2K3WA

Nmr structure of vps4a-mit-chmp6
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
73
structure length
73
Chain Sequence
TSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4A
publication title Two distinct modes of ESCRT-III recognition are required for VPS4 functions in lysosomal protein targeting and HIV-1 budding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 28
structure length 73
sequence length 73
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2k3wA00
4CN4A 1WFDA 4U33A 3ZT5A 3ZSTA 4IT4A 1WR0A 2CPTA 2LRLA 1YXRA 2V6YA 2JQHA 4CN1A 2WY2A 4ZEYA 4NIQA 2RPAA 2LRKA 2MPKA 5FVKA 5CGMA 4U2ZA 4U7YA 4CN6A 2JQKA 2W2UA 2DL1A 1WCRA 2JQ9A 2XZEA 4WZXA 5LB7B 4P1NA 4U3CA 2WWVA 3K1SA 3ZT7A 4U2YA 5CJ5A 4A5XA 3ZT6A 2V6YB 2V6XA 3EABA 3ZSSA 5FVLA 2A9UA 4U7IA 2CRBA 4U31A 2K3WA
chains in the Genus database with same CATH superfamily
2CLYB 5HXCA 3NRYA 2XSAA 5AQUB 4UF0A 2IHR1 4IDZA 1D0ZA 5JDNA 2H89A 3FXEB 2V1DB 4HKAA 3Q5XA 1W9RA 5KX5E 2IW5B 1ZEEA 2LLYA 1X9BA 2X0HA 2W61A 5JRCB 2A72A 2UUBT 2E9XC 4TWHA 2QVAA 3KV6A 3RYCE 3FHNA 3L8RA 2WDRA 4IE4A 3ZCIA 2UUAT 5JRCA 3AE8A 1HNXT 3AEFA 5AQTB 1JNZA 2PBIA 1OEDE 3OPCA 3EVYA 4YTPA 3PURA 3SFDA 1CHUA 3K3NA 4EEDA 5L3EB 3ZSSA 1WYCA 3BQIA 2Q9QD 4HFDA 1IZNB 5IWAT 2DCFA 4EYYR 2XJ7A 4DVDA 2CE7A 3PUGA 4X1YE 4LMKA 4TUYE 4ZI3D 5ABHA 4YHHT 3GWHA 4COFA 4ILUA 3ONLC 2WDQA 1MMGA 3CQCB 3IEEA 3SWHA 4QHOA 3PUWF 2JIWA 3LFMA 1KF6A 4ZI2D 4NUVA 2V6XA 2YINA 2V7IA 1NENA 5AQJB 3GA8A 2KNDA 5L2LA 3AEAA 4Z90A 2KWHA 2EHOC 2C5KT 2XTLA 2OA5A 4DMVA 5CFBA 1H7CA 2CEAA 3WAJA 5BR8T 5LJNA 2XQ5A 3RIUA 5FP3A 4TNVA 5HXEA 5M4YA 4I55E 3I0OA 4LFBT 2UXNB 2KMFA 2CHOA 3UU3A 3AAIA 3PUQA 3PUSA 4TX5A 4HN9A 2QGSA 1HS7A 4CI3B 4HWFA 3ZMSB 3AXJB 3RRWA 2E2AA 4B3ST 2ACXA 4CXYA 4NXMT 2UXDT 4QH1A 2VQFT 3AXJA 3T8OA 3ZT6A 5L47A 3AE6A 5HAXA 2V8SV 2FUPA 1V9DA 4TWFA 3RKGA 2QA7A 1D1AA 2DL1A 2ZM0A 5LMNT 2X68A 4HWHA 1S94A 3ZLIA 2N2NA 3AE3A 3SRZA 3FZMB 4YSXA 2BS2A 3JADA 4AISA 3CKDA 3T1HT 3N2KE 2YKSA 2NTXA 4PJNA 1E1HB 2WU5A 5JDFA 3RGLA 2HH7A 3DJBA 5FXZA 1HG5A 1SUMB 4EB6E 2VL0A 4ZOLE 3X1DA 1XNQT 5HEGA 5AQLB 2XAQB 4QXHB 5FYMA 2VKDA 5LYJE 1ZP0A 1KNPA 4JUYA 3H3AA 2K48A 2W0GA 5J2UE 2WMOA 3CX8B 5FY1A 3CX6B 2NR4A 4UVAB 2QYWA 2C5IT 2M67A 4ZZCA 4XBFB 4U7YA 2E5VA 5LCYA 2JQ9A 1S35A 4DR7T 5AQRB 3TKLB 2VKHA 1KNRA 4HTEA 2PFVA 4B3TT 4OHFA 3DTOA 1IAPA 3VU7H 2X9XA 4H9NC 2NTYA 1XWMA 1WLXA 1G8XA 2YDSA 4KMCA 2Q9QC 2MTQA 4EXTA 2E9XD 4WBOA 4LF8T 2XQ3A 3EI0A 3UU6A 2BVLA 4MBQA 5JR9C 2KT9A 5LG3A 3OKQA 3HA4A 4ZI3C 3KFWX 2CBJA 4PJJA 4V1Av 1CUNA 3N9LA 2BS3A 4QWNB 4O4HE 3H37A 3ZMUB 3CK6A 2LHNA 4EV6A 5FNVE 3RHWA 1OXZA 1KFYA 3MXZA 3UFGA 4NXNT 2BBHA 2DLRA 1IBKT 3O9XA 3LK3B 2MOZA 2NP9A 2ZLYA 4PJMA 4BA9A 2DHRA 2YEVC 3AA6B 4ILAA 4TZ4C 2RPAA 5AQVB 4YJ2E 1YD8G 3AB3B 2R6GF 2CMRA 3V5UA 3HL6A 3PUAA 4LFAT 1HX8A 4NPPA 4I50E 4EZHA 2YDQA 1B7TA 2XQAA 2N9DA 3O4XE 2K24A 