2K3YA

Solution structure of eaf3 chromo barrel domain bound to histone h3 with a dimethyllysine analog h3k36me2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
133
Chain Sequence
MVDLEQEFALGGRVLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKSFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAGSTGSAPATGGVKPHRYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin modification-related protein EAF3
publication title Structural Basis for the Recognition of Methylated Histone H3K36 by the Eaf3 Subunit of Histone Deacetylase Complex Rpd3S.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulator
total genus 27
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k3yA01
4E7KA 4PLIA 2X35A 4EDUA 4QQGA 4E7LA 4BDYA 2DIQA 4B9XA 3H6ZA 3S3MA 3OYGA 2K3YA 4N4HA 2GF7A 5KE2A 3H8ZA 3MP1A 3S3OA 2L3RA 2RHYA 3L2WA 2GFAA 5M9OA 3OS0A 2RHXA 1MHNA 5KE3A 2EKOA 2BIVA 2XDPA 2X4YA 4QQDA 3OYNA 3L2UA 2IG0A 2E5QA 3OYMA 3CEYA 1SSFA 2G3RA 2XK0A 2FHDA 3OS1A 2K3XA 2YRVA 3QIIA 3DB3A 3PMTA 5IN1A 5J39A 3SD4A 4BACA 3S3NA 2R57A 4C5EA 4IKFA 3MP8A 2MWOA 3QKJA 4QVZA 2WACA 3O8VA 3OYEA 3ASKA 3QJ6A 2F5KA 4CRIA 3PNWC 2RI3A 3PFSA 2RJEA 2D9TA 5D6WA 3OY9A 1OYXA 4GY5A 3OYJA 5KH6A 2RI2A 3P8HA 4IUQA 5J26A 2DIGA 3UWNA 4A4FA 2RJDA 3FEOA 5C0MA 1WJRA 2NLUA 2X4WA 4B9WA 4N4GA 2RJFA 4FL6A 2P0KA 3FC3A 3MEAA 4FU6A 5FROA 3NTHA 4IURA 2RHIA 3OMCA 5FRMA 1G5VA 2LTOA 3FLGA 3BDLA 2HQEA 5CIUA 2BUDA 3QBYA 5FRNA 3LX7A 3MP6A 2LDMA 3OQ5A 4PL6A 4C5IA 4BE2A 3EAEA 3L2VA 4HCZA 1WGSA 1XNIA 4RG2A 3DB4A 1OZ3A 3LYIA 3OYAA 4BD3A 4C5GA 2QQSA 3META 2M16A 1WJSA 4NS5A 2JTFA 3LH0A 3L2QA 3ZEHA 4A4HA 3OYDA 4BDZA 4L59A 5D6XA 2EQMA 3NTKA 3LLRA 4N4IA 3DLMA 3P8DA 3OMGA 4E7IA 3LGFA 3OB9A 3FDRA 2GFUA 2X4XA 1KHCA 2B8AA 2R5MA 3OYKA 3OA6A 2DAQA 3Q1JA 2EQKA 2R5AA 3MEVA 4BE1A 4E7JA 2EFIA 5KCHA 5KCOA 2M0OA 4BE0A 3MEWA 2RI5A 2O4XB 2O4XA 1WJQA 4X34A 4IUVA 3UT1A 4C5HA 3OYBA 1RI0A 4E7HA 2MWPA 2RO0A 4IUPA 4QW2A 1OI1A 3OYHA 2LRQA 3E9GA 4Z02A 3M9QA 5IAYA 2PQWA 3PMIA 3OYCA 1OZ2A 2M1HA 3C4SA 3F70A 3KUFA 3LGLA 2RHUA 4A4GA 2EQJA 4PLLA 2EQUA 2RHZA 3OYIA 3GOXA 1N27A 3L42A 2HQXA 5D6YA 2BKDN 2QQRA 2CKKA 3MO8A 3E9FA 4OVAA 1H3ZA 3OYLA 4IUTA 2JZ2A 2RJCA 4A4EA 3OYFA 4ZTJA 3NTIA 2E6NA 2LVMA 4ZTFA 2R58A 4II1A 4LD6A 3ME9A 2LCCA 4QQ6A 3S6WA 3L2RA 2L8DA 4IUUA 5C6SA 2L89A 4UC4A 4Q5WA 2VYTA 3MEUA 3OS2A
chains in the Genus database with same CATH superfamily
3CCRT 1WX6A 2XU8A 1W2BS 4E7LA 4AFSC 3R6NA 2LP5A 4DBFA 2QA4A 4JLGA 1B34B 2CZ1B 2K3BA 1J3TA 2IIMA 2SRCA 4ELZC 3TEEA 2BIVA 2VGMA 2MCNA 2X3XD 4LDVA 1TOVA 1AVZC 2RPNA 4LDXA 1IO6A 2HDAA 2J6FA 3QIIA 3CD6T 1IGQA 4M75B 2GNCA 4RTUA 4PJOA 3QKJA 1KC8U 3CD6Q 1P92A 4XTWA 3OBYA 2A3LA 2COWA 3J81E 1ZUUA 4PJMA 4JUVA 1VQ7Q 2HSPA 1GCQA 4Y28E 2KT1A 1UGRB 3FEOA 1HYOA 4J9DA 1TS9A 3EGXA 3LH5A 1V1CA 3FC3A 3OMCA 1XOVA 2QQAA 1AWJA 4P5NA 4J7IA 3RKXA 2MK5A 2EYQA 2A0FB 1UTIA 2EYXA 3JCMf 2DL8A 3EAEA 3CC2A 4OB0B 1RAIB 3VUBA 2RQRA 5GANd 2YRDA 1N5ZA 1YJWA 2KBTA 1MGQA 2D8HA 2E3IA 1I5LA 1K0SA 2C06A 3LLRA 3DLMA 2OTJQ 1NLOC 2FO0A 2DTIA 1Q86R 3HRUA 3EGDA 5GAOn 2QAZA 5KCOA 2FG0A 1BI2A 3OYEA 5D7UA 1AOJA 3JCMh 3R6OA 2XG8D 5GMKl 2O88A 5GANg 2ABLA 2VV5A 2JTMA 3CPFA 2DD4A 2YHTA 3HPWA 5HCKA 4LN2A 2V26A 2DRKA 2CUDA 2DMOA 2P0QA 1EZZB 5C6SA 2DNUA 2L89A 1O75A 3QSUA 1H92A 4BI8B 2DIQA 2EPDA 2K3YA 2P0PA 3OSSC 4GLMA 5KE2A 1U5SA 3BFMA 3EG1A 1VQ4A 4ESRA 1MHNA 1VQ5Q 6AT1B 4QQDA 3CCLT 4AFUC 1ZUKA 2YUNA 1TXQA 1ZA1B 5IN1A 3PMTA 3CCMQ 4OMPA 2HMAA 1QQJA 1O9SA 3RKWA 1ZBJA 1Q82U 2KROA 1WXBA 4ME7A 4PJLA 3UATA 1Y7XA 2ZZDA 5DLOA 1NPPA 2CZ6B 1Q81C 3EFSA 5FROA 1NYGA 5I22A 1M3BA 1RUWA 1M1KU 2X9HA 1D0YA 4EMKB 4PL6A 3ZL7C 1W1FA 1S72A 1WHJA 3T9NA 2M16A 3DLLA 2RK2A 1ZA2B 2KGTA 4C0GA 1K9MR 2J7IA 2R5MA 3OYKA 1K4US 1U8RA 1JU5C 2COYA 2RD1A 1TWBA 1M2OA 1M3CA 2JJ9A 3M56A 2RO0A 4IUPA 5GAOq 1RAGB 4JDSA 5L8RE 5A0DA 1OZ2A 2LCSA 2OX7A 1SF9A 5KYXB 1YIJA 1IB8A 1BIAA 1TU0B 2RJCA 3V7RA 2ED0A 5ECAA 4BY6B 2QA4T 1Q7YU 1D0XA 5FLXE 1X75C 2QA4Q 5GANf 2DD5A 2X35A 5LJ3d 5LJ3e 4C0DC 1ZSGA 4F7UB 2V1RA 1VQMQ 1MV3A 3X28B 2MMPA 3OSVA 3C95A 2EVRA 1WIEA 2LT4A 1T3SA 4IIMA 1GFCA 4M7DE 2G6FX 4ELYC 4BACA 2YT6A 3FRNA 2R57A 2KNBB 4FIBA 4FYVB 2HAXA 3BE3A 2JUFA 2E70A 3EG0A 3QJ6A 2JOYA 3V8KA 1GXIE 3PFSA 4RTZA 5GANh 2A7YA 2X4JA 1JO8A 1NEGA 3OW2A 2JMCA 2BE7D 2HBWA 3EFOB 1WHHA 4C8QA 4N4GA 1HK9A 1K8AR 2DYIA 4FYWB 4M77E 2ESWA 2J06A 1NEBA 1Y0MA 4M78D 4JJBA 1AHJB 5HK0A 3CC2Q 2DKGA 1VOMA 1MMDA 1YJWQ 1UGSB 2AZSA 1NG2A 4M78C 3CCVT 4A63B 2KXCA 3RIRA 4BI4A 3SWNB 2F5TX 4E7IA 3CC4A 1JJ2P 4M78G 1SG5A 2GFUA 3EG3A 3GF5A 4VUBA 1JB0E 1K73U 1QVPA 2JMAA 5GMKm 4E7JA 3MEWA 3HP9A 2CP7A 2D6FA 2D0NA 3X26B 3CXCA 1B34A 1M3AA 2M1HA 3C4SA 2L3PA 5KYWB 4PJOE 4BI3A 1QP3A 1XJWB 2YXYA 2LC4A 2VASA 1Y96B 1N8RC 1R0CB 3JCMQ 2QGFB 1UGQB 2H3JA 4M75A 3S6WA 2DE0X 1TTHB 3CPWP 3X25B 4JRQA 4O5VA 4B6MA 5HK3A 1VQ4T 1KJWA 4MZMA 3PTAA 2PVDB 1FMWA 1PWTA 1VQ4Q 1H641 1YBYA 2KXDA 2DXCA 2LNVA 4OF1A 1LPLA 2XICA 1SEMA 3QWYA 3OYNA 2PVOB 1IHWA 3OYMA 4RTYA 1ZX6A 3CBMA 3S3NA 1K76A 4JS5A 4Z88A 4QVZA 1JBMA 5GAN8 4J6YA 1IHVA 3NHNA 2AZVA 4CRIA 1QVGA 1BK2A 1G3TA 2D9TA 4AMCA 4TVRA 4R55A 4XU0A 5J26A 4ZNXA 5GAN2 1I0CA 4LUEA 2MYSA 2NLUA 3CCRA 3CBOA 3KBGA 3FLGA 1UGPB 1M8VA 2F2VA 1S72Q 5CAIA 4A53A 4C5IA 1VQLA 2E3HA 5LJ5g 1Q86U 3OYAA 4NS5A 4ZN1A 4M7DF 2L5QA 2A28A 4L59A 2P4RA 2K6DA 2GGRA 2YUPA 3JB9D 3P8DA 2LZ6B 3E19A 5GANj 2QYZA 3UF4A 2ZGWA 3LGFA 1SRMA 2MI6A 2X4XA 3OA6A 2EYZA 5KCHA 1TSFA 5HY6A 1YIJT 4CC3A 1MMAA 2RQUA 1M27C 2A37A 1YIJQ 2K5FA 4KT0E 3E9FA 2WSFE 2OJ2A 1HSQA 4A4EA 1I81A 2CH4A 3ME9A 4XTXA 3L2RA 4AFQC 1TUGB 3RESA 5KYYB 1N6AA 1RABB 4BB7A 1VQPT 1UFFA 5EC7A 1SHFA 3PIOA 3CBPA 4E7ZA 1UECA 1Z9ZA 1TG0A 1UDLA 2KMTA 1M90R 3J80E 2XI9A 1YI2Q 2QGGA 4J9CA 3HHTB 2LJ3A 1PG5B 1C6VX 4J83A 3M57A 3NPFA 3OW2S 1SHGA 1WHGA 2YRVA 4PJOF 5IH2A 3QDRB 4C5EA 2JW4A 4EMKA 1YHQQ 3D7SB 2QQBA 1UE9A 2JNGA 1X27A 4V2SA 2EJ9A 1Y71A 4IUQA 4J9EA 3UWNA 2X4WA 2LT1A 4X9CA 2RJFA 3CPWS 4BY6C 4DQ2A 1KQ1A 2DTHA 2DLPA 1X2QA 1AWOA 5GAOl 3LX7A 3MP6A 1K9MU 2KAFA 3L2VA 1WGSA 3CCQA 2LQ8A 3CCLA 3AHUA 3GLXA 4C92D 3CC4Q 2PUKB 2MPXC 4CC2A 2NUTA 4M7DG 1A0NB 3VJPA 4XU2A 4C92C 2EQKA 2QK0A 5LJ5f 2VKNA 2YLCA 2MOXA 5I2SA 2F2WA 9ATCB 4XTUA 2IVWA 1VQOT 1VIEA 3NFCA 1OOTA 1X6BA 1VQ9T 1QP2A 4OB3B 2BKDN 1VQ6A 1G2BA 4K11A 2LVMA 2WSCE 2LCCA 1ZSZC 3QYGB 1CSKA 4C92A 1PD1A 5FU6B 4RTTA 1NPRA 4C8QE 1WYXA 5GAN6 1X69A 3LW5E 1MUZA 2YSQA 3VRZA 1UG1A 3MJXA 3H0IA 2A36A 3EG9B 2RHXA 2DA9A 2LNHB 2X4YA 1WZOA 3C94A 2EGCA 5FU7B 7AT1B 5GAN7 4JRIA 4FW2A 3MP8A 4OP0A 3O8VA 1K8AU 3M0QA 4PJOG 2JS0A 3CCRQ 1GCQC 3SWNA 3JB9I 5GAN5 3HFOA 4FU6A 1VQLT 3BDUA 4M78E 3BDLA 4OMOA 2HQEA 2DZ9A 2YLBA 4WTOB 4LNPA 1KQSA 3I55A 4ZGEB 4DA4A 4M75E 