2K3WA

Nmr structure of vps4a-mit-chmp6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
TSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4A
publication title Two distinct modes of ESCRT-III recognition are required for VPS4 functions in lysosomal protein targeting and HIV-1 budding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 28
structure length 73
sequence length 73
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2k3wA00
2V6XA 2JQ9A 4WZXA 3EABA 3ZT7A 4ZEYA 4P1NA 5LB7B 2XZEA 2DL1A 2V6YB 5FVKA 2WWVA 4NIQA 2RPAA 1YXRA 2WY2A 5FVLA 2LRKA 4U2ZA 4U31A 4U7YA 4U2YA 4CN6A 5CGMA 4CN4A 3ZT5A 3ZSTA 4IT4A 1WR0A 2MPKA 4A5XA 2K3WA 4CN1A 2CPTA 3ZT6A 1WFDA 2W2UA 4U7IA 4U33A 4U3CA 3K1SA 3ZSSA 5CJ5A 1WCRA 2LRLA 2JQKA 2CRBA 2JQHA 2V6YA 2A9UA
chains in the Genus database with same CATH superfamily
1VCSA 2LHNA 3T8OA 4HKAA 3B5MA 2B76A 1MIYA 4TV9E 2X67A 4AKLA 4X65T 4ISTA 5AQPB 5L3DB 3V5SA 2V7LA 4IE7A 5AFUL 4HFVA 3N2OA 3UU5A 4DR3T 2Q9QD 3PUZF 4X5TA 2UU9T 5JR9C 1L0VA 4QX7B 1MMNA 5LB7B 3ETVA 2XQ6A 4DR1T 5FMNA 2IHR1 4I50E 3ZPOA 1FMVA 1YKHB 2V6XA 4IDNA 2WZHA 2X9XA 1E1HB 5L3FB 3W15B 1N34T 3E0ZA 3OBVE 4TX5A 4ASKA 3F31A 4ZHQE 4JI8T 4ZOLE 3UQ4A 2NP9A 4F6RC 5HWXA 3IHRA 2BG9B 1B7TA 3PUAA 3UFGA 5JDMA 3N9LA 1FEWA 2Q9QB 1IBMT 3HKDE 4HGAA 1CHUA 3ZYMA 3MK7C 4IREA 4AXPA 1HFAA 2QVAA 4JI2T 3AA0B 3CX7B 2MYSA 1NWMX 2YDSA 5AQNB 4NUVA 2ES0A 2JRKA 1JNZA 1D1AA 4Z91A 2LSYA 3KVBA 3ZJ2A 2NTYA 3QB5K 3N2GE 2BVMA 2WP9A 2CRBA 2XAQB 4Z90A 3AEGA 4U72A 2EHOA 2XPKA 2YINA 2W00A 4AI6A 4A5XA 2DWKA 2UXCT 3H3MA 1JNRA 2JJ9A 2K24A 4LF6T 2JQ9A 2G0UA 2XM1A 1HNZT 1T8BA 1I94T 2D9DA 4B3MT 1W09A 2Y48B 3AB3B 5KMGP 2LOPA 1XDOA 3CWZB 1XZYA 5AQGB 3RC8A 2C0SA 3RRWA 2IMLA 3KV6A 4TNVA 3EUHA 5HEHA 2X0YA 3ONJA 2WMOA 2JQQA 5H6QB 2QA7A 5AQTB 4AKHA 3CK6A 1XMQT 2D0UA 5LOVE 3ABVA 1MIWA 5DABA 4Q25A 4UV9B 1QSDA 1SHZC 3BQLA 1GQEA 3K1SA 4IDPA 4UVBB 4P09A 4O4JE 4A98A 4HFDA 3GN5B 1N33T 5HEGA 3C4ZA 3CVRA 2E8IA 2BS2A 3NZQA 2V5DA 3CPZA 2X9YA 1XNRT 4HWFA 4GYRA 1HS7A 3ESLA 3F2EA 2XM2A 2X51A 3R84B 4PJJA 2WBLA 5KDMC 2L8KA 2N9DA 4KI0F 2BKNA 3UU3A 3N9QA 5LMUT 2UXDT 5ABHA 2XQ7A 3PUWF 1UUSA 2H7OA 4JBWF 2BKOA 1IAPA 2LRKA 3ETUA 2WB5A 3EAMA 4O4IE 4YY3T 4H9PC 2BG9E 3LFMA 5ETWA 4WNKA 2KMFA 4AQYT 3AE4A 2VWAA 2QYWA 2IAKA 3A7MA 3UUXB 1LVFA 2ACXA 3F57A 5CA1E 2FUPA 3FBLA 3CX8B 3HI2A 4DV6T 2VK9A 2DCFA 1M7KA 4JUYA 4EEBA 2E9XA 5ABEA 2L3LA 4CXXA 4J2CA 1U5PA 3E08A 3ZYLA 4KMCA 3TLWA 2CWOA 4IE6A 4ZZBA 2VB6A 1KK7A 4H63H 2CXFA 1OEDA 2W67A 3ZSTA 2V7MA 2HPLA 1HX1B 2VVSA 2XASB 2GK9A 4TN7B 4K0UA 1EZ3A 2VL0A 5LGNB 1XNQT 3WAKA 4GK5E 5FVLA 4U7YA 2ZLYA 3EDVA 2IIUA 3WAJA 2WU5A 3PUVF 3L3PA 2L9QA 3UTKA 4ILUA 2M67A 3V5UA 2K5BB 3ZMSB 3KBUA 4DMWA 5JR9A 5E0OA 1E2AA 4GKJT 1T7SA 1WR0A 5HEUA 5A1LA 4LMJA 5HXCA 3WI3A 4U3CA 5JDFA 1WCRA 4OX9T 4CZZB 3PDYA 3PJAJ 2C5JA 3N2KE 3ZYKA 5FYMA 3KDSE 5KXJA 2BBJA 5LJMA 