2W63A 2IAKA 5CA1E 4OYJA 2L3LA 3MJXA 1J1JA 4C90A 5HEJA 2E8IA 4IREA 3UU4A 2I0MA 4DMWA 1ZHCA 3JCFA 3N9PA 5HYAA 4AKGA 2SPCA 4AIUA 4EOZB 3AEGA 3ETUA 5F3JA 3CWZB 3D0TA 3E22E 3RX6A 3LBXB 2LHRA 4BJMA 3NBXX 4J2CA 4L5GA 1DU2A 2EHOB 3LBXA 3P7IA 5C3JA 2UXCT 1U5PA 4A56A 2EHOA 4X20E 3ANWB 2BBJA 3K1SA 4JBWF 2W4XA 2WBLA 1LVKA 4JI3T 4X66T 4KHZF 3ANWA 1OEDC 2LSYA 2WQYA 4YSZA 1T98A 5AQIB 5JDGA 2LRKA 5HEOA 3QUJA 3N2GE 4UEMA 1BR2A 2HPLA 2LKHA 4K0KT 1N34T 1IJ5A 4DV0T 3RQUA 3N2OA 3E0ZA 3N9MA 5HXRA 3VHLA 3ESLA 4ASKA 4X62T 2OLTA 4AKRB 2XQ8A 1YKHB 3RRCA 4YT0A 5H6RB 5HEHA 2CHNA 3P50A 4DR4T 4CN4A 3G06A 4YFSA 2AE9A 5J1GA 4IE5A 4LMLA 3M65A 2UXBT 1QSDA 4DR5T 4JI8T 4IE6A 4P1NA 1M7KA 2BKNA 5JREA 5CB4E 2IMLA 4GYRA 5L3DB 2MYSA 4U31A 5HXSA 2DWGA 3AE5A 2CXLA 4MALA 3FZHB 1T8BA 2IIUA 4GK0E 1Y01A 4TWDA 4L0RA 1VOMA 5FKYA 2G0UA 5AQPB 3RF1A 4H63H 4DV1T 2IDOB 1NEKA 2XAHB 1IJ6A 4DV2T 4HE8A 2RA1A 3IA3A 4UV9B 4DV4T 2VASA 2W66A 4ZHQE 4X65T 3ZJ1A 5J0ZA 5L4HA 2ODVA 2PG8A 3Q2MA 3MK7C 4DR3T 2OV9A 2XQ9A 2DI4A 3FXDB 4GKKT 3BQKA 4PNIA 1XMOT 4LF4T 5HXHA 3RI5A 3AE9A 2NOXA 3HKEE 2YK0A 5LBMA 4PK4A 5FXVA 3NVOA 1WR6A 5LJMA 1D1BA 3UU5A 2MAWA 3C4WA 3ZSTA 4HWIB 4YHJA 2NW9A 2J4GA 3LK42 5L3BB 1US7B 2V26A 2Q9QB 2VWAA 4UVCB 1QLBA 3ZYLA 4ZXLA 5HCMA 2X66A 1MMNA 2Q9QA 5JR9B 3TLWA 2CA5A 4C91A 2CCQA 2XASB 3AA7B 2DNXA 2WSSV 2LRLA 5AQHB 5JR9A 2XQYA 4IDNA 3T1YT 1J5WA 5ABGA 4QX7B 3Q5EA 2ZM8A 1N33T 2J1DG 3TLSA 3ONXA 1JNRA 3EUHA 4ERRA 1KNZA 2XAGB 5DQVA 2WZHA 5AQKB 5C2TA 4FI5A 3VRAA 4CN1A 2V5DA 4O2BE 1D0YA 3UT5E 4TNWA 3HKCE 2WU2A 4ISTA 1T72A 4M1PA 3AAEB 5FVLA 3NRXA 5FY7A 4A98A 3IF8B 3RPUA 4YTMA 3LSVA 4GK5E 2W00A 3VKGA 4IL4A 1WRDA 2KINB 2LSKA 2F4VT 2GK9A 3CMLA 4JV5T 5KDMC 2XY8B 3FZKB 5FMNA 4EYUA 3LDQB 2PTFA 4KX6A 2Y6XA 4CXWA 2BDEA 3FZFB 3ZPOA 4DBQA 1HCIA 4TV9E 3L09A 2X0YA 2D0UA 4KBMB 5LGNB 2WWUA 3PDYA 3PTRB 3A5XA 4HWCA 3AE2A 4I4TE 4QXBB 4JYAT 4IDQA 3ZYMA 2KZ7B 1YQ3A 2P9BA 3AEBA 1OWAA 3AE1A 3HR0A 3ZKRA 3TLVA 4O8SA 3RIFA 2CWOA 2XQ4A 1AJ3A 4U74A 1HF8A 1OEDB 1HTJF 1HNZT 4Q25A 2Z6EA 1W0AA 3UUBA 3RYFE 3AA0B 2XAFB 4PFOA 1OEDA 4HFVA 3ZN0B 2VURA 2WZIA 1YXRA 3F57A 3JC6D 5LOVE 4A97A 2JRKA 3ZMZB 3RYHE 3DP7A 2YN6A 5LA6E 1WFDA 2W67A 3UQ7A 4JI0T 2CM0A 3A8YC 5E0OA 2CBIA 4BJNA 3B13A 3K3OA 3PU3A 5JDQA 5IHYA 3SS1A 4HGAA 4HEAA 3CIRA 2L9QA 4AKHA 1MMAA 4PAGA 3AEEA 3HI2A 4Z91A 2BG9E 1E2AA 4H9SE 3W15B 5FXXA 3VKHA 3NZQA 3AVRA 4H9RC 1NWMX 5LHGB 3ZT5A 4KHPT 3PJAA 4JI2T 1UCUA 2E9XB 2X51A 3BK9A 1MIVA 1XDPA 3SFEA 3WAKA 3KVBA 2W62A 2YU1A 4PK6A 4B3MT 3PUXF 4N78D 2E9XA 2VQET 3M3ZB 3ONJA 2L8KA 3I9WA 3I9YA 3F2EA 3ZCJA 1Z8UA 3RIUC 1QUUA 3A7MA 2X0LB 2IC6A 5HWYA 3VR8A 3UQ4A 4E7ZA 5LB7B 2LKGA 1Y64B 4IE0A 3UTKA 5LGTB 4HFIA 1R8IA 4E7SA 2LEHA 3KBTA 4HFCA 1LRZA 3OTOT 4AI6A 4LF6T 4LMJA 4AQFC 2JQQA 4DNDA 5CA0E 2LM9A 3P8CD 3RLFF 2ES0A 2X67A 3ETVA 4ZS3A 4MHCA 3ZMVB 4JEUB 5AQFB 2IUBA 2MPKA 2V7LA 5C8YE 4CQIA 3P4QA 2FJBA 