3A8GB 4KGVB 2KRSA 1X2KA 1XQHA 2BZXA 3PGGA 4XAXB 2QQ9A 3JSCA 2QG9B 2VUBA 4BE1A 4HVVA 4BE0A 4JJNK 2O4XB 3V8JA 3MHXA 1X6OA 1RI0A 2DL3A 3E1SA 3GNGA 4Z02A 3A8LB 2ZPBB 3CMET 3OYIA 5GANe 3L42A 1WNLA 1MMNA 3CCUT 5D6YA 2DJQA 3CC7A 2JT4A 1U06A 2RQTA 1TUDA 1RLPC 2CP2A 2DILA 4BUGA 3CCVA 1G83A 1KK7A 3A5ZB 1E6GA 4ZGJB 2DXTA 4OGEA 4Q5WA 1BIBA 3UA6A 5IT9E 4BDYA 4B9XA 3JRZA 1D1BA 4D8DA 4XTYA 3SB2A 5GAOr 3CCET 2KRNA 4FSXA 3L2WA 2IPOB 1YWOA 3H0FA 1OU8A 3OS0A 2KE9A 2V8JA 2OTLA 1RAAB 2DK3A 4J9HA 2CGHA 3M55A 2EKHA 3ASKA 4DEXA 1UEBA 2EGAA 4LUDA 1CKBA 3P8HA 4MMLA 1QCOA 2D1XA 5LJ5j 1FWZA 2MAMA 2KVQG 4C8QF 5GAOm 1KD1U 5DM7R 1BI3A 5FRMA 2RHIA 3CCQT 2EJGA 4KGZB 4HXJA 1I4K1 1WA7A 4WF2A 3GPLA 3CMAA 3CCLQ 3CCQQ 3QZ5B 4HCZA 3LYIA 1FX7A 3JCMX 4JJDA 2EQMA 2RN8A 1W70A 2M02A 1EX4A 2M0YA 3OMGA 1PKSA 4MZPA 2GBQA 3JCMP 4OMMA 4HT8A 3M54A 1YP5A 2R5AA 4OMFB 4Z8AA 3C12A 2HBPA 5KYYA 1T3LA 1VQ6T 1WLPB 2KY9A 5CKBA 2PQWA 3OYCA 3G71T 4M78F 1PM3A 4F16A 3MO8A 3M53A 3G4SA 1VQNT 3FB9A 3I35A 3DKMA 4KGXB 2DYBA 4WCIA 1NJIC 4LD9K 2QTVA 3L2ZA 4M75F 2W10A 1LVKA 2VB6A 4XTZA 4XU1A 1M90U 3MEUA 3OS2A 1QVFA 2XKOC 1DJ7B 4EDUA 4M4ZA 1G3WA 1W6XA 3H6ZA 1RAHB 3VS6A 1N9RA 4N4HA 3G6ET 2K9GA 3H8ZA 2COZA 4LXCA 4HCCA 5CKHA 2EAYA 4M7AB 1UGVA 1Q81R 1ZLMA 1JRIA 2EBPA 2VWFA 4NOYA 1YJNA 4F14A 1QCFA 5EG2A 4C8QD 2E41A 2CYZB 1YCSB 2E65A 4XQ3A 5A0GA 3OYJA 3CQTA 2ZPHB 2BZ8A 1ARKA 1FMVA 1KQSS 2DEQA 4L5GA 4XU3A 1K8AC 4C8QC 3I55T 3HFNA 2RA2A 2RMOA 1VQPA 3LWHA 1MNEA 2CZ0B 1UHFA 3I55Q 1G8XA 4C8QG 5CIUA 4QVDA 4DOWA 4J7FA 4RTVA 5KYUA 3RMQA 4EIKA 4FT4A 3PVQA 5I2MA 3WVDB 2CP5A 3REAB 2XDBA 2JTFA 3L2QA 3ZEHA 4C92E 4M7DB 3JCMV 4A4HA 1VQ8T 2DXBA 2LX9A 1K0XA 4PFZA 4N4IA 2AT1B 1KC8C 2A08A 3QJYA 2K57A 2B8AA 4CI0C 1UB4A 3JCMc 4HVUA 4C0FA 1IREB 1EIFA 2P4TA 2EFIA 4HA8A 3KFVA 3CC7T 3OS5A 3GBQA 3CCSA 3P8BB 3OYHA 1BYMA 4ORZA 3E2UA 4M77B 3CC7Q 4M75D 2DJZA 2O9VA 3QYHB 1AZEA 4PFOA 1RL2A 3CCVQ 1W4SA 4IUTA 2DPPB 4DBRA 4OMQA 3HSBA 1Q95G 1AZGB 4M75C 1U3OA 3PVLA 3VS0A 2VYTA 3JB9F 2KK4A 4E7KA 3L1AA 3QWXX 1WXTA 2FVUA 2DL7A 3MCAB 2C0TA 4M75G 4QQGA 2CZ7B 3OW2P 2OTLT 3U23A 3OYGA 3S3OA 3EH2A 3SHWA 2OTLQ 1JXMA 5M9OA 2JS2A 3EHQA 2XDPA 1VQOA 5GMKh 2EWNA 1VYVA 2FZGB 4XTVA 1VQ9A 5J39A 3SD4A 4PJOB 3VS3A 5GAMg 2V8KA 3PNWC 5CKEA 2GQIA 1OYXA 3RR6A 1WXUA 2HZYA 1X43A 4A4FA 1ZHIA 3EHRA 4KH1B 3CMAT 4AG2C 4J5YA 2PTKA 1FMKA 2LTOA 1BBZA 1PRLC 4HVWA 5A0LA 1KD1C 3CXCP 2LQWA 1NZ9A 4JJCA 5LJ5e 5LJ5d 2QTXA 3M5AA 2CDTA 4RKUE 2EQIA 3OB9A 2DTOA 3G1JA 1N8RR 4PJNA 2EYWA 1Q82C 1PHTA 3EGDB 3C0CA 3SEMA 2ECZA 4KH0B 2VXFA 1M8MA 4E7HA 2GCXA 3EFRA 1BCOA 3G4ST 3EG2A 3RKYA 5IAYA 4MMKA 4X1VA 3KUFA 2XMFA 3LGLA 4A4GA 3GOXA 2DL4A 2ZPEB 2RHZA 1M1KC 1NE8A 5CVIA 2VXEA 3N5BB 3O5ZA 3RMSA 4E6RA 3OYLA 2LJ1A 1W2BA 2DFUA 2JZ2A 3MPUB 5IHIA 1BKBA 3M0TA 4C92F 4CC4B 1KQ2A 2FL7A 1QVGP 2ZPIB 1Z9QA 1RLQC 4FW1A 3TSZA 5CO7A 5CQXA 3X20B 1AWWA 1RI9A 1M90C 1GL5A 3JB9G 3JV3A 1YJNT 3TU4K 5KE3A 1LOJA 2AHJB 1IRXA 1YJNQ 3UA7A 1PNJA 3CMEA 3URGA 1GFDA 1B3QA 3EGUA 1RAEB 2FPDA 3CCUA 4ANJA 4EMKC 2WACA 2YUOA 2NUPB 1YJ9A 2RJEA 2PNIA 2H3EB 2HEQA 1Q7YC 1KIKA 1VQKA 4LDWA 1VQPQ 2HL5C 1HD3A 4NL3A 3ULRB 5CCAA 1OPKA 2DBMA 2OAUA 2HQHA 2K4YA 5GAMf 3OYYA 2I2LA 3I56T 1PC0A 3CCEA 3QBYA 3KXTA 2BTTA 1GCPA 3SDZA 5GMKj 4JPBW 4CC7A 4RG2A 5DY9A 3OYDA 1U1SA 3AT1B 4OB1B 1WHKA 4NL2A 1HJDA 2V8IA 3CCST 2VVKA 3EH1A 3M0PA 3M59A 2DAQA 2LQKA 4OMNA 2DL5A 2QASA 2L0AA 2E12A 2DVJA 2I0NA 2ZAEA 3CCSQ 4PFPA 4OB2B 4J6WA 3M9QA 3F70A 2EQUA 4MZTA 4GLKA 4HCKA 5KYXA 4MDWA 4M7AA 1QLYA 1U1TA 3CXCS 4ZTJA 1K1ZA 5CK9A 1UUEA 4II1A 2L8DA 3M58A 1QMCA 2KT8A 3QPHA 3M0SA 1QWFA 1Q81U 4F04B 2F1LA 2M9UA 4C92G 1K73C 3V8LA 3CCJA 1QKXA 4F7UA 3JCMg 4FYXB 4AG1C 1VQOQ 3VS7A 3FJ5A 1G3YA 1SPKA 2ZPFB 1VQ9Q 2G3RA 3G71A 2K3XA 4RTXA 2MWOA 1VQNA 5LJ5h 2FZCB 1M5Q1 5KH6A 1X6GA 4C0DB 4AFZC 5KYNA 2KYBA 1VA7A 3SWNC 4EMGA 3EFOA 1WJRA 1AD5A 4B9WA 4FL6A 1QVGS 4FM4B 1M2VB 2QDLA 3G6EA 3JAME 2O2OA 1PCXA 1KG1A 3OQ5A 3V7SA 2DEUA 2V1QA 2Y4XA 1WPYA 4M77A 2JXBA 2YDLA 4BDZA 4FYYB 5IHKA 3VS4A 2AKLA 3TVTA 2CT4A 1YNZA 1SRLA 1VQLQ 3OYBA 1WFWA 2EYYA 4DBQA 5CKFA 4M78B 5KYWA 1MMGA 1G3SA 2L2PA 1VQMA 4QT7A 3HL8A 1Y96A 2XIDA 3RDVA 2EJFA 2JM9A 2CSQA 1Q86C 3NTIA 2CP0A 4LD6A 1UHCA 4FT2A 1WHLA 1VQ8A 2D8JA 1VQ7T 3H0HA 2EIFA 4EMHA 5LL6S 5GAMj 2GF7A 4KRTA 2HKQB 1I5OB 4HCBA 5GMKi 3CMEQ 1YN8A 3WXMB 3RUXA 1YJ9T 1WHMA 3CCUQ 1KQSP 4DEYA 3LWIA 2X3WD 4OMLA 3OS1A 1VQKT 1C0MA 2QEXA 4LDYA 3M4YA 1YJ9Q 3V7CA 8AT1B 1PD0A 1VQKQ 3VU3C 1LNXA 2RH2A 4Y92A 1NYFA 2KR3A 2OTJT 4D6WA 5AYFA 1Y57A 3CCEQ 4IURA 2FZKB 1G5VA 1AEYA 1TH7A 5FRNA 3QG1A 1N8RU 2CUBA 5GJWB 1EFNA 4BE2A 3QDFA 2AK5A 3DB4A 2E6ZA 2CP3A 4YTLA 1NLPC 2FEIA 3UDCA 1T0JA 1YCYA 4PJJA 1M30A 4R0KA 1YITA 2HKNA 2KYMA 2E10A 2F2XA 2J6KA 5GMKe 2E1HA 1E6HA 4ZGDB 2SEMA 3FJPA 1WJQA 3UT1A 1SSHA 4IUVA 3H9NA 4J9BA 4Y91A 1C1AA 5GAOp 1BI1A 2LRQA 1BCMA 3PMIA 1GRIA 1VQ5T 5FWCA 2E5KA 5AT1B 3IQLA 2BZYA 3M0UA 3TQ7P 1K9MC 5HKCA 2RQWA 3CCMT 2C0OA 2RNAA 1IGUA 1PKTA 1ZBXA 3CCJT 2R58A 5DLQE 4QQ6A 3QHSA 1OULA 2CSIA 4UC4A 1H3HA 3CCJQ 5GAN4 2NUPA 4D8KA 3NGPA 2NYSA 2O9SA 2GTOA 2DVEA 3S3MA 3VS2A 4QKUA 2RB6A 1VQ6Q 3VYGA 3ER0A 3GIBA 3G71Q 2EKOA 1JQQA 2EGEA 1UJYA 4DBHA 3VKIA 1SKUB 2XK0A 2KSSA 4E7SA 1VQNQ 1QWEA 2HD0A 4KULA 1PSEA 2YRCA 1AT1B 4GY5A 3H41A 5I11A 3QUIA 3BY7A 2WSEE 2ED1A 2YUQA 4RCBA 2DIGA 1OQKA 1LCKA 2O31A 5C0MA 4KUIA 4GBQA 3BW1A 3G6EQ 1D09B 3NTHA 4RUGA 3PT9A 5A2QE 2FB7A 3TREA 2BUDA 3A8HB 4M7AE 1OPLA 3JCMW 2GQVA 2LJ0A 2LDMA 1B7TA 1R77A 1TUCA 1D3BB 1OZ3A 4A4KA 3PIPA 2DF6A 1WJSA 1BB9A 1KSWA 4FSSA 5FWBA 1NM7A 2NUTB 2BE9B 4F7UE 3A1PA 3SFMA 3MKDA 1NJIR 3Q1JA 1QVFP 4KUDK 5FU6C 3HRSA 1H8KA 2LCLA 3ZBDA 1VQMT 4X34A 1RACB 4C5HA 2K2MA 2EW3A 2J05A 3A98A 2JN0A 2KRMA 2EQJA 3I56A 2DERA 2QI2A 3VUZA 1R0BG 4DOVA 4RG8A 2CREA 3JCMJ 5FU7C 1X01A 1VQ8Q 2ZCFB 1YI2A 1JJ2A 3TCJA 2NUZA 3THKA 4C92B 1RADB 3I5SA 2LMJA 4PLIA 2K5IA 2PZ1A 4OGCA 1YHQA 5LJ3g 3GNFB 3ZFJA 3M0RA 2ZPGB 4EPCA 2QEXT 2RK1A 2RHYA 4JS4A 1K9AA 4HT9A 3EG9A 1I1JA 8ATCB 1OU9A 3CC2T 4PNOA 2QEXQ 3L2UA 2E5QA 3CEYA 1M2VA 2LX7A 1D1AA 2D0QB 2FHDA 2FPEA 2RM4A 3DB3A 1YJWT 1WQWA 1ZSZB 3OBWA 4IKFA 2DZCA 3VRYA 5GAMe 5GAMd 3JB9H 2F5KA 2HNIA 4HKEA 3CPWA 2RI3A 3RERA 4AT1B 1WDXA 1BI0A 1MV0B 3QXEB 2E64A 2PU9B 5IHNA 2L3SA 2K2VA 1Y07A 2DO3A 2P0KA 1KC8R 2QDYB 2HSEB 1PRMC 3JCMb 1OX8A 2LQNA 2MIOA 1YITT 5IXBA 2CT3A 2PVGB 4C5GA 3META 2Y90A 2HCKA 4M78A 1YITQ 4ATOA 1QCNA 5CQYA 2VGNA 3NTKA 5I21A 2RF0A 1JXOA 1PSFA 4MDXA 5J3BA 3EGXB 3VYHB 4J8OA 1ZUYA 3NMZC 2C0IA 3CMAQ 2Y4YA 1M1FA 3QZ9B 2O4XA 2RI5A 2E4HA 4QW2A 2YWWA 1V29B 4JLIA 5GAN3 2ATCB 1D1CA 1N27A 2HQXA 4J9FA 2CKKA 4M7AF 2KQWA 2K5LA 4R56A 1BU1A 4ZTFA 4JZ3A 1LJOA 2DX1A 2FYKA 4QVCA 1R8OB 4RMOA 1NBEB 3M4GA 4F7UF 2XDDA 