4XBFB 3IA3A 4DR6T 4O2BE 2H89A 2KZ7B 4IGUA 3HR0A 2UXNB 5AQMB 2V7JA 5EK4A 2B1EA 3AE5A 3PE0A 4GYSA 2R6GF 3AAEB 2DI4A 4HFEA 5LP6E 2ZM2A 3HKCE 3SFEA 4CN4A 2V26A 4LFCT 3JAFA 2XSAA 3AVSA 4C91A 2EHOD 3LJCA 5JREA 4KP3C 2ODVA 1VCTA 1MIVA 5LCYA 4UF0B 5FY1A 2ZMAA 3KINB 3DP7A 4CN1A 4EB6E 4H9NC 5FXZA 1KNRA 3DTOA 1MNEA 3OYXA 4HEAA 4BA9A 5JVDE 5EK2A 3ONLC 5L3EB 2WDVA 4DUZT 2DLRA 1HTJF 5HXHA 1OXZA 5CFBA 2BG9C 1LVKA 4IE4A 4ZI2D 3UFEA 3AA6B 2CHOA 2W61A 3RIFA 1HCIA 3ZT7A 2JMHA 5TAOA 4GKKT 2V6YB 4KHZF 1D0ZA 5AQVB 1Z8UA 4I4TE 4COFA 2E9XC 2M6BA 2X9WA 2VVNA 5CJ5A 2KWIB 4IDOA 1OEDC 1US7B 2DWGA 1IBLT 2RPAA 3QOFA 4U31A 2MBGA 4YXDA 3OTOT 4B6XA 3SOLA 4JI6T 3KVAA 5LYJE 5FXWA 1R8IA 3EABA 3H3AA 4HFHA 2DL1A 5H6RB 1XWMA 2VURA 1VOMA 1Y01A 5LMNT 2XQAA 4OFZA 3OYZA 1J1JA 4KBMB 4B3RT 1X79A 3RIAA 4JI7T 3LBXB 3MKDA 3Q9DA 3CQXC 3A5XA 4P0AA 2V1DB 4MBQA 4U74A 4PJMA 3JC6D 5LG3A 1HG5A 2W2UA 4LF4T 3O1IA 1ZKEA 2JQHA 3M65A 5J1GA 3L39A 2Y6XA 4LMKA 2XHEB 3U3IA 5L3CB 3K3NA 5LBMA 3LK3B 4I0UA 4DV5T 3HKBE 2JIWA 5LHGB 2BBHA 3VR8A 2YK0A 3LK42 1AJ3A 1SUMB 4UIGA 1IZNB 5ABFB 4TV8E 2AXDS 1HR0T 1YW0A 4IT4A 5AQUB 4YT0A 2D0TA 4H9OC 4C90A 2J62A 5HWYA 2Y8DA 3ANWA 4MFRA 4QXCB 4BJNA 2LT3A 4DR4T 3EVYA 2XJ7A 5JDNA 3ZJ1A 3Q2MA 2A9UA 3C64A 4UXNB 5C3JA 3KBTA 4X1KE 3S4UA 5LGUB 4A56A 2N1GA 5L47A 4U7IA 3B13A 3TLSA 2BKPA 4JI5T 3JAEA 5FY0A 3AE3A 5JDQA 5JH7E 4ADZA 4X1YE 5LG4A 5IUXA 2H3RA 4YSYA 5J0ZA 4JEHB 2PTFA 3P50A 5L3GB 3J9X1 4PFPA 1WR6A 5JRCA 3PV0F 5JTGA 4TWFA 2CXDA 4IL9A 4HWCA 3RYFE 4U2YA 3H37A 2UXBT 1UURA 4MHCA 2LSGA 3MACA 1YD8G 4JV5T 3TLTA 4EV6A 4DR2T 4IE0A 2XQ5A 4K0KT 3FBZA 5J2TE 1MNDA 3AA1B 3SS1A 3DJBA 2E2AA 1FJGT 2V5CA 4FJOA 3UT5E 2A72A 1O3XA 3RF1A 5C2TA 2LSJA 4XAXB 5L3BB 2VKHA 4QXBB 3KV5A 3RLFF 3T1YT 2H88A 4LF7T 2UUAT 4UVAB 4IDZA 5HXEA 5FVKA 2CE7A 2WQYA 3VR9A 4QH1A 3IEEA 4L5GA 3MZKB 1LKXA 4YSXA 2MPKA 3AXJB 2XUEA 4ZS3A 2CPTA 4DO0A 1W9RA 3MA9A 2BG9A 3KV4A 4PW8A 4JYAT 4KX6A 3I1AA 5JDLA 2HH7A 3AE2A 4DMVA 4E7SA 2XSBA 4ZS2A 2DNXA 2WS3A 1I6ZA 4WBNE 3PU8A 2NW8A 4NUUA 4EZHA 4ZXLA 2LLYA 2MAWA 3N5LA 2UUBT 1W0BA 4OK0A 3UUBA 5CGMA 3RQUA 2VASA 3AAAB 4I43B 2FJDA 5F5WA 2C5KT 1Y64B 2CM0A 3PUGA 3RKOA 4ZEYA 5M4YA 3AE9A 1QLBA 3PUQA 2WZIA 3AAIA 2FBWA 4N78D 3L8RA 1J5WA 2X9HA 4OHFA 5HEOA 3HKEE 3VKHA 2XAJB 2HPJA 2XQ9A 2ZM0A 4TZ4C 3Q5XA 2W4XA 5J2UE 1W0AA 3NRYA 4LFAT 3MXZA 1FMWA 4P0BA 1SA0E 2WDQA 3GMIA 3VU7H 3ONXA 4EXTA 3BQIA 2YOEA 2CCQA 2ODUA 3HL6A 5CB4E 3G06A 4LF9T 2CLYB 3LG7A 3ZCJA 5JDGA 3FZFB 4IE5A 1KF6A 3C4XA 4NIQA 3RGLA 4M1PA 3X1DA 3D0TA 4LMLA 1HNXT 3RI5A 3TLVA 1WYCA 2XQ3A 4AIUA 2BDEA 2NW9A 2LEHA 4QX8B 2YKSA 4H9SE 2I6HA 2YN6A 3P7IA 3ZLIA 4YJ3E 3CX6B 1BR1A 5FL0A 2KXPB 1Z0PA 3SFDA 4H9RC 4KUMB 3GN5A 3N9OA 1V9DA 2YDRA 2W63A 3N9NA 3P4WA 4WYVA 4EZ4A 3QC9A 4ZI3D 2N2NA 3ZN1B 2XY8B 4PK6A 1WRDA 4BJMA 2KT9A 4OYKA 4ILCA 4BAYB 1N32T 5C8YE 3K3QC 4UV8B 2P9BA 3EI0A 1KEYA 2V8SV 3PU3A 2NOXA 2J4GA 