2K3DA

Solution nmr structure of the folded 79 residue fragment of lin0334 from listeria innocua. northeast structural genomics consortium target lkr15
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
AFFNEQKEKVTLYLKHNIPDFNTVTFTNEEFNPIGISIDGYINNDKNLSFTAGKDVKIFSSSEELDKMFQEPRKGYDEILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the folded 79 residue fragment of Lin0334 from Listeria innocua. Northeast Structural Genomics Consortium target LkR15.
rcsb
source organism Listeria innocua clip11262
molecule tags Structural genomics, unknown function
molecule keywords Lin0334 protein
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.130 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, folded 79 residue fragment of lin0334 like domains 2k3dA00
2K3DA
chains in the Genus database with same CATH superfamily
3HI7A 3CCS3 1N5HA 4GHOA 1IYYA 4J8TA 1W5ZA 3HZPA 2W0QA 3IPTA 3LTBA 3K0ZA 4N6UA 3S28A 1TIJA 1DMMA 1JV2B 1YGEA 4N6OB 3S5CA 3S27A 2Y73A 1RNTA 2B1XB 1NJI4 2SARA 2A15A 4BTXA 1VQL3 3RNTA 1MWSA 4CCVA 4NHFA 1IQYA 2IYJA 4GSPA 1Q42A 1MWUA 1FGQA 4JRFA 5CF1A 3BB9A 5GSPA 3NM7A 1U5OA 4MMZB 5KP3A 3MWZA 3CC43 1R4YA 2D42A 2YX9A 1GYBA 2CC3A 2Z6BA 3OX9A 1JBSA 3G16A 1KQS2 7GSPA 2IUJA 1GOVA 1EKMA 3CD63 4WYKB 1W6YA 2RGQA 3MYTA 1B3SA 1UW1A 3Q3FA 3PGBA 2RFRA 2KF5A 3X42A 2CH9A 4HM8B 2P05A 1BRKA 3LYGA 4MEIA 5AIHA 3WA3A 1K28A 2RSXA 3FZWA 3CC73 1BOXA 2GBXB 1OF5A 5IENA 2CW9A 1W02A 3DMCA 3UNLA 4HYZA 4OK0A 1GSPA 1I0VA 3O8YA 3WOFB 1FW7A 4FMBA 4IT7A 5KP1A 1ASKA 2GEXA 2CHCA 2HMMB 2CFKA 3N54B 3V92A 2E2TA 3EJVA 3V99A 1BRIA 1BSCA 3MSOA 3NBRA 3F8XA 1DYUA 1UDII 3A76A 3GZYB 3SX1A 1NNVA 1OUNA 4XBTA 5BXQA 1K41A 3IJEB 4HJLB 1N5PA 1G02A 2CIUA 3DGOA 3UJMA 3Q2PA 1JBTA 1WQLB 1O7HB 3Q1CA 4XDWA 1RHLA 3B4PA 3PCSA 1DETA 3GZBA 4HM7B 1WMOA 1BNIA 1T2IA 1MWRA 3D3LA 3U97A 3NHXA 1AV4A 1RGAA 2F98A 1GS3A 1UGIA 2GU1A 1ISKA 7RNTA 1YJN3 2XSOB 4N6MA 4BL2A 1BSBA 3HX8A 1ROAA 4RZMA 1HZ1A 2IUKA 1W7CA 1I2EA 1EQKA 3T0UA 3AHSA 4EV2A 1BNFA 3STDA 1LOWA 2Y74A 4HM6B 2HMKB 3DGNA 1BRHA 2XRXB 1O7NB 1PFPA 4N6LA 1N8QA 3FF0A 2L4VA 2JQ5A 4O2HA 3WOEB 2QEX3 2CX1A 3F40A 3PS8A 