1QW1A 3MP1A 3VV0A 3G4SQ 2L3RA 3RNJA 2MF2A 4PKCC 1QVFS 2DXUA 2JVVA 5FW9A 1S72T 1M9SA 3TSWA 2IG0A 4LDUA 3RBBB 5CR2A 5LJ3f 2VC8A 4IIOA 2DRMA 1KD1R 1M1GA 5D6WA 1OX9A 3OY9A 2PUOB 1FYNA 3CD6A 2XD0A 1GBQA 2J6OA 2GTJA 2OAWA 4RTWA 1VQ7A 1ABOA 3MEAA 1XTDA 3HKSA 1Q82R 4N0AC 1KHIA 1VYTA 4E2FB 5LJ3h 1CKAA 1XNIA 4M77F 3VS1A 4BD3A 2QQSA 1RAFB 4XK8E 2Z0WA 1W2BP 1UJ0A 1M1KR 2DM1A 3A8OB 3G7ZA 1M4ZA 4L6V5 3FDRA 3INZA 1KHCA 3J7AF 1ABQA 2NWMA 4O6JA 1MNDA 2M51A 4PK4A 2L3QA 3MEVA 1HXDA 2ROTA 2DETA 4N0AA 2OTJA 1B07A 1WI7A 2M0OA 1GBRA 2AKKA 2O01E 1D0ZA 4M7AD 4J9GA 2MWPA 4J9IA 3I56Q 1OI1A 3E9GA 2ROLA 1JJ2S 1YI2T 1VIFA 2RHUA 3FIFA 1KFZA 3UPUA 1FXXA 3HTRA 2QQRA 4M7AC 1JEGA 1T0HA 1H3ZA 1YHQT 1I8FA 3PE0A 1ZQ1A 3GP8A 2CS7A 4M7AG 4IUUA 3OYFA 4ZN3A 1I07A 5GAMh 1F1BB 3REBB 3X24B 2FRYA 4LE9A 1QKWA 2DBKA 3JCMe 3JCMd 1Q7YR 2GFAA 4JZ4A 5IXFA 2KDSA 4F7UG 2K79A 2XHCA 4Z89A 2X51A 4M7DD 1SSFA 3WVEB 1VQ5A 2OI3A 2JM8A 2JTEA 3QO3A 3CC4T 3VS5A 1E7OA 1YWPA 1D3BA 3CCMA 1VYUA 5L23A 4M7DC 2RI2A 4JRKA 2HL3A 1IZ6A 1VUBA 2RJDA 2W0ZA 3I9QA 1IXDA 4X9DA 1OEBA 4M77D 2B86A 2CH4W 4KBMB 3A8MB 4J6XA 4FCYA 2CP6A 5KYUB 1NJIU 4M77C 1S1NA 1ACMB 3LH0A 4M7DA 5D6XA 2RQVA 4C0ZA 2KEAA 2KI7A 2FRWA 4M77G 2ENMA 2P84A 4C8QB 1N9SA 5GJVB 2QXFA 3I5RA 4F17A 2H8HA 2K7AA 1V76A 2FPFA 4A54A 1K73R 4PLLA 4PJOD 5LJ3j 2AIRB 4OVAA 2F69A 1YFNA 1WQ7A 2E6NA 3JB9J 3HRTA 4JRPA 1OV3A 1ZSZA 4PJOC 1AWXA 5CKDA 4RCCA 4E47A
chains in the Genus database with same CATH topology
3JB9F 2KK4A 1N6AA 5GAN4 4E7KA 3CCRT 3L1AA 4BB7A 1VQPT 2FVUA 2XU8A 1W2BS 3MCAB 4QQGA 4E7LA 4M75G 2CZ7B 2OTLT 3S3MA 2DVEA 2QA4A 3OYGA 4JLGA 3PIOA 1B34B 2CZ1B 3CBPA 2RB6A 3S3OA 2KMTA 3VYGA 4ELZC 5M9OA 3ER0A 3TEEA 3J80E 2XI9A 3GIBA 2EKOA 2BIVA 2VGMA 2XDPA 3HHTB 1VQOA 5GMKh 4LDVA 2EWNA 4J83A 3M57A 3VKIA 2XK0A 3OW2S 4LDXA 2KSSA 3QIIA 2YRVA 3CD6T 4M75B 4XTVA 4PJOF 3SD4A 5J39A 1VQ9A 3QDRB 4C5EA 2HD0A 4PJOB 4PJOA 4KULA 1PSEA 3QKJA 4EMKA 1KC8U 5GAMg 2V8KA 2QQBA 3PNWC 5CKEA 1P92A 4XTWA 2JNGA 3OBYA 2A3LA 1OYXA 4GY5A 3J81E 3QUIA 2EJ9A 4V2SA 3BY7A 2WSEE 4JUVA 1Y71A 4IUQA 4RCBA 4Y28E 2DIGA 3UWNA 4A4FA 1ZHIA 1UGRB 5C0MA 3FEOA 4KUIA 3CMAT 4J5YA 2X4WA 2LT1A 4X9CA 3BW1A 2RJFA 3CPWS 4BY6C 3FC3A 3NTHA 3OMCA 1XOVA 2LTOA 2QQAA 4DQ2A 3PT9A 1KQ1A 4P5NA 5A2QE 2DTHA 4J7IA 3RKXA 2FB7A 2EYQA 3TREA 2BUDA 3A8HB 5A0LA 5GAOl 1KD1C 4M7AE 3JCMW 2GQVA 3LX7A 3MP6A 2LDMA 3JCMf 1K9MU 3EAEA 2KAFA 3L2VA 1WGSA 1NZ9A 4OB0B 3VUBA 3CC2A 1D3BB 1OZ3A 5LJ5e 5LJ5d 2LQ8A 4A4KA 3CCQA 3PIPA 1K73C 3CCLA 5GANd 1WJSA 3AHUA 3GLXA 2QTXA 3CCJA 4C92D 2PUKB 1YJWA 1MGQA 3M5AA 1I5LA 2C06A 3LLRA 4RKUE 3DLMA 3OB9A 2DTOA 4M7DG 1Q82C 3VJPA 4F7UE 3SFMA 4XU2A 2DTIA 3Q1JA 4C92C 2EQKA 3HRUA 5FU6C 4KUDK 3HRSA 5GAOn 5LJ5f 2LCLA 5KCOA 2YLCA 1BI2A 3ZBDA 3OYEA 4X34A 5I2SA 1VQMT 2VXFA 4C5HA 4E7HA 2GCXA 4XTUA 2IVWA 3EFRA 3G4ST 1VQOT 1VIEA 3RKYA 5IAYA 3JCMh 3R6OA 2XG8D 4MMKA 2JN0A 3KUFA 3LGLA 3NFCA 4A4GA 5GMKl 3GOXA 2EQJA 3I56A 2ZPEB 2RHZA 5GANg 1VQ9T 1QP2A 1M1KC 1NE8A 2VV5A 4OB3B 5CVIA 2QI2A 2VXEA 3N5BB 2BKDN 3VUZA 2JTMA 3CPFA 4DOVA 4RG8A 3RMSA 1VQ6A 3OYLA 3JCMJ 1W2BA 2DD4A 2YHTA 5FU7C 2JZ2A 1X01A 3HPWA 2ZCFB 2LVMA 1YI2A 1BKBA 2WSCE 1JJ2A 2P0QA 3TCJA 2LCCA 4C92F 3QYGB 4C92A 4C92B 5C6SA 2FL7A 5FU6B 1KQ2A 2L89A 1O75A 1NPRA 2ZPIB 4C8QE 3QSUA 5GAN6 4PLIA 2K5IA 3LW5E 4BI8B 4OGCA 1YHQA 5CO7A 2DIQA 5CQXA 5LJ3g 3X20B 2K3YA 2P0PA 3GNFB 3OSSC 3ZFJA 5KE2A 2ZPGB 1M90C 3JB9G 4EPCA 3BFMA 2QEXT 2RK1A 2RHYA 4JS4A 1VQ4A 1YJNT 4HT9A 4M7DB 3TU4K 2RHXA 1MHNA 5KE3A 3CC2T 1LOJA 4PNOA 2X4YA 4QQDA 3C94A 2AHJB 3L2UA 5FU7B 3CCLT 2E5QA 3CEYA 5GAN7 3CMEA 2D0QB 2FHDA 2RM4A 4JRIA 5IN1A 3DB3A 3PMTA 3URGA 1WQWA 1YJWT 3OBWA 3CCUA 4IKFA 3MP8A 4OP0A 4EMKC 2WACA 3O8VA 2DZCA 3JB9H 5GAMe 5GAMd 1K8AU 2F5KA 2HNIA 4HKEA 3CPWA 2RI3A 1O9SA 1YJ9A 2RJEA 3RKWA 3RERA 1BI0A 1Q82U 4PJOG 1Q7YC 4ME7A 1VQKA 3QXEB 4LDWA 2E64A 3SWNA 1Y7XA 2PU9B 2ZZDA 5DLOA 3JB9I 4NL3A 1NPPA 2K2VA 2CZ6B 5GAN5 1Q81C 5CCAA 1Y07A 3EFSA 2DO3A 2P0KA 3HFOA 5FROA 4FU6A 1VQLT 2OAUA 2QDYB 2K4YA 3BDUA 3OYYA 2I2LA 4M78E 5GAMf 3I56T 3BDLA 3CCEA 2HQEA 2DZ9A 2YLBA 3JCMb 1M1KU 3QBYA 3KXTA 1KQSA 3I55A 4ZGEB 3SDZA 4PL6A 4EMKB 5GMKj 1YITT 4RG2A 2PVGB 5DY9A 1S72A 4DA4A 4C5GA 3META 2M16A 2Y90A 4M75E 4M78A 3T9NA 3OYDA 3DLLA 4ATOA 3A8GB 5CQYA 2VGNA 1XQHA 3NTKA 3PGGA 1U1SA 5I21A 4OB1B 4XAXB 2RK2A 4NL2A 2QQ9A 3JSCA 1PSFA 2V8IA 4C0GA 3CCST 4MDXA 5J3BA 3VYHB 2R5MA 2VUBA 4J8OA 3M59A 3OYKA 2DAQA 2LQKA 1U8RA 2Y4YA 4BE1A 2E12A 1M1FA 2RD1A 3QZ9B 1NJIU 4OB2B 4BE0A 4JJNK 2O4XA 2O4XB 2RI5A 3V8JA 3M56A 3MHXA 1X6OA 1RI0A 2RO0A 4IUPA 3E1SA 4QW2A 3GNGA 5GAOq 1V29B 4J6WA 4JDSA 4Z02A 3M9QA 5L8RE 3A8LB 5A0DA 2ZPBB 1OZ2A 3F70A 3CMET 4JLIA 5GAN3 3OYIA 5GANe 2EQUA 4MZTA 1N27A 3L42A 1WNLA 2HQXA 5D6YA 4GLKA 3CCUT 4M7AF 2CKKA 4MDWA 3CC7A 1YIJA 4M7AA 1U1TA 2KQWA 1BIAA 2K5LA 4R56A 2RJCA 3V7RA 3CXCS 4ZTJA 4ZTFA 5CK9A 4BY6B 2QA4T 4II1A 3CCVA 1Q7YU 4BUGA 2L8DA 3A5ZB 1LJOA 5FLXE 2FYKA 3M58A 2DXTA 1X75C 3QPHA 4OGEA 4ZGJB 4Q5WA 1BIBA 4QVCA 5GANf 2DD5A 2X35A 1Q81U 5IT9E 1R8OB 4BDYA 4RMOA 2M9UA 3M4GA 5LJ3d 3V8LA 4B9XA 4C0DC 4C92G 4F7UF 5LJ3e 3JRZA 4F7UA 1QW1A 4F7UB 2XDDA 4XTYA 3SB2A 3JCMg 5GAOr 3CCET 3X28B 3MP1A 3VV0A 4FSXA 2MMPA 3OSVA 2L3RA 3C95A 3L2WA 2MF2A 4PKCC 3OS0A 2LT4A 1QVFS 1G3YA 2V8JA 2DXUA 2JVVA 2OTLA 2ZPFB 1S72T 1M9SA 2IG0A 4LDUA 4M7DE 2DK3A 2G3RA 3G71A 4ELYC 4BACA 2K3XA 5CR2A 5LJ3f 3FRNA 2R57A 4FIBA 2HAXA 2MWOA 2CGHA 2E70A 2JUFA 2VC8A 3M55A 3ASKA 2JOYA 3QJ6A 1M1GA 3V8KA 1VQNA 5LJ5h 3PFSA 1GXIE 1UEBA 5D6WA 5GANh 2A7YA 2PUOB 2X4JA 3OY9A 1M5Q1 5KH6A 4C0DB 3CD6A 3OW2A 3P8HA 2XD0A 4MMLA 5LJ5j 1FWZA 2MAMA 3SWNC 4EMGA 2KVQG 4C8QF 1WJRA 5GAOm 4C8QA 5DM7R 1KD1U 1VQ7A 4B9WA 4N4GA 4FL6A 1QVGS 1BI3A 1HK9A 4FM4B 3MEAA 5FRMA 2RHIA 4M77E 3CCQT 2EJGA 1XTDA 3HKSA 4M78D 3G6EA 4N0AC 1KHIA 3JAME 1AHJB 5HK0A 1I4K1 4WF2A 2DKGA 3GPLA 3CMAA 1KG1A 3OQ5A 3V7SA 5LJ3h 3QZ5B 2Y4XA 1WPYA 1XNIA 4HCZA 4M77F 3LYIA 1UGSB 1FX7A 4M77A 4BD3A 3JCMX 2QQSA 4M78C 4XK8E 3CCVT 4BDZA 3RIRA 2EQMA 4BI4A 3SWNB 3A8OB 3G7ZA 1M4ZA 2F5TX 3OMGA 4E7IA 3CC4A 4M78G 4MZPA 3FDRA 2GFUA 3INZA 3GF5A 4L6V5 1KHCA 4VUBA 3JCMP 1JB0E 3J7AF 1K73U 1QVPA 4O6JA 4HT8A 3M54A 2R5AA 3MEVA 1HXDA 4OMFB 3C12A 5GMKm 4E7JA 4N0AA 2OTJA 2M0OA 2HBPA 2O01E 3MEWA 3OYBA 4M7AD 1VQ6T 2MWPA 1OI1A 3HP9A 2D6FA 2KY9A 3E9GA 5CKBA 1B34A 3X26B 2PQWA 3CXCA 3OYCA 1JJ2S 2M1HA 3C4SA 3G71T 1YI2T 1VIFA 2RHUA 3FIFA 4M78F 3UPUA 5CKFA 4M78B 4PJOE 1FXXA 1QP3A 4BI3A 1G3SA 2QQRA 1VQMA 4M7AC 2LC4A 3HL8A 1Y96A 1Y96B 3MO8A 3M53A 2XIDA 3G4SA 1N8RC 1VQNT 3FB9A 1H3ZA 2EJFA 3DKMA 3JCMQ 1NJIC 1YHQT 1I8FA 1Q86C 4LD9K 3NTIA 1ZQ1A 3GP8A 1UGQB 3L2ZA 2H3JA 4LD6A 4M75F 4M75A 2CS7A 4FT2A 3S6WA 4M7AG 1VQ8A 4IUUA 3X25B 4JRQA 4XTZA 4XU1A 