2K3YA

Solution structure of eaf3 chromo barrel domain bound to histone h3 with a dimethyllysine analog h3k36me2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
133
Chain Sequence
MVDLEQEFALGGRVLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKSFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAGSTGSAPATGGVKPHRYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Recognition of Methylated Histone H3K36 by the Eaf3 Subunit of Histone Deacetylase Complex Rpd3S.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulator
molecule keywords Chromatin modification-related protein EAF3
total genus 27
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k3yA01
4II1A 1WJSA 4PLIA 4C5HA 3PMIA 3E9GA 3QIIA 4IUPA 2LCCA 4QQ6A 3OYMA 3OYLA 3F70A 2R5AA 1WJRA 3MEVA 4HCZA 2EQJA 3ASKA 4IUQA 5D6YA 3L2WA 2IG0A 3L2UA 2RI5A 3QBYA 5FRNA 4BE2A 3FLGA 3PNWC 3L42A 5KCHA 2RHXA 2M16A 3OYBA 4BDZA 4BDYA 2RHZA 4E7JA 3H6ZA 2LVMA 4FL6A 4A4EA 4BD3A 4E7LA 3EAEA 4EDUA 3OYHA 2BIVA 5KH6A 4A4GA 3MEAA 3OY9A 2M0OA 3DB3A 2RJFA 1G5VA 4GY5A 2EQUA 2JTFA 3L2QA 1OYXA 3NTIA 2YRVA 5FRMA 5IAYA 3C4SA 3ME9A 5D6XA 3LX7A 4A4HA 2L8DA 5FROA 2RI2A 3P8DA 3OS1A 3DLMA 3QJ6A 3MEWA 3P8HA 2R58A 2GFAA 4QQDA 5KE2A 3GOXA 4ZTFA 4BE0A 2RJEA 3LYIA 4IKFA 2DIGA 1RI0A 2BUDA 2DAQA 2FHDA 3FEOA 2VYTA 3MO8A 2RHUA 2O4XB 4IUTA 3FC3A 3UWNA 4OVAA 3S3OA 4IUUA 3MP8A 2R5MA 3OMCA 3OQ5A 2E5QA 3S3MA 2X4XA 4IUVA 3OYJA 3LH0A 3PFSA 2X4YA 4QVZA 1WJQA 2LRQA 3OYNA 1KHCA 3PMTA 4PL6A 3LGFA 4PLLA 2O4XA 5C0MA 2MWOA 5IN1A 2G3RA 2RI3A 3UT1A 3MP6A 4E7HA 2XK0A 3OYIA 2K3XA 2R57A 4B9XA 2RO0A 4L59A 5KE3A 3OS2A 2MWPA 1SSFA 3OYEA 3M9QA 3SD4A 3MEUA 1XNIA 1H3ZA 3O8VA 5CIUA 3OS0A 2DIQA 3BDLA 3OB9A 4LD6A 3DB4A 1OZ2A 4Z02A 3H8ZA 3NTHA 3CEYA 2BKDN 2EKOA 2GFUA 5KCOA 3OYAA 1WGSA 3FDRA 3L2RA 4N4GA 3Q1JA 2RJDA 3OMGA 2RJCA 4E7IA 2CKKA 4N4HA 4RG2A 4BACA 2QQSA 4QQGA 2XDPA 1MHNA 2EFIA 2HQEA 4X34A 3OYKA 2LTOA 3S6WA 3OYFA 3OYCA 2RHYA 3S3NA 4ZTJA 2P0KA 2HQXA 4B9WA 2GF7A 2NLUA 4FU6A 3OYDA 4Q5WA 2JZ2A 4C5GA 2M1HA 5C6SA 4BE1A 2D9TA 2B8AA 2X35A 2X4WA 2L3RA 4C5EA 5J26A 3QKJA 1OI1A 3ZEHA 3KUFA 2F5KA 4UC4A 4A4FA 2QQRA 4C5IA 5D6WA 3NTKA 3MP1A 2E6NA 4CRIA 1OZ3A 4NS5A 5J39A 3E9FA 2EQMA 2WACA 4E7KA 2L89A 2RHIA 3META 4N4IA 2LDMA 3L2VA 4QW2A 2PQWA 2EQKA 1N27A 3LGLA 3LLRA 3OYGA 4IURA 2K3YA 3OA6A 5M9OA
chains in the Genus database with same CATH superfamily
3INZA 3QIIA 4F04B 1GFDA 1FMKA 2RI5A 1M3AA 3UF4A 3OYBA 2C0IA 1JB0E 3EAEA 1YNZA 5KYUB 3CC7T 2F2XA 3M57A 3CCMQ 4EPCA 1NPPA 2FPEA 3I55T 3CCUT 1YJ9Q 5FU7C 5AT1B 1VYVA 4A4HA 4FW2A 1M1KU 2MI6A 1W6XA 3H0IA 2L8DA 5GMKh 2QGGA 1KQSS 3P8HA 2AZVA 3ZFJA 2H8HA 2BUDA 4NOYA 4XK8E 2O4XB 1YIJQ 1M5Q1 1Y71A 2KXCA 3CXCA 2RPNA 3OQ5A 4RUGA 1UUEA 4KH0B 4AFSC 3A98A 2V26A 3PFSA 1ZUKA 3I55A 1B3QA 4OMPA 2W10A 4KGXB 1BCOA 1M8VA 2KVQG 1M2VB 5KE3A 1VQ8A 1U8RA 1I07A 2DM1A 2LJ3A 2A08A 4GLMA 2KYBA 1G83A 1HJDA 3TCJA 4N4GA 2DF6A 4AFQC 1UGPB 1BI1A 1QP2A 5IHIA 4Z89A 4MMLA 5KYWB 2FO0A 1LJOA 4EMGA 