2V7JA 1UGOA 3PU8A 2Y8DA 4JI1T 1M62A 3PUYF 3VRBA 2XQ6A 3B5MA 2AXDS 2QRXA 4JI6T 1HNWT 2M6IA 2RP4A 2JQKA 4MLKA 4PFPA 1MIWA 5KXJA 3K8PC 1HG2A 4NUUA 5AQNB 5H6QB 3RYIE 2D9DA 3C4ZA 5DJQC 3AA1B 4AKIA 2BZBA 4XZCA 4L9IA 1W0BA 2CXFA 2N1GA 2UU9T 3N5LA 1XZYA 3NZPA 3NKZA 5ETWA 3RQWA 3OJAA 1U4QA 4OFZA 4X1IE 3VR9A 3AEDA 4XAXB 2UUCT 4ZS2A 3CX7B 4JEHB 4UIGA 4U3CA 1MMDA 5ABFB 3PJAJ 5KMGP 2XM2A 2WS3A 3KVAA 4DV5T 2V7MA 3QB5K 5ABFA 1YKEB 4IGUA 1UX4A 2H88A 4BAYB 3I0QA 2CPTA 2WY2A 4IIJE 3JC6C 5TAOA 5JVDE 3PUZF 3EAMA 3P4PA 1XNRT 4YY3T 5F5WA 4DR2T 5J2TE 1HX1B 2KWIB 3RC8A 2M6BA 3J9X1 2JQHA 4IDOA 5JH7E 3TLUA 5EK2A 2XPKA 1FMWA 5HCJA 3L39A 4I0UA 2A9UA 4HFHA 1YQ4A 2B76A 2VL8A 1G73A 4NIQA 4UXNB 4DBRA 2BKOA 5L3FB 2KLQA 1FMVA 4AXPA 4DV7T 4X64T 4O4JE 1D0XA 4AKLA 3BQLA 2Y48B 4F8HA 1WR0A 4H63V 3C64A 3J7Yq 4ZZBA 3JAEA 3KV4A 1ZKEA 2XHEB 2HN1A 4FJOA 4WNKA 3ZT7A 4F6RC 1IBLT 3EABA 1FJGT 5JQGE 4I43B 3KV9A 2PJQA 1UK5A 2D0TA 2LE8A 3OBVE 4KP3C 4EEBA 5LP6E 4TN7B 3KDSE 1W09A 3UULA 2DWKA 4OYKA 4GOUA 3AE4A 4X5TA 2K3WA 2LM2A 2X9WA 3WI3A 2D2SA 5LHIB 4YXDA 3FZLB 1D1CA 4QKNA 4CN6A 3MA9A 2MBGA 2XZEA 3HKDE 4CZZB 5JDMA 5LHHB 2B1EA 2X9HA 1X79A 2YU2A 5HWXA 1NAFA 1XDOA 3MKDA 4HFEA 2X9YA 4OX9T 1SA0E 1FIOA 4KI0F 4EZ4A 2ACZA 2KXPB 2NWBA 3CPZA 2LJLA 5EZYE 3K3QC 4EAHA 4DUYT 2WMNA 1SHZC 4P0AA 2J62A 1UUSA 5CGMA 4PW8A 2HPJA 2XSBA 3OYZA 4TV8E 2HHHT 4JLEA 4MFRA 3LG7A 5EK4A 1L0VA 4P0BA 3GMIA 5AQSB 4DR1T 2CRBA 3FBLA 2CXDA 1ZOYA 1IBMT 3C50A 1HFAA 1E7PA 2VK9A 2YOEA 4DIDB 3ZC1A 4AQFA 5IYZE 3TLTA 1BR1A 3NWIA 2A2FX 2IC9A 1XMQT 4OK0A 3R84B 4AQGA 3KINB 1VRBA 1N32T 2BG9C 3L3PA 4G2AA 2D5UA 1N36T 3ZJ2A 2HN2A 3UU8A 1VCSA 1T7SA 4UR9A 4YSYA 2I59A 4EGWA 3UUNA 3CQGB 4X1KE 5DQWA 2CLYC 3KV5A 4HWDA 5LG4A 4UV8B 3B57A 4QH4A 5JDHA 4O4LE 4DUZT 2VVSA 1WYBA 4U72A 3IHRA 5AQMB 2FJAA 3U78A 2UXXB 4H9PC 5FVKA 5FXWA 2BVMA 3AE7A 3MACA 2H3RA 4JI5T 4GKJT 2J47A 4PJLA 3O1JA 3RIAA 1VCTA 4GYSA 3I1AA 3C51A 3RKOA 2W2UA 3EDUA 4ZI7E 4K0UA 2JMKA 3U3IA 3ZYKA 2ZM6T 1BR4A 5L4EA 3E08A 2VVNA 5FY0A 3C4XA 4IE7A 5IUXA 2BS4A 3N9QA 2YDRA 3RC3A 3AAAB 5LNKA 4DO0A 4WZXA 2JMHA 4YTNA 4U2YA 1MNEA 2LT3A 4JI4T 5LGUB 1I6ZA 4G63A 4IT4A 1Z0PA 2H7OA 3EDVA 5L3GB 3HKBE 5AFUL 4LF5T 4DV3T 3Q5DA 3FBZA 2WP9A 3QB5A 3KBUA 1ZV4X 2JPFA 4H9QC 5ABEA 2FJDA 4U7IA 4CI1B 4P09A 3QNUA 2CWYA 4HFBA 2XAJB 2C5JA 3UUMA 1LVFA 1FEWA 2LSIA 1O3XA 3UUXB 1SE7A 5AQOB 4DV6T 4Z8XA 3RH3A 3V5SA 2BKPA 1EZ3A 3P4WA 4QXCB 2VB6A 4ANJA 4LF7T 2WDVA 2KSRA 4YJ3E 5FL1A 4AQYT 4ZEYA 3N9OA 5LBQB 2XQ7A 2K5BB 4ZI2C 3H3MA 2VKJA 1WCRA 3C98B 4O4IE 2LSJA 1UX5A 4LFCT 5ADXL 4JI7T 4WBNE 2V6YB 3IBPA 2K9AA 3EHZA 1MIYA 2LOPA 4QH5A 5GONE 2WB5A 5LXTE 2V6YA 1BR0A 2WWVA 5LMUT 3O1IA 3LK2B 4A5XA 3N9NA 4ADZA 4B3RT 4YLHA 3R6NA 2FBWA 2NW7A 3UFEA 5AQQB 3S4UA 2E5LT 3CVRA 3SOLA 4UELA 5HEUA 2JJ9A 2EHOD 5JDLA 2H7VC 3ZC0A 4H9OC 2V5CA 2FJEA 3OYXA 3PE0A 2A3DA 2ZMAA 2V7KA 4GIWA 4ISSA 3AVSA 2XM1A 3P4RA 