4O5VA 1M90U 5HK3A 3OYFA 3MEUA 4ZN3A 5GAMh 3OS2A 1VQ4T 1VQ7T 4MZMA 1QVFA 3PTAA 2XKOC 1DJ7B 2EIFA 4EDUA 1G3WA 3X24B 2PVDB 3H6ZA 1H641 1N9RA 4N4HA 5LL6S 1YBYA 2GF7A 4EMHA 3JCMe 3JCMd 5GAMj 3G6ET 2DXCA 3H8ZA 2LNVA 4OF1A 4HCCA 2GFAA 2XICA 4HCBA 5CKHA 2EAYA 5GMKi 2KDSA 4M7AB 4F7UG 2XHCA 3WXMB 3RUXA 3OYNA 1YJ9T 2PVOB 3OYMA 4M7DD 1SSFA 3WVEB 3LWIA 1JRIA 1VQ5A 3CBMA 3OS1A 3S3NA 2QEXA 4NOYA 4JS5A 4LDYA 1VQKT 3M4YA 1YJNA 3V7CA 4QVZA 3QO3A 1JBMA 5GAN8 4J6YA 3CC4T 5EG2A 4C8QD 2E41A 4CRIA 1QVGA 1D3BA 3VU3C 2CYZB 1G3TA 3CCMA 1LNXA 2D9TA 2E65A 4XQ3A 5A0GA 2RH2A 3OYJA 4M7DC 2ZPHB 2RI2A 4TVRA 4R55A 4JRKA 1IZ6A 4XU0A 2OTJT 5J26A 4D6WA 5GAN2 1VUBA 1KQSS 4M7DA 2DEQA 4L5GA 4XU3A 2RJDA 5AYFA 1K8AC 4C8QC 2NLUA 3I55T 3HFNA 3CCRA 2RA2A 4X9DA 1VQPA 3LWHA 4IURA 2CZ0B 4M77D 1G5VA 3CBOA 3KBGA 3FLGA 1UGPB 4C8QG 4KBMB 5CIUA 4QVDA 4DOWA 3A8MB 1M8VA 4J6XA 1TH7A 4J7FA 5FRNA 5CAIA 4A53A 3QG1A 1N8RU 4C5IA 4BE2A 1VQLA 3DB4A 3RMQA 2E6ZA 4FT4A 4M77C 5LJ5g 3OYAA 4YTLA 5I2MA 3WVDB 4NS5A 4ZN1A 1Q86U 2XDBA 4M7DF 2JTFA 2L5QA 3LH0A 3UDCA 3ZEHA 4C92E 3JCMV 4A4HA 3L2QA 1VQ8T 4L59A 2DXBA 1YCYA 2LX9A 5D6XA 4C0ZA 4N4IA 3JB9D 3P8DA 1YITA 4M77G 3E19A 5GANj 1KC8C 2ZGWA 3LGFA 4C8QB 3QJYA 1N9SA 2E10A 2K57A 2MI6A 2X4XA 2B8AA 2QXFA 4CI0C 1UB4A 3OA6A 3JCMc 4C0FA 1IREB 2E1HA 1EIFA 5GMKe 2P4TA 2EFIA 4HA8A 5KCHA 4ZGDB 3FJPA 5HY6A 1WJQA 3UT1A 3CC7T 4IUVA 1YIJT 4Y91A 3OS5A 3CCSA 3P8BB 5GAOp 3OYHA 1BI1A 2LRQA 1BYMA 4A54A 3PMIA 4M77B 1VQ5T 4PLLA 4M75D 4PJOD 5LJ3j 2DJZA 3QYHB 1RL2A 2K5FA 4KT0E 3E9FA 4OVAA 2F69A 2WSFE 1K9MC 5HKCA 1W4SA 3CCMT 4IUTA 2DPPB 4A4EA 1WQ7A 1ZBXA 1I81A 2E6NA 3JB9J 3CCJT 3HSBA 2R58A 3HRTA 3ME9A 4M75C 4XTXA 4QQ6A 5DLQE 3L2RA 4JRPA 4PJOC 3QHSA 5CKDA 4RCCA 4UC4A 3RESA 2VYTA 4E47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7K A;  4PLI A;  2X35 A;  4EDU A;  4QQG A;  4E7L A;  4BDY A;  2DIQ A;  4B9X A;  3H6Z A;  3S3M A;  3OYG A;  2K3Y A;  4N4H A;  2GF7 A;  5KE2 A;  3H8Z A;  3MP1 A;  3S3O A;  2L3R A;  2RHY A;  3L2W A;  2GFA A;  5M9O A;  3OS0 A;  2RHX A;  1MHN A;  5KE3 A;  2EKO A;  2BIV A;  2XDP A;  2X4Y A;  4QQD A;  3OYN A;  3L2U A;  2IG0 A;  2E5Q A;  3OYM A;  3CEY A;  1SSF A;  2G3R A;  2XK0 A;  2FHD A;  3OS1 A;  2K3X A;  2YRV A;  3QII A;  3DB3 A;  3PMT A;  5IN1 A;  5J39 A;  3SD4 A;  4BAC A;  3S3N A;  2R57 A;  4C5E A;  4IKF A;  3MP8 A;  2MWO A;  3QKJ A;  4QVZ A;  2WAC A;  3O8V A;  3OYE A;  3ASK A;  3QJ6 A;  2F5K A;  4CRI A;  3PNW C;  2RI3 A;  3PFS A;  2RJE A;  2D9T A;  5D6W A;  3OY9 A;  1OYX A;  4GY5 A;  3OYJ A;  5KH6 A;  2RI2 A;  3P8H A;  4IUQ A;  5J26 A;  2DIG A;  3UWN A;  4A4F A;  2RJD A;  3FEO A;  5C0M A;  1WJR A;  2NLU A;  2X4W A;  4B9W A;  4N4G A;  2RJF A;  4FL6 A;  2P0K A;  3FC3 A;  3MEA A;  4FU6 A;  5FRO A;  3NTH A;  4IUR A;  2RHI A;  3OMC A;  5FRM A;  1G5V A;  2LTO A;  3FLG A;  3BDL A;  2HQE A;  5CIU A;  2BUD A;  3QBY A;  5FRN A;  3LX7 A;  3MP6 A;  2LDM A;  3OQ5 A;  4PL6 A;  4C5I A;  4BE2 A;  3EAE A;  3L2V A;  4HCZ A;  1WGS A;  1XNI A;  4RG2 A;  3DB4 A;  1OZ3 A;  3LYI A;  3OYA A;  4BD3 A;  4C5G A;  2QQS A;  3MET A;  2M16 A;  1WJS A;  4NS5 A;  2JTF A;  3LH0 A;  3L2Q A;  3ZEH A;  4A4H A;  3OYD A;  4BDZ A;  4L59 A;  5D6X A;  2EQM A;  3NTK A;  3LLR A;  4N4I A;  3DLM A;  3P8D A;  3OMG A;  4E7I A;  3LGF A;  3OB9 A;  3FDR A;  2GFU A;  2X4X A;  1KHC A;  2B8A A;  2R5M A;  3OYK A;  3OA6 A;  2DAQ A;  3Q1J A;  2EQK A;  2R5A A;  3MEV A;  4BE1 A;  4E7J A;  2EFI A;  5KCH A;  5KCO A;  2M0O A;  4BE0 A;  3MEW A;  2RI5 A;  2O4X B;  2O4X A;  1WJQ A;  4X34 A;  4IUV A;  3UT1 A;  4C5H A;  3OYB A;  1RI0 A;  4E7H A;  2MWP A;  2RO0 A;  4IUP A;  4QW2 A;  1OI1 A;  3OYH A;  2LRQ A;  3E9G A;  4Z02 A;  3M9Q A;  5IAY A;  2PQW A;  3PMI A;  3OYC A;  1OZ2 A;  2M1H A;  3C4S A;  3F70 A;  3KUF A;  3LGL A;  2RHU A;  4A4G A;  2EQJ A;  4PLL A;  2EQU A;  2RHZ A;  3OYI A;  3GOX A;  1N27 A;  3L42 A;  2HQX A;  5D6Y A;  2BKD N;  2QQR A;  2CKK A;  3MO8 A;  3E9F A;  4OVA A;  1H3Z A;  3OYL A;  4IUT A;  2JZ2 A;  2RJC A;  4A4E A;  3OYF A;  4ZTJ A;  3NTI A;  2E6N A;  2LVM A;  4ZTF A;  2R58 A;  4II1 A;  4LD6 A;  3ME9 A;  2LCC A;  4QQ6 A;  3S6W A;  3L2R A;  2L8D A;  4IUU A;  5C6S A;  2L89 A;  4UC4 A;  4Q5W A;  2VYT A;  3MEU A;  3OS2 A; 
#chains in the Genus database with same CATH topology
 3CCR T;  1WX6 A;  2XU8 A;  1W2B S;  4E7L A;  4AFS C;  3R6N A;  2LP5 A;  4DBF A;  2QA4 A;  4JLG A;  1B34 B;  2CZ1 B;  2K3B A;  1J3T A;  2IIM A;  2SRC A;  4ELZ C;  3TEE A;  2BIV A;  2VGM A;  2MCN A;  2X3X D;  4LDV A;  1TOV A;  1AVZ C;  2RPN A;  4LDX A;  1IO6 A;  2HDA A;  2J6F A;  3QII A;  3CD6 T;  1IGQ A;  4M75 B;  2GNC A;  4RTU A;  4PJO A;  3QKJ A;  1KC8 U;  3CD6 Q;  1P92 A;  4XTW A;  3OBY A;  2A3L A;  2COW A;  3J81 E;  1ZUU A;  4PJM A;  4JUV A;  1VQ7 Q;  2HSP A;  1GCQ A;  4Y28 E;  2KT1 A;  1UGR B;  3FEO A;  1HYO A;  4J9D A;  1TS9 A;  3EGX A;  3LH5 A;  1V1C A;  3FC3 A;  3OMC A;  1XOV A;  2QQA A;  1AWJ A;  4P5N A;  4J7I A;  3RKX A;  2MK5 A;  2EYQ A;  2A0F B;  1UTI A;  2EYX A;  3JCM f;  2DL8 A;  3EAE A;  3CC2 A;  4OB0 B;  1RAI B;  3VUB A;  2RQR A;  5GAN d;  2YRD A;  1N5Z A;  1YJW A;  2KBT A;  1MGQ A;  2D8H A;  2E3I A;  1I5L A;  1K0S A;  2C06 A;  3LLR A;  3DLM A;  2OTJ Q;  1NLO C;  2FO0 A;  2DTI A;  1Q86 R;  3HRU A;  3EGD A;  5GAO n;  2QAZ A;  5KCO A;  2FG0 A;  1BI2 A;  3OYE A;  5D7U A;  1AOJ A;  3JCM h;  3R6O A;  2XG8 D;  5GMK l;  2O88 A;  5GAN g;  2ABL A;  2VV5 A;  2JTM A;  3CPF A;  2DD4 A;  2YHT A;  3HPW A;  5HCK A;  4LN2 A;  2V26 A;  2DRK A;  2CUD A;  2DMO A;  2P0Q A;  1EZZ B;  5C6S A;  2DNU A;  2L89 A;  1O75 A;  3QSU A;  1H92 A;  4BI8 B;  2DIQ A;  2EPD A;  2K3Y A;  2P0P A;  3OSS C;  4GLM A;  5KE2 A;  1U5S A;  3BFM A;  3EG1 A;  1VQ4 A;  4ESR A;  1MHN A;  1VQ5 Q;  6AT1 B;  4QQD A;  3CCL T;  4AFU C;  1ZUK A;  2YUN A;  1TXQ A;  1ZA1 B;  5IN1 A;  3PMT A;  3CCM Q;  4OMP A;  2HMA A;  1QQJ A;  1O9S A;  3RKW A;  1ZBJ A;  1Q82 U;  2KRO A;  1WXB A;  4ME7 A;  4PJL A;  3UAT A;  1Y7X A;  2ZZD A;  5DLO A;  1NPP A;  2CZ6 B;  1Q81 C;  3EFS A;  5FRO A;  1NYG A;  5I22 A;  1M3B A;  1RUW A;  1M1K U;  2X9H A;  1D0Y A;  4EMK B;  4PL6 A;  3ZL7 C;  1W1F A;  1S72 A;  1WHJ A;  3T9N A;  2M16 A;  3DLL A;  2RK2 A;  1ZA2 B;  2KGT A;  4C0G A;  1K9M R;  2J7I A;  2R5M A;  3OYK A;  1K4U S;  1U8R A;  1JU5 C;  2COY A;  2RD1 A;  1TWB A;  1M2O A;  1M3C A;  2JJ9 A;  3M56 A;  2RO0 A;  4IUP A;  5GAO q;  1RAG B;  4JDS A;  5L8R E;  5A0D A;  1OZ2 A;  2LCS A;  2OX7 A;  1SF9 A;  5KYX B;  1YIJ A;  1IB8 A;  1BIA A;  1TU0 B;  2RJC A;  3V7R A;  2ED0 A;  5ECA A;  4BY6 B;  2QA4 T;  1Q7Y U;  1D0X A;  5FLX E;  1X75 C;  2QA4 Q;  5GAN f;  2DD5 A;  2X35 A;  5LJ3 