4ZTJA 2KROA 2JZ2A 2NWMA 2E70A 5GAOq 2VVKA 5GAMh 1E6GA 3FRNA 2JTMA 7AT1B 1GRIA 2LT4A 1N8RU 4HXJA 5CCAA 2LMJA 4OMFB 2YXYA 2K2VA 4L5GA 1C6VX 1K9AA 2L5QA 2RQRA 1BI0A 4LUDA 4ZNXA 1X01A 2K3YA 1IXDA 6AT1B 2KEAA 2XDDA 3REAB 3UATA 1T0JA 1CKAA 2E41A 1X2KA 2L2PA 3ASKA 4HCZA 4FYWB 3RDVA 4PJOB 3QBYA 3CCUQ 4C92B 3CPWP 4C8QF 2QXFA 4HCCA 1WHHA 4XTZA 3OYHA 3CCET 4EIKA 3MEAA 3DB3A 1ZBXA 4J6WA 3ME9A 4XTYA 1EZZB 1VQ5Q 1FXXA 1WDXA 2FHDA 3HHTB 5GAN5 1RAFB 5KYYA 2R5MA 4M7DA 2KRMA 4KGZB 2GBQA 2RQWA 4IIOA 1I4K1 5CKDA 4L59A 1SF9A 3EFRA 4O6JA 1KSWA 1XNIA 2O88A 3O8VA 4JS4A 4JLGA 3OB9A 3V7SA 2ED0A 2YLCA 3L2RA 4DBRA 1S72Q 4M7DF 3Q1JA 3G4ST 3EH1A 4M78A 4HT8A 3S3NA 4OB2B 1D09B 2E65A 2P0PA 2F5TX 1Z9QA 3LH5A 3VUBA 4QT7A 4X1VA 4KUIA 1W1FA 1JXOA 3VV0A 2E6NA 4F7UA 4NS5A 1NJIR 4FYYB 2WACA 4XTXA 4WCIA 1FMWA 1AVZC 2PUKB 3QXEB 4N4IA 2EQKA 4JJBA 4J7FA 5GAN4 2YDLA 4QQ6A 2LCCA 2NUZA 3F70A 1WJRA 1GFCA 4FSXA 1JJ2A 2LQKA 2EQJA 2IG0A 3FLGA 1QVFS 2ZGWA 5LJ3f 4F7UF 3E2UA 4MDXA 2LJ0A 4E7LA 2CS7A 1VIFA 2EQUA 2KSSA 3L2QA 2Y4XA 5IAYA 1SKUB 2ZPBB 5LJ3d 2OJ2A 1MMNA 3GOXA 2GFAA 4ZTFA 4A54A 1VQ6T 1VQ6A 2J6OA 2VYTA 1H8KA 1YJ9A 2DVEA 4OVAA 3S3OA 2HBWA 2E5QA 4RCBA 1BB9A 1Q86U 2LJ1A 1RL2A 4M7AF 5CR2A 1ZSZA 3EG3A 1N9SA 2V8JA 5DLOA 1YHQA 2IPOB 3VRYA 3OYIA 1YP5A 1KC8U 2QQ9A 3TEEA 4KULA 4JJNK 1VQ9A 1AZEA 3HFNA 1TU0B 1VQKQ 1TWBA 4DBHA 2DL3A 2DXBA 3DB4A 2VV5A 3CPWA 3CXCS 1VQ8Q 1UTIA 1J3TA 1MHNA 1M90U 2HZYA 2P0KA 5ECAA 2GF7A 1WA7A 2A3LA 2K2MA 1X75C 2DL8A 1Q81R 2M1HA 1VQ8T 1XQHA 1BIAA 3JSCA 1YFNA 1AEYA 2GQVA 2F1LA 3HSBA 2QDLA 1PC0A 2RHIA 3I9QA 1YCYA 1Y07A 2OAUA 3LGLA 3QWYA 5I22A 4LDYA 1WIEA 2QA4T 2QA4A 3JCMc 2ABLA 2ZPEB 1K0SA 3OYYA 2KT8A 3QO3A 2CZ6B 5IXFA 5D6YA 3CCJQ 2J05A 1Q82R 1VQMA 2MIOA 2RHZA 5HY6A 3EGXA 3OSSC 5GJVB 4BD3A 3M56A 2BIVA 3WVDB 2L0AA 5CKHA 3I56Q 5KH6A 1VQ9Q 1V76A 3C4SA 5KYXB 3CCVT 1SRMA 5FROA 2LX9A 1S1NA 2H3JA 3CD6A 1D0ZA 2QK0A 1VIEA 3VS6A 1QCOA 3CMAT 3UWNA 4LD9K 1QWFA 2L3QA 5CO7A 3SEMA 2HEQA 2K57A 4LNPA 1Q7YC 2COZA 5LJ3g 3OSVA 2OTLA 2VGMA 2M0YA 4OGEA 2RN8A 2O4XA 4RTYA 5I2MA 1G8XA 4ATOA 3HRTA 1O9SA 4M75D 1QVGA 1ACMB 2KMTA 1ABOA 3JB9F 3G71A 3NHNA 4C92E 1RI9A 3OYEA 4AT1B 3A8MB 2AHJB 4RCCA 4LD6A 2DFUA 2ZPIB 3MKDA 3CEYA 3EFOB 2GFUA 3FDRA 2FPFA 4HA8A 1GCPA 3QUIA 4X34A 3S6WA 4C92G 2RHYA 1UHCA 2HBPA 2HQXA 2DTIA 1ARKA 2NUPB 3L2ZA 2JS0A 3DKMA 2VWFA 3CMEQ 1PWTA 3EGUA 3SWNA 1S72A 2MMPA 1VA7A 3LWHA 3A8HB 1GXIE 3NPFA 2E3IA 4C0FA 4C5IA 5GAMj 5D6WA 2LQWA 4C92C 3RBBB 2EQMA 1NE8A 2ZAEA 3A8LB 4AFUC 4HT9A 4ZGEB 4JZ3A 1H3HA 3OA6A 2XIDA 4A4KA 1K9MU 3QZ9B 5LJ3e 4Y91A 4M7AD 1IRXA 5A0GA 3JCMf 2EJGA 2OTLQ 1KG1A 5HKCA 2LC4A 3PNWC 3CPWS 2HAXA 2L3SA 5GAOm 3H6ZA 2YHTA 4FL6A 3CXCP 4EDUA 3SFMA 4C92A 4XTUA 1OYXA 1NEGA 2J06A 3V7RA 3QG1A 8AT1B 3LX7A 2CZ1B 2DNUA 3P8DA 2JXBA 2YUPA 1UEBA 3MO8A 3QHSA 2CSQA 5CQXA 1WPYA 4BUGA 1HSQA 4BB7A 1QVFA 3V8KA 3A8OB 2PUOB 2X4YA 1K73C 1VQ7T 4OMQA 3GP8A 2P4RA 2EBPA 4C92F 4C8QB 4EMKB 5GANd 1YJ9T 1JU5C 2C0TA 1B34B 2DD4A 1OX8A 2R57A 3UDCA 