3P4SA 4UVBB 5FL0A 3QOFA 5A1LA 2C0SA 4IL9A 5DABA 1KEYA 5JTGA 3LJCA 3QK6A 4WW0A 4IDPA 4CXXA 4U2ZA 3ZN1B 1HR0T 2ODUA 3O1HA 2VKOA 4B6XA 4KUMB 4QX8B 3MZKB 2WM9A 1GQEA 3OVUA 3ZEFB 3JAFA 5EK3A 1J5ET 2WAUA 4ILBA 5L3CB 2WCAA 4ILCA 3FB2A 1MNDA 3AECA 2LOSA 4CI2B 2XUEA 5BMVE 4IHJE 2ZM2A 4EIWA 3GN5B 3Q5WA 2LSGA 5AQGB 4U33A 3ZMTB 2I6HA 2NW8A 5F8PA 3GN5A 3ABVA 1KK7A 3Q9DA 3F31A 1YW0A 1LKXA 2BG9B 4PK5A 4DR6T 5CJ5A 3QC9A 3CQXC 4O2AE 3PV0F 3PUVF 4WYVA 4UF0B 1I94T 4LF9T 2BG9A 1UURA
chains in the Genus database with same CATH topology
4CN4A 1WFDA 4U33A 3ZT5A 3ZSTA 4IT4A 1WR0A 2CPTA 2LRLA 1YXRA 2V6YA 2JQHA 4CN1A 2WY2A 4ZEYA 4NIQA 2RPAA 2LRKA 2MPKA 5FVKA 5CGMA 4U2ZA 4U7YA 4CN6A 2JQKA 2W2UA 2DL1A 1WCRA 2JQ9A 2XZEA 4WZXA 5LB7B 4P1NA 4U3CA 2WWVA 3K1SA 3ZT7A 4U2YA 5CJ5A 4A5XA 3ZT6A 2V6YB 2V6XA 3EABA 3ZSSA 5FVLA 2A9UA 4U7IA 2CRBA 4U31A 2K3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CN4 A;  1WFD A;  4U33 A;  3ZT5 A;  3ZST A;  4IT4 A;  1WR0 A;  2CPT A;  2LRL A;  1YXR A;  2V6Y A;  2JQH A;  4CN1 A;  2WY2 A;  4ZEY A;  4NIQ A;  2RPA A;  2LRK A;  2MPK A;  5FVK A;  5CGM A;  4U2Z A;  4U7Y A;  4CN6 A;  2JQK A;  2W2U A;  2DL1 A;  1WCR A;  2JQ9 A;  2XZE A;  4WZX A;  5LB7 B;  4P1N A;  4U3C A;  2WWV A;  3K1S A;  3ZT7 A;  4U2Y A;  5CJ5 A;  4A5X A;  3ZT6 A;  2V6Y B;  2V6X A;  3EAB A;  3ZSS A;  5FVL A;  2A9U A;  4U7I A;  2CRB A;  4U31 A;  2K3W A; 
#chains in the Genus database with same CATH topology
 2CLY B;  5HXC A;  3NRY A;  2XSA A;  5AQU B;  4UF0 A;  2IHR 1;  4IDZ A;  1D0Z A;  5JDN A;  2H89 A;  3FXE B;  2V1D B;  4HKA A;  3Q5X A;  1W9R A;  5KX5 E;  2IW5 B;  1ZEE A;  2LLY A;  1X9B A;  2X0H A;  2W61 A;  5JRC B;  2A72 A;  2UUB T;  2E9X C;  4TWH A;  2QVA A;  3KV6 A;  3RYC E;  3FHN A;  3L8R A;  2WDR A;  4IE4 A;  3ZCI A;  2UUA T;  5JRC A;  3AE8 A;  1HNX T;  3AEF A;  5AQT B;  1JNZ A;  2PBI A;  1OED E;  3OPC A;  3EVY A;  4YTP A;  3PUR A;  3SFD A;  1CHU A;  3K3N A;  4EED A;  5L3E B;  3ZSS A;  1WYC A;  3BQI A;  2Q9Q D;  4HFD A;  1IZN B;  5IWA T;  2DCF A;  4EYY R;  2XJ7 A;  4DVD A;  2CE7 A;  3PUG A;  4X1Y E;  4LMK A;  4TUY E;  4ZI3 D;  5ABH A;  4YHH T;  3GWH A;  4COF A;  4ILU A;  3ONL C;  2WDQ A;  1MMG A;  3CQC B;  3IEE A;  3SWH A;  4QHO A;  3PUW F;  2JIW A;  3LFM A;  1KF6 A;  4ZI2 D;  4NUV A;  2V6X A;  2YIN A;  2V7I A;  1NEN A;  5AQJ B;  3GA8 A;  2KND A;  5L2L A;  3AEA A;  4Z90 A;  2KWH A;  2EHO C;  2C5K T;  2XTL A;  2OA5 A;  4DMV A;  5CFB A;  1H7C A;  2CEA A;  3WAJ A;  5BR8 T;  5LJN A;  2XQ5 A;  3RIU A;  5FP3 A;  4TNV A;  5HXE A;  5M4Y A;  4I55 E;  3I0O A;  4LFB T;  2UXN B;  2KMF A;  2CHO A;  3UU3 A;  3AAI A;  3PUQ A;  3PUS A;  4TX5 A;  4HN9 A;  2QGS A;  1HS7 A;  4CI3 B;  4HWF A;  3ZMS B;  3AXJ B;  3RRW A;  2E2A A;  4B3S T;  2ACX A;  4CXY A;  4NXM T;  2UXD T;  4QH1 A;  2VQF T;  3AXJ A;  3T8O A;  3ZT6 A;  5L47 A;  3AE6 A;  5HAX A;  2V8S V;  