2K3SA

Haddock-derived structure of the ch-domain of the smoothelin-like 1 complexed with the c-domain of apocalmodulin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
GPLGSKNMLLEWCRAMTRNYEHVDIQNFSSSWSSGMAFCALIHKFFPEAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Smoothelin-like protein 1
publication title Solution structure of the calponin homology (CH) domain from the smoothelin-like 1 protein: a unique apocalmodulin-binding mode and the possible role of the C-terminal type-2 CH-domain in smooth muscle relaxation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.10 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Calponin-like domain 2k3sA01
1AA2A 5BVRA 2R0OA 3JARM 3KMWB 5A38A 3KMUB 5J8EA 4TXIA 1DXXA 2VZGB 3HORA 3JAKM 1PXYA 2D87A 3HOPA 1BKRA 2WA6A 2WA5A 3REPB 2EE7A 2L3GA 4Q59A 2D88A 2QJZA 3FERA 2D89A 1AOAA 1V5KA 2VZIB 1MB8A 2EYIA 1VKAA 2EYNA 2R8UA 3F7PA 3JALM 1SH6A 4TXKA 2WFNA 2D86A 1WYQA 1WYNA 3CO1A 1UJOA 2WA7A 3I6XA 2D85A 1UEGA 1WYLA 1QAGA 1P2XA 5L0OA 1PA7A 1TJTA 4EDNA 1SH5A 2DK9A 2K3SA 4EDLA 4EDMA 1WYPA 1WYRA 1WJOA 1WKUA 2K2RA 2E9KA 5A4BA 4Q58A 1WYOA 3HOCA 5A36A 2VZDA 1P5SA 2JV9A 1BHDA 1WIXA 2VZCA 1WYMA 4Q57B 2RR8A 2YRNA 1H67A 2QJXA 5A37A 1RT8A 3KY9A 4B7LA
chains in the Genus database with same CATH superfamily
1AA2A 5BVRA 2R0OA 2VE7A 3JARM 3KMWB 5A38A 3KMUB 2WE6A 4TXIA 1DXXA 2VZGB 5J8EA 3HORA 3JAKM 1PXYA 2D87A 3HOPA 1BKRA 2WA6A 2WA5A 3REPB 2EE7A 2L3GA 4Q59A 2D88A 2QJZA 3FERA 2D89A 1AOAA 1V5KA 2VZIB 2EQOA 1MB8A 2EYIA 1VKAA 2EYNA 2R8UA 3JALM 3F7PA 2IGPA 1SH6A 4LVRA 4TXKA 2WFNA 2D86A 1WYQA 1EUVA 1WYNA 3EAYA 3CO1A 1UJOA 5FMUA 2WA7A 3I6XA 2D85A 1UEGA 2VE7C 1WYLA 1QAGA 1P2XA 5L0OA 1PA7A 4LVPA 1TJTA 5FMTA 4EDNA 1SH5A 2DK9A 2K3SA 4EDLA 3VP7A 4EDMA 1WYPA 1WYRA 1WJOA 1WKUA 2K2RA 2E9KA 5A4BA 4DDPA 4Q58A 1WYOA 2HL9A 3HOCA 5A36A 2VZDA 1P5SA 2JV9A 1BHDA 2HL8A 1WIXA 2VZCA 1WYMA 4Q57B 2WDTA 2RR8A 2YRNA 1H67A 2QJXA 5A37A 2HKPA 1RT8A 3KY9A 4B7LA
chains in the Genus database with same CATH topology
1AA2A 5BVRA 2R0OA 3JARM 3KMWB 5A38A 3KMUB 5J8EA 4TXIA 1DXXA 2VZGB 3HORA 3JAKM 1PXYA 2D87A 3HOPA 1BKRA 2WA6A 2WA5A 3REPB 2EE7A 2L3GA 4Q59A 2D88A 2QJZA 3FERA 2D89A 1AOAA 1V5KA 2VZIB 1MB8A 2EYIA 1VKAA 2EYNA 2R8UA 3F7PA 3JALM 1SH6A 4TXKA 2WFNA 2D86A 1WYQA 1WYNA 3CO1A 1UJOA 2WA7A 3I6XA 2D85A 1UEGA 1WYLA 1QAGA 1P2XA 5L0OA 1PA7A 1TJTA 4EDNA 1SH5A 2DK9A 2K3SA 4EDLA 4EDMA 1WYPA 1WYRA 1WJOA 1WKUA 2K2RA 2E9KA 5A4BA 4Q58A 1WYOA 3HOCA 5A36A 2VZDA 1P5SA 2JV9A 1BHDA 1WIXA 2VZCA 1WYMA 4Q57B 2RR8A 2YRNA 1H67A 2QJXA 5A37A 1RT8A 3KY9A 4B7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AA2 A;  5BVR A;  2R0O A;  3JAR M;  3KMW B;  5A38 A;  3KMU B;  5J8E A;  4TXI A;  1DXX