2RO0A 5GAOl 3AHUA 3X26B 2O2OA 4M7AA 1YITQ 2XI9A 4K11A 5I2SA 1Z9ZA 2JM9A 3GIBA 2LQNA 1OU8A 3HFOA 2HQEA 1UJYA 2JTEA 3TSWA 1Q82C 3VS5A 2DETA 1JQQA 3OW2P 2YSQA 2NLUA 5GAN3 3MPUB 2FEIA 1PG5B 2C0OA 4A4FA 1AZGB 1VQOQ 4J6YA 4OF1A 3M0PA 3QDFA 3ER0A 1BI3A 5DY9A 1WFWA 2DXTA 3H0HA 2DTOA 4XQ3A 1YIJA 4PLIA 4ZN1A 3E9GA 2V1RA 3R6NA 4YTLA 1RABB 4J9GA 4ELZC 3CBMA 2QASA 3L2WA 2X3WD 2ZPGB 4J9CA 4E7ZA 3X24B 3CCSA 1JO8A 2RHXA 2M16A 4M75F 1KD1C 2I0NA 4E7JA 3SHWA 1Q7YU 1X27A 4N0AA 3RKXA 4QKUA 3JCMh 3JB9H 1G5VA 2KBTA 4FYVB 2DZCA 4JRPA 1SRLA 1K73R 2AK5A 1W70A 3MEWA 4J5YA 3I56A 2RHUA 3X28B 4IUTA 2DL7A 4MMKA 4D6WA 4ANJA 5CQYA 3OYJA 1ZHIA 4LDUA 4DBFA 1TXQA 3JCMP 1KHCA 3PMTA 2GCXA 3VYHB 1A0NB 4CC3A 3JCMg 5L8RE 1JEGA 3BFMA 3QYGB 1G3SA 4PNOA 4J9IA 4RTXA 2BZYA 5AYFA 2DLPA 2LP5A 3H8ZA 2I2LA 4J7IA 4ELYC 5EC7A 4A53A 1IHVA 1NM7A 2YT6A 1RLPC 2HQHA 1E7OA 4M77D 3VS3A 3CCSQ 3CC2Q 1N8RR 1K9MC 2DBKA 5FLXE 2DILA 2D0QB 1YJNT 2K9GA 3SWNC 5LJ5f 3EHQA 3QKJA 5GAMf 3C94A 2PVGB 4M75G 2DJQA 1I5LA 5GAMg 4QVCA 4XU0A 1TOVA 2LT1A 3RMQA 1K73U 1I81A 1OEBA 4C8QE 5GAOp 1Y96A 2JOYA 1WJSA 2YUOA 1AWWA 2KYMA 4C5HA 3FJ5A 4J9FA 2NUTA 2HKQB 4X9DA 2DL5A 2DRKA 1QCNA 3PE0A 5FW9A 4LE9A 4M78B 2CP6A 1SHGA 2FVUA 2CT4A 2VASA 2X51A 4JS5A 2DX1A 2LCLA 1NLPC 3HTRA 1YCSB 4LXCA 3R6OA 3ZL7C 1U1SA 1QLYA 4JZ4A 1RAHB 1QKWA 2ENMA 4P5NA 1RLQC 4M75C 3CC2A 1QVFP 1D3BA 2CP7A 3CCVQ 3CCQA 3NMZC 3LH0A 4RG8A 1YWPA 2QEXT 2OX7A 3C12A 4N0AC 1K8AR 3X20B 2XU8A 2M51A 1QKXA 3HP9A 2PTKA 3BDLA 4C0GA 4KGVB 2FZCB 1IGQA 2XG8D 3HRUA 3V7CA 3OYAA 1R0CB 3PTAA 1U3OA 3G1JA 4JRIA 1BI2A 1KQ2A 2RA2A 1ZA2B 3KBGA 1NJIU 3GPLA 3OYFA 4B9WA 1M3CA 4OMOA 3I5RA 2NUTB 2BZ8A 4J9BA 3KUFA 2CUDA 1MV3A 2KNBB 1X6GA 4M7DD 4OMLA 3H41A 1OZ3A 5D7UA 5J39A 1ZBJA 2KRSA 3L2VA 4AG1C 1RAEB 3VU3C 2FL7A 3PGGA 2QI2A 1QVGP 5KYYB 1M90C 2YLBA 1G3WA 3G4SQ 2XICA 4KUDK 3V8JA 4M7DB 1DJ7B 2PVOB 3IQLA 3L2UA 1VQNT 2D0NA 5CKFA 1C1AA 4C0DB 1D1AA 4IIMA 2V1QA 4M78D 2ED1A 2K5FA 1D1CA 1KC8C 1KIKA 2AZSA 2K3BA 1KFZA 2NYSA 1AD5A 1VQKA 4VUBA 1NPRA 1UDLA 3C95A 2DEUA 2KR3A 2EW3A 2HL5C 4Y28E 4M77F 2CH4A 2CUBA 2Y4YA 4IKFA 3QSUA 1RI0A 4O5VA 1VQLA 5GAOr 1OPLA 5LJ3j 4IUUA 3OMCA 2COYA 3JCMJ 1WNLA 1WJQA 2JNGA 2LRQA 3RKWA 2DZ9A 3G6EA 1W2BA 1BBZA 4KRTA 5EG2A 1AWOA 3CCMT 2CDTA 1UHFA 2MWPA 4PJOC 2XHCA 2NUPA 1Y7XA 3MEUA 1OV3A 1M30A 1NYFA 3OS0A 3PVLA 4L6V5 2PNIA 4J8OA 3THKA 4E2FB 3G4SA 1M1KC 2RJDA 4E7IA 2QQSA 2BE9B 2F2WA 1TUCA 3CCJA 1KD1U 1VOMA 1AT1B 5GJWB 1ZUUA 3OYCA 1RUWA 4E47A 3V8LA 4FU6A 2DRMA 1NEBA 1M9SA 1QWEA 4PJOA 2B8AA 5CKBA 4D8KA 1XJWB 4E6RA 3LWIA 2A7YA 5FU7B 4FW1A 2L3PA 4KBMB 5GAOn 2X3XD 3EG0A 1Y0MA 1N8RC 3CMET 4DBQA 2PQWA 3JV3A 3CD6Q 2JUFA 2H3EB 1ZA1B 1M1GA 4MZTA 5IHKA 5GMKe 1TUDA 3O5ZA 1BU1A 5IHNA 3CCLA 4XU3A 3CCLT 3CBPA 3GBQA 2HD0A 3BDUA 1MV0B 4JRKA 4BE2A 5DM7R 3L42A 1Y57A 3G6EQ 2EVRA 2JM8A 5KYUA 3MJXA 3TQ7P 3OBWA 1K8AC 1VQ7Q 4RKUE 2QGFB 2RJFA 1U1TA 1OULA 4JLIA 1GBQA 4J83A 2JMAA 1C0MA 3M4GA 1MNDA 2E4HA 1M2OA 1HYOA 1X69A 3HKSA 4ESRA 5GMKl 4PJOE 