6STDA 3X41A 3I553 3B8LA 2OCTA 4QWTA 3KSED 2GEYA 1QVF2 1TFKA 3ZG5A 2GXFA 4K90B 1JKGA 2AAEA 2XF3A 4J9AA 3ZFZA 5G1LA 1ULIB 4HBRA 5LC6A 1N9JA 3TDGA 3CCJ3 3CNXA 3FG3A 2UUGC 5IW9A 1LNHA 4I4KA 3PCRA 2PNCA 2XGNA 1W6GA 5BU4A 2HMLB 2L1SA 1IVUA 1CQSA 3WA2X 3LMLA 3PYJA 3F7XA 1OCVA 1B2XA 3MHEA 1TRQA 5D81A 3AMOA 2M7OA 5IG0A 1K9M4 3IMAB 3LT8A 3E99A 1N9EA 3SLUA 4R80A 1UCLA 1ULJB 3NXJA 2C10A 6GSPA 2B24B 2F4YA 2P0XA 9RNTA 3OW22 3VGNA 1BRJA 2WOFA 1JJ22 1T3BA 2YFIB 2H0GA 5CK6A 5AYSC 3JUOA 2R4IA 1OACA 3ECFA 1A2VA 4LSOA 1X1WA 2CWVA 3KSPA 1RCKA 4FMDA 2RBIA 4HM0B 1CYUA 5IEPA 5IEOA 4HM1B 3K63A 4N3VA 3WDGB 2C4BA 5M18A 1VQO3 1IU7A 1FUWA 1VQM3 1DVDA 1HKXA 2J8XB 3QK9A 1STDA 3WHOA 1GMQA 2XFSA 1BSAA 1Q814 3SYUA 4O8SA 2BNGA 4FR9A 1OF5B 3V98A 1NWWA 3EB8A 4HZBB 4AKZA 1LNIA 3K9MC 1BNEA 3QRDA 2W56B 6RNTA 3MPHA 1W4NA 1JN5A 2GBWB 3FGYA 2YFJB 3UB1A 1B2SA 7STDA 1VQ73 2K0MA 3X3ZA 1I8VA 2XGLA 1W00A 3CCU3 1EUIC 2Z7AA 1AR0A 1BSDA 3CME3 3NBJA 1BNGA 1ZO2A 1AQZA 3DH2A 4LGQA 2WOHA 3X40A 1T2HA 3FSDA 1GOYA 1U8CB 3OV4A 4OUQA 3AHWA 3JUPA 3MKIA 5AEUB 1JKGB 2I9WA 1IVVA 4CJNA 3NX0A 1RGEA 1BUQA 1OGXA 2XEPA 1FYSA 3KFQC 3KZTA 2CG1A 2H0IA 3RGAA 1E3RA 3PZWA 4BTYA 1LQMB 3KN4A 1UUGB 3SOAA 5FGOA 1FUTA 3JUQA 1RGGA 1AVKA 1RRLA 3MG3A 3DZLA 3CCM3 1Z1SA 3GWRA 4RBNA 4KZ1A 1IDPA 2BMOB 2CWUA 2GU3A 2C11A 3EF8A 2W2CA 1Q864 1RN4A 1MNLA 3BU4A 4MMXB 2KXGA 1VQ43 1FGMA 1AVLA 2LQVA 3SEDA 1TFOA 1W01A 1Q824 1IQXA 2KF6A 3FCSB 4HZ9B 3NM2A 3OWYA 1DMNA 1G0TA 2ZL8A 4KT3B 3CPOA 2INXA 5IG5A 2ZDJA 4FCMA 1S723 3GZRA 3KKGA 1W2B2 4DKIA 2CFGA 1TRPA 2H0HA 1UUVB 2KF3A 4WYKA 3CCR3 1VQP3 1VQ63 4NREA 4BU4A 1JNQA 2BHMA 4WFOA 1TU5A 5M1AA 3DGMA 1A90A 4BTWA 1B2UA 1DVCA 3BNCA 2FGTA 1A67A 5AI1A 1FGTA 4OVMA 1LOXA 1UCIA 2XH9A 4BIRA 4HAAA 3HIGA 2BMQB 2HMNB 1RLSA 1LVNA 1VQQA 4L8OA 4O02B 1YJ93 1N8R4 2F5MA 1G96A 3D79A 1R4CA 2OQEC 4HM3B 1SIHA 1JRQA 1RGFA 1MGWA 1X1XA 2V1LA 3LOYA 3LZAA 5CLKA 1J2BA 2PZVA 2Q07A 3U1WA 3RGRA 5CXOA 2IMJA 3CXC2 3WODG 1HU9A 2XSHB 4ORLA 1RDSA 3ALAA 5AIGA 1RGKA 2FXTA 4KFDA 3DXOA 2MF7A 1UCJA 3DY5A 2F5WA 5M19A 3NUVA 3N8BA 1KD14 3S29A 1NB5I 2BT3A 3F7SA 3VSYA 1OPYA 1JB5A 4FMAA 2AADA 2D1WA 4HVNA 