2FUP A;  1V9D A;  4TWF A;  3RKG A;  2QA7 A;  1D1A A;  2DL1 A;  2ZM0 A;  5LMN T;  2X68 A;  4HWH A;  1S94 A;  3ZLI A;  2N2N A;  3AE3 A;  3SRZ A;  3FZM B;  4YSX A;  2BS2 A;  3JAD A;  4AIS A;  3CKD A;  3T1H T;  3N2K E;  2YKS A;  2NTX A;  4PJN A;  1E1H B;  2WU5 A;  5JDF A;  3RGL A;  2HH7 A;  3DJB A;  5FXZ A;  1HG5 A;  1SUM B;  4EB6 E;  2VL0 A;  4ZOL E;  3X1D A;  1XNQ T;  5HEG A;  5AQL B;  2XAQ B;  4QXH B;  5FYM A;  2VKD A;  5LYJ E;  1ZP0 A;  1KNP A;  4JUY A;  3H3A A;  2K48 A;  2W0G A;  5J2U E;  2WMO A;  3CX8 B;  5FY1 A;  3CX6 B;  2NR4 A;  4UVA B;  2QYW A;  2C5I T;  2M67 A;  4ZZC A;  4XBF B;  4U7Y A;  2E5V A;  5LCY A;  2JQ9 A;  1S35 A;  4DR7 T;  5AQR B;  3TKL B;  2VKH A;  1KNR A;  4HTE A;  2PFV A;  4B3T T;  4OHF A;  3DTO A;  1IAP A;  3VU7 H;  2X9X A;  4H9N C;  2NTY A;  1XWM A;  1WLX A;  1G8X A;  2YDS A;  4KMC A;  2Q9Q C;  2MTQ A;  4EXT A;  2E9X D;  4WBO A;  4LF8 T;  2XQ3 A;  3EI0 A;  3UU6 A;  2BVL A;  4MBQ A;  5JR9 C;  2KT9 A;  5LG3 A;  3OKQ A;  3HA4 A;  4ZI3 C;  3KFW X;  2CBJ A;  4PJJ A;  4V1A v;  1CUN A;  3N9L A;  2BS3 A;  4QWN B;  4O4H E;  3H37 A;  3ZMU B;  3CK6 A;  2LHN A;  4EV6 A;  5FNV E;  3RHW A;  1OXZ A;  1KFY A;  3MXZ A;  3UFG A;  4NXN T;  2BBH A;  2DLR A;  1IBK T;  3O9X A;  3LK3 B;  2MOZ A;  2NP9 A;  2ZLY A;  4PJM A;  4BA9 A;  2DHR A;  2YEV C;  3AA6 B;  4ILA A;  4TZ4 C;  2RPA A;  5AQV B;  4YJ2 E;  1YD8 G;  3AB3 B;  2R6G F;  2CMR A;  3V5U A;  3HL6 A;  3PUA A;  4LFA T;  1HX8 A;  4NPP A;  4I50 E;  4EZH A;  2YDQ A;  1B7T A;  2XQA A;  2N9D A;  3O4X E;  2K24 A;  2W63 A;  2IAK A;  5CA1 E;  4OYJ A;  2L3L A;  3MJX A;  1J1J A;  4C90 A;  5HEJ A;  2E8I A;  4IRE A;  3UU4 A;  2I0M A;  4DMW A;  1ZHC A;  3JCF A;  3N9P A;  5HYA A;  4AKG A;  2SPC A;  4AIU A;  4EOZ B;  3AEG A;  3ETU A;  5F3J A;  3CWZ B;  3D0T A;  3E22 E;  3RX6 A;  3LBX B;  2LHR A;  4BJM A;  3NBX X;  4J2C A;  4L5G A;  1DU2 A;  2EHO B;  3LBX A;  3P7I A;  5C3J A;  2UXC T;  1U5P A;  4A56 A;  2EHO A;  4X20 E;  3ANW B;  2BBJ A;  3K1S A;  4JBW F;  2W4X A;  2WBL A;  1LVK A;  4JI3 T;  4X66 T;  4KHZ F;  3ANW A;  1OED C;  2LSY A;  2WQY A;  4YSZ A;  1T98 A;  5AQI B;  5JDG A;  2LRK A;  5HEO A;  3QUJ A;  3N2G E;  4UEM A;  1BR2 A;  2HPL A;  2LKH A;  4K0K T;  1N34 T;  1IJ5 A;  4DV0 T;  3RQU A;  3N2O A;  3E0Z A;  3N9M A;  5HXR A;  3VHL A;  3ESL A;  4ASK A;  4X62 T;  2OLT A;  4AKR B;  2XQ8 A;  1YKH B;  3RRC A;  4YT0 A;  5H6R B;  5HEH A;  2CHN A;  3P50 A;  4DR4 T;  4CN4 A;  3G06 A;  4YFS A;  2AE9 A;  5J1G A;  4IE5 A;  4LML A;  3M65 A;  2UXB T;  1QSD A;  4DR5 T;  4JI8 T;  4IE6 A;  4P1N A;  1M7K A;  2BKN A;  5JRE A;  5CB4 E;  2IML A;  4GYR A;  5L3D B;  2MYS A;  4U31 A;  5HXS A;  2DWG A;  3AE5 A;  2CXL A;  4MAL A;  3FZH B;  1T8B A;  2IIU A;  4GK0 E;  1Y01 A;  4TWD A;  4L0R A;  1VOM A;  5FKY A;  2G0U A;  5AQP B;  3RF1 A;  4H63 H;  4DV1 T;  2IDO B;  1NEK A;  2XAH B;  