3FC3A 2DYBA 4M4ZA 1M8MA 4OB3B 3CMEA 2KE9A 4DOWA 1VUBA 3VS0A 3QJYA 2RQVA 1KHIA 1WXBA 2ZCFB 4M75B 1VQPT 5IH2A 1ABQA 3GNGA 3VJPA 3CCQQ 2OTLT 2KDSA 3RUXA 3SD4A 3JCMX 2VUBA 2DIQA 3QWXX 4M7AC 1YHQQ 4D8DA 1WGSA 2EYYA 5L23A 1YJNA 1EFNA 1FMVA 2RJCA 2EJ9A 2RMOA 2CZ7B 4MZPA 1VQ4A 3TU4K 1VQLT 2DBMA 4M78F 1PKTA 4XAXB 3KXTA 1Q86R 2KK4A 1WQ7A 2D9TA 2ZPFB 3JCMd 3ZEHA 3G6ET 2G6FX 3J81E 2DVJA 2PU9B 3META 2MK5A 4JPBW 3TSZA 1VQNQ 3VS2A 4M75A 4C0ZA 2D6FA 4MZMA 3FB9A 4FT2A 3GNFB 4ORZA 2DXUA 4GLKA 1OU9A 5FRNA 4B6MA 3H9NA 4JJCA 1XTDA 4BDYA 4XTWA 3M0TA 2E5KA 4FT4A 2LVMA 1X2QA 4DEXA 2DJZA 4A4GA 4DOVA 4M78G 4HKEA 5GANg 1PRMC 2IVWA 4GY5A 5KYWA 2HNIA 3NTIA 1VQMQ 2O31A 4EMHA 1QQJA 1M2VA 2KXDA 4PJOG 1W2BP 1FX7A 3QJ6A 5KE2A 1YJNQ 3QDRB 5HK0A 2RJEA 2DIGA 1AHJB 2DAQA 1NG2A 1LVKA 4F7UG 3WXMB 4JJDA 5FU6B 5LL6S 1D0XA 2SEMA 4GBQA 2P84A 2FPDA 3I56T 1ZQ1A 1OOTA 3FJPA 3L1AA 2BZXA 4ZGDB 1WQWA 2ECZA 3UT1A 1VQOA 1SG5A 2KGTA 5LJ5e 2YUQA 5A0LA 5LJ5j 1TG0A 5GMKi 5GANj 1EIFA 1OZ2A 2RK1A 4J9DA 3G7ZA 4C92D 4FCYA 2XDPA 4NL3A 1MGQA 1CSKA 1TH7A 4Q5WA 2D1XA 2DMOA 3EG1A 3ZBDA 1BK2A 2DK3A 1LCKA 1VQ5T 2L3RA 4C5EA 3A1PA 2DKGA 2AIRB 3OS5A 3EFOA 4E7KA 4FSSA 2ZZDA 1WHKA 1OX9A 2QAZA 2JMCA 3BW1A 1B34A 5LJ5g 2RQTA 3VUZA 1U06A 1BKBA 4JRQA 1I0CA 3OYLA 3RNJA 4E7SA 2VKNA 1B7TA 2VGNA 5LJ5d 4RTVA 2JS2A 4M77A 1PCXA 1T3SA 4PK4A 4OB1B 1YWOA 1MNEA 3BE3A 5GAN2 4F7UE 2ATCB 3OY9A 1YBYA 5GMKj 2QDYB 2RD1A 1IREB 3CBOA 3OS1A 3CCRQ 2K6DA 1TUGB 2HSEB 2R58A 1VQ7A 4Y92A 2EJFA 3FEOA 4OP0A 4XTVA 1NZ9A 2EYWA 2KI7A 3JB9J 1JBMA 1I8FA 1Q81C 2E6ZA 3TREA 5CK9A 2EKHA 1I5OB 1X43A 2PVDB 4PLLA 1N5ZA 1WXUA 1QVGS 3PIOA 5IN1A 2G3RA 2GNCA 3JB9G 4E7HA 1GBRA 1WHLA 1SSFA 2YRCA 2AT1B 5GMKm 3H0FA 5I21A 3D7SB 1T3LA 1JXMA 2X4JA 4M7DE 2HMAA 5I11A 2CKKA 2EFIA 4LN2A 1MMAA 3OYKA 4HCKA 4M77E 4DEYA 3EG9B 2RNAA 3T9NA 5J3BA 2AKKA 4C0DC 4CI0C 5LJ5h 1GL5A 1NYGA 2DERA 3EGDA 2K5LA 5J26A 2QQRA 1KQSA 4PJMA 1Y96B 3MP1A 1VQPA 2DE0X 1VQ4Q 2V8KA 2DXCA 5A0DA 3CCEQ 4WTOB 2V8IA 1E6HA 3J7AF 2CH4W 2JJ9A 3LLRA 3M0UA 5FWBA 2GGRA 3EH2A 1WXTA 2ESWA 3OYMA 2DA9A 2VXFA 3KFVA 3MEVA 1QCFA 1W4SA 3CMAA 2WSFE 1WI7A 1RADB 4M75E 3SB2A 1K76A 2JN0A 1XOVA 2A36A 2RH2A 1WLPB 1VQ5A 1LPLA 1YJWT 2D8HA 2CP0A 1P92A 1WHMA 2JW4A 1HK9A 1PM3A 3DLMA 4QQDA 4F17A 3CC4A 1PHTA 1X6OA 1VYTA 2XKOC 1VQ9T 2GTJA 1SPKA 1WZOA 4XU2A 1GCQC 2YUNA 3FIFA 1BYMA 3LGFA 4HVWA 2RI3A 4X9CA 3MP6A 2M02A 2XK0A 3ULRB 3M5AA 4PKCC 2OTJQ 4F16A 2RB6A 1R8OB 2KRNA 1H3ZA 2CZ0B 3M53A 4XU1A 1SSHA 2Z0WA 4Z02A 1D1BA 1K0XA 2EKOA 5KCOA 1UB4A 1B07A 3RR6A 4N4HA 1PRLC 4PFZA 4TVRA 2CREA 2KAFA 1RAIB 3HRSA 5LJ3h 4ME7A 2K4YA 1IB8A 4PJNA 2X4WA 3CC7A 3RIRA 2EYXA 3CCST 1SEMA 3RERA 3NTKA 1M27C 1UECA 3UA6A 1K4US 4BY6B 1I1JA 5IXBA 4C8QD 4M77B 2LX7A 1OPKA 3RMSA 3JCMQ 5FWCA 2DTHA 1YJWQ 2QYZA 1VQLQ 4J9HA 5GANh 3REBB 1QW1A 2KQWA 1QP3A 1UGSB 3CD6T 4IUQA 1UFFA 2RK2A 3VKIA 2DYIA 3BY7A 4Z88A 4FYXB 1TSFA 3NFCA 1WHJA 5DLQE 4BDZA 1G3YA 1MMGA 1UGRB 4PJOD 1TTHB 1UG1A 3PVQA 2OTJA 1VQ6Q 4J9EA 5GANe 4M7DG 