3URPA 2P09A 3SVAA 1QAFA 1JZOA 4N6V0 5I97A 4EXRA 1M9GA 1ROVA 4H3UA 3FKAA 3BNDA 5JBSA 4N6TA 2SBLA 2UX0A 2BMRB 3RDEA 3MG2A 1X1YA 1M1K4 1JB4A 3K5TA 1GY5A 1O7PB 4RNZA 2CFWA 4XBXA 4CPKA 1PYLA 3CCQ3 1DMQA 2HOHA 3CC23 1TTOA 1RMSA 1RTUA 3BIRA 3B7CA 2ML5A 3KCHA 5JPUA 1IV7A 2P0MA 3JUMA 1LOYA 3ZG0A 1C7HA 2W9QA 1K734 2E2UA 3EBTA 3LTAA 1QMAA 1LRAA 4KVHA 2F86B 1M1XB 2XFTA 1BVIA 4HM2B 2OWPA 2KRTA 3GRDA 1JB2A 2IA7A 3AMOB 1JN5B 3GAXA 4STDA 1MGRA 2WGOA 3CCV3 1UGHI 1UI7A 4Q53A 1WMPA 1W2ZA 4EYCA 3BLZA 4EV5A 1PU4A 2KF4A 1OHSA 1HYFA 3LXUX 3D5GA 3WR2A 3SOYA 3CCE3 3EX9A 1GD4A 3FLJA 4K61A 1OGZA 4FCJA 4R4KA 3JUNA 5DREA 5BVBA 3DGLA 1CEWI 1VZZA 1BANA 1NU3A 3K7CA 3FF2A 5G2GA 1I2GA 4NPBA 3EE1A 4X2HA 2O3OA 5IG4A 1AY7A 3T8NA 3G6E3 1NB3I 1GY7A 1YVSA 1I0XA 1SIIA 4LYLB 4R9KA 4N6NB 1KWIA 1DE3A 3X3XA 2JDIH 3NQZA 5STDA 1GMPA 1B21A 4GB5A 1MOLA 1SARA 1OHOA 1V57A 1CYVA 5ELUA 3UL5A 3EN8A 3JVCA 1V58A 3VF1A 1UUWB 1VQ83 5AEWB 4U13A 4WWUC 1EG9B 3PXMA 4BL3A 1IQ8A 2Z76A 1Q40B 4ILFA 4MMYB 3FG4A 1BU4A 1Q9EA 2WO0A 5AIFA 5D83A 1JZDA 2YFLB 3B4OA 3LH4A 3DM8A 3L0RA 4H61A 5FW5A 1C54A 3X3YA 1A2PA 2CWTA 4FMCA 5AYRB 1YJW3 5EEOA 3G713 5AIIA 2LYXA 2QGUA 3D5IA 1I3IA 2CKFB 1IVWA 1KSIA 1VQ93 1IV9A 4LZIA 1RNBA 3HK4A 3H3HA 1YNVX 2IY2A 4LEHA 2BIRA 4KFEA 3DGYA 1IT8A 1VQK3 4K1VA 1YIT3 3G0KA 1V74A 1MWTA 1FUSA 1QAKA 3J7Yd 3H51A 1QJGA 1YGWA 1ZS7A 4XB5A 1NDOB 2CX0A 1EA2A 1SPUA 1SQWA 1B2MA 1LOVA 5EVHA 3FG1A 1RGCA 1SJWA 1BNJA 4TX4A 1OH0A 1K8A4 4K1UA 2W03A 2KCDA 1BIRA 2ZA4A 2HMOB 3BNEA 3HIIA 4HOHA 2BO9B 3NBBA 2XR8B 1RKYA 3CNMA 1RRHA 1VQN3 1RJOA 4R9LA 3I563 1BNRA 1ZGXA 3AGOA 1BRNL 1O7MB 1BNSA 1PY3A 2OOVC 1S5AA 3LT9A 4XDVA 3GSPA 3I0YA 5ELJA 3D4AA 4G1MB 5TGNA 4AKYA 2STDA 4ZM8A 3DUKA 3NV0A 4RNYA 5KP4A 2E2VA 1EEJA 4EC6A 3G8ZA 1WMNA 3OXAA 4AEQA 1TUHA 1F8NA 1WTHA 4L7KA 1E3VA 1GOUA 1RN1A 1LQGC 3M8CA 5G1KA 1YI23 1GD3A 2ML6A 1E97A 1I2FA 2W6JH 3BNBA 3KE7A 2K54A 3KIIA 1RGLA 1FA3A 3G4S3 2F99A 3ER7A 2CG0A 2OTJ3 1Q40A 2KAAA 1GMRA 1BSEA 5EQLA 3S67A 1YVBI 2WGQA 2ZHXB 1B2ZA 4CDLA 3N9HA 1X1UA 3OWUA 2CFDA 4WP5A 1W6CA 4EBGA 8CHOA 3T8UA 1RSNA 2HMJB 2Z77A 5LC7A 2W04A 5RNTA 4I5QA 1JBRA 1YIJ3 1UCKA 