1IJ6 A;  4DV2 T;  4HE8 A;  2RA1 A;  3IA3 A;  4UV9 B;  4DV4 T;  2VAS A;  2W66 A;  4ZHQ E;  4X65 T;  3ZJ1 A;  5J0Z A;  5L4H A;  2ODV A;  2PG8 A;  3Q2M A;  3MK7 C;  4DR3 T;  2OV9 A;  2XQ9 A;  2DI4 A;  3FXD B;  4GKK T;  3BQK A;  4PNI A;  1XMO T;  4LF4 T;  5HXH A;  3RI5 A;  3AE9 A;  2NOX A;  3HKE E;  2YK0 A;  5LBM A;  4PK4 A;  5FXV A;  3NVO A;  1WR6 A;  5LJM A;  1D1B A;  3UU5 A;  2MAW A;  3C4W A;  3ZST A;  4HWI B;  4YHJ A;  2NW9 A;  2J4G A;  3LK4 2;  5L3B B;  1US7 B;  2V26 A;  2Q9Q B;  2VWA A;  4UVC B;  1QLB A;  3ZYL A;  4ZXL A;  5HCM A;  2X66 A;  1MMN A;  2Q9Q A;  5JR9 B;  3TLW A;  2CA5 A;  4C91 A;  2CCQ A;  2XAS B;  3AA7 B;  2DNX A;  2WSS V;  2LRL A;  5AQH B;  5JR9 A;  2XQY A;  4IDN A;  3T1Y T;  1J5W A;  5ABG A;  4QX7 B;  3Q5E A;  2ZM8 A;  1N33 T;  2J1D G;  3TLS A;  3ONX A;  1JNR A;  3EUH A;  4ERR A;  1KNZ A;  2XAG B;  5DQV A;  2WZH A;  5AQK B;  5C2T A;  4FI5 A;  3VRA A;  4CN1 A;  2V5D A;  4O2B E;  1D0Y A;  3UT5 E;  4TNW A;  3HKC E;  2WU2 A;  4IST A;  1T72 A;  4M1P A;  3AAE B;  5FVL A;  3NRX A;  5FY7 A;  4A98 A;  3IF8 B;  3RPU A;  4YTM A;  3LSV A;  4GK5 E;  2W00 A;  3VKG A;  4IL4 A;  1WRD A;  2KIN B;  2LSK A;  2F4V T;  2GK9 A;  3CML A;  4JV5 T;  5KDM C;  2XY8 B;  3FZK B;  5FMN A;  4EYU A;  3LDQ B;  2PTF A;  4KX6 A;  2Y6X A;  4CXW A;  2BDE A;  3FZF B;  3ZPO A;  4DBQ A;  1HCI A;  4TV9 E;  3L09 A;  2X0Y A;  2D0U A;  4KBM B;  5LGN B;  2WWU A;  3PDY A;  3PTR B;  3A5X A;  4HWC A;  3AE2 A;  4I4T E;  4QXB B;  4JYA T;  4IDQ A;  3ZYM A;  2KZ7 B;  1YQ3 A;  2P9B A;  3AEB A;  1OWA A;  3AE1 A;  3HR0 A;  3ZKR A;  3TLV A;  4O8S A;  3RIF A;  2CWO A;  2XQ4 A;  1AJ3 A;  4U74 A;  1HF8 A;  1OED B;  1HTJ F;  1HNZ T;  4Q25 A;  2Z6E A;  1W0A A;  3UUB A;  3RYF E;  3AA0 B;  2XAF B;  4PFO A;  1OED A;  4HFV A;  3ZN0 B;  2VUR A;  2WZI A;  1YXR A;  3F57 A;  3JC6 D;  5LOV E;  4A97 A;  2JRK A;  3ZMZ B;  3RYH E;  3DP7 A;  2YN6 A;  5LA6 E;  1WFD A;  2W67 A;  3UQ7 A;  4JI0 T;  2CM0 A;  3A8Y C;  5E0O A;  2CBI A;  4BJN A;  3B13 A;  3K3O A;  3PU3 A;  5JDQ A;  5IHY A;  3SS1 A;  4HGA A;  4HEA A;  3CIR A;  2L9Q A;  4AKH A;  1MMA A;  4PAG A;  3AEE A;  3HI2 A;  4Z91 A;  2BG9 E;  1E2A A;  4H9S E;  3W15 B;  5FXX A;  3VKH A;  3NZQ A;  3AVR A;  4H9R C;  1NWM X;  5LHG B;  3ZT5 A;  4KHP T;  3PJA A;  4JI2 T;  1UCU A;  2E9X B;  2X51 A;  3BK9 A;  1MIV A;  1XDP A;  3SFE A;  3WAK A;  3KVB A;  2W62 A;  2YU1 A;  4PK6 A;  4B3M T;  3PUX F;  4N78 D;  2E9X A;  2VQE T;  3M3Z B;  3ONJ A;  2L8K A;  3I9W A;  3I9Y A;  3F2E A;  3ZCJ A;  1Z8U A;  3RIU C;  1QUU A;  3A7M A;  2X0L B;  2IC6 A;  5HWY A;  3VR8 A;  3UQ4 A;  4E7Z A;  5LB7 B;  2LKG A;  1Y64 B;  4IE0 A;  3UTK A;  5LGT B;  4HFI A;  1R8I A;  4E7S A;  2LEH A;  3KBT A;  4HFC A;  1LRZ A;  3OTO T;  4AI6 A;  4LF6 T;  4LMJ A;  4AQF C;  2JQQ A;  4DND A;  5CA0 E;  2LM9 A;  3P8C D;  3RLF F;  2ES0 A;  2X67 A;  3ETV