3JAME 4LDVA 3MCAB 2CP5A 2P4TA 9ATCB 5GANf 3OW2S 1YN8A 3MP8A 1LNXA 4IUVA 4LUEA 2EGEA 2J6FA 3CC7Q 4C8QA 4EMKA 4PL6A 1RACB 1RAAB 5CKEA 2Y90A 2OAWA 2CP3A 2FRYA 3PT9A 3CCVA 4B9XA 4LDWA 1FWZA 4OMMA 4HCBA 4BI4A 2XDBA 1LOJA 4CC4B 2J7IA 4OMNA 1K8AU 4RG2A 3CC4T 1JRIA 4JUVA 1O75A 3M55A 2EIFA 1AOJA 1YI2Q 2X9HA 2K79A 1NLOC 2EPDA 1G2BA 3VS4A 1OI1A 4UC4A 2F5KA 2QA4Q 4WF2A 4CRIA 4QVDA 1G3TA 5KYNA 1ZLMA 4QW2A 4PFPA 2HL3A 1UGVA 1N27A 3A8GB 1BCMA 4M77G 4C8QG 4IURA 2EYQA 2O01E 2YRDA 1VQPQ 1Q82U 1PKSA 3CCEA 5CVIA 4AFZC 4M7AG 1H641 5KCHA 2EAYA 2HCKA 2FZKB 2CT3A 4A4EA 1MUZA 4LDXA 4PFOA 3DLLA 1M3BA 5HK3A 3QPHA 1YIJT 5GAMd 3CMAQ 2EYZA 5FRMA 4CC7A 2LNHB 2HKNA 4R55A 2MYSA 1SHFA 3E19A 3JB9I 5CAIA 3JCMV 4BE0A 1IGUA 3C0CA 4AG2C 3UPUA 2ROLA 2E3HA 1BIBA 1YI2T 2BE7D 2DD5A 5FU6C 3OYNA 2GTOA 3M58A 1WHGA 5GAN6 4RMOA 5C0MA 1KD1R 1K1ZA 3GLXA 3EG2A 4RTWA 3JCMb 3OS2A 4ZGJB 2VXEA 3SWNB 4DQ2A 1JJ2S 3CPFA 5CIUA 1VQNA 1KQ1A 1R77A 2A37A 2RM4A 2MAMA 3NTHA 2FRWA 3QYHB 1N6AA 4J6XA 1WX6A 3CCQT 2OTJT 5IT9E 2DPPB 3A5ZB 1QMCA 4PJOF 2QQAA 3JRZA 4R0KA 3OYDA 1IHWA 2LQ8A 1PNJA 1D0YA 4BE1A 3VS1A 1PSEA 3EFSA 1Q81U 4M7AE 3AT1B 2QEXQ 3JCMe 4JDSA 4M7AB 2F2VA 2J6KA 2W0ZA 1FYNA 1X6BA 2A28A 3OYGA 3J80E 2E64A 4II1A 3PMIA 4CC2A 3M0QA 1ZUYA 1Q7YR 1RAGB 2FB7A 8ATCB 1K9MR 3SDZA 1YJWA 3HL8A 1YHQT 1VQOT 1Q86C 1S72T 3CCLQ 4BI8B 1GCQA 1Q95G 2O9VA 4RTZA 2MPXC 3EGXB 2ZPHB 2MCNA 2JTFA 3PIPA 2YRVA 5D6XA 3RESA 1NBEB 1HD3A 2RI2A 2E10A 4HVUA 4PJLA 2FZGB 3LYIA 3NGPA 3I55Q 3M54A 4M78E 1ZSZC 1VQ4T 3JB9D 2CYZB 2EGCA 2COWA 4OGCA 2X4XA 4MDWA 3VRZA 4QVZA 1YITA 2B86A 2QEXA 1EX4A 2D8JA 2MWOA 3URGA 2O9SA 2K3XA 2F69A 2AKLA 4PJJA 2K7AA 3M9QA 2XMFA 3CC2T 3EHRA 2DO3A 2KT1A 3OBYA 2BKDN 3UA7A 1MMDA 2LNVA 1N9RA 3QZ5B 3OMGA 1M4ZA 4QQGA 2ROTA 2LTOA 1JJ2P 3M0RA 1VQKT 2M9UA 3M4YA 4FIBA 1V29B 3HPWA 4C5GA 4F14A 5C6SA 4AMCA 1T0HA 2X35A 3MHXA 1IZ6A 2LZ6B 1TS9A 1UJ0A 3E9FA 4V2SA 1ZSZB 2C06A 1CKBA 1YI2A 5GAN8 5A2QE 4DA4A 4RTUA 3CCRA 3VYGA 3G71Q 3CCRT 2EQIA 2QTVA 4A63B 3CCUA 5GAN7 1QVPA 2XD0A 1ZX6A 4IUPA 3OW2A 2QQBA 2R5AA 1PSFA 5KYXA 1AWXA 2E1HA 3EG9A 3M59A 1UGQB 1HXDA 1UE9A 2QG9B 2VB6A 4FM4B 4M78C 3P8BB 2DEQA 3WVEB 2CP2A 3N5BB 3EGDB 3U23A 3G71T 2M0OA 3TVTA 2MF2A 5GAMe 1M1FA 2YWWA 4C8QC 4EMKC 4BY6C 1U5SA 3M0SA 4NL2A 2JT4A 3E1SA 1PD0A 1VYUA 1M90R 3GF5A 1R0BG 1W2BS 3JCMW 3S3MA 1IO6A 4ZN3A 4M7DC 2BTTA 1OQKA 1KK7A 2PZ1A 1H92A 4F7UB 2FG0A 2HDAA 4KH1B 2GQIA 2QTXA 3VS7A 4M77C 1AWJA 2CGHA 3CCMA 2RQUA 1KC8R 2EGAA 2LCSA 2WSCE 2IIMA 3LW5E 2E12A 4OB0B 2A0FB 4Z8AA 1D3BB 2K5IA 2DL4A 3CQTA 1KJWA 4HVVA 4RTTA 4BACA 1NJIC 2VC8A 2SRCA 3I5SA 1YITT 1ZSGA 1PD1A 3X25B 2MOXA 2HSPA 2CSIA 2KY9A 2WSEE 1WYXA 2P0QA 1M1KR 4KT0E 2OI3A 4R56A 1F1BB 2FYKA 5HCKA 2L89A 2LDMA 1KQSP 3CC4Q 2JVVA 3CCJT 3RKYA 3I35A 2RF0A 4BI3A 1V1CA 1VQMT 2EWNA 5M9OA
chains in the Genus database with same CATH topology