1BRSA 2UGIA 5CF2A 2CK3H 2OQEA 1RCLA 1ZX2A 4EW5A 3CCL3 4LMIA 5IF6A 1I3FA 2O9UX 4JF8A 3SXXA 4L8PA 1FGOA 1STFI 2BU4A 2FNQA 3NQYA 5HGRA 5A0OB 2P38A 4GL6A 1L5GB 2MC8A 1US1A 1D6YA 2RCDA 1B27A 4RNTA 3EBYA 3WMDA 1Q7Y4 1TJDA 4O3VA 3CMA3 1RGHA 2QA43 2W9PA 4PEJA 3UL6A 1A2KA 1UI8A 4KFFA 3EHCA 3LTCA 4HKVB 1B20A 1RN7A 2CFLA 5JPPA 1BUJA 3AGNA 3EN1B 3FH1A 1Q7HA 1IVXA 2QIYA 4WHAA 5HOHA 1NO3A 2F56A 1O7GB 4X2OA 3ROBA 2OOVA 1I70A 1D6ZA 1TP6A 5D82A 4HM4B 1VQ53 4XBYA 1LXEA 1BAOA 1IT7A 4J5KA 1FZUA 3F14A 3HOHA 1FGRA 1D6UA 4MJDA 1BRGA 3D9RA 1M904 3EC9A 4IPBA 3A5EA 1T5YA 1IK3A 2R41A 2GSPA 3CU3A 8RNTA 1Y4KA 4FCZA 1YHQ3 3MG1A 1GY6A 1QVG2 5IG3A 4J5GA 3CPW2 1WNHA 5DRVA 4R1KA 1BGSA 3NV0B 1OHPA 2RNTA 3F9SA 1O7WB 3GZXB 3EQQB 5IERA 2OTL3 4HM5B 2K3DA 4IIAA 1CH0A 3OWSA 4XM4A 3F8HA 2W56A 5BIRA 3LTDA 1QALA 1KC84 3Q90A
chains in the Genus database with same CATH topology
2K3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3D A; 
#chains in the Genus database with same CATH topology
 3HI7 A;  3CCS 3;  1N5H A;  4GHO A;  1IYY A;  4J8T A;  1W5Z A;  3HZP A;  2W0Q A;  3IPT A;  3LTB A;  3K0Z A;  4N6U A;  3S28 A;  1TIJ A;  1DMM A;  1JV2 B;  1YGE A;  4N6O B;  3S5C A;  3S27 A;  2Y73 A;  1RNT A;  2B1X B;  1NJI 4;  2SAR A;  2A15 A;  4BTX A;  1VQL 3;  3RNT A;  1MWS A;  4CCV A;  4NHF A;  1IQY A;  2IYJ A;  4GSP A;  1Q42 A;  1MWU A;  1FGQ A;  4JRF A;  5CF1 A;  3BB9 A;  5GSP A;  3NM7 A;  1U5O A;  4MMZ B;  5KP3 A;  3MWZ A;  3CC4 3;  1R4Y A;  2D42 A;  2YX9 A;  1GYB A;  2CC3 A;  2Z6B A;  3OX9 A;  1JBS A;  3G16 A;  1KQS 2;  7GSP A;  2IUJ A;  1GOV A;  1EKM A;  3CD6 3;  4WYK B;  1W6Y A;  2RGQ A;  3MYT A;  1B3S A;  1UW1 A;  3Q3F A;  3PGB A;  2RFR A;  2KF5 A;  3X42 A;  2CH9 A;  4HM8 B;  2P05 A;  1BRK A;  3LYG A;  4MEI A;  5AIH A;  3WA3 A;  1K28 A;  2RSX A;  3FZW A;  3CC7 3;  1BOX A;  2GBX B;  1OF5 A;  5IEN A;  2CW9 A;  1W02 A;  3DMC A;  3UNL A;  4HYZ A;  4OK0 A;  1GSP A;  1I0V A;  3O8Y A;  3WOF B;  1FW7 A;  4FMB A;  4IT7 A;  5KP1 A;  1ASK A;  2GEX A;  2CHC A;  2HMM B;  2CFK A;  3N54 B;  3V92 A;  2E2T A;  3EJV A;  3V99 A;  1BRI A;  1BSC A;  3MSO A;  3NBR A;  3F8X