A;  4ZS3 A;  4MHC A;  3ZMV B;  4JEU B;  5AQF B;  2IUB A;  2MPK A;  2V7L A;  5C8Y E;  4CQI A;  3P4Q A;  2FJB A;  2V7J A;  1UGO A;  3PU8 A;  2Y8D A;  4JI1 T;  1M62 A;  3PUY F;  3VRB A;  2XQ6 A;  3B5M A;  2AXD S;  2QRX A;  4JI6 T;  1HNW T;  2M6I A;  2RP4 A;  2JQK A;  4MLK A;  4PFP A;  1MIW A;  5KXJ A;  3K8P C;  1HG2 A;  4NUU A;  5AQN B;  5H6Q B;  3RYI E;  2D9D A;  3C4Z A;  5DJQ C;  3AA1 B;  4AKI A;  2BZB A;  4XZC A;  4L9I A;  1W0B A;  2CXF A;  2N1G A;  2UU9 T;  3N5L A;  1XZY A;  3NZP A;  3NKZ A;  5ETW A;  3RQW A;  3OJA A;  1U4Q A;  4OFZ A;  4X1I E;  3VR9 A;  3AED A;  4XAX B;  2UUC T;  4ZS2 A;  3CX7 B;  4JEH B;  4UIG A;  4U3C A;  1MMD A;  5ABF B;  3PJA J;  5KMG P;  2XM2 A;  2WS3 A;  3KVA A;  4DV5 T;  2V7M A;  3QB5 K;  5ABF A;  1YKE B;  4IGU A;  1UX4 A;  2H88 A;  4BAY B;  3I0Q A;  2CPT A;  2WY2 A;  4IIJ E;  3JC6 C;  5TAO A;  5JVD E;  3PUZ F;  3EAM A;  3P4P A;  1XNR T;  4YY3 T;  5F5W A;  4DR2 T;  5J2T E;  1HX1 B;  2KWI B;  3RC8 A;  2M6B A;  3J9X 1;  2JQH A;  4IDO A;  5JH7 E;  3TLU A;  5EK2 A;  2XPK A;  1FMW A;  5HCJ A;  3L39 A;  4I0U A;  2A9U A;  4HFH A;  1YQ4 A;  2B76 A;  2VL8 A;  1G73 A;  4NIQ A;  4UXN B;  4DBR A;  2BKO A;  5L3F B;  2KLQ A;  1FMV A;  4AXP A;  4DV7 T;  4X64 T;  4O4J E;  1D0X A;  4AKL A;  3BQL A;  2Y48 B;  4F8H A;  1WR0 A;  4H63 V;  3C64 A;  3J7Y q;  4ZZB A;  3JAE A;  3KV4 A;  1ZKE A;  2XHE B;  2HN1 A;  4FJO A;  4WNK A;  3ZT7 A;  4F6R C;  1IBL T;  3EAB A;  1FJG T;  5JQG E;  4I43 B;  3KV9 A;  2PJQ A;  1UK5 A;  2D0T A;  2LE8 A;  3OBV E;  4KP3 C;  4EEB A;  5LP6 E;  4TN7 B;  3KDS E;  1W09 A;  3UUL A;  2DWK A;  4OYK A;  4GOU A;  3AE4 A;  4X5T A;  2K3W A;  2LM2 A;  2X9W A;  3WI3 A;  2D2S A;  5LHI B;  4YXD A;  3FZL B;  1D1C A;  4QKN A;  4CN6 A;  3MA9 A;  2MBG A;  2XZE A;  3HKD E;  4CZZ B;  5JDM A;  5LHH B;  2B1E A;  2X9H A;  1X79 A;  2YU2 A;  5HWX A;  1NAF A;  1XDO A;  3MKD A;  4HFE A;  2X9Y A;  4OX9 T;  1SA0 E;  1FIO A;  4KI0 F;  4EZ4 A;  2ACZ A;  2KXP B;  2NWB A;  3CPZ A;  2LJL A;  5EZY E;  3K3Q C;  4EAH A;  4DUY T;  2WMN A;  1SHZ C;  4P0A A;  2J62 A;  1UUS A;  5CGM A;  4PW8 A;  2HPJ A;  2XSB A;  3OYZ A;  4TV8 E;  2HHH T;  4JLE A;  4MFR A;  3LG7 A;  5EK4 A;  1L0V A;  4P0B A;  3GMI A;  5AQS B;  4DR1 T;  2CRB A;  3FBL A;  2CXD A;  1ZOY A;  1IBM T;  3C50 A;  1HFA A;  1E7P A;  2VK9 A;  2YOE A;  4DID B;  3ZC1 A;  4AQF A;  5IYZ E;  3TLT A;  1BR1 A;  3NWI A;  2A2F X;  2IC9 A;  1XMQ T;  4OK0 A;  3R84 B;  4AQG A;  3KIN B;  1VRB A;  1N32 T;  2BG9 C;  3L3P A;  4G2A A;  2D5U A;  1N36 T;  3ZJ2 A;  2HN2 A;  3UU8 A;  1VCS A;  1T7S A;  4UR9 A;  4YSY A;  2I59 A;  4EGW A;  3UUN A;  3CQG B;  4X1K E;  5DQW A;  2CLY C;  3KV5 A;  4HWD A;  5LG4 A;  4UV8 B;  3B57 A;  4QH4 A;  5JDH A;  4O4L E;  4DUZ T;  2VVS A;  1WYB A;  4U72 A;  3IHR A;  5AQM B;  2FJA A;  3U78 A;  2UXX B;  4H9P C;  5FVK A;  5FXW A;  2BVM A;  3AE7 