3INZA 2XIDA 4A4KA 5GANh 1QW1A 2KQWA 1QP3A 1UGSB 3QIIA 1K9MU 3QZ9B 5LJ3e 3CCLA 4XU3A 4Y91A 3CCLT 3CD6T 5A0GA 4M7AD 3JCMf 4IUQA 2EJGA 2RK2A 3CBPA 3VKIA 5HKCA 1KG1A 2RI5A 2HD0A 3BDUA 3BY7A 4JRKA 2LC4A 3PNWC 5DM7R 3NFCA 3CPWS 3L42A 5DLQE 4BE2A 2HAXA 3OYBA 4BDZA 1G3YA 1JB0E 1UGRB 5GAOm 4PJOD 3H6ZA 2YHTA 4FL6A 3EAEA 3OBWA 4EDUA 1K8AC 3CC7T 2OTJA 3M57A 4EPCA 1NPPA 4RKUE 2RJFA 3I55T 3SFMA 3CCUT 4C92A 1U1TA 4XTUA 5FU7C 1OYXA 4JLIA 3V7RA 3QG1A 4A4HA 3LX7A 5GANe 1M1KU 2MI6A 2CZ1B 2L8DA 5GMKh 4J83A 3M4GA 3P8DA 4M7DG 1KQSS 3JAME 3P8HA 4LDVA 3HKSA 3MCAB 3ZFJA 1UEBA 2BUDA 5GMKl 2P4TA 4NOYA 3MO8A 4XK8E 2O4XB 3QHSA 5GANf 3OW2S 4PJOE 3FC3A 1M5Q1 1Y71A 1WPYA 5CQXA 3CXCA 3MP8A 4BUGA 3OQ5A 4BB7A 4OB3B 1QVFA 3CMEA 3V8KA 1LNXA 4IUVA 4DOWA 1VUBA 3A8OB 3QJYA 2PUOB 3PFSA 2X4YA 1K73C 1KHIA 1VQ7T 4C8QA 4EMKA 4PL6A 3I55A 3GP8A 2ZCFB 4C92F 5CKEA 4C8QB 4EMKB 4M75B 5GANd 1VQPT 1YJ9T 2Y90A 3CCVA 1B34B 3GNGA 3PT9A 3VJPA 2DD4A 2R57A 3UDCA 2KVQG 4B9XA 1M8VA 2RO0A 5KE3A 1VQ8A 4LDWA 5GAOl 2OTLT 2KDSA 3RUXA 1U8RA 3AHUA 3SD4A 3X26B 3JCMX 1FWZA 4M7AA 2VUBA 4HCBA 2XI9A 2DIQA 4BI4A 2XDBA 5I2SA 4M7AC 3TCJA 1LOJA 3GIBA 1WGSA 4N4GA 1UGPB 1YJNA 1K8AU 2RJCA 3HFOA 1BI1A 4RG2A 1QP2A 3CC4T 2EJ9A 1JRIA 2HQEA 2CZ7B 4JUVA 4MMLA 4MZPA 1Q82C 1VQ4A 1LJOA 1O75A 3TU4K 4EMGA 4M78F 4ZTJA 1VQLT 2NLUA 3M55A 5GAN3 2EIFA 2JZ2A 2E70A 4XAXB 3KXTA 2KK4A 1WQ7A 5GAOq 2D9TA 2ZPFB 5GAMh 3FRNA 1OI1A 3JCMd 2JTMA 4UC4A 2F5KA 3ZEHA 4A4FA 4WF2A 2LT4A 4CRIA 3G6ET 1N8RU 4QVDA 5CCAA 3J81E 1G3TA 2PU9B 4OMFB 3META 4J6YA 4OF1A 4QW2A 2K2VA 4L5GA 3ER0A 1BI3A 1N27A 3A8GB 4M77G 5DY9A 2L5QA 4C8QG 1BI0A 1X01A 4IURA 2K3YA 2DXTA 2DTOA 2EYQA 4XQ3A 2O01E 4M75A 4PLIA 4C0ZA 1YIJA 1Q82U 4ZN1A 3E9GA 4YTLA 2D6FA 4MZMA 4ELZC 2XDDA 3FB9A 4FT2A 3CBMA 2E41A 3CCEA 4HCZA 3ASKA 3L2WA 3GNFB 2ZPGB 5CVIA 2DXUA 3X24B 4GLKA 3CCSA 4PJOB 3QBYA 5FRNA 4M7AG 4C92B 4C8QF 1H641 2RHXA 2M16A 2QXFA 4M75F 5KCHA 1KD1C 1XTDA 2EAYA 4XTWA 4BDYA 4E7JA 4HCCA 4FT4A 1Q7YU 2LVMA 4A4EA 4LDXA 4XTZA 3OYHA 3CCET 4N0AA 2DJZA 3RKXA 3DLLA 4A4GA 4DOVA 3MEAA 3QPHA 3DB3A 4HKEA 4M78G 3JCMh 5HK3A 5GANg 2IVWA 4GY5A 3JB9H 2HNIA 1G5VA 1YIJT 5GAMd 3NTIA 1ZBXA 4J6WA 5FRMA 3ME9A 4EMHA 4XTYA 2DZCA 4JRPA 4PJOG 1FX7A 3QJ6A 5KE2A 3MEWA 3E19A 3JB9I 4R55A 5CAIA 3QDRB 4J5YA 3JCMV 2RJEA 5HK0A 3I56A 2DIGA 4BE0A 1AHJB 2DAQA 1FXXA 2FHDA 3UPUA 2RHUA 3X28B 4IUTA 3HHTB 3WXMB 1BIBA 4F7UG 5GAN5 4MMKA 2R5MA 4D6WA 4M7DA 5FU6B 1YI2T 5LL6S 5CQYA 2DD5A 3OYJA 1ZHIA 5FU6C 4LDUA 3I56T 3OYNA 3JCMP 1KHCA 3PMTA 2GCXA 3M58A 1ZQ1A 3FJPA 3VYHB 5GAN6 3L1AA 1I4K1 5C0MA 4ZGDB 4RMOA 5CKDA 1WQWA 3JCMg 3UT1A 3GLXA 5L8RE 1VQOA 5LJ5e 3BFMA 3QYGB 3JCMb 1G3SA 4L59A 5A0LA 5LJ5j 3OS2A 4PNOA 3EFRA 4O6JA 4ZGJB 2VXEA 3SWNB 4DQ2A 1XNIA 3CPFA 1JJ2S 3O8VA 5CIUA 5GMKi 4JS4A 4JLGA 5GANj 5AYFA 1VQNA 1KQ1A 3OB9A 2RM4A 1EIFA 1OZ2A 2MAMA 2RK1A 3H8ZA 2I2LA 4J7IA 3NTHA 3V7SA 4ELYC 3QYHB 2YLCA 3L2RA 1N6AA 4A53A 4J6XA 4M7DF 3Q1JA 3G4ST 3G7ZA 3CCQT 4C92D 2OTJT 5IT9E 2DPPB 2XDPA 3A5ZB 4NL3A 4M78A 4M77D 4PJOF 1K9MC 4HT8A 5GMKe 2QQAA 1MGQA 3JRZA 5FLXE 3S3NA 4OB2B 2E65A 3OYDA 1TH7A 2P0PA 4Q5WA 2D0QB 2F5TX 2LQ8A 3ZBDA 