RA 5AIIA 1YJW3 1IV9A 1I3FA 2M7OA 5LC6A 5AIHA 1CYVA 3OX9A 4X2HA 2OTL3 1UUWB 3FG3A 3DY5A 2O3OA 1QALA 2KF5A 3LT9A 4HM4B 1MOLA 2XSHB 1YIJ3 1UW1A 2D1WA 3BNEA 4AKYA 4BL3A 3SEDA 3WODG 1HU9A 3J7Yd 3WR2A 3MWZA 1VQO3 1D6ZA 4QWTA 3RNTA 1EEJA 3KKGA 1VZZA 2K54A 2W56A 2H0IA 3EBTA 3FG4A 2HMKB 3NXJA 3NUVA 3SLUA 1BOXA 1GOYA 1DYUA 1RSNA 1DMMA 2GXFA 3LTAA 4KVHA 2CH9A 2F99A 3RGAA 3WOFB 1I0XA 3CCL3 1W2B2 1CYUA 1FUWA 3EHCA 1BSDA 3AHSA 5KP3A 1BRGA 1GD4A 4HBRA 4J9AA 1RGKA 1STDA 2P0XA 3WA2X 3GZBA 4HM1B 4BTXA 3X3YA 3FF2A 1NB5I 1LQMB 2YFJB 4NHFA 1OH0A 4JF8A 2Q07A 1S723 1B21A 2CX1A 1OHSA 2OCTA 4STDA 2W56B 1FGOA 1RHLA 1B2SA 2HMJB 2RFRA 1JBTA 4EV2A 1TIJA 5TGNA 3S5CA 5JPUA 2GBXB 2CWUA 5CK6A 3BLZA 3LTDA 3MG2A 1QJGA 3PS8A 3MPHA 4FMDA 1RRLA 1T5YA 2AADA 1PY3A 1Y4KA 4EBGA 2PZVA 3PCSA 1DMQA 1KSIA 5CLKA 5CXOA 4XDWA 3GZYB 1LQGC 5ELJA 1LNIA 1RCLA 1RGGA 2R41A 2C4BA 1ISKA 1ROAA 2WGOA 3M8CA 1I70A 4TX4A 3LXUX 4R4KA 3WDGB 4AEQA 1MWTA 4N6NB 2CC3A 1FUSA 2BMQB 3CCM3 3T8UA 4R1KA 1WMNA 2K3DA 1RGHA 3NHXA 3X3XA 3KCHA 3V99A 1JN5B 5BVBA 1VQ83 2OOVC 2CFDA 4HJLB 2KF4A 5AYRB 3SXXA 3CD63 3DXOA 1MNLA 4WWUC 1D6YA 1GY6A 3Q90A 4N6V0 3I553 1Q824 3Q1CA 3F7XA 4ORLA 3AHWA 1WMOA 2W2CA 2XGLA 4WFOA 2WO0A 2CKFB 3F9SA 5G1LA 1AR0A 4EC6A 4XBTA 3SX1A 5ELUA 1UCIA 3F7SA 6RNTA 3EN1B 3HIGA 3BNBA 3O8YA 1KD14 1RMSA 3EE1A 1I2FA 2HMOB 3HX8A 4PEJA 4WYKB 3X42A 4EYCA 5M19A 1B2UA 2HOHA 3PXMA 1VQM3 1B3SA 3BNDA 3OXAA 5BU4A 1W00A 1X1WA 1MWUA 5EEOA 5LC7A 4XB5A 2BO9B 1W6GA 2AAEA 2FXTA 8RNTA 1IVXA 3D5IA 3HK4A 2XFTA 3EX9A 4HYZA 1PU4A 1PYLA 3UNLA 1NU3A 1TFOA 3DGLA 4HAAA 2IUJA 3CCU3 1BGSA 2XRXB 1RN4A 1J2BA 2Z7AA 1ZO2A 3RGRA 4J5KA 2WOHA 1K28A 2QEX3 1GMPA 4RNTA 1GY7A 3OWUA 4J5GA
chains in the Genus database with same CATH topology
2K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3D A; 
#chains in the Genus database with same CATH topology
 5M18 A;  2P09 A;  2OQE A;  2WGQ A;  4GSP A;  1MGR A;  1KQS 2;  2ZA4 A;  3JUN A;  3ZFZ A;  4BIR A;  2F4Y A;  1HKX A;  4U13 A;  3DGM A;  4XBX A;  2BMR B;  1JJ2 2;  5D83 A;  4L8P A;  1OCV A;  4RZM A;  3OWS A;  1BVI A;  1YGE A;  3SVA A;  4CPK A;  1NJI 4;  1RJO A;  4OVM A;  4L7K A;  1DE3 A;  2L1S A;  1DVC A;  2P05 A;  4FR9 A;  3NBJ A;  1A2P A;  3GSP A;  1YJN 3;  1B2Z A;  3BU4 A;  2IMJ A;  1R4C A;  1D6U A;  1SPU A;  3U97 A;  2CK3 H;  3I0Y A;  3G8Z A;  3CC7 3;  4FCM A;  4HM5 B;  1BSE A;  1AV4 A;  1BSA A;  4EW5 A;  1W4N A;  1W2Z A;  1OPY A;  4L8O A;  3OW2 2;  3E99 A;  4XDV A;  1W6Y A;  3WA3 A;  3DGY A;  3IMA B;  1OUN A;  4KZ1 A;  3JUO A;  3DUK A;  2ZL8 A;  2CHC A;  3H3H A;  4BTW A;  1B2X A;  1VQ4 3;  1T2H A;  1RGE A;  1C54 A;  2W6J H;  3DM8 A;  4GHO A;  1EKM A;  3PYJ A;  2F56 A;  3NBR A;  4CCV A;  1YVB I;  5G2G A;  3JVC A;  1BU4 A;  3A5E A;  4H3U A;  1U8C B;  4Q53 A;  1LOV A;  3LYG A;  2W03 A;  3KSP A;  5IF6 A;  2RSX A;  1GS3 A;  1I2E A;  1TJD A;  3BB9 A;  3F14 A;  1YVS A;  3LH4 A;  1U5O A;  1I3I A;  3D3L A;  5AI1 A;  3LTB A;  2KXG A;  1BNR A;  2XFS A;  1BUQ A;  1KWI A;  2BT3 A;  1VQN 3;  2GU1 A;  1O7M B;  4FCZ A;  4ILF A;  4EV5 A;  1BSC A;  3HOH A;  2RCD A;  1LVN A;  1GYB A;  2XH9 A;  1Q40 A;  1ROV A;  2O9U X;  1G0T A;  1JRQ A;  1O7P B;  3B7C A;  2CWV A;  3B8L A;  4MJD A;  3JUM A;  8CHO A;  4N6O B;  5RNT A;  1R4Y A;  1SII A;  5D81 A;  2ZDJ A;  1GY5 A;  1BIR A;  1ULJ B;  3F8H A;  2BMO B;  3MHE A;  2CWT A;  3F40 A;  1SAR A;  1W01 A;  2C10 A;  1TP6 A;  1NNV A;  3NX0 A;  2XEP A;  2K0M A;  3X40 A;  1FYS A;  1E97 A;  3ZG0 A;  3N9H A;  1JB4 A;  2F98 A;  5KP1 A;  3EB8 A;  3KFQ C;  3PZW A;  4CJN A;  1UI8 A;  3AGN A;  1BRJ A;  1N9J A;  1UUG B;  5IG3 A;  1JNQ A;  2B1X B;  1IVW A;  1UCJ A;  4FMA A;  2LYX A;  1Q7H A;  1ZS7 A;  2W9P A;  1N5P A;  2F5M A;  1SJW A;  1EA2 A;  4HM6 B;  1BNS A;  1IQX A;  1UI7 A;  3V92 A;  3CXC 2;  1LNH A;  3ER7 A;  4HM7 B;  3A76 A;  3G0K A;  3FG1 A;  3S27 A;  3S28 A;  3L0R A;  3PCR A;  1PFP A;  1JZO A;  3KII A;  3ROB A;  4DKI A;  4NPB A;  1A2K A;  1RRH A;  3CC2 3;  4EXR A;  3CCR 3;  1DET A;  1MWR A;  1C7H A;  2CX0 A;  4LSO A;  5AIG A;  3DGO A;  1OHO A;  1TFK A;  1IQ8 A;  3DMC A;  4KFE A;  1SQW A;  5CF1 A;  2SBL A;  4I5Q A;  4FCJ A;  2A15 A;  4FMB A;  4CDL A;  3GZR A;  1Q42 A;  4AKZ A;  1RN7 A;  1JKG A;  1NB3 I;  4K1V A;  5IG4 A;  1O7W B;  1N8R 4;  1S5A A;  3EBY A;  3N54 B;  2RGQ A;  3MKI A;  2YFI B;  4XM4 A;  5AYS C;  3VSY A;  1TRP A;  1RGC A;  3GAX A;  1VQK 3;  1BSB A;  2W04 A;  4LZI A;  4N6L A;  3HII A;  1BRI A;  1RNT A;  3WHO A;  3EN8 A;  4JRF A;  4N6T A;  3CPW 2;  1CEW I;  3NV0 A;  1Q9E A;  1NDO B;  2PNC A;  1OGZ A;  4O2H A;  1TUH A;  1QVF 2;  1IU7 A;  1FUT A;  3V98 