d;  5LJ3 e;  4C0D C;  1ZSG A;  4F7U B;  2V1R A;  1VQM Q;  1MV3 A;  3X28 B;  2MMP A;  3OSV A;  3C95 A;  2EVR A;  1WIE A;  2LT4 A;  1T3S A;  4IIM A;  1GFC A;  4M7D E;  2G6F X;  4ELY C;  4BAC A;  2YT6 A;  3FRN A;  2R57 A;  2KNB B;  4FIB A;  4FYV B;  2HAX A;  3BE3 A;  2JUF A;  2E70 A;  3EG0 A;  3QJ6 A;  2JOY A;  3V8K A;  1GXI E;  3PFS A;  4RTZ A;  5GAN h;  2A7Y A;  2X4J A;  1JO8 A;  1NEG A;  3OW2 A;  2JMC A;  2BE7 D;  2HBW A;  3EFO B;  1WHH A;  4C8Q A;  4N4G A;  1HK9 A;  1K8A R;  2DYI A;  4FYW B;  4M77 E;  2ESW A;  2J06 A;  1NEB A;  1Y0M A;  4M78 D;  4JJB A;  1AHJ B;  5HK0 A;  3CC2 Q;  2DKG A;  1VOM A;  1MMD A;  1YJW Q;  1UGS B;  2AZS A;  1NG2 A;  4M78 C;  3CCV T;  4A63 B;  2KXC A;  3RIR A;  4BI4 A;  3SWN B;  2F5T X;  4E7I A;  3CC4 A;  1JJ2 P;  4M78 G;  1SG5 A;  2GFU A;  3EG3 A;  3GF5 A;  4VUB A;  1JB0 E;  1K73 U;  1QVP A;  2JMA A;  5GMK m;  4E7J A;  3MEW A;  3HP9 A;  2CP7 A;  2D6F A;  2D0N A;  3X26 B;  3CXC A;  1B34 A;  1M3A A;  2M1H A;  3C4S A;  2L3P A;  5KYW B;  4PJO E;  4BI3 A;  1QP3 A;  1XJW B;  2YXY A;  2LC4 A;  2VAS A;  1Y96 B;  1N8R C;  1R0C B;  3JCM Q;  2QGF B;  1UGQ B;  2H3J A;  4M75 A;  3S6W A;  2DE0 X;  1TTH B;  3CPW P;  3X25 B;  4JRQ A;  4O5V A;  4B6M A;  5HK3 A;  1VQ4 T;  1KJW A;  4MZM A;  3PTA A;  2PVD B;  1FMW A;  1PWT A;  1VQ4 Q;  1H64 1;  1YBY A;  2KXD A;  2DXC A;  2LNV A;  4OF1 A;  1LPL A;  2XIC A;  1SEM A;  3QWY A;  3OYN A;  2PVO B;  1IHW A;  3OYM A;  4RTY A;  1ZX6 A;  3CBM A;  3S3N A;  1K76 A;  4JS5 A;  4Z88 A;  4QVZ A;  1JBM A;  5GAN 8;  4J6Y A;  1IHV A;  3NHN A;  2AZV A;  4CRI A;  1QVG A;  1BK2 A;  1G3T A;  2D9T A;  4AMC A;  4TVR A;  4R55 A;  4XU0 A;  5J26 A;  4ZNX A;  5GAN 2;  1I0C A;  4LUE A;  2MYS A;  2NLU A;  3CCR A;  3CBO A;  3KBG A;  3FLG A;  1UGP B;  1M8V A;  2F2V A;  1S72 Q;  5CAI A;  4A53 A;  4C5I A;  1VQL A;  2E3H A;  5LJ5 g;  1Q86 U;  3OYA A;  4NS5 A;  4ZN1 A;  4M7D F;  2L5Q A;  2A28 A;  4L59 A;  2P4R A;  2K6D A;  2GGR A;  2YUP A;  3JB9 D;  3P8D A;  2LZ6 B;  3E19 A;  5GAN j;  2QYZ A;  3UF4 A;  2ZGW A;  3LGF A;  1SRM A;  2MI6 A;  2X4X A;  3OA6 A;  2EYZ A;  5KCH A;  1TSF A;  5HY6 A;  1YIJ T;  4CC3 A;  1MMA A;  2RQU A;  1M27 C;  2A37 A;  1YIJ Q;  2K5F A;  4KT0 E;  3E9F A;  2WSF E;  2OJ2 A;  1HSQ A;  4A4E A;  1I81 A;  2CH4 A;  3ME9 A;  4XTX A;  3L2R A;  4AFQ C;  1TUG B;  3RES A;  5KYY B;  1N6A A;  1RAB B;  4BB7 A;  1VQP T;  1UFF A;  5EC7 A;  1SHF A;  3PIO A;  3CBP A;  4E7Z A;  1UEC A;  1Z9Z A;  1TG0 A;  1UDL A;  2KMT A;  1M90 R;  3J80 E;  2XI9 A;  1YI2 Q;  2QGG A;  4J9C A;  3HHT B;  2LJ3 A;  1PG5 B;  1C6V X;  4J83 A;  3M57 A;  3NPF A;  3OW2 S;  1SHG A;  1WHG A;  2YRV A;  4PJO F;  5IH2 A;  3QDR B;  4C5E A;  2JW4 A;  4EMK A;  1YHQ Q;  3D7S B;  2QQB A;  1UE9 A;  2JNG A;  1X27 A;  4V2S A;  2EJ9 A;  1Y71 A;  4IUQ A;  4J9E A;  3UWN A;  2X4W A;  2LT1 A;  4X9C A;  2RJF A;  3CPW S;  4BY6 C;  4DQ2 A;  1KQ1 A;  2DTH A;  2DLP A;  1X2Q A;  1AWO A;  5GAO l;  3LX7 A;  3MP6 A;  1K9M U;  2KAF A;  3L2V A;  1WGS A;  3CCQ A;  2LQ8 A;  3CCL A;  3AHU A;  3GLX A;  4C92 D;  3CC4 Q;  2PUK B;  2MPX C;  4CC2 A;  2NUT A;  4M7D G;  1A0N B;  3VJP A;  4XU2 A;  4C92 C;  2EQK A;  2QK0 A;  5LJ5 f;  2VKN A;  2YLC A;  2MOX A;  5I2S A;  2F2W A;  9ATC B;  4XTU A;  2IVW A;  1VQO T;  1VIE A;  3NFC A;  1OOT A;  1X6B A;  1VQ9 T;  1QP2 A;  4OB3 B;  2BKD N;  1VQ6 A;  1G2B A;  4K11 A;  2LVM A;  2WSC E;  2LCC A;  1ZSZ C;  3QYG B;  1CSK A;  4C92 A;  1PD1 A;  5FU6 B;  4RTT A;  1NPR A;  4C8Q E;  1WYX A;  5GAN 6;  1X69 A;  3LW5 E;  1MUZ A;  2YSQ A;  3VRZ A;  1UG1 A;  3MJX A;  3H0I A;  2A36 A;  3EG9 B;  2RHX A;  2DA9 A;  2LNH B;  2X4Y A;  1WZO A;  3C94 A;  2EGC A;  5FU7 B;  7AT1 B;  5GAN 7;  4JRI A;  4FW2 A;  3MP8 A;  4OP0 A;  3O8V A;  1K8A U;  3M0Q A;  4PJO G;  2JS0 A;  3CCR Q;  1GCQ C;  3SWN A;  3JB9 I;  5GAN 5;  3HFO A;  4FU6 A;  1VQL T;  3BDU A;  4M78 E;  3BDL A;  4OMO A;  2HQE A;  2DZ9 A;  2YLB A;  4WTO B;  4LNP A;  1KQS A;  3I55 A;  4ZGE B;  4DA4 A;  4M75 E;  3A8G B;  4KGV B;  2KRS A;  1X2K A;  1XQH A;  2BZX A;  3PGG A;  4XAX B;  2QQ9 A;  3JSC A;  2QG9 B;  2VUB A;  4BE1 A;  4HVV A;  4BE0 A;  4JJN K;  2O4X B;  3V8J A;  3MHX A;  1X6O A;  1RI0 A;  2DL3 A;  3E1S A;  3GNG A;  4Z02 A;  3A8L B;  2ZPB B;  3CME T;  3OYI A;  5GAN e;  3L42 A;  1WNL A;  1MMN A;  3CCU T;  5D6Y A;  2DJQ A;  3CC7 A;  2JT4 A;  1U06 A;  2RQT A;  1TUD A;  1RLP C;  2CP2 A;  2DIL A;  4BUG A;  3CCV A;  1G83 A;  1KK7 A;  3A5Z B;  1E6G A;  4ZGJ B;  2DXT A;  4OGE A;  4Q5W A;  1BIB A;  3UA6 A;  5IT9 E;  4BDY A;  4B9X A;  3JRZ A;  1D1B A;  4D8D A;  4XTY A;  3SB2 A;  5GAO r;  3CCE T;  2KRN A;  4FSX A;  3L2W A;  2IPO B;  1YWO A;  3H0F A;  1OU8 A;  3OS0 A;  2KE9 A;  2V8J A;  2OTL A;  1RAA B;  2DK3 A;  4J9H A;  2CGH A;  3M55 A;  2EKH A;  3ASK A;  4DEX A;  1UEB A;  2EGA A;  4LUD A;  1CKB A;  3P8H A;  4MML A;  1QCO A;  2D1X A;  5LJ5 j;  1FWZ A;  2MAM A;  2KVQ G;  4C8Q F;  5GAO m;  1KD1 U;  5DM7 R;  1BI3 A;  5FRM A;  2RHI A;  3CCQ T;  2EJG A;  4KGZ B;  4HXJ A;  1I4K 1;  1WA7 A;  4WF2 A;  3GPL A;  3CMA A;  3CCL Q;  3CCQ Q;  3QZ5 B;  4HCZ A;  3LYI A;  1FX7 A;  3JCM X;  4JJD A;  2EQM A;  2RN8 A;  1W70 A;  2M02 A;  1EX4 A;  2M0Y A;  3OMG A;  1PKS A;  4MZP A;  2GBQ A;  3JCM P;  4OMM A;  4HT8 A;  3M54 A;  1YP5 A;  2R5A A;  4OMF B;  4Z8A A;  3C12 A;  2HBP A;  5KYY A;  1T3L A;  1VQ6 T;  1WLP B;  2KY9 A;  5CKB A;  2PQW A;  3OYC A;  3G71 T;  4M78 F;  1PM3 A;  4F16 A;  3MO8 A;  3M53 A;  3G4S A;  1VQN T;  3FB9 A;  3I35 A;  3DKM A;  4KGX B;  2DYB A;  4WCI A;  1NJI C;  4LD9 K;  2QTV A;  3L2Z A;  4M75 F;  2W10 A;  1LVK A;  2VB6 A;  4XTZ A;  4XU1 A;  1M90 U;  3MEU A;  3OS2 A;  1QVF A;  2XKO C;  1DJ7 B;  4EDU A;  4M4Z A;  1G3W A;  1W6X A;  3H6Z A;  1RAH B;  3VS6 A;  1N9R A;  4N4H A;  3G6E T;  2K9G A;  3H8Z A;  2COZ A;  4LXC A;  4HCC A;  5CKH A;  2EAY A;  4M7A B;  1UGV A;  1Q81 R;  1ZLM A;  1JRI A;  2EBP A;  2VWF A;  4NOY A;  1YJN A;  4F14 A;  1QCF A;  5EG2 A;  4C8Q D;  2E41 A;  2CYZ B;  1YCS B;  2E65 A;  4XQ3 A;  5A0G A;  3OYJ A;  3CQT A;  2ZPH B;  2BZ8 A;  1ARK A;  1FMV A;  1KQS S;  2DEQ A;  4L5G A;  4XU3 A;  1K8A C;  4C8Q C;  3I55 T;  3HFN A;  2RA2 A;  2RMO A;  1VQP A;  3LWH A;  1MNE A;  2CZ0 B;  1UHF A;  3I55 Q;  1G8X A;  4C8Q G;  5CIU A;  4QVD A;  4DOW A;  4J7F A;  4RTV A;  5KYU A;  3RMQ A;  4EIK A;  4FT4 A;  3PVQ A;  5I2M A;  3WVD B;  2CP5 A;  3REA B;  2XDB A;  2JTF A;  3L2Q A;  3ZEH A;  4C92 E;  4M7D B;  3JCM V;  4A4H A;  1VQ8 T;  2DXB A;  2LX9 A;  1K0X A;  4PFZ A;  4N4I A;  2AT1 B;  1KC8 C;  2A08 A;  3QJY A;  2K57 A;  2B8A A;  4CI0 C;  1UB4 A;  3JCM c;  4HVU A;  4C0F A;  1IRE B;  1EIF