1YJNT 4BE1A 3SWNC 2DK3A 1H3ZA 1VQ5T 1PSEA 3VUBA 2L3RA 3EFSA 4C5EA 5LJ5f 1Q81U 3QKJA 2DKGA 4M7AE 4KUIA 3JCMe 4JDSA 3OS5A 4M7AB 5GAMf 3C94A 2PVGB 3VV0A 2E6NA 4F7UA 4NS5A 4M75G 2WACA 4XTXA 4E7KA 1I5LA 5GAMg 2PUKB 2ZZDA 3QXEB 4N4IA 4XU0A 4QVCA 3BW1A 1B34A 2EQKA 5LJ5g 2LT1A 3RMQA 1K73U 1I81A 3OYGA 4C8QE 3VUZA 5GAOp 1Y96A 2JOYA 1BKBA 4J7FA 5GAN4 2E64A 4II1A 1WJSA 3J80E 4JRQA 4C5HA 3PMIA 4QQ6A 2LCCA 3OYLA 3F70A 2VGNA 1WJRA 5LJ5d 4FSXA 1JJ2A 2LQKA 2EQJA 2FB7A 4X9DA 2IG0A 4M77A 3SDZA 3FLGA 3HL8A 1YJWA 4OB1B 4M78B 1QVFS 2ZGWA 5LJ3f 4F7UF 1YHQT 4MDXA 2FVUA 1VQOT 5GAN2 1Q86C 4JS5A 4E7LA 1S72T 4F7UE 4BI8B 2LCLA 2CS7A 3OY9A 1VIFA 1YBYA 2ZPHB 2EQUA 2JTFA 2KSSA 3PIPA 5GMKj 3L2QA 2YRVA 3R6OA 2Y4XA 5IAYA 5D6XA 2QDYB 2ZPBB 5LJ3d 3RESA 2RD1A 2RI2A 1IREB 2E10A 1U1SA 3CBOA 3OS1A 3GOXA 2R58A 2GFAA 4ZTFA 4A54A 3LYIA 1VQ7A 2EJFA 3M54A 4M78E 4P5NA 1VQ6T 1VQ6A 3FEOA 2VYTA 4M75C 3CC2A 4OP0A 1VQ4T 3JB9D 1D3BA 1YJ9A 2CYZB 2DVEA 4OVAA 3S3OA 4XTVA 1NZ9A 4RCBA 2E5QA 3JB9J 1JBMA 1I8FA 4OGCA 2X4XA 2E6ZA 3CCQA 3TREA 5CK9A 1Q81C 1Q86U 3LH0A 4MDWA 4QVZA 1RL2A 4RG8A 1YITA 2PVDB 4PLLA 4M7AF 2QEXA 5CR2A 1QVGS 2QEXT 3PIOA 1N9SA 2MWOA 5IN1A 2G3RA 2V8JA 3URGA 5DLOA 1YHQA 3JB9G 4E7HA 3OYIA 2K3XA 3C12A 4N0AC 2F69A 1KC8U 2QQ9A 3TEEA 3X20B 2XU8A 3HP9A 1SSFA 4KULA 3M9QA 5GMKm 4JJNK 1VQ9A 3HFNA 5I21A 3CC2T 3BDLA 4C0GA 2DXBA 3DB4A 2DO3A 2XG8D 3HRUA 3OBYA 2BKDN 3V7CA 2X4JA 2VV5A 2LNVA 3OYAA 4M7DE 1N9RA 3PTAA 3QZ5B 3CXCS 3OMGA 3CPWA 2CKKA 4JRIA 1M4ZA 1BI2A 1KQ2A 2RA2A 4QQGA 1MHNA 2EFIA 3KBGA 3OYKA 2LTOA 4M77E 3GPLA 1NJIU 3OYFA 1M90U 1VQKT 2M9UA 3M4YA 2P0KA 4C0DC 3T9NA 2GF7A 2A3LA 4FIBA 5J3BA 4B9WA 4CI0C 1X75C 1V29B 5LJ5h 3HPWA 4C5GA 2M1HA 5C6SA 1VQ8T 2K5LA 2X35A 3MHXA 1XQHA 1IZ6A 5J26A 1BIAA 3JSCA 3KUFA 2QQRA 1KQSA 1Y96B 4M7DD 3MP1A 1VQPA 1OZ3A 2GQVA 3HSBA 2V8KA 3E9FA 5J39A 4V2SA 2DXCA 2C06A 5A0DA 2RHIA 1YI2A 3L2VA 5GAN8 5A2QE 1YCYA 4DA4A 2V8IA 1Y07A 3CCRA 3VYGA 3CCRT 3J7AF 2OAUA 3LGLA 3LLRA 3VU3C 4LDYA 1VQMT 3CCUA 2FL7A 2QA4T 3PGGA 2QA4A 3JCMc 5GAN7 1QVPA 2QI2A 2XD0A 1M90C 2YLBA 1G3WA 2ZPEB 4IUPA 2XICA 3OYYA 3OYMA 3OW2A 4KUDK 3V8JA 4M7DB 2VXFA 2QQBA 1DJ7B 2R5AA 3QO3A 3MEVA 2PVOB 2CZ6B 5D6YA 1PSFA 3L2UA 2E1HA 1VQNT 3M59A 1W4SA 1UGQB 1HXDA 3CMAA 1VQMA 5CKFA 2WSFE 4FM4B 4M78C 4C0DB 3P8BB 2RHZA 2DEQA 4M75E 3SB2A 5HY6A 3WVEB 2JN0A 3OSSC 4BD3A 1XOVA 3M56A 4M78D 2RH2A 3N5BB 2K5FA 2BIVA 3WVDB 5CKHA 1VQ5A 5KH6A 1KC8C 3G71T 2M0OA 1YJWT 2MF2A 1VQKA 1P92A 1NPRA 3C95A 4VUBA 5GAMe 3C4SA 3CCVT 1M1FA 4C8QC 4EMKC 1HK9A 4Y28E 5FROA 2LX9A 4BY6C 4M77F 3DLMA 4QQDA 2H3JA 3CD6A 3CC4A 2Y4YA 1X6OA 4IKFA 4NL2A 3QSUA 1VIEA 2XKOC 1VQ9T 3E1SA 1RI0A 4O5VA 3CMAT 1VQLA 5GAOr 3UWNA 5LJ3j 4LD9K 3GF5A 4IUUA 3OMCA 4XU2A 1W2BS 3JCMW 5CO7A 3S3MA 2K57A 3FIFA 1Q7YC 4ZN3A 5LJ3g 3OSVA 3JCMJ 2OTLA 1WNLA 1WJQA 2JNGA 4M7DC 1BYMA 2LRQA 2VGMA 3LGFA 4OGEA 3RKWA 2O4XA 5I2MA 2DZ9A 3G6EA 1W2BA 2RI3A 4X9CA 4F7UB 5EG2A 3MP6A 2QTXA 4ATOA 4M77C 2XK0A 3HRTA 1O9SA 2CGHA 3M5AA 4PKCC 4M75D 