2M6IA 5CA0E 5AQHB 4X1IE 3GA8A 4EIWA 3PJAA 2IC9A 3ANWB 3RYHE 3AE8A 3FZMB 2ZM6T 1UCUA 3OKQA 3RYIE 5FNVE 2LJLA 4V1Av 2XAHB 5LHHB 3AEEA 2Q9QC 1HG2A 3P8CD 3AVRA 5LGTB 4PJNA 1IJ6A 2WU2A 2LM2A 2XAGB 4O2AE 1NAFA 2K9AA 4AISA 3JC6C 3LDQB 3PURA 5L4EA 2EHOB 3ZMZB 3E22E 3PUSA 1MMAA 4CXWA 3C51A 1D0YA 2ZM8A 3Q5EA 4DV3T 4LF8T 4CN6A 3SWHA 3RIUC 1NENA 1D1BA 4HWHA 4QKNA 3O1JA 5HXSA 5L4HA 4PFOA 4DR7T 3R6NA 2KWHA 2YU2A 4JEUB 4CI1B 3A8YC 5GONE 2LKGA 3ZC1A 3KV9A 1WFDA 2QGSA 5F8PA 5FKYA 4YSZA 4DV2T 4DV4T 2LRLA 2MOZA 1KNZA 4QWNB 3JCFA 3TKLB 4TWHA 2WCAA 3P4RA 4PAGA 2AE9A 2F4VT 4QH5A 4OYJA 4DUYT 1M62A 1IBKT 4WBOA 1MMGA 2PG8A 3P4SA 3J7Yq 1NEKA 3RQWA 2X66A 2FJAA 2CHNA 1T98A 3RHWA 2E9XD 1KFYA 3C4WA 3I0QA 4JI4T 4HFBA 5KX5E 3P4QA 2PJQA 2SPCA 4O8SA 4HWIB 3UULA 4EEDA 1X9BA 5DQVA 5EK3A 1UK5A 4ISSA 4EYUA 1J5ET 3U78A 1YXRA 3OJAA 3EDUA 3LK2B 4IHJE 3Q5WA 5AQFB 1YQ3A 4B3ST 4DIDB 4DR5T 4ILBA 3AE7A 1D1CA 4UF0A 1HNWT 2UXXB 2V7IA 4XZCA 2I59A 4G2AA 3AEDA 4I55E 3AE6A 2CA5A 3NBXX 5LNKA 2HN1A 2KNDA 2NWBA 4ZZCA 2LSIA 1S35A 3ZSSA 4YTMA 3CIRA 1U4QA 2E5LT 2LHRA 3QNUA 4AQFC 4NXMT 5ADXL 4NXNT 3OPCA 3BQKA 2E9XB 3PUXF 1KNPA 2OA5A 2D5UA 1FIOA 3CQCB 2LE8A 1OEDB 4LFBT 2V6YA 5FP3A 1QUUA 5JDHA 4IL4A 4B3TT 2D2SA 4H63V 3RX6A 4HE8A 4MLKA 3FXEB 2NTXA 4GOUA 5AQKB 4L0RA 4AQGA 2IDOB 2IUBA 3UUMA 2WWUA 4CXYA 4X20E 1ZHCA 3K3OA 4CI3B 1WLXA 1HX8A 2WWVA 5HXRA 2LM9A 3EHZA 3UQ7A 3IF8B 4UELA 1G73A 5JR9B 2K3WA 4FI5A 1ZV4X 5IHYA 2VKDA 4UR9A 1H7CA 4DBQA 2WAUA 3ZT5A 5F3JA 3LBXA 1S94A 3NRXA 2WDRA 2W0GA 2XQYA 1DU2A 5EZYE 2QRXA 3FHNA 3I9YA 2XZEA 4PK5A 4JI3T 4ANJA 3IBPA 4CI2B 2CLYC 3N9MA 4GIWA 2VKOA 2LSKA 3AEAA 2XQ4A 4TNWA 2CBIA 4YHJA 4EGWA 2X0LB 2BVLA 2X68A 2WMNA 2XAFB 4KHPT 3ZKRA 3MJXA 2W66A 3CMLA 1LRZA 5ABFA 4MALA 3B57A 2I0MA 3NVOA 2VKJA 4CQIA 2Q9QA 3FZKB 3O1HA 4YJ2E 3BK9A 5AQJB 4ILAA 3AECA 4EAHA 4EOZB 5HCMA 5L2LA 3OVUA 5HEJA 3FXDB 4L9IA 4PJLA 1MMDA 3RH3A 3O9XA 2HHHT 5AQLB 2YU1A 3TLUA 3AEBA 3T1HT 4AKGA 2Z6EA 4DVDA 2W62A 3JADA 4H9QC 3ZMVB 2WY2A 1XDPA 4DNDA 5LHIB 5AQQB 2LKHA 4QH4A 5AQRB 1ZP0A 4U33A 3FZHB 2KLQA 4O4LE 3I0OA 3RIUA 4TUYE 1CUNA 1SE7A 4YHHT 1OEDE 3PTRB 1G8XA 4IDQA 2OV9A 3QB5A 2FJEA 4YTNA 4UEMA 2EHOC 3CKDA 3ZCIA 2RA1A 3ZMTB 4ZI3C 5BMVE 5FL1A 4AKRB 4A97A 2UUCT 2CMRA 2CWYA 4U2ZA 2IC6A 4AKIA 2J1DG 5LJNA 2FJBA 4PK4A 2PFVA 4HN9A 4YLHA 4WW0A 3AE1A 3NZPA 5AQIB 3VKGA 4UVCB 3P4PA 2A2FX 1ZOYA 5HCJA 4DV1T 4ZI2C 2LOSA 2CBJA 2J47A 4QXHB 4EYYR 2VQFT 5HAXA 3QK6A 5DJQC 1D0XA 5LA6E 2WSSV 4YTPA 3AA7B 3N9PA 1YQ4A 2JMKA 2C5IT 5AQSB 4HFCA 4LF5T 3NKZA 4G63A 2PBIA 4JLEA 1WYBA 3LSVA 1HF8A 2VQET 2MTQA 2CEAA 3ZMUB 3RC3A 3ZN0B 3M3ZB 4TWDA 5DQWA 3ZEFB 2K48A 5FXXA 4JI1T 1BR2A 2H7VC 2JQKA 4Z8XA 4PNIA 4WZXA 1UX4A 3CQGB 3I9WA 2X0HA 2JPFA 2A3DA 2BS4A 2KSRA 2XQ8A 3AXJA 4DV7T 5IWAT 2RP4A 4AQFA 2ACZA 4QHOA 1E7PA 4NPPA 4HFIA 5FY7A 3ZT6A 1ZEEA 5AQOB 1BR4A 3VRBA 2WM9A 3SRZA 4E7ZA 1VRBA 2NW7A 2V7KA 