A;  2J8X B;  3T0U A;  2Z76 A;  4O8S A;  1VQQ A;  2OTJ 3;  1US1 A;  3EJV A;  3WMD A;  1MGW A;  3CU3 A;  1WQL B;  1HZ1 A;  3ZG5 A;  5A0O B;  1V58 A;  2IYJ A;  2UUG C;  3D79 A;  1N9E A;  1YNV X;  3AMO A;  3OWY A;  3CCQ 3;  5JPP A;  3FZW A;  3HI7 A;  1DMN A;  1I8V A;  2IY2 A;  5IEP A;  5G1K A;  2WOF A;  5JBS A;  1QVG 2;  2FGT A;  5BIR A;  1BNG A;  1UDI I;  1YI2 3;  2V1L A;  1IVU A;  5AIF A;  1OAC A;  2ZHX B;  3B4O A;  3BNC A;  3LTC A;  4GB5 A;  3KZT A;  1W6C A;  5FW5 A;  3DH2 A;  2CW9 A;  1T2I A;  4XBY A;  5IW9 A;  2HMM B;  1QMA A;  1YJ9 3;  1GD3 A;  4N6U A;  2RNT A;  5EVH A;  5STD A;  1ZGX A;  4H61 A;  3AMO B;  1AVL A;  2GU3 A;  1O7G B;  1NO3 A;  1RN1 A;  3JUQ A;  1RTU A;  1Q86 4;  4HM2 B;  3NQZ A;  2RBI A;  2D42 A;  1QAF A;  2BIR A;  3B4P A;  3LT8 A;  4HM0 B;  5IER A;  1AQZ A;  3CME 3;  3CCV 3;  2QGU A;  3I56 3;  2P0M A;  2QIY A;  3D5G A;  1EG9 B;  2Z77 A;  4LEH A;  3D9R A;  1FW7 A;  2CFL A;  1RGL A;  1FGT A;  3SOY A;  3UJM A;  3CCS 3;  2CG0 A;  4MMX B;  1RDS A;  3N8B A;  1W5Z A;  3CCE 3;  1B20 A;  2YX9 A;  1QAK A;  3S67 A;  1G96 A;  3K63 A;  2F5W A;  2HMN B;  3KE7 A;  4HKV B;  1W02 A;  2XGN A;  4KFD A;  1FZU A;  2OOV A;  1BRH A;  1RNB A;  4R9K A;  3FSD A;  3CCJ 3;  2HML B;  5CF2 A;  1AY7 A;  1RLS A;  4BTY A;  1WMP A;  4HM3 B;  2I9W A;  1VQL 3;  4IIA A;  1CQS A;  2SAR A;  4MMY B;  1KC8 4;  2CFG A;  1BUJ A;  1ULI B;  1RGA A;  2L4V A;  1M90 4;  3HZP A;  1JZD A;  1I0V A;  3BIR A;  3K0Z A;  3FCS B;  4KT3 B;  2OWP A;  1A90 A;  3ALA A;  3QK9 A;  3FH1 A;  4LYL B;  4NRE A;  2GEX A;  4R80 A;  3X3Z A;  1B27 A;  1W7C A;  5BXQ A;  2BHM A;  1K41 A;  4HOH A;  2KF6 A;  6STD A;  5I97 A;  2KF3 A;  2GSP A;  3CNM A;  1OF5 A;  4X2O A;  1FGQ A;  1LXE A;  2Y74 A;  3K5T A;  3KSE D;  4N6M A;  1GMR A;  4O3V A;  2MC8 A;  3CC4 3;  2OQE C;  3GRD A;  4GL6 A;  2E2U A;  1AVK A;  4O02 B;  3UB1 A;  1BRS A;  5IEN A;  1VQ5 3;  2KRT A;  2STD A;  1BNJ A;  4MMZ B;  3U1W A;  1LOW A;  1MWS A;  1FGR A;  1E3V A;  2Y73 A;  2XF3 A;  4HVN A;  3STD A;  1BNI A;  1Q40 B;  4RBN A;  2CG1 A;  3LOY A;  3X41 A;  7STD A;  1B2M A;  1CH0 A;  1OF5 B;  1TRQ A;  2P38 A;  3MYT A;  1M9G A;  1UCL A;  1UUV B;  2LQV A;  3FF0 A;  2H0G A;  3CMA 3;  1YIT 3;  1A67 A;  2E2T A;  3VGN A;  2H0H A;  2QA4 3;  1JN5 A;  1LRA A;  1YHQ 3;  