A;  3MAC A;  2H3R A;  4JI5 T;  4GKJ T;  2J47 A;  4PJL A;  3O1J A;  3RIA A;  1VCT A;  4GYS A;  3I1A A;  3C51 A;  3RKO A;  2W2U A;  3EDU A;  4ZI7 E;  4K0U A;  2JMK A;  3U3I A;  3ZYK A;  2ZM6 T;  1BR4 A;  5L4E A;  3E08 A;  2VVN A;  5FY0 A;  3C4X A;  4IE7 A;  5IUX A;  2BS4 A;  3N9Q A;  2YDR A;  3RC3 A;  3AAA B;  5LNK A;  4DO0 A;  4WZX A;  2JMH A;  4YTN A;  4U2Y A;  1MNE A;  2LT3 A;  4JI4 T;  5LGU B;  1I6Z A;  4G63 A;  4IT4 A;  1Z0P A;  2H7O A;  3EDV A;  5L3G B;  3HKB E;  5AFU L;  4LF5 T;  4DV3 T;  3Q5D A;  3FBZ A;  2WP9 A;  3QB5 A;  3KBU A;  1ZV4 X;  2JPF A;  4H9Q C;  5ABE A;  2FJD A;  4U7I A;  4CI1 B;  4P09 A;  3QNU A;  2CWY A;  4HFB A;  2XAJ B;  2C5J A;  3UUM A;  1LVF A;  1FEW A;  2LSI A;  1O3X A;  3UUX B;  1SE7 A;  5AQO B;  4DV6 T;  4Z8X A;  3RH3 A;  3V5S A;  2BKP A;  1EZ3 A;  3P4W A;  4QXC B;  2VB6 A;  4ANJ A;  4LF7 T;  2WDV A;  2KSR A;  4YJ3 E;  5FL1 A;  4AQY T;  4ZEY A;  3N9O A;  5LBQ B;  2XQ7 A;  2K5B B;  4ZI2 C;  3H3M A;  2VKJ A;  1WCR A;  3C98 B;  4O4I E;  2LSJ A;  1UX5 A;  4LFC T;  5ADX L;  4JI7 T;  4WBN E;  2V6Y B;  3IBP A;  2K9A A;  3EHZ A;  1MIY A;  2LOP A;  4QH5 A;  5GON E;  2WB5 A;  5LXT E;  2V6Y A;  1BR0 A;  2WWV A;  5LMU T;  3O1I A;  3LK2 B;  4A5X A;  3N9N A;  4ADZ A;  4B3R T;  4YLH A;  3R6N A;  2FBW A;  2NW7 A;  3UFE A;  5AQQ B;  3S4U A;  2E5L T;  3CVR A;  3SOL A;  4UEL A;  5HEU A;  2JJ9 A;  2EHO D;  5JDL A;  2H7V C;  3ZC0 A;  4H9O C;  2V5C A;  2FJE A;  3OYX A;  3PE0 A;  2A3D A;  2ZMA A;  2V7K A;  4GIW A;  4ISS A;  3AVS A;  2XM1 A;  3P4R A;  3P4S A;  4UVB B;  5FL0 A;  3QOF A;  5A1L A;  2C0S A;  4IL9 A;  5DAB A;  1KEY A;  5JTG A;  3LJC A;  3QK6 A;  4WW0 A;  4IDP A;  4CXX A;  4U2Z A;  3ZN1 B;  1HR0 T;  2ODU A;  3O1H A;  2VKO A;  4B6X A;  4KUM B;  4QX8 B;  3MZK B;  2WM9 A;  1GQE A;  3OVU A;  3ZEF B;  3JAF A;  5EK3 A;  1J5E T;  2WAU A;  4ILB A;  5L3C B;  2WCA A;  4ILC A;  3FB2 A;  1MND A;  3AEC A;  2LOS A;  4CI2 B;  2XUE A;  5BMV E;  4IHJ E;  2ZM2 A;  4EIW A;  3GN5 B;  3Q5W A;  2LSG A;  5AQG B;  4U33 A;  3ZMT B;  2I6H A;  2NW8 A;  5F8P A;  3GN5 A;  3ABV A;  1KK7 A;  3Q9D A;  3F31 A;  1YW0 A;  1LKX A;  2BG9 B;  4PK5 A;  4DR6 T;  5CJ5 A;  3QC9 A;  3CQX C;  4O2A E;  3PV0 F;  3PUV F;  4WYV A;  4UF0 B;  1I94 T;  4LF9 T;  2BG9 A;  1UUR A; 
#chains in the Genus database with same CATH homology
 4CN4 A;  1WFD A;  4U33 A;  3ZT5 A;  3ZST A;  4IT4 A;  1WR0 A;  2CPT A;  2LRL A;  1YXR A;  2V6Y A;  2JQH A;  4CN1 A;  2WY2 A;  4ZEY A;  4NIQ A;  2RPA A;  2LRK A;  2MPK A;  5FVK A;  5CGM A;  4U2Z A;  4U7Y A;  4CN6 A;  2JQK A;  2W2U A;  2DL1 A;  1WCR A;  2JQ9 A;  2XZE A;  4WZX A;  5LB7 B;  4P1N A;  4U3C A;  2WWV A;  3K1S A;  3ZT7 A;  4U2Y A;  5CJ5 A;  4A5X A;  3ZT6 A;  2V6Y B;  2V6X A;  3EAB A;  3ZSS A;  5FVL A;  2A9U A;  4U7I A;  2CRB A;  4U31 A;  2K3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...