A;  1DYU A;  1UDI I;  3A76 A;  3GZY B;  3SX1 A;  1NNV A;  1OUN A;  4XBT A;  5BXQ A;  1K41 A;  3IJE B;  4HJL B;  1N5P A;  1G02 A;  2CIU A;  3DGO A;  3UJM A;  3Q2P A;  1JBT A;  1WQL B;  1O7H B;  3Q1C A;  4XDW A;  1RHL A;  3B4P A;  3PCS A;  1DET A;  3GZB A;  4HM7 B;  1WMO A;  1BNI A;  1T2I A;  1MWR A;  3D3L A;  3U97 A;  3NHX A;  1AV4 A;  1RGA A;  2F98 A;  1GS3 A;  1UGI A;  2GU1 A;  1ISK A;  7RNT A;  1YJN 3;  2XSO B;  4N6M A;  4BL2 A;  1BSB A;  3HX8 A;  1ROA A;  4RZM A;  1HZ1 A;  2IUK A;  1W7C A;  1I2E A;  1EQK A;  3T0U A;  3AHS A;  4EV2 A;  1BNF A;  3STD A;  1LOW A;  2Y74 A;  4HM6 B;  2HMK B;  3DGN A;  1BRH A;  2XRX B;  1O7N B;  1PFP A;  4N6L A;  1N8Q A;  3FF0 A;  2L4V A;  2JQ5 A;  4O2H A;  3WOE B;  2QEX 3;  2CX1 A;  3F40 A;  3PS8 A;  6STD A;  3X41 A;  3I55 3;  3B8L A;  2OCT A;  4QWT A;  3KSE D;  2GEY A;  1QVF 2;  1TFK A;  3ZG5 A;  2GXF A;  4K90 B;  1JKG A;  2AAE A;  2XF3 A;  4J9A A;  3ZFZ A;  5G1L A;  1ULI B;  4HBR A;  5LC6 A;  1N9J A;  3TDG A;  3CCJ 3;  3CNX A;  3FG3 A;  2UUG C;  5IW9 A;  1LNH A;  4I4K A;  3PCR A;  2PNC A;  2XGN A;  1W6G A;  5BU4 A;  2HML B;  2L1S A;  1IVU A;  1CQS A;  3WA2 X;  3LML A;  3PYJ A;  3F7X A;  1OCV A;  1B2X A;  3MHE A;  1TRQ A;  5D81 A;  3AMO A;  2M7O A;  5IG0 A;  1K9M 4;  3IMA B;  3LT8 A;  3E99 A;  1N9E A;  3SLU A;  4R80 A;  1UCL A;  1ULJ B;  3NXJ A;  2C10 A;  6GSP A;  2B24 B;  2F4Y A;  2P0X A;  9RNT A;  3OW2 2;  3VGN A;  1BRJ A;  2WOF A;  1JJ2 2;  1T3B A;  2YFI B;  2H0G A;  5CK6 A;  5AYS C;  3JUO A;  2R4I A;  1OAC A;  3ECF A;  1A2V A;  4LSO A;  1X1W A;  2CWV A;  3KSP A;  1RCK A;  4FMD A;  2RBI A;  4HM0 B;  1CYU A;  5IEP A;  5IEO A;  4HM1 B;  3K63 A;  4N3V A;  3WDG B;  2C4B A;  5M18 A;  1VQO 3;  1IU7 A;  1FUW A;  1VQM 3;  1DVD A;  1HKX A;  2J8X B;  3QK9 A;  1STD A;  3WHO A;  1GMQ A;  2XFS A;  1BSA A;  1Q81 4;  3SYU A;  4O8S A;  2BNG A;  4FR9 A;  1OF5 B;  3V98 A;  1NWW A;  3EB8 A;  4HZB B;  4AKZ A;  1LNI A;  3K9M C;  1BNE A;  3QRD A;  2W56 B;  6RNT A;  3MPH A;  1W4N A;  1JN5 A;  2GBW B;  3FGY A;  2YFJ B;  3UB1 A;  1B2S A;  7STD A;  1VQ7 3;  2K0M A;  3X3Z A;  1I8V A;  2XGL A;  