A;  2P4T A;  2EFI A;  4HA8 A;  3KFV A;  3CC7 T;  3OS5 A;  3GBQ A;  3CCS A;  3P8B B;  3OYH A;  1BYM A;  4ORZ A;  3E2U A;  4M77 B;  3CC7 Q;  4M75 D;  2DJZ A;  2O9V A;  3QYH B;  1AZE A;  4PFO A;  1RL2 A;  3CCV Q;  1W4S A;  4IUT A;  2DPP B;  4DBR A;  4OMQ A;  3HSB A;  1Q95 G;  1AZG B;  4M75 C;  1U3O A;  3PVL A;  3VS0 A;  2VYT A;  3JB9 F;  2KK4 A;  4E7K A;  3L1A A;  3QWX X;  1WXT A;  2FVU A;  2DL7 A;  3MCA B;  2C0T A;  4M75 G;  4QQG A;  2CZ7 B;  3OW2 P;  2OTL T;  3U23 A;  3OYG A;  3S3O A;  3EH2 A;  3SHW A;  2OTL Q;  1JXM A;  5M9O A;  2JS2 A;  3EHQ A;  2XDP A;  1VQO A;  5GMK h;  2EWN A;  1VYV A;  2FZG B;  4XTV A;  1VQ9 A;  5J39 A;  3SD4 A;  4PJO B;  3VS3 A;  5GAM g;  2V8K A;  3PNW C;  5CKE A;  2GQI A;  1OYX A;  3RR6 A;  1WXU A;  2HZY A;  1X43 A;  4A4F A;  1ZHI A;  3EHR A;  4KH1 B;  3CMA T;  4AG2 C;  4J5Y A;  2PTK A;  1FMK A;  2LTO A;  1BBZ A;  1PRL C;  4HVW A;  5A0L A;  1KD1 C;  3CXC P;  2LQW A;  1NZ9 A;  4JJC A;  5LJ5 e;  5LJ5 d;  2QTX A;  3M5A A;  2CDT A;  4RKU E;  2EQI A;  3OB9 A;  2DTO A;  3G1J A;  1N8R R;  4PJN A;  2EYW A;  1Q82 C;  1PHT A;  3EGD B;  3C0C A;  3SEM A;  2ECZ A;  4KH0 B;  2VXF A;  1M8M A;  4E7H A;  2GCX A;  3EFR A;  1BCO A;  3G4S T;  3EG2 A;  3RKY A;  5IAY A;  4MMK A;  4X1V A;  3KUF A;  2XMF A;  3LGL A;  4A4G A;  3GOX A;  2DL4 A;  2ZPE B;  2RHZ A;  1M1K C;  1NE8 A;  5CVI A;  2VXE A;  3N5B B;  3O5Z A;  3RMS A;  4E6R A;  3OYL A;  2LJ1 A;  1W2B A;  2DFU A;  2JZ2 A;  3MPU B;  5IHI A;  1BKB A;  3M0T A;  4C92 F;  4CC4 B;  1KQ2 A;  2FL7 A;  1QVG P;  2ZPI B;  1Z9Q A;  1RLQ C;  4FW1 A;  3TSZ A;  5CO7 A;  5CQX A;  3X20 B;  1AWW A;  1RI9 A;  1M90 C;  1GL5 A;  3JB9 G;  3JV3 A;  1YJN T;  3TU4 K;  5KE3 A;  1LOJ A;  2AHJ B;  1IRX A;  1YJN Q;  3UA7 A;  1PNJ A;  3CME A;  3URG A;  1GFD A;  1B3Q A;  3EGU A;  1RAE B;  2FPD A;  3CCU A;  4ANJ A;  4EMK C;  2WAC A;  2YUO A;  2NUP B;  1YJ9 A;  2RJE A;  2PNI A;  2H3E B;  2HEQ A;  1Q7Y C;  1KIK A;  1VQK A;  4LDW A;  1VQP Q;  2HL5 C;  1HD3 A;  4NL3 A;  3ULR B;  5CCA A;  1OPK A;  2DBM A;  2OAU A;  2HQH A;  2K4Y A;  5GAM f;  3OYY A;  2I2L A;  3I56 T;  1PC0 A;  3CCE A;  3QBY A;  3KXT A;  2BTT A;  1GCP A;  3SDZ A;  5GMK j;  4JPB W;  4CC7 A;  4RG2 A;  5DY9 A;  3OYD A;  1U1S A;  3AT1 B;  4OB1 B;  1WHK A;  4NL2 A;  1HJD A;  2V8I A;  3CCS T;  2VVK A;  3EH1 A;  3M0P A;  3M59 A;  2DAQ A;  2LQK A;  4OMN A;  2DL5 A;  2QAS A;  2L0A A;  2E12 A;  2DVJ A;  2I0N A;  2ZAE A;  3CCS Q;  4PFP A;  4OB2 B;  4J6W A;  3M9Q A;  3F70 A;  2EQU A;  4MZT A;  4GLK A;  4HCK A;  5KYX A;  4MDW A;  4M7A A;  1QLY A;  1U1T A;  3CXC S;  4ZTJ A;  1K1Z A;  5CK9 A;  1UUE A;  4II1 A;  2L8D A;  3M58 A;  1QMC A;  2KT8 A;  3QPH A;  3M0S A;  1QWF A;  1Q81 U;  4F04 B;  2F1L A;  2M9U A;  4C92 G;  1K73 C;  3V8L A;  3CCJ A;  1QKX A;  4F7U A;  3JCM g;  4FYX B;  4AG1 C;  1VQO Q;  3VS7 A;  3FJ5 A;  1G3Y A;  1SPK A;  2ZPF B;  1VQ9 Q;  2G3R A;  3G71 A;  2K3X A;  4RTX A;  2MWO A;  1VQN A;  5LJ5 h;  2FZC B;  1M5Q 1;  5KH6 A;  1X6G A;  4C0D B;  4AFZ C;  5KYN A;  2KYB A;  1VA7 A;  3SWN C;  4EMG A;  3EFO A;  1WJR A;  1AD5 A;  4B9W A;  4FL6 A;  1QVG S;  4FM4 B;  1M2V B;  2QDL A;  3G6E A;  3JAM E;  2O2O A;  1PCX A;  1KG1 A;  3OQ5 A;  3V7S A;  2DEU A;  2V1Q A;  2Y4X A;  1WPY A;  4M77 A;  2JXB A;  2YDL A;  4BDZ A;  4FYY B;  5IHK A;  3VS4 A;  2AKL A;  3TVT A;  2CT4 A;  1YNZ A;  1SRL A;  1VQL Q;  3OYB A;  1WFW A;  2EYY A;  4DBQ A;  5CKF A;  4M78 B;  5KYW A;  1MMG A;  1G3S A;  2L2P A;  1VQM A;  4QT7 A;  3HL8 A;  1Y96 A;  2XID A;  3RDV A;  2EJF A;  2JM9 A;  2CSQ A;  1Q86 C;  3NTI A;  2CP0 A;  4LD6 A;  1UHC A;  4FT2 A;  1WHL A;  1VQ8 A;  2D8J A;  1VQ7 T;  3H0H A;  2EIF A;  4EMH A;  5LL6 S;  5GAM j;  2GF7 A;  4KRT A;  2HKQ B;  1I5O B;  4HCB A;  5GMK i;  3CME Q;  1YN8 A;  3WXM B;  3RUX A;  1YJ9 T;  1WHM A;  3CCU Q;  1KQS P;  4DEY A;  3LWI A;  2X3W D;  4OML A;  3OS1 A;  1VQK T;  1C0M A;  2QEX A;  4LDY A;  3M4Y A;  1YJ9 Q;  3V7C A;  8AT1 B;  1PD0 A;  1VQK Q;  3VU3 C;  1LNX A;  2RH2 A;  4Y92 A;  1NYF A;  2KR3 A;  2OTJ T;  4D6W A;  5AYF A;  1Y57 A;  3CCE Q;  4IUR A;  2FZK B;  1G5V A;  1AEY A;  1TH7 A;  5FRN A;  3QG1 A;  1N8R U;  2CUB A;  5GJW B;  1EFN A;  4BE2 A;  3QDF A;  2AK5 A;  3DB4 A;  2E6Z A;  2CP3 A;  4YTL A;  1NLP C;  2FEI A;  3UDC A;  1T0J A;  1YCY A;  4PJJ A;  1M30 A;  4R0K A;  1YIT A;  2HKN A;  2KYM A;  2E10 A;  2F2X A;  2J6K A;  5GMK e;  2E1H A;  1E6H A;  4ZGD B;  2SEM A;  3FJP A;  1WJQ A;  3UT1 A;  1SSH A;  4IUV A;  3H9N A;  4J9B A;  4Y91 A;  1C1A A;  5GAO p;  1BI1 A;  2LRQ A;  1BCM A;  3PMI A;  1GRI A;  1VQ5 T;  5FWC A;  2E5K A;  5AT1 B;  3IQL A;  2BZY A;  3M0U A;  3TQ7 P;  1K9M C;  5HKC A;  2RQW A;  3CCM T;  2C0O A;  2RNA A;  1IGU A;  1PKT A;  1ZBX A;  3CCJ T;  2R58 A;  5DLQ E;  4QQ6 A;  3QHS A;  1OUL A;  2CSI A;  4UC4 A;  1H3H A;  3CCJ Q;  5GAN 4;  2NUP A;  4D8K A;  3NGP A;  2NYS A;  2O9S A;  2GTO A;  2DVE A;  3S3M A;  3VS2 A;  4QKU A;  2RB6 A;  1VQ6 Q;  3VYG A;  3ER0 A;  3GIB A;  3G71 Q;  2EKO A;  1JQQ A;  2EGE A;  1UJY A;  4DBH A;  3VKI A;  1SKU B;  2XK0 A;  2KSS A;  4E7S A;  1VQN Q;  1QWE A;  2HD0 A;  4KUL A;  1PSE A;  2YRC A;  1AT1 B;  4GY5 A;  3H41 A;  5I11 A;  3QUI A;  3BY7 A;  2WSE E;  2ED1 A;  2YUQ A;  4RCB A;  2DIG A;  1OQK A;  1LCK A;  2O31 A;  5C0M A;  4KUI A;  4GBQ A;  3BW1 A;  3G6E Q;  1D09 B;  3NTH A;  4RUG A;  3PT9 A;  5A2Q E;  2FB7 A;  3TRE A;  2BUD A;  3A8H B;  4M7A E;  1OPL A;  3JCM W;  2GQV A;  2LJ0 A;  2LDM A;  1B7T A;  1R77 A;  1TUC A;  1D3B B;  1OZ3 A;  4A4K A;  3PIP A;  2DF6 A;  1WJS A;  1BB9 A;  1KSW A;  4FSS A;  5FWB A;  1NM7 A;  2NUT B;  2BE9 B;  4F7U E;  3A1P A;  3SFM A;  3MKD A;  1NJI R;  3Q1J A;  1QVF P;  4KUD K;  5FU6 C;  3HRS A;  1H8K A;  2LCL A;  3ZBD A;  1VQM T;  4X34 A;  1RAC B;  4C5H A;  2K2M A;  2EW3 A;  2J05 A;  3A98 A;  2JN0 A;  2KRM A;  2EQJ A;  3I56 A;  2DER A;  2QI2 A;  3VUZ A;  1R0B G;  4DOV A;  4RG8 A;  2CRE A;  3JCM J;  5FU7 C;  1X01 A;  1VQ8 Q;  2ZCF B;  1YI2 A;  1JJ2 A;  3TCJ A;  2NUZ A;  3THK A;  4C92 B;  1RAD B;  3I5S A;  2LMJ A;  4PLI A;  2K5I A;  2PZ1 A;  4OGC A;  1YHQ A;  5LJ3 g;  3GNF B;  3ZFJ A;  3M0R A;  2ZPG B;  4EPC A;  2QEX T;  2RK1 A;  2RHY A;  4JS4 A;  1K9A A;  4HT9 A;  3EG9 A;  1I1J A;  8ATC B;  1OU9 A;  3CC2 T;  4PNO A;  2QEX Q;  3L2U A;  2E5Q A;  3CEY A;  1M2V A;  2LX7 A;  1D1A A;  2D0Q B;  2FHD A;  2FPE A;  2RM4 A;  3DB3 A;  1YJW T;  1WQW A;  1ZSZ B;  3OBW A;  4IKF A;  2DZC A;  3VRY A;  5GAM e;  5GAM d;  3JB9 H;  2F5K A;  2HNI A;  4HKE A;  3CPW A;  2RI3 A;  3RER A;  4AT1 B;  1WDX A;  1BI0 A;  1MV0 B;  3QXE B;  2E64 A;  2PU9 B;  5IHN A;  2L3S A;  2K2V A;  1Y07 A;  