3ZC0A 3C98B 3HA4A 4IIJE 3AEFA 3VHLA 2HN2A 2E5VA 3RRCA 2KINB 3KFWX 2NR4A 4X64T 2DHRA 1T72A 3L09A 2BS3A 4YFSA 2YEVC 3RYCE 5LBQB 3RKGA 1UX5A 4GK0E 3UU4A 4P1NA 1UGOA 4O4HE 4DBRA 1OWAA 3FB2A 5IYZE 1YKEB 4X62T 2BZBA 4JI0T 5LXTE 3VRAA 5ABGA 3QUJA 3GWHA 2YDQA 4ERRA 5HYAA 2OLTA 3UU6A 1N36T 4HTEA 3K8PC 2CXLA 1BR0A 4DV0T 5JQGE 3UU8A 3RPUA 1XMOT 3PUYF 3UUNA 5JRCB 4X66T 5BR8T 4F8HA 2VL8A 3NWIA 4ZI7E 3O4XE 3Q5DA 2IW5B 4HWDA 3C50A 2XTLA 1IJ5A 3FZLB 5FXVA
chains in the Genus database with same CATH topology
2V6XA 2JQ9A 4WZXA 3EABA 3ZT7A 4ZEYA 4P1NA 5LB7B 2XZEA 2DL1A 2V6YB 5FVKA 2WWVA 4NIQA 2RPAA 1YXRA 2WY2A 5FVLA 2LRKA 4U2ZA 4U31A 4U7YA 4U2YA 4CN6A 5CGMA 4CN4A 3ZT5A 3ZSTA 4IT4A 1WR0A 2MPKA 4A5XA 2K3WA 4CN1A 2CPTA 3ZT6A 1WFDA 2W2UA 4U7IA 4U33A 4U3CA 3K1SA 3ZSSA 5CJ5A 1WCRA 2LRLA 2JQKA 2CRBA 2JQHA 2V6YA 2A9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6X A;  2JQ9 A;  4WZX A;  3EAB A;  3ZT7 A;  4ZEY A;  4P1N A;  5LB7 B;  2XZE A;  2DL1 A;  2V6Y B;  5FVK A;  2WWV A;  4NIQ A;  2RPA A;  1YXR A;  2WY2 A;  5FVL A;  2LRK A;  4U2Z A;  4U31 A;  4U7Y A;  4U2Y A;  4CN6 A;  5CGM A;  4CN4 A;  3ZT5 A;  3ZST A;  4IT4 A;  1WR0 A;  2MPK A;  4A5X A;  2K3W A;  4CN1 A;  2CPT A;  3ZT6 A;  1WFD A;  2W2U A;  4U7I A;  4U33 A;  4U3C A;  3K1S A;  3ZSS A;  5CJ5 A;  1WCR A;  2LRL A;  2JQK A;  2CRB A;  2JQH A;  2V6Y A;  2A9U A; 
#chains in the Genus database with same CATH topology
 1VCS A;  2LHN A;  3T8O A;  4HKA A;  3B5M A;  2B76 A;  1MIY A;  4TV9 E;  2X67 A;  4AKL A;  4X65 T;  4IST A;  5AQP B;  5L3D B;  3V5S A;  2V7L A;  4IE7 A;  5AFU L;  4HFV A;  3N2O A;  3UU5 A;  4DR3 T;  2Q9Q D;  3PUZ F;  4X5T A;  2UU9 T;  5JR9 C;  1L0V A;  4QX7 B;  1MMN A;  5LB7 B;  3ETV A;  2XQ6 A;  4DR1 T;  5FMN A;  2IHR 1;  4I50 E;  3ZPO A;  1FMV A;  1YKH B;  2V6X A;  4IDN A;  2WZH A;  2X9X A;  1E1H B;  5L3F B;  3W15 B;  1N34 T;  3E0Z A;  3OBV E;  4TX5 A;  4ASK A;  3F31 A;  4ZHQ E;  4JI8 T;  4ZOL E;  3UQ4 A;  2NP9 A;  4F6R C;  5HWX A;  3IHR A;  2BG9 B;  1B7T A;  3PUA A;  3UFG A;  5JDM A;  3N9L A;  1FEW A;  2Q9Q B;  1IBM T;  3HKD E;  4HGA A;  1CHU A;  3ZYM A;  3MK7 C;  4IRE A;  4AXP A;  1HFA A;  2QVA A;  4JI2 T;  3AA0 B;  3CX7 B;  2MYS A;  1NWM X;  2YDS A;  5AQN B;  4NUV A;  2ES0 A;  2JRK A;  1JNZ A;  1D1A A;  4Z91 A;  2LSY A;  3KVB A;  3ZJ2 A;  2NTY A;  3QB5 K;  3N2G E;  2BVM A;  2WP9 A;  2CRB A;  2XAQ B;  4Z90 A;  3AEG A;  4U72 A;  2EHO A;  2XPK A;  2YIN A;  2W00 A;  4AI6 A;  4A5X A;  2DWK A;  2UXC T;  3H3M A;  1JNR A;  2JJ9 A;  2K24 A;  4LF6 T;  2JQ9 A;  2G0U A;  2XM1 A;  1HNZ T;  1T8B A;  1I94 T;  2D9D A;  4B3M T;  1W09 A;  2Y48 B;  3AB3 B;  5KMG P;  2LOP A;  1XDO A;  3CWZ B;  1XZY A;  5AQG B;  3RC8 A;  2C0S A;  3RRW A;  2IML A;  3KV6 A;  4TNV A;  3EUH A;  5HEH A;  2X0Y A;  3ONJ A;  2WMO A;  2JQQ A;  5H6Q B;  2QA7 A;  5AQT B;  4AKH A;  3CK6 A;  1XMQ T;  