1W00 A;  3CCU 3;  1EUI C;  2Z7A A;  1AR0 A;  1BSD A;  3CME 3;  3NBJ A;  1BNG A;  1ZO2 A;  1AQZ A;  3DH2 A;  4LGQ A;  2WOH A;  3X40 A;  1T2H A;  3FSD A;  1GOY A;  1U8C B;  3OV4 A;  4OUQ A;  3AHW A;  3JUP A;  3MKI A;  5AEU B;  1JKG B;  2I9W A;  1IVV A;  4CJN A;  3NX0 A;  1RGE A;  1BUQ A;  1OGX A;  2XEP A;  1FYS A;  3KFQ C;  3KZT A;  2CG1 A;  2H0I A;  3RGA A;  1E3R A;  3PZW A;  4BTY A;  1LQM B;  3KN4 A;  1UUG B;  3SOA A;  5FGO A;  1FUT A;  3JUQ A;  1RGG A;  1AVK A;  1RRL A;  3MG3 A;  3DZL A;  3CCM 3;  1Z1S A;  3GWR A;  4RBN A;  4KZ1 A;  1IDP A;  2BMO B;  2CWU A;  2GU3 A;  2C11 A;  3EF8 A;  2W2C A;  1Q86 4;  1RN4 A;  1MNL A;  3BU4 A;  4MMX B;  2KXG A;  1VQ4 3;  1FGM A;  1AVL A;  2LQV A;  3SED A;  1TFO A;  1W01 A;  1Q82 4;  1IQX A;  2KF6 A;  3FCS B;  4HZ9 B;  3NM2 A;  3OWY A;  1DMN A;  1G0T A;  2ZL8 A;  4KT3 B;  3CPO A;  2INX A;  5IG5 A;  2ZDJ A;  4FCM A;  1S72 3;  3GZR A;  3KKG A;  1W2B 2;  4DKI A;  2CFG A;  1TRP A;  2H0H A;  1UUV B;  2KF3 A;  4WYK A;  3CCR 3;  1VQP 3;  1VQ6 3;  4NRE A;  4BU4 A;  1JNQ A;  2BHM A;  4WFO A;  1TU5 A;  5M1A A;  3DGM A;  1A90 A;  4BTW A;  1B2U A;  1DVC A;  3BNC A;  2FGT A;  1A67 A;  5AI1 A;  1FGT A;  4OVM A;  1LOX A;  1UCI A;  2XH9 A;  4BIR A;  4HAA A;  3HIG A;  2BMQ B;  2HMN B;  1RLS A;  1LVN A;  1VQQ A;  4L8O A;  4O02 B;  1YJ9 3;  1N8R 4;  2F5M A;  1G96 A;  3D79 A;  1R4C A;  2OQE C;  4HM3 B;  1SIH A;  1JRQ A;  1RGF A;  1MGW A;  1X1X A;  2V1L A;  3LOY A;  3LZA A;  5CLK A;  1J2B A;  2PZV A;  2Q07 A;  3U1W A;  3RGR A;  5CXO A;  2IMJ A;  3CXC 2;  3WOD G;  1HU9 A;  2XSH B;  4ORL A;  1RDS A;  3ALA A;  5AIG A;  1RGK A;  2FXT A;  4KFD A;  3DXO A;  2MF7 A;  1UCJ A;  3DY5 A;  2F5W A;  5M19 A;  3NUV A;  3N8B A;  1KD1 4;  3S29 A;  1NB5 I;  2BT3 A;  3F7S A;  3VSY A;  1OPY A;  1JB5 A;  4FMA A;  2AAD A;  2D1W A;  4HVN A;  3URP A;  2P09 A;  3SVA A;  1QAF A;  1JZO A;  4N6V 0;  5I97 A;  4EXR A;  1M9G A;  1ROV A;  4H3U A;  3FKA A;  3BND A;  5JBS A;  4N6T A;  2SBL A;  2UX0 A;  2BMR B;  3RDE A;  3MG2 A;  1X1Y A;  1M1K 4;  1JB4 A;  3K5T A;  1GY5 A;  1O7P B;  4RNZ A;  2CFW A;  4XBX A;  4CPK A;  1PYL