1RCK A;  1F8N A;  3UL5 A;  3AGO A;  3D4A A;  3MG1 A;  1IK3 A;  4N3V A;  2C11 A;  1VQ9 3;  3SYU A;  3GWR A;  4RNZ A;  1X1Y A;  7GSP A;  2UGI A;  3LZA A;  3RDE A;  1TTO A;  3OV4 A;  1L5G B;  3ECF A;  3TDG A;  5D82 A;  1BRN L;  4WYK A;  5IG0 A;  4RNY A;  3DGN A;  3G6E 3;  3CPO A;  1TU5 A;  2IUK A;  4HZB B;  5FGO A;  1IDP A;  3S29 A;  3G4S 3;  1K9M 4;  1BAN A;  1WNH A;  2YFL B;  1K73 4;  1BNE A;  4KFF A;  1STF I;  4IPB A;  1EQK A;  3Q2P A;  4I4K A;  1JV2 B;  1IV7 A;  4OUQ A;  5EQL A;  1O7N B;  3EF8 A;  1BRK A;  3EC9 A;  4J8T A;  1BAO A;  4IT7 A;  7RNT A;  2XR8 B;  1JBS A;  3Q3F A;  1JBR A;  1I2G A;  1X1U A;  1BNF A;  2CFW A;  4BL2 A;  1OHP A;  1K8A 4;  2KAA A;  1RKY A;  3SOA A;  1HYF A;  1IT8 A;  1Z1S A;  3JUP A;  4LGQ A;  4ZM8 A;  3G71 3;  1FA3 A;  2FNQ A;  1JB5 A;  1LOY A;  1JKG B;  1NWW A;  3FGY A;  3KN4 A;  3NM2 A;  3NM7 A;  4WP5 A;  3VF1 A;  5M1A A;  1VQP 3;  5IG5 A;  1FGM A;  2B24 B;  2INX A;  2R4I A;  1GOU A;  3MG3 A;  1JB2 A;  1DVD A;  2W9Q A;  2Z6B A;  3IPT A;  1ZX2 A;  2W0Q A;  4WHA A;  1M1X B;  1YGW A;  1IQY A;  1X1X A;  2BNG A;  5DRE A;  3UL6 A;  4BU4 A;  1V57 A;  4MEI A;  3K9M C;  3NV0 B;  1UGH I;  3DZL A;  2JQ5 A;  4K61 A;  2ML6 A;  5AEU B;  3K7C A;  2BU4 A;  3PGB A;  2KCD A;  4HZ9 B;  9RNT A;  1IVV A;  1VQ6 3;  1LOX A;  2UX0 A;  1N8Q A;  3QRD A;  4R9L A;  4LMI A;  2ML5 A;  1Q7Y 4;  1UGI A;  3H51 A;  3NQY A;  1VQ7 3;  1IYY A;  2E2V A;  4K1U A;  3GZX B;  2CFK A;  1A2V A;  1O7H B;  5IEO A;  2IA7 A;  1OGX A;  5KP4 A;  2XSO B;  3T8N A;  3G16 A;  5GSP A;  1EUI C;  3EQQ B;  1GMQ A;  1WTH A;  4K90 B;  2F86 B;  2JDI H;  2CIU A;  3MSO A;  5HGR A;  5DRV A;  1IT7 A;  1RGF A;  3CNX A;  1SIH A;  3F8X A;  1G02 A;  6GSP A;  4FMC A;  1N5H A;  1T3B A;  3WOE B;  4HM8 B;  1M1K 4;  3FLJ A;  1UCK A;  3LML A;  1GOV A;  1ASK A;  2GEY A;  1Q81 4;  1GSP A;  3IJE B;  4OK0 A;  2GBW B;  3FKA A;  2MF7 A;  4G1M B;  5AEW B;  3NBB A;  1V74 A;  3URP A;  5HOH A;  1E3R A;  5AII A;  1YJW 3;  1IV9 A;  1I3F A;  2M7O A;  5LC6 A;  5AIH A;  1CYV A;  3OX9 A;  4X2H A;  2OTL 3;  1UUW B;  3FG3 A;  3DY5 A;  2O3O A;  1QAL A;  2KF5 A;  3LT9 A;  4HM4 B;  1MOL A;  2XSH B;  1YIJ 3;  1UW1 A;  2D1W A;  3BNE A;  4AKY A;  4BL3 A;  3SED A;  3WOD G;  1HU9 A;  3J7Y d;  3WR2 A;  3MWZ A;  1VQO 3;  1D6Z A;  4QWT A;  