2D0U A;  5LOV E;  3ABV A;  1MIW A;  5DAB A;  4Q25 A;  4UV9 B;  1QSD A;  1SHZ C;  3BQL A;  1GQE A;  3K1S A;  4IDP A;  4UVB B;  4P09 A;  4O4J E;  4A98 A;  4HFD A;  3GN5 B;  1N33 T;  5HEG A;  3C4Z A;  3CVR A;  2E8I A;  2BS2 A;  3NZQ A;  2V5D A;  3CPZ A;  2X9Y A;  1XNR T;  4HWF A;  4GYR A;  1HS7 A;  3ESL A;  3F2E A;  2XM2 A;  2X51 A;  3R84 B;  4PJJ A;  2WBL A;  5KDM C;  2L8K A;  2N9D A;  4KI0 F;  2BKN A;  3UU3 A;  3N9Q A;  5LMU T;  2UXD T;  5ABH A;  2XQ7 A;  3PUW F;  1UUS A;  2H7O A;  4JBW F;  2BKO A;  1IAP A;  2LRK A;  3ETU A;  2WB5 A;  3EAM A;  4O4I E;  4YY3 T;  4H9P C;  2BG9 E;  3LFM A;  5ETW A;  4WNK A;  2KMF A;  4AQY T;  3AE4 A;  2VWA A;  2QYW A;  2IAK A;  3A7M A;  3UUX B;  1LVF A;  2ACX A;  3F57 A;  5CA1 E;  2FUP A;  3FBL A;  3CX8 B;  3HI2 A;  4DV6 T;  2VK9 A;  2DCF A;  1M7K A;  4JUY A;  4EEB A;  2E9X A;  5ABE A;  2L3L A;  4CXX A;  4J2C A;  1U5P A;  3E08 A;  3ZYL A;  4KMC A;  3TLW A;  2CWO A;  4IE6 A;  4ZZB A;  2VB6 A;  1KK7 A;  4H63 H;  2CXF A;  1OED A;  2W67 A;  3ZST A;  2V7M A;  2HPL A;  1HX1 B;  2VVS A;  2XAS B;  2GK9 A;  4TN7 B;  4K0U A;  1EZ3 A;  2VL0 A;  5LGN B;  1XNQ T;  3WAK A;  4GK5 E;  5FVL A;  4U7Y A;  2ZLY A;  3EDV A;  2IIU A;  3WAJ A;  2WU5 A;  3PUV F;  3L3P A;  2L9Q A;  3UTK A;  4ILU A;  2M67 A;  3V5U A;  2K5B B;  3ZMS B;  3KBU A;  4DMW A;  5JR9 A;  5E0O A;  1E2A A;  4GKJ T;  1T7S A;  1WR0 A;  5HEU A;  5A1L A;  4LMJ A;  5HXC A;  3WI3 A;  4U3C A;  5JDF A;  1WCR A;  4OX9 T;  4CZZ B;  3PDY A;  3PJA J;  2C5J A;  3N2K E;  3ZYK A;  5FYM A;  3KDS E;  5KXJ A;  2BBJ A;  5LJM A;  4XBF B;  3IA3 A;  4DR6 T;  4O2B E;  2H89 A;  2KZ7 B;  4IGU A;  3HR0 A;  2UXN B;  5AQM B;  2V7J A;  5EK4 A;  2B1E A;  3AE5 A;  3PE0 A;  4GYS A;  2R6G F;  3AAE B;  2DI4 A;  4HFE A;  5LP6 E;  2ZM2 A;  3HKC E;  3SFE A;  4CN4 A;  2V26 A;  4LFC T;  3JAF A;  2XSA A;  3AVS A;  4C91 A;  2EHO D;  3LJC A;  5JRE A;  4KP3 C;  2ODV A;  1VCT A;  1MIV A;  5LCY A;  4UF0 B;  5FY1 A;  2ZMA A;  3KIN B;  3DP7 A;  4CN1 A;  4EB6 E;  4H9N C;  5FXZ A;  1KNR A;  3DTO A;  1MNE A;  3OYX A;  4HEA A;  4BA9 A;  5JVD E;  5EK2 A;  3ONL C;  5L3E B;  2WDV A;  4DUZ T;  2DLR A;  1HTJ F;  5HXH A;  1OXZ A;  5CFB A;  2BG9 C;  1LVK A;  4IE4 A;  4ZI2 D;  3UFE A;  3AA6 B;  2CHO A;  2W61 A;  3RIF A;  1HCI A;  3ZT7 A;  2JMH A;  5TAO A;  4GKK T;  2V6Y B;  4KHZ F;  1D0Z A;  5AQV B;  1Z8U A;  4I4T E;  4COF A;  2E9X C;  2M6B A;  2X9W A;  2VVN A;  5CJ5 A;  2KWI B;  4IDO A;  1OED C;  1US7 B;  2DWG A;  1IBL T;  2RPA A;  3QOF A;  4U31 A;  2MBG A;  4YXD A;  3OTO T;  4B6X A;  3SOL A;  4JI6 T;  3KVA A;  5LYJ E;  5FXW A;  1R8I A;  3EAB A;  3H3A A;  4HFH A;  2DL1 A;  5H6R B;  1XWM A;  2VUR A;  1VOM A;  1Y01 A;  5LMN T;  2XQA A;  4OFZ A;  3OYZ A;  1J1J A;  4KBM B;  4B3R T;  1X79 A;  3RIA A;  4JI7 T;  3LBX B;  3MKD A;  3Q9D A;  3CQX C;  3A5X A;  4P0A A;  2V1D B;  4MBQ A;  4U74 A;  4PJM A;  3JC6 D;  5LG3 A;  1HG5 A;  2W2U A;  4LF4 T;  3O1I A;  1ZKE A;  2JQH A;  3M65 A;  5J1G A;  3L39 A;  2Y6X A;  4LMK A;  2XHE B;  3U3I A;  5L3C B;  3K3N A;  5LBM A;  3LK3 B;  4I0U A;  4DV5 T;  3HKB E;  2JIW A;  5LHG B;  2BBH A;  3VR8 A;  2YK0 A;  3LK4 2;  1AJ3 A;  1SUM B;  4UIG A;  1IZN B;  5ABF B;  4TV8 E;  2AXD S;  1HR0 T;  1YW0 A;  4IT4 A;  5AQU B;  4YT0 A;  2D0T A;  4H9O C;  4C90 A;  2J62 A;  5HWY A;  2Y8D A;  3ANW A;  4MFR A;  4QXC B;  4BJN A;  2LT3 A;  4DR4 T;  3EVY A;  2XJ7 A;  5JDN A;  3ZJ1 A;  3Q2M A;  2A9U A;  3C64 A;  4UXN B;  5C3J A;  3KBT A;  4X1K E;  3S4U A;  5LGU B;  4A56 A;  2N1G A;  5L47 A;  4U7I A;  3B13 A;  3TLS A;  2BKP A;  4JI5 T;  3JAE A;  5FY0 A;  3AE3 A;  5JDQ A;  5JH7 E;  4ADZ A;  4X1Y E;  5LG4 A;  5IUX A;  2H3R A;  4YSY A;  5J0Z A;  4JEH B;  2PTF A;  3P50 A;  5L3G B;  3J9X 1;  4PFP A;  1WR6 A;  5JRC A;  3PV0 F;  5JTG A;  4TWF A;  2CXD A;  4IL9 A;  4HWC A;  3RYF E;  4U2Y A;  3H37 A;  2UXB T;  1UUR A;  4MHC A;  2LSG A;  3MAC A;  1YD8 G;  4JV5 T;  3TLT A;  4EV6 A;  4DR2 T;  4IE0 A;  2XQ5 A;  4K0K T;  3FBZ A;  5J2T E;  1MND A;  3AA1 B;  3SS1 A;  3DJB A;  2E2A A;  1FJG T;  2V5C A;  4FJO A;  3UT5 E;  2A72 A;  1O3X A;  3RF1 A;  5C2T A;  2LSJ A;  4XAX B;  5L3B B;  2VKH A;  4QXB B;  3KV5 A;  3RLF F;  3T1Y T;  2H88 A;  4LF7 T;  2UUA T;  4UVA B;  4IDZ A;  5HXE A;  5FVK A;  2CE7 A;  2WQY A;  3VR9 A;  4QH1 A;  3IEE A;  4L5G A;  3MZK B;  1LKX A;  4YSX A;  2MPK A;  3AXJ B;  2XUE A;  4ZS3 A;  2CPT A;  4DO0 A;  1W9R A;  3MA9 A;  2BG9 A;  3KV4 A;  4PW8 A;  4JYA T;  4KX6 A;  3I1A A;  5JDL A;  2HH7 A;  3AE2 A;  4DMV A;  4E7S A;  2XSB A;  4ZS2 A;  2DNX A;  2WS3 A;  1I6Z A;  4WBN E;  3PU8 A;  2NW8 A;  4NUU A;  4EZH A;  4ZXL A;  2LLY A;  2MAW A;  3N5L A;  2UUB T;  1W0B A;  4OK0 A;  3UUB A;  5CGM A;  3RQU A;  2VAS A;  3AAA B;  4I43 B;  2FJD A;  5F5W A;  2C5K T;  1Y64 B;  2CM0 A;  3PUG A;  3RKO A;  4ZEY A;  5M4Y A;  3AE9 A;  1QLB A;  3PUQ A;  2WZI A;  3AAI A;  2FBW A;  4N78 D;  3L8R A;  1J5W A;  2X9H A;  4OHF A;  5HEO A;  3HKE E;  3VKH A;  2XAJ B;  2HPJ A;  2XQ9 A;  2ZM0 A;  4TZ4 C;  3Q5X A;  2W4X A;  5J2U E;  1W0A A;  3NRY A;  4LFA T;  3MXZ A;  1FMW A;  4P0B A;  1SA0 E;  2WDQ A;  3GMI A;  3VU7 H;  3ONX A;  4EXT A;  3BQI A;  2YOE A;  2CCQ A;  2ODU A;  3HL6 A;  5CB4 E;  3G06 A;  4LF9 T;  2CLY B;  3LG7 A;  3ZCJ A;  5JDG A;  3FZF B;  4IE5 A;  1KF6 A;  3C4X A;  4NIQ A;  3RGL A;  4M1P A;  3X1D A;  3D0T A;  4LML A;  1HNX T;  3RI5 A;  3TLV A;  1WYC A;  2XQ3 A;  4AIU A;  2BDE A;  2NW9 A;  2LEH A;  4QX8 B;  2YKS A;  4H9S E;  2I6H A;  2YN6 A;  3P7I A;  3ZLI A;  4YJ3 E;  3CX6 B;  1BR1 A;  5FL0 A;  2KXP B;  1Z0P A;  3SFD A;  4H9R C;  4KUM B;  3GN5 A;  3N9O A;  1V9D A;  2YDR A;  2W63 A;  3N9N A;  3P4W A;  4WYV A;  4EZ4 A;  3QC9 A;  4ZI3 D;  2N2N A;  3ZN1 B;  2XY8 B;  4PK6 A;  1WRD A;  