A;  3CCQ 3;  1DMQ A;  2HOH A;  3CC2 3;  1TTO A;  1RMS A;  1RTU A;  3BIR A;  3B7C A;  2ML5 A;  3KCH A;  5JPU A;  1IV7 A;  2P0M A;  3JUM A;  1LOY A;  3ZG0 A;  1C7H A;  2W9Q A;  1K73 4;  2E2U A;  3EBT A;  3LTA A;  1QMA A;  1LRA A;  4KVH A;  2F86 B;  1M1X B;  2XFT A;  1BVI A;  4HM2 B;  2OWP A;  2KRT A;  3GRD A;  1JB2 A;  2IA7 A;  3AMO B;  1JN5 B;  3GAX A;  4STD A;  1MGR A;  2WGO A;  3CCV 3;  1UGH I;  1UI7 A;  4Q53 A;  1WMP A;  1W2Z A;  4EYC A;  3BLZ A;  4EV5 A;  1PU4 A;  2KF4 A;  1OHS A;  1HYF A;  3LXU X;  3D5G A;  3WR2 A;  3SOY A;  3CCE 3;  3EX9 A;  1GD4 A;  3FLJ A;  4K61 A;  1OGZ A;  4FCJ A;  4R4K A;  3JUN A;  5DRE A;  5BVB A;  3DGL A;  1CEW I;  1VZZ A;  1BAN A;  1NU3 A;  3K7C A;  3FF2 A;  5G2G A;  1I2G A;  4NPB A;  3EE1 A;  4X2H A;  2O3O A;  5IG4 A;  1AY7 A;  3T8N A;  3G6E 3;  1NB3 I;  1GY7 A;  1YVS A;  1I0X A;  1SII A;  4LYL B;  4R9K A;  4N6N B;  1KWI A;  1DE3 A;  3X3X A;  2JDI H;  3NQZ A;  5STD A;  1GMP A;  1B21 A;  4GB5 A;  1MOL A;  1SAR A;  1OHO A;  1V57 A;  1CYV A;  5ELU A;  3UL5 A;  3EN8 A;  3JVC A;  1V58 A;  3VF1 A;  1UUW B;  1VQ8 3;  5AEW B;  4U13 A;  4WWU C;  1EG9 B;  3PXM A;  4BL3 A;  1IQ8 A;  2Z76 A;  1Q40 B;  4ILF A;  4MMY B;  3FG4 A;  1BU4 A;  1Q9E A;  2WO0 A;  5AIF A;  5D83 A;  1JZD A;  2YFL B;  3B4O A;  3LH4 A;  3DM8 A;  3L0R A;  4H61 A;  5FW5 A;  1C54 A;  3X3Y A;  1A2P A;  2CWT A;  4FMC A;  5AYR B;  1YJW 3;  5EEO A;  3G71 3;  5AII A;  2LYX A;  2QGU A;  3D5I A;  1I3I A;  2CKF B;  1IVW A;  1KSI A;  1VQ9 3;  1IV9 A;  4LZI A;  1RNB A;  3HK4 A;  3H3H A;  1YNV X;  2IY2 A;  4LEH A;  2BIR A;  4KFE A;  3DGY A;  1IT8 A;  1VQK 3;  4K1V A;  1YIT 3;  3G0K A;  1V74 A;  1MWT A;  1FUS A;  1QAK A;  3J7Y d;  3H51 A;  1QJG A;  1YGW A;  1ZS7 A;  4XB5 A;  1NDO B;  2CX0 A;  1EA2 A;  1SPU A;  1SQW A;  1B2M A;  1LOV A;  5EVH A;  3FG1 A;  1RGC A;  1SJW A;  1BNJ A;  4TX4 A;  1OH0 A;  1K8A 4;  4K1U A;  2W03 A;  2KCD A;  1BIR A;  2ZA4 A;  2HMO B;  3BNE A;  3HII A;  4HOH A;  2BO9 B;  3NBB A;  2XR8 B;  1RKY A;  3CNM A;  1RRH A;  1VQN 3;  1RJO A;  4R9L A;  3I56 3;  1BNR A;  1ZGX A;  3AGO A;  1BRN L;  1O7M B;  1BNS A;  