2DO3 A;  2P0K A;  1KC8 R;  2QDY B;  2HSE B;  1PRM C;  3JCM b;  1OX8 A;  2LQN A;  2MIO A;  1YIT T;  5IXB A;  2CT3 A;  2PVG B;  4C5G A;  3MET A;  2Y90 A;  2HCK A;  4M78 A;  1YIT Q;  4ATO A;  1QCN A;  5CQY A;  2VGN A;  3NTK A;  5I21 A;  2RF0 A;  1JXO A;  1PSF A;  4MDX A;  5J3B A;  3EGX B;  3VYH B;  4J8O A;  1ZUY A;  3NMZ C;  2C0I A;  3CMA Q;  2Y4Y A;  1M1F A;  3QZ9 B;  2O4X A;  2RI5 A;  2E4H A;  4QW2 A;  2YWW A;  1V29 B;  4JLI A;  5GAN 3;  2ATC B;  1D1C A;  1N27 A;  2HQX A;  4J9F A;  2CKK A;  4M7A F;  2KQW A;  2K5L A;  4R56 A;  1BU1 A;  4ZTF A;  4JZ3 A;  1LJO A;  2DX1 A;  2FYK A;  4QVC A;  1R8O B;  4RMO A;  1NBE B;  3M4G A;  4F7U F;  2XDD A;  1QW1 A;  3MP1 A;  3VV0 A;  3G4S Q;  2L3R A;  3RNJ A;  2MF2 A;  4PKC C;  1QVF S;  2DXU A;  2JVV A;  5FW9 A;  1S72 T;  1M9S A;  3TSW A;  2IG0 A;  4LDU A;  3RBB B;  5CR2 A;  5LJ3 f;  2VC8 A;  4IIO A;  2DRM A;  1KD1 R;  1M1G A;  5D6W A;  1OX9 A;  3OY9 A;  2PUO B;  1FYN A;  3CD6 A;  2XD0 A;  1GBQ A;  2J6O A;  2GTJ A;  2OAW A;  4RTW A;  1VQ7 A;  1ABO A;  3MEA A;  1XTD A;  3HKS A;  1Q82 R;  4N0A C;  1KHI A;  1VYT A;  4E2F B;  5LJ3 h;  1CKA A;  1XNI A;  4M77 F;  3VS1 A;  4BD3 A;  2QQS A;  1RAF B;  4XK8 E;  2Z0W A;  1W2B P;  1UJ0 A;  1M1K R;  2DM1 A;  3A8O B;  3G7Z A;  1M4Z A;  4L6V 5;  3FDR A;  3INZ A;  1KHC A;  3J7A F;  1ABQ A;  2NWM A;  4O6J A;  1MND A;  2M51 A;  4PK4 A;  2L3Q A;  3MEV A;  1HXD A;  2ROT A;  2DET A;  4N0A A;  2OTJ A;  1B07 A;  1WI7 A;  2M0O A;  1GBR A;  2AKK A;  2O01 E;  1D0Z A;  4M7A D;  4J9G A;  2MWP A;  4J9I A;  3I56 Q;  1OI1 A;  3E9G A;  2ROL A;  1JJ2 S;  1YI2 T;  1VIF A;  2RHU A;  3FIF A;  1KFZ A;  3UPU A;  1FXX A;  3HTR A;  2QQR A;  4M7A C;  1JEG A;  1T0H A;  1H3Z A;  1YHQ T;  1I8F A;  3PE0 A;  1ZQ1 A;  3GP8 A;  2CS7 A;  4M7A G;  4IUU A;  3OYF A;  4ZN3 A;  1I07 A;  5GAM h;  1F1B B;  3REB B;  3X24 B;  2FRY A;  4LE9 A;  1QKW A;  2DBK A;  3JCM e;  3JCM d;  1Q7Y R;  2GFA A;  4JZ4 A;  5IXF A;  2KDS A;  4F7U G;  2K79 A;  2XHC A;  4Z89 A;  2X51 A;  4M7D D;  1SSF A;  3WVE B;  1VQ5 A;  2OI3 A;  2JM8 A;  2JTE A;  3QO3 A;  3CC4 T;  3VS5 A;  1E7O A;  1YWP A;  1D3B A;  3CCM A;  1VYU A;  5L23 A;  4M7D C;  2RI2 A;  4JRK A;  2HL3 A;  1IZ6 A;  1VUB A;  2RJD A;  2W0Z A;  3I9Q A;  1IXD A;  4X9D A;  1OEB A;  4M77 D;  2B86 A;  2CH4 W;  4KBM B;  3A8M B;  4J6X A;  4FCY A;  2CP6 A;  5KYU B;  1NJI U;  4M77 C;  1S1N A;  1ACM B;  3LH0 A;  4M7D A;  5D6X A;  2RQV A;  4C0Z A;  2KEA A;  2KI7 A;  2FRW A;  4M77 G;  2ENM A;  2P84 A;  4C8Q B;  1N9S A;  5GJV B;  2QXF A;  3I5R A;  4F17 A;  2H8H A;  2K7A A;  1V76 A;  2FPF A;  4A54 A;  1K73 R;  4PLL A;  4PJO D;  5LJ3 j;  2AIR B;  4OVA A;  2F69 A;  1YFN A;  1WQ7 A;  2E6N A;  3JB9 J;  3HRT A;  4JRP A;  1OV3 A;  1ZSZ A;  4PJO C;  1AWX A;  5CKD A;  4RCC A;  4E47 A; 
#chains in the Genus database with same CATH homology
 3JB9 F;  2KK4 A;  1N6A A;  5GAN 4;  4E7K A;  3CCR T;  3L1A A;  4BB7 A;  1VQP T;  2FVU A;  2XU8 A;  1W2B S;  3MCA B;  4QQG A;  4E7L A;  4M75 G;  2CZ7 B;  2OTL T;  3S3M A;  2DVE A;  2QA4 A;  3OYG A;  4JLG A;  3PIO A;  1B34 B;  2CZ1 B;  3CBP A;  2RB6 A;  3S3O A;  2KMT A;  3VYG A;  4ELZ C;  5M9O A;  3ER0 A;  3TEE A;  3J80 E;  2XI9 A;  3GIB A;  2EKO A;  2BIV A;  2VGM A;  2XDP A;  3HHT B;  1VQO A;  5GMK h;  4LDV A;  2EWN A;  4J83 A;  3M57 A;  3VKI A;  2XK0 A;  3OW2 S;  4LDX A;  2KSS A;  3QII A;  2YRV A;  3CD6 T;  4M75 B;  4XTV A;  4PJO F;  3SD4 A;  5J39 A;  1VQ9 A;  3QDR B;  4C5E A;  2HD0 A;  4PJO B;  4PJO A;  4KUL A;  1PSE A;  3QKJ A;  4EMK A;  1KC8 U;  5GAM g;  2V8K A;  2QQB A;  3PNW C;  5CKE A;  1P92 A;  4XTW A;  2JNG A;  3OBY A;  2A3L A;  1OYX A;  4GY5 A;  3J81 E;  3QUI A;  2EJ9 A;  4V2S A;  3BY7 A;  2WSE E;  4JUV A;  1Y71 A;  4IUQ A;  4RCB A;  4Y28 E;  2DIG A;  3UWN A;  4A4F A;  1ZHI A;  1UGR B;  5C0M A;  3FEO A;  4KUI A;  3CMA T;  4J5Y A;  2X4W A;  2LT1 A;  4X9C A;  3BW1 A;  2RJF A;  3CPW S;  4BY6 C;  3FC3 A;  3NTH A;  3OMC A;  1XOV A;  2LTO A;  2QQA A;  4DQ2 A;  3PT9 A;  1KQ1 A;  4P5N A;  5A2Q E;  2DTH A;  4J7I A;  3RKX A;  2FB7 A;  2EYQ A;  3TRE A;  2BUD A;  3A8H B;  5A0L A;  5GAO l;  1KD1 C;  4M7A E;  3JCM W;  2GQV A;  3LX7 A;  3MP6 A;  2LDM A;  3JCM f;  1K9M U;  3EAE A;  2KAF A;  3L2V A;  1WGS A;  1NZ9 A;  4OB0 B;  3VUB A;  3CC2 A;  1D3B B;  1OZ3 A;  5LJ5 e;  5LJ5 d;  2LQ8 A;  4A4K A;  3CCQ A;  3PIP A;  1K73 C;  3CCL A;  5GAN d;  1WJS A;  3AHU A;  3GLX A;  2QTX A;  3CCJ A;  4C92 D;  2PUK B;  1YJW A;  1MGQ A;  3M5A A;  1I5L A;  2C06 A;  3LLR A;  4RKU E;  3DLM A;  3OB9 A;  2DTO A;  4M7D G;  1Q82 C;  3VJP A;  4F7U E;  3SFM A;  4XU2 A;  2DTI A;  3Q1J A;  4C92 C;  2EQK A;  3HRU A;  5FU6 C;  4KUD K;  3HRS A;  5GAO n;  5LJ5 f;  2LCL A;  5KCO A;  2YLC A;  1BI2 A;  3ZBD A;  3OYE A;  4X34 A;  5I2S A;  1VQM T;  2VXF A;  4C5H A;  4E7H A;  2GCX A;  4XTU A;  2IVW A;  3EFR A;  3G4S T;  1VQO T;  1VIE A;  3RKY A;  5IAY A;  3JCM h;  3R6O A;  2XG8 D;  4MMK A;  2JN0 A;  3KUF A;  3LGL A;  3NFC A;  4A4G A;  5GMK l;  3GOX A;  2EQJ A;  3I56 A;  2ZPE B;  2RHZ A;  5GAN g;  1VQ9 T;  1QP2 A;  1M1K C;  1NE8 A;  2VV5 A;  4OB3 B;  5CVI A;  2QI2 A;  2VXE A;  3N5B B;  2BKD N;  3VUZ A;  2JTM A;  3CPF A;  4DOV A;  4RG8 A;  3RMS A;  1VQ6 A;  3OYL A;  3JCM J;  1W2B A;  2DD4 A;  2YHT A;  5FU7 C;  2JZ2 A;  1X01 A;  3HPW A;  2ZCF B;  2LVM A;  1YI2 A;  1BKB A;  2WSC E;  1JJ2 A;  2P0Q A;  3TCJ A;  2LCC A;  4C92 F;  3QYG B;  4C92 A;  4C92 B;  5C6S A;  2FL7 A;  5FU6 B;  1KQ2 A;  2L89 A;  1O75 A;  1NPR A;  2ZPI B;  4C8Q E;  3QSU A;  5GAN 6;  4PLI A;  2K5I A;  3LW5 E;  4BI8 B;  4OGC A;  1YHQ A;  5CO7 A;  2DIQ A;  5CQX A;  5LJ3 g;  3X20 B;  2K3Y A;  2P0P A;  3GNF B;  3OSS C;  3ZFJ A;  5KE2 A;  2ZPG B;  1M90 C;  3JB9 G;  4EPC A;  3BFM A;  2QEX T;  2RK1 A;  2RHY A;  4JS4 A;  1VQ4 A;  1YJN T;  4HT9 A;  4M7D B;  3TU4 K;  2RHX A;  1MHN A;  5KE3 A;  3CC2 T;  1LOJ A;  4PNO A;  2X4Y A;  4QQD A;  3C94 A;  2AHJ B;  3L2U A;  5FU7 B;  3CCL T;  2E5Q A;  3CEY A;  5GAN 7;  3CME A;  2D0Q B;  2FHD A;  2RM4 A;  4JRI A;  5IN1 A;  3DB3 A;  3PMT A;  3URG A;  1WQW A;  1YJW T;  3OBW A;  3CCU A;  4IKF A;  3MP8 A;  4OP0 A;  4EMK C;  2WAC A;  3O8V A;  2DZC A;  3JB9 H;  5GAM e;  5GAM d;  1K8A U;  2F5K A;  2HNI A;  4HKE A;  3CPW A;  2RI3 A;  1O9S A;  1YJ9 A;  2RJE A;  3RKW A;  3RER A;  1BI0 A;  1Q82 U;  4PJO G;  1Q7Y C;  4ME7 A;  1VQK A;  3QXE B;  4LDW A;  2E64 A;  3SWN A;  1Y7X A;  2PU9 B;  2ZZD A;  5DLO A;  3JB9 I;  4NL3 A;  1NPP A;  2K2V A;  2CZ6 B;  5GAN 5;  1Q81 C;  5CCA A;  1Y07 A;  3EFS A;  2DO3 A;  2P0K A;  3HFO A;  5FRO A;  4FU6 A;  1VQL T;  2OAU A;  2QDY B;  2K4Y A;  3BDU A;  3OYY A;  2I2L A;  