A;  2VZG B;  3HOR A;  3JAK M;  1PXY A;  2D87 A;  3HOP A;  1BKR A;  2WA6 A;  2WA5 A;  3REP B;  2EE7 A;  2L3G A;  4Q59 A;  2D88 A;  2QJZ A;  3FER A;  2D89 A;  1AOA A;  1V5K A;  2VZI B;  1MB8 A;  2EYI A;  1VKA A;  2EYN A;  2R8U A;  3F7P A;  3JAL M;  1SH6 A;  4TXK A;  2WFN A;  2D86 A;  1WYQ A;  1WYN A;  3CO1 A;  1UJO A;  2WA7 A;  3I6X A;  2D85 A;  1UEG A;  1WYL A;  1QAG A;  1P2X A;  5L0O A;  1PA7 A;  1TJT A;  4EDN A;  1SH5 A;  2DK9 A;  2K3S A;  4EDL A;  4EDM A;  1WYP A;  1WYR A;  1WJO A;  1WKU A;  2K2R A;  2E9K A;  5A4B A;  4Q58 A;  1WYO A;  3HOC A;  5A36 A;  2VZD A;  1P5S A;  2JV9 A;  1BHD A;  1WIX A;  2VZC A;  1WYM A;  4Q57 B;  2RR8 A;  2YRN A;  1H67 A;  2QJX A;  5A37 A;  1RT8 A;  3KY9 A;  4B7L A; 
#chains in the Genus database with same CATH topology
 1AA2 A;  5BVR A;  2R0O A;  2VE7 A;  3JAR M;  3KMW B;  5A38 A;  3KMU B;  2WE6 A;  4TXI A;  1DXX A;  2VZG B;  5J8E A;  3HOR A;  3JAK M;  1PXY A;  2D87 A;  3HOP A;  1BKR A;  2WA6 A;  2WA5 A;  3REP B;  2EE7 A;  2L3G A;  4Q59 A;  2D88 A;  2QJZ A;  3FER A;  2D89 A;  1AOA A;  1V5K A;  2VZI B;  2EQO A;  1MB8 A;  2EYI A;  1VKA A;  2EYN A;  2R8U A;  3JAL M;  3F7P A;  2IGP A;  1SH6 A;  4LVR A;  4TXK A;  2WFN A;  2D86 A;  1WYQ A;  1EUV A;  1WYN A;  3EAY A;  3CO1 A;  1UJO A;  5FMU A;  2WA7 A;  3I6X A;  2D85 A;  1UEG A;  2VE7 C;  1WYL A;  1QAG A;  1P2X A;  5L0O A;  1PA7 A;  4LVP A;  1TJT A;  5FMT A;  4EDN A;  1SH5 A;  2DK9 A;  2K3S A;  4EDL A;  3VP7 A;  4EDM A;  1WYP A;  1WYR A;  1WJO A;  1WKU A;  2K2R A;  2E9K A;  5A4B A;  4DDP A;  4Q58 A;  1WYO A;  2HL9 A;  3HOC A;  5A36 A;  2VZD A;  1P5S A;  2JV9 A;  1BHD A;  2HL8 A;  1WIX A;  2VZC A;  1WYM A;  4Q57 B;  2WDT A;  2RR8 A;  2YRN A;  1H67 A;  2QJX A;  5A37 A;  2HKP A;  1RT8 A;  3KY9 A;  4B7L A; 
#chains in the Genus database with same CATH homology
 1AA2 A;  5BVR A;  2R0O A;  3JAR M;  3KMW B;  5A38 A;  3KMU B;  5J8E A;  4TXI A;  1DXX A;  2VZG B;  3HOR A;  3JAK M;  1PXY A;  2D87 A;  3HOP A;  1BKR A;  2WA6 A;  2WA5 A;  3REP B;  2EE7 A;  2L3G A;  4Q59 A;  2D88 A;  2QJZ A;  3FER A;  2D89 A;  1AOA A;  1V5K A;  2VZI B;  1MB8 A;  2EYI A;  1VKA A;  2EYN A;  2R8U A;  3F7P A;  3JAL M;  1SH6 A;  4TXK A;  2WFN A;  2D86 A;  1WYQ A;  1WYN A;  3CO1 A;  1UJO A;  2WA7 A;  3I6X A;  2D85 A;  1UEG A;  1WYL A;  1QAG A;  1P2X A;  5L0O A;  1PA7 A;  1TJT A;  4EDN A;  1SH5 A;  2DK9 A;  2K3S A;  4EDL A;  4EDM A;  1WYP A;  1WYR A;  1WJO A;  1WKU A;  2K2R A;  2E9K A;  5A4B A;  4Q58 A;  1WYO A;  3HOC A;  5A36 A;  2VZD A;  1P5S A;  2JV9 A;  1BHD A;  1WIX A;  2VZC A;  1WYM A;  4Q57 B;  2RR8 A;  2YRN A;  1H67 A;  2QJX A;  5A37 A;  1RT8 A;  3KY9 A;  4B7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...