1PY3 A;  2OOV C;  1S5A A;  3LT9 A;  4XDV A;  3GSP A;  3I0Y A;  5ELJ A;  3D4A A;  4G1M B;  5TGN A;  4AKY A;  2STD A;  4ZM8 A;  3DUK A;  3NV0 A;  4RNY A;  5KP4 A;  2E2V A;  1EEJ A;  4EC6 A;  3G8Z A;  1WMN A;  3OXA A;  4AEQ A;  1TUH A;  1F8N A;  1WTH A;  4L7K A;  1E3V A;  1GOU A;  1RN1 A;  1LQG C;  3M8C A;  5G1K A;  1YI2 3;  1GD3 A;  2ML6 A;  1E97 A;  1I2F A;  2W6J H;  3BNB A;  3KE7 A;  2K54 A;  3KII A;  1RGL A;  1FA3 A;  3G4S 3;  2F99 A;  3ER7 A;  2CG0 A;  2OTJ 3;  1Q40 A;  2KAA A;  1GMR A;  1BSE A;  5EQL A;  3S67 A;  1YVB I;  2WGQ A;  2ZHX B;  1B2Z A;  4CDL A;  3N9H A;  1X1U A;  3OWU A;  2CFD A;  4WP5 A;  1W6C A;  4EBG A;  8CHO A;  3T8U A;  1RSN A;  2HMJ B;  2Z77 A;  5LC7 A;  2W04 A;  5RNT A;  4I5Q A;  1JBR A;  1YIJ 3;  1UCK A;  1BRS A;  2UGI A;  5CF2 A;  2CK3 H;  2OQE A;  1RCL A;  1ZX2 A;  4EW5 A;  3CCL 3;  4LMI A;  5IF6 A;  1I3F A;  2O9U X;  4JF8 A;  3SXX A;  4L8P A;  1FGO A;  1STF I;  2BU4 A;  2FNQ A;  3NQY A;  5HGR A;  5A0O B;  2P38 A;  4GL6 A;  1L5G B;  2MC8 A;  1US1 A;  1D6Y A;  2RCD A;  1B27 A;  4RNT A;  3EBY A;  3WMD A;  1Q7Y 4;  1TJD A;  4O3V A;  3CMA 3;  1RGH A;  2QA4 3;  2W9P A;  4PEJ A;  3UL6 A;  1A2K A;  1UI8 A;  4KFF A;  3EHC A;  3LTC A;  4HKV B;  1B20 A;  1RN7 A;  2CFL A;  5JPP A;  1BUJ A;  3AGN A;  3EN1 B;  3FH1 A;  1Q7H A;  1IVX A;  2QIY A;  4WHA A;  5HOH A;  1NO3 A;  2F56 A;  1O7G B;  4X2O A;  3ROB A;  2OOV A;  1I70 A;  1D6Z A;  1TP6 A;  5D82 A;  4HM4 B;  1VQ5 3;  4XBY A;  1LXE A;  1BAO A;  1IT7 A;  4J5K A;  1FZU A;  3F14 A;  3HOH A;  1FGR A;  1D6U A;  4MJD A;  1BRG A;  3D9R A;  1M90 4;  3EC9 A;  4IPB A;  3A5E A;  1T5Y A;  1IK3 A;  2R41 A;  2GSP A;  3CU3 A;  8RNT A;  1Y4K A;  4FCZ A;  1YHQ 3;  3MG1 A;  1GY6 A;  1QVG 2;  5IG3 A;  4J5G A;  3CPW 2;  1WNH A;  5DRV A;  4R1K A;  1BGS A;  3NV0 B;  1OHP A;  2RNT A;  3F9S A;  1O7W B;  3GZX B;  3EQQ B;  5IER A;  2OTL 3;  4HM5 B;  2K3D A;  4IIA A;  1CH0 A;  3OWS A;  4XM4 A;  3F8H A;  2W56 A;  5BIR A;  3LTD A;  1QAL A;  1KC8 4;  3Q90 A; 
#chains in the Genus database with same CATH homology
 2K3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...