3RNT A;  1EEJ A;  3KKG A;  1VZZ A;  2K54 A;  2W56 A;  2H0I A;  3EBT A;  3FG4 A;  2HMK B;  3NXJ A;  3NUV A;  3SLU A;  1BOX A;  1GOY A;  1DYU A;  1RSN A;  1DMM A;  2GXF A;  3LTA A;  4KVH A;  2CH9 A;  2F99 A;  3RGA A;  3WOF B;  1I0X A;  3CCL 3;  1W2B 2;  1CYU A;  1FUW A;  3EHC A;  1BSD A;  3AHS A;  5KP3 A;  1BRG A;  1GD4 A;  4HBR A;  4J9A A;  1RGK A;  1STD A;  2P0X A;  3WA2 X;  3GZB A;  4HM1 B;  4BTX A;  3X3Y A;  3FF2 A;  1NB5 I;  1LQM B;  2YFJ B;  4NHF A;  1OH0 A;  4JF8 A;  2Q07 A;  1S72 3;  1B21 A;  2CX1 A;  1OHS A;  2OCT A;  4STD A;  2W56 B;  1FGO A;  1RHL A;  1B2S A;  2HMJ B;  2RFR A;  1JBT A;  4EV2 A;  1TIJ A;  5TGN A;  3S5C A;  5JPU A;  2GBX B;  2CWU A;  5CK6 A;  3BLZ A;  3LTD A;  3MG2 A;  1QJG A;  3PS8 A;  3MPH A;  4FMD A;  1RRL A;  1T5Y A;  2AAD A;  1PY3 A;  1Y4K A;  4EBG A;  2PZV A;  3PCS A;  1DMQ A;  1KSI A;  5CLK A;  5CXO A;  4XDW A;  3GZY B;  1LQG C;  5ELJ A;  1LNI A;  1RCL A;  1RGG A;  2R41 A;  2C4B A;  1ISK A;  1ROA A;  2WGO A;  3M8C A;  1I70 A;  4TX4 A;  3LXU X;  4R4K A;  3WDG B;  4AEQ A;  1MWT A;  4N6N B;  2CC3 A;  1FUS A;  2BMQ B;  3CCM 3;  3T8U A;  4R1K A;  1WMN A;  2K3D A;  1RGH A;  3NHX A;  3X3X A;  3KCH A;  3V99 A;  1JN5 B;  5BVB A;  1VQ8 3;  2OOV C;  2CFD A;  4HJL B;  2KF4 A;  5AYR B;  3SXX A;  3CD6 3;  3DXO A;  1MNL A;  4WWU C;  1D6Y A;  1GY6 A;  3Q90 A;  4N6V 0;  3I55 3;  1Q82 4;  3Q1C A;  3F7X A;  4ORL A;  3AHW A;  1WMO A;  2W2C A;  2XGL A;  4WFO A;  2WO0 A;  2CKF B;  3F9S A;  5G1L A;  1AR0 A;  4EC6 A;  4XBT A;  3SX1 A;  5ELU A;  1UCI A;  3F7S A;  6RNT A;  3EN1 B;  3HIG A;  3BNB A;  3O8Y A;  1KD1 4;  1RMS A;  3EE1 A;  1I2F A;  2HMO B;  3HX8 A;  4PEJ A;  4WYK B;  3X42 A;  4EYC A;  5M19 A;  1B2U A;  2HOH A;  3PXM A;  1VQM 3;  1B3S A;  3BND A;  3OXA A;  5BU4 A;  1W00 A;  1X1W A;  1MWU A;  5EEO A;  5LC7 A;  4XB5 A;  2BO9 B;  1W6G A;  2AAE A;  2FXT A;  8RNT A;  1IVX A;  3D5I A;  3HK4 A;  2XFT A;  3EX9 A;  4HYZ A;  1PU4 A;  1PYL A;  3UNL A;  1NU3 A;  1TFO A;  3DGL A;  4HAA A;  2IUJ A;  3CCU 3;  1BGS A;  2XRX B;  1RN4 A;  1J2B A;  2Z7A A;  1ZO2 A;  3RGR A;  4J5K A;  2WOH A;  1K28 A;  2QEX 3;  1GMP A;  4RNT A;  1GY7 A;  3OWU A;  4J5G A; 
#chains in the Genus database with same CATH homology
 2K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...