4BJM A;  2KT9 A;  4OYK A;  4ILC A;  4BAY B;  1N32 T;  5C8Y E;  3K3Q C;  4UV8 B;  2P9B A;  3EI0 A;  1KEY A;  2V8S V;  3PU3 A;  2NOX A;  2J4G A;  2M6I A;  5CA0 E;  5AQH B;  4X1I E;  3GA8 A;  4EIW A;  3PJA A;  2IC9 A;  3ANW B;  3RYH E;  3AE8 A;  3FZM B;  2ZM6 T;  1UCU A;  3OKQ A;  3RYI E;  5FNV E;  2LJL A;  4V1A v;  2XAH B;  5LHH B;  3AEE A;  2Q9Q C;  1HG2 A;  3P8C D;  3AVR A;  5LGT B;  4PJN A;  1IJ6 A;  2WU2 A;  2LM2 A;  2XAG B;  4O2A E;  1NAF A;  2K9A A;  4AIS A;  3JC6 C;  3LDQ B;  3PUR A;  5L4E A;  2EHO B;  3ZMZ B;  3E22 E;  3PUS A;  1MMA A;  4CXW A;  3C51 A;  1D0Y A;  2ZM8 A;  3Q5E A;  4DV3 T;  4LF8 T;  4CN6 A;  3SWH A;  3RIU C;  1NEN A;  1D1B A;  4HWH A;  4QKN A;  3O1J A;  5HXS A;  5L4H A;  4PFO A;  4DR7 T;  3R6N A;  2KWH A;  2YU2 A;  4JEU B;  4CI1 B;  3A8Y C;  5GON E;  2LKG A;  3ZC1 A;  3KV9 A;  1WFD A;  2QGS A;  5F8P A;  5FKY A;  4YSZ A;  4DV2 T;  4DV4 T;  2LRL A;  2MOZ A;  1KNZ A;  4QWN B;  3JCF A;  3TKL B;  4TWH A;  2WCA A;  3P4R A;  4PAG A;  2AE9 A;  2F4V T;  4QH5 A;  4OYJ A;  4DUY T;  1M62 A;  1IBK T;  4WBO A;  1MMG A;  2PG8 A;  3P4S A;  3J7Y q;  1NEK A;  3RQW A;  2X66 A;  2FJA A;  2CHN A;  1T98 A;  3RHW A;  2E9X D;  1KFY A;  3C4W A;  3I0Q A;  4JI4 T;  4HFB A;  5KX5 E;  3P4Q A;  2PJQ A;  2SPC A;  4O8S A;  4HWI B;  3UUL A;  4EED A;  1X9B A;  5DQV A;  5EK3 A;  1UK5 A;  4ISS A;  4EYU A;  1J5E T;  3U78 A;  1YXR A;  3OJA A;  3EDU A;  3LK2 B;  4IHJ E;  3Q5W A;  5AQF B;  1YQ3 A;  4B3S T;  4DID B;  4DR5 T;  4ILB A;  3AE7 A;  1D1C A;  4UF0 A;  1HNW T;  2UXX B;  2V7I A;  4XZC A;  2I59 A;  4G2A A;  3AED A;  4I55 E;  3AE6 A;  2CA5 A;  3NBX X;  5LNK A;  2HN1 A;  2KND A;  2NWB A;  4ZZC A;  2LSI A;  1S35 A;  3ZSS A;  4YTM A;  3CIR A;  1U4Q A;  2E5L T;  2LHR A;  3QNU A;  4AQF C;  4NXM T;  5ADX L;  4NXN T;  3OPC A;  3BQK A;  2E9X B;  3PUX F;  1KNP A;  2OA5 A;  2D5U A;  1FIO A;  3CQC B;  2LE8 A;  1OED B;  4LFB T;  2V6Y A;  5FP3 A;  1QUU A;  5JDH A;  4IL4 A;  4B3T T;  2D2S A;  4H63 V;  3RX6 A;  4HE8 A;  4MLK A;  3FXE B;  2NTX A;  4GOU A;  5AQK B;  4L0R A;  4AQG A;  2IDO B;  2IUB A;  3UUM A;  2WWU A;  4CXY A;  4X20 E;  1ZHC A;  3K3O A;  4CI3 B;  1WLX A;  1HX8 A;  2WWV A;  5HXR A;  2LM9 A;  3EHZ A;  3UQ7 A;  3IF8 B;  4UEL A;  1G73 A;  5JR9 B;  2K3W A;  4FI5 A;  1ZV4 X;  5IHY A;  2VKD A;  4UR9 A;  1H7C A;  4DBQ A;  2WAU A;  3ZT5 A;  5F3J A;  3LBX A;  1S94 A;  3NRX A;  2WDR A;  2W0G A;  2XQY A;  1DU2 A;  5EZY E;  2QRX A;  3FHN A;  3I9Y A;  2XZE A;  4PK5 A;  4JI3 T;  4ANJ A;  3IBP A;  4CI2 B;  2CLY C;  3N9M A;  4GIW A;  2VKO A;  2LSK A;  3AEA A;  2XQ4 A;  4TNW A;  2CBI A;  4YHJ A;  4EGW A;  2X0L B;  2BVL A;  2X68 A;  2WMN A;  2XAF B;  4KHP T;  3ZKR A;  3MJX A;  2W66 A;  3CML A;  1LRZ A;  5ABF A;  4MAL A;  3B57 A;  2I0M A;  3NVO A;  2VKJ A;  4CQI A;  2Q9Q A;  3FZK B;  3O1H A;  4YJ2 E;  3BK9 A;  5AQJ B;  