4M78 E;  5GAM f;  3I56 T;  3BDL A;  3CCE A;  2HQE A;  2DZ9 A;  2YLB A;  3JCM b;  1M1K U;  3QBY A;  3KXT A;  1KQS A;  3I55 A;  4ZGE B;  3SDZ A;  4PL6 A;  4EMK B;  5GMK j;  1YIT T;  4RG2 A;  2PVG B;  5DY9 A;  1S72 A;  4DA4 A;  4C5G A;  3MET A;  2M16 A;  2Y90 A;  4M75 E;  4M78 A;  3T9N A;  3OYD A;  3DLL A;  4ATO A;  3A8G B;  5CQY A;  2VGN A;  1XQH A;  3NTK A;  3PGG A;  1U1S A;  5I21 A;  4OB1 B;  4XAX B;  2RK2 A;  4NL2 A;  2QQ9 A;  3JSC A;  1PSF A;  2V8I A;  4C0G A;  3CCS T;  4MDX A;  5J3B A;  3VYH B;  2R5M A;  2VUB A;  4J8O A;  3M59 A;  3OYK A;  2DAQ A;  2LQK A;  1U8R A;  2Y4Y A;  4BE1 A;  2E12 A;  1M1F A;  2RD1 A;  3QZ9 B;  1NJI U;  4OB2 B;  4BE0 A;  4JJN K;  2O4X A;  2O4X B;  2RI5 A;  3V8J A;  3M56 A;  3MHX A;  1X6O A;  1RI0 A;  2RO0 A;  4IUP A;  3E1S A;  4QW2 A;  3GNG A;  5GAO q;  1V29 B;  4J6W A;  4JDS A;  4Z02 A;  3M9Q A;  5L8R E;  3A8L B;  5A0D A;  2ZPB B;  1OZ2 A;  3F70 A;  3CME T;  4JLI A;  5GAN 3;  3OYI A;  5GAN e;  2EQU A;  4MZT A;  1N27 A;  3L42 A;  1WNL A;  2HQX A;  5D6Y A;  4GLK A;  3CCU T;  4M7A F;  2CKK A;  4MDW A;  3CC7 A;  1YIJ A;  4M7A A;  1U1T A;  2KQW A;  1BIA A;  2K5L A;  4R56 A;  2RJC A;  3V7R A;  3CXC S;  4ZTJ A;  4ZTF A;  5CK9 A;  4BY6 B;  2QA4 T;  4II1 A;  3CCV A;  1Q7Y U;  4BUG A;  2L8D A;  3A5Z B;  1LJO A;  5FLX E;  2FYK A;  3M58 A;  2DXT A;  1X75 C;  3QPH A;  4OGE A;  4ZGJ B;  4Q5W A;  1BIB A;  4QVC A;  5GAN f;  2DD5 A;  2X35 A;  1Q81 U;  5IT9 E;  1R8O B;  4BDY A;  4RMO A;  2M9U A;  3M4G A;  5LJ3 d;  3V8L A;  4B9X A;  4C0D C;  4C92 G;  4F7U F;  5LJ3 e;  3JRZ A;  4F7U A;  1QW1 A;  4F7U B;  2XDD A;  4XTY A;  3SB2 A;  3JCM g;  5GAO r;  3CCE T;  3X28 B;  3MP1 A;  3VV0 A;  4FSX A;  2MMP A;  3OSV A;  2L3R A;  3C95 A;  3L2W A;  2MF2 A;  4PKC C;  3OS0 A;  2LT4 A;  1QVF S;  1G3Y A;  2V8J A;  2DXU A;  2JVV A;  2OTL A;  2ZPF B;  1S72 T;  1M9S A;  2IG0 A;  4LDU A;  4M7D E;  2DK3 A;  2G3R A;  3G71 A;  4ELY C;  4BAC A;  2K3X A;  5CR2 A;  5LJ3 f;  3FRN A;  2R57 A;  4FIB A;  2HAX A;  2MWO A;  2CGH A;  2E70 A;  2JUF A;  2VC8 A;  3M55 A;  3ASK A;  2JOY A;  3QJ6 A;  1M1G A;  3V8K A;  1VQN A;  5LJ5 h;  3PFS A;  1GXI E;  1UEB A;  5D6W A;  5GAN h;  2A7Y A;  2PUO B;  2X4J A;  3OY9 A;  1M5Q 1;  5KH6 A;  4C0D B;  3CD6 A;  3OW2 A;  3P8H A;  2XD0 A;  4MML A;  5LJ5 j;  1FWZ A;  2MAM A;  3SWN C;  4EMG A;  2KVQ G;  4C8Q F;  1WJR A;  5GAO m;  4C8Q A;  5DM7 R;  1KD1 U;  1VQ7 A;  4B9W A;  4N4G A;  4FL6 A;  1QVG S;  1BI3 A;  1HK9 A;  4FM4 B;  3MEA A;  5FRM A;  2RHI A;  4M77 E;  3CCQ T;  2EJG A;  1XTD A;  3HKS A;  4M78 D;  3G6E A;  4N0A C;  1KHI A;  3JAM E;  1AHJ B;  5HK0 A;  1I4K 1;  4WF2 A;  2DKG A;  3GPL A;  3CMA A;  1KG1 A;  3OQ5 A;  3V7S A;  5LJ3 h;  3QZ5 B;  2Y4X A;  1WPY A;  1XNI A;  4HCZ A;  4M77 F;  3LYI A;  1UGS B;  1FX7 A;  4M77 A;  4BD3 A;  3JCM X;  2QQS A;  4M78 C;  4XK8 E;  3CCV T;  4BDZ A;  3RIR A;  2EQM A;  4BI4 A;  3SWN B;  3A8O B;  3G7Z A;  1M4Z A;  2F5T X;  3OMG A;  4E7I A;  3CC4 A;  4M78 G;  4MZP A;  3FDR A;  2GFU A;  3INZ A;  3GF5 A;  4L6V 5;  1KHC A;  4VUB A;  3JCM P;  1JB0 E;  3J7A F;  1K73 U;  1QVP A;  4O6J A;  4HT8 A;  3M54 A;  2R5A A;  3MEV A;  1HXD A;  4OMF B;  3C12 A;  5GMK m;  4E7J A;  4N0A A;  2OTJ A;  2M0O A;  2HBP A;  2O01 E;  3MEW A;  3OYB A;  4M7A D;  1VQ6 T;  2MWP A;  1OI1 A;  3HP9 A;  2D6F A;  2KY9 A;  3E9G A;  5CKB A;  1B34 A;  3X26 B;  2PQW A;  3CXC A;  3OYC A;  1JJ2 S;  2M1H A;  3C4S A;  3G71 T;  1YI2 T;  1VIF A;  2RHU A;  3FIF A;  4M78 F;  3UPU A;  5CKF A;  4M78 B;  4PJO E;  1FXX A;  1QP3 A;  4BI3 A;  1G3S A;  2QQR A;  1VQM A;  4M7A C;  2LC4 A;  3HL8 A;  1Y96 A;  1Y96 B;  3MO8 A;  3M53 A;  2XID A;  3G4S A;  1N8R C;  1VQN T;  3FB9 A;  1H3Z A;  2EJF A;  3DKM A;  3JCM Q;  1NJI C;  1YHQ T;  1I8F A;  1Q86 C;  4LD9 K;  3NTI A;  1ZQ1 A;  3GP8 A;  1UGQ B;  3L2Z A;  2H3J A;  4LD6 A;  4M75 F;  4M75 A;  2CS7 A;  4FT2 A;  3S6W A;  4M7A G;  1VQ8 A;  4IUU A;  3X25 B;  4JRQ A;  4XTZ A;  4XU1 A;  4O5V A;  1M90 U;  5HK3 A;  3OYF A;  3MEU A;  4ZN3 A;  5GAM h;  3OS2 A;  1VQ4 T;  1VQ7 T;  4MZM A;  1QVF A;  3PTA A;  2XKO C;  1DJ7 B;  2EIF A;  4EDU A;  1G3W A;  3X24 B;  2PVD B;  3H6Z A;  1H64 1;  1N9R A;  4N4H A;  5LL6 S;  1YBY A;  2GF7 A;  4EMH A;  3JCM e;  3JCM d;  5GAM j;  3G6E T;  2DXC A;  3H8Z A;  2LNV A;  4OF1 A;  4HCC A;  2GFA A;  2XIC A;  4HCB A;  5CKH A;  2EAY A;  5GMK i;  2KDS A;  4M7A B;  4F7U G;  2XHC A;  3WXM B;  3RUX A;  3OYN A;  1YJ9 T;  2PVO B;  3OYM A;  4M7D D;  1SSF A;  3WVE B;  3LWI A;  1JRI A;  1VQ5 A;  3CBM A;  3OS1 A;  3S3N A;  2QEX A;  4NOY A;  4JS5 A;  4LDY A;  1VQK T;  3M4Y A;  1YJN A;  3V7C A;  4QVZ A;  3QO3 A;  1JBM A;  5GAN 8;  4J6Y A;  3CC4 T;  5EG2 A;  4C8Q D;  2E41 A;  4CRI A;  1QVG A;  1D3B A;  3VU3 C;  2CYZ B;  1G3T A;  3CCM A;  1LNX A;  2D9T A;  2E65 A;  4XQ3 A;  5A0G A;  2RH2 A;  3OYJ A;  4M7D C;  2ZPH B;  2RI2 A;  4TVR A;  4R55 A;  4JRK A;  1IZ6 A;  4XU0 A;  2OTJ T;  5J26 A;  4D6W A;  5GAN 2;  1VUB A;  1KQS S;  4M7D A;  2DEQ A;  4L5G A;  4XU3 A;  2RJD A;  5AYF A;  1K8A C;  4C8Q C;  2NLU A;  3I55 T;  3HFN A;  3CCR A;  2RA2 A;  4X9D A;  1VQP A;  3LWH A;  4IUR A;  2CZ0 B;  4M77 D;  1G5V A;  3CBO A;  3KBG A;  3FLG A;  1UGP B;  4C8Q G;  4KBM B;  5CIU A;  4QVD A;  4DOW A;  3A8M B;  1M8V A;  4J6X A;  1TH7 A;  4J7F A;  5FRN A;  5CAI A;  4A53 A;  3QG1 A;  1N8R U;  4C5I A;  4BE2 A;  1VQL A;  3DB4 A;  3RMQ A;  2E6Z A;  4FT4 A;  4M77 C;  5LJ5 g;  3OYA A;  4YTL A;  5I2M A;  3WVD B;  4NS5 A;  4ZN1 A;  1Q86 U;  2XDB A;  4M7D F;  2JTF A;  2L5Q A;  3LH0 A;  3UDC A;  3ZEH A;  4C92 E;  3JCM V;  4A4H A;  3L2Q A;  1VQ8 T;  4L59 A;  2DXB A;  1YCY A;  2LX9 A;  5D6X A;  4C0Z A;  4N4I A;  3JB9 D;  3P8D A;  1YIT A;  4M77 G;  3E19 A;  5GAN j;  1KC8 C;  2ZGW A;  3LGF A;  4C8Q B;  3QJY A;  1N9S A;  2E10 A;  2K57 A;  2MI6 A;  2X4X A;  2B8A A;  2QXF A;  4CI0 C;  1UB4 A;  3OA6 A;  3JCM c;  4C0F A;  1IRE B;  2E1H A;  1EIF A;  5GMK e;  2P4T A;  2EFI A;  4HA8 A;  5KCH A;  4ZGD B;  3FJP A;  5HY6 A;  1WJQ A;  3UT1 A;  3CC7 T;  4IUV A;  1YIJ T;  4Y91 A;  3OS5 A;  3CCS A;  3P8B B;  5GAO p;  3OYH A;  1BI1 A;  2LRQ A;  1BYM A;  4A54 A;  3PMI A;  4M77 B;  1VQ5 T;  4PLL A;  4M75 D;  4PJO D;  5LJ3 j;  2DJZ A;  3QYH B;  1RL2 A;  2K5F A;  4KT0 E;  3E9F A;  4OVA A;  2F69 A;  2WSF E;  1K9M C;  5HKC A;  1W4S A;  3CCM T;  4IUT A;  2DPP B;  4A4E A;  1WQ7 A;  1ZBX A;  1I81 A;  2E6N A;  3JB9 J;  3CCJ T;  3HSB A;  2R58 A;  3HRT A;  3ME9 A;  4M75 C;  4XTX A;  4QQ6 A;  5DLQ E;  3L2R A;  4JRP A;  4PJO C;  3QHS A;  5CKD A;  4RCC A;  4UC4 A;  3RES A;  2VYT A;  4E47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...