4ILA A;  3AEC A;  4EAH A;  4EOZ B;  5HCM A;  5L2L A;  3OVU A;  5HEJ A;  3FXD B;  4L9I A;  4PJL A;  1MMD A;  3RH3 A;  3O9X A;  2HHH T;  5AQL B;  2YU1 A;  3TLU A;  3AEB A;  3T1H T;  4AKG A;  2Z6E A;  4DVD A;  2W62 A;  3JAD A;  4H9Q C;  3ZMV B;  2WY2 A;  1XDP A;  4DND A;  5LHI B;  5AQQ B;  2LKH A;  4QH4 A;  5AQR B;  1ZP0 A;  4U33 A;  3FZH B;  2KLQ A;  4O4L E;  3I0O A;  3RIU A;  4TUY E;  1CUN A;  1SE7 A;  4YHH T;  1OED E;  3PTR B;  1G8X A;  4IDQ A;  2OV9 A;  3QB5 A;  2FJE A;  4YTN A;  4UEM A;  2EHO C;  3CKD A;  3ZCI A;  2RA1 A;  3ZMT B;  4ZI3 C;  5BMV E;  5FL1 A;  4AKR B;  4A97 A;  2UUC T;  2CMR A;  2CWY A;  4U2Z A;  2IC6 A;  4AKI A;  2J1D G;  5LJN A;  2FJB A;  4PK4 A;  2PFV A;  4HN9 A;  4YLH A;  4WW0 A;  3AE1 A;  3NZP A;  5AQI B;  3VKG A;  4UVC B;  3P4P A;  2A2F X;  1ZOY A;  5HCJ A;  4DV1 T;  4ZI2 C;  2LOS A;  2CBJ A;  2J47 A;  4QXH B;  4EYY R;  2VQF T;  5HAX A;  3QK6 A;  5DJQ C;  1D0X A;  5LA6 E;  2WSS V;  4YTP A;  3AA7 B;  3N9P A;  1YQ4 A;  2JMK A;  2C5I T;  5AQS B;  4HFC A;  4LF5 T;  3NKZ A;  4G63 A;  2PBI A;  4JLE A;  1WYB A;  3LSV A;  1HF8 A;  2VQE T;  2MTQ A;  2CEA A;  3ZMU B;  3RC3 A;  3ZN0 B;  3M3Z B;  4TWD A;  5DQW A;  3ZEF B;  2K48 A;  5FXX A;  4JI1 T;  1BR2 A;  2H7V C;  2JQK A;  4Z8X A;  4PNI A;  4WZX A;  1UX4 A;  3CQG B;  3I9W A;  2X0H A;  2JPF A;  2A3D A;  2BS4 A;  2KSR A;  2XQ8 A;  3AXJ A;  4DV7 T;  5IWA T;  2RP4 A;  4AQF A;  2ACZ A;  4QHO A;  1E7P A;  4NPP A;  4HFI A;  5FY7 A;  3ZT6 A;  1ZEE A;  5AQO B;  1BR4 A;  3VRB A;  2WM9 A;  3SRZ A;  4E7Z A;  1VRB A;  2NW7 A;  2V7K A;  3ZC0 A;  3C98 B;  3HA4 A;  4IIJ E;  3AEF A;  3VHL A;  2HN2 A;  2E5V A;  3RRC A;  2KIN B;  3KFW X;  2NR4 A;  4X64 T;  2DHR A;  1T72 A;  3L09 A;  2BS3 A;  4YFS A;  2YEV C;  3RYC E;  5LBQ B;  3RKG A;  1UX5 A;  4GK0 E;  3UU4 A;  4P1N A;  1UGO A;  4O4H E;  4DBR A;  1OWA A;  3FB2 A;  5IYZ E;  1YKE B;  4X62 T;  2BZB A;  4JI0 T;  5LXT E;  3VRA A;  5ABG A;  3QUJ A;  3GWH A;  2YDQ A;  4ERR A;  5HYA A;  2OLT A;  3UU6 A;  1N36 T;  4HTE A;  3K8P C;  2CXL A;  1BR0 A;  4DV0 T;  5JQG E;  3UU8 A;  3RPU A;  1XMO T;  3PUY F;  3UUN A;  5JRC B;  4X66 T;  5BR8 T;  4F8H A;  2VL8 A;  3NWI A;  4ZI7 E;  3O4X E;  3Q5D A;  2IW5 B;  4HWD A;  3C50 A;  2XTL A;  1IJ5 A;  3FZL B;  5FXV A; 
#chains in the Genus database with same CATH homology
 2V6X A;  2JQ9 A;  4WZX A;  3EAB A;  3ZT7 A;  4ZEY A;  4P1N A;  5LB7 B;  2XZE A;  2DL1 A;  2V6Y B;  5FVK A;  2WWV A;  4NIQ A;  2RPA A;  1YXR A;  2WY2 A;  5FVL A;  2LRK A;  4U2Z A;  4U31 A;  4U7Y A;  4U2Y A;  4CN6 A;  5CGM A;  4CN4 A;  3ZT5 A;  3ZST A;  4IT4 A;  1WR0 A;  2MPK A;  4A5X A;  2K3W A;  4CN1 A;  2CPT A;  3ZT6 A;  1WFD A;  2W2U A;  4U7I A;  4U33 A;  4U3C A;  3K1S A;  3ZSS A;  5CJ5 A;  1WCR A;  2LRL A;  2JQK A;  2CRB A;  2JQH A;  2V6Y A;  2A9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...