3CCMT 1QVGA 3CCMA 2KMTA 3JB9F 2MWPA 4PJOC 2WSCE 2XHCA 2RB6A 4C92E 1R8OB 3LW5E 1Y7XA 2E12A 3MEUA 3OYEA 3G71A 2CZ0B 3A8MB 3M53A 4OB0B 2AHJB 4XU1A 3OS0A 4L6V5 4RCCA 4LD6A 1D3BB 2K5IA 4Z02A 2ZPIB 3CEYA 4J8OA 2EKOA 2GFUA 5KCOA 3FDRA 4HA8A 3G4SA 1M1KC 2RJDA 1UB4A 4E7IA 4N4HA 4BACA 2QQSA 3QUIA 1NJIC 2VC8A 4TVRA 4X34A 3S6WA 4C92G 3CCJA 1YITT 1KD1U 2KAFA 3X25B 3OYCA 2RHYA 2HBPA 2HQXA 2DTIA 3V8LA 4E47A 4FU6A 3L2ZA 3DKMA 3HRSA 4ME7A 5LJ3h 1M9SA 4PJOA 2K4YA 3SWNA 1S72A 2B8AA 2KY9A 2MMPA 2WSEE 5CKBA 2X4WA 3A8HB 3LWHA 3CC7A 3RIRA 1GXIE 3LWIA 3CCST 2A7YA 5FU7B 4C0FA 4C5IA 2P0QA 5GAMj 4KBMB 5GAOn 3RERA 5D6WA 4KT0E 3NTKA 4C92C 4R56A 2EQMA 4BY6B 2FYKA 1NE8A 1N8RC 2L89A 3CMET 4C8QD 2LDMA 4M77B 2PQWA 3A8LB 3RMSA 4HT9A 3JCMQ 2JUFA 2JVVA 4ZGEB 1M1GA 2DTHA 3RKYA 4MZTA 3CCJT 4BI3A 3OA6A 2EWNA 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II1 A;  1WJS A;  4PLI A;  4C5H A;  3PMI A;  3E9G A;  3QII A;  4IUP A;  2LCC A;  4QQ6 A;  3OYM A;  3OYL A;  3F70 A;  2R5A A;  1WJR A;  3MEV A;  4HCZ A;  2EQJ A;  3ASK A;  4IUQ A;  5D6Y A;  3L2W A;  2IG0 A;  3L2U A;  2RI5 A;  3QBY A;  5FRN A;  4BE2 A;  3FLG A;  3PNW C;  3L42 A;  5KCH A;  2RHX A;  2M16 A;  3OYB A;  4BDZ A;  4BDY A;  2RHZ A;  4E7J A;  3H6Z A;  2LVM A;  4FL6 A;  4A4E A;  4BD3 A;  4E7L A;  3EAE A;  4EDU A;  3OYH A;  2BIV A;  5KH6 A;  4A4G A;  3MEA A;  3OY9 A;  2M0O A;  3DB3 A;  2RJF A;  1G5V A;  4GY5 A;  2EQU A;  2JTF A;  3L2Q A;  1OYX A;  3NTI A;  2YRV A;  5FRM A;  5IAY A;  3C4S A;  3ME9 A;  5D6X A;  3LX7 A;  4A4H A;  2L8D A;  5FRO A;  2RI2 A;  3P8D A;  3OS1 A;  3DLM A;  3QJ6 A;  3MEW A;  3P8H A;  2R58 A;  2GFA A;  4QQD A;  5KE2 A;  3GOX A;  4ZTF A;  4BE0 A;  2RJE A;  3LYI A;  4IKF A;  2DIG A;  1RI0 A;  2BUD A;  2DAQ A;  2FHD A;  3FEO A;  2VYT A;  3MO8 A;  2RHU A;  2O4X B;  4IUT A;  3FC3 A;  3UWN A;  4OVA A;  3S3O A;  4IUU A;  3MP8 A;  2R5M A;  3OMC A;  3OQ5 A;  2E5Q A;  3S3M A;  2X4X A;  4IUV A;  3OYJ A;  3LH0 A;  3PFS A;  2X4Y A;  4QVZ A;  1WJQ A;  2LRQ A;  3OYN A;  1KHC A;  3PMT A;  4PL6 A;  3LGF A;  4PLL A;  2O4X A;  5C0M A;  2MWO A;  5IN1 A;  2G3R A;  2RI3 A;  3UT1 A;  3MP6 A;  4E7H A;  2XK0 A;  3OYI A;  2K3X A;  2R57 A;  4B9X A;  2RO0 A;  4L59 A;  5KE3 A;  3OS2 A;  2MWP A;  1SSF A;  3OYE A;  3M9Q A;  3SD4 A;  3MEU A;  1XNI A;  1H3Z A;  3O8V A;  5CIU A;  3OS0 A;  2DIQ A;  3BDL A;  3OB9 A;  4LD6 A;  3DB4 A;  1OZ2 A;  4Z02 A;  3H8Z A;  3NTH A;  3CEY A;  2BKD N;  2EKO A;  2GFU A;  5KCO A;  3OYA A;  1WGS A;  3FDR A;  3L2R A;  4N4G A;  3Q1J A;  2RJD A;  3OMG A;  2RJC A;  4E7I A;  2CKK A;  4N4H A;  4RG2 A;  4BAC A;  2QQS A;  4QQG A;  2XDP A;  1MHN A;  2EFI A;  2HQE A;  4X34 A;  3OYK A;  2LTO A;  3S6W A;  3OYF A;  3OYC A;  2RHY A;  3S3N A;  4ZTJ A;  2P0K A;  2HQX A;  4B9W A;  2GF7 A;  2NLU A;  4FU6 A;  3OYD A;  4Q5W A;  2JZ2 A;  4C5G A;  2M1H A;  5C6S A;  4BE1 A;  2D9T A;  2B8A A;  2X35 A;  2X4W A;  2L3R A;  4C5E A;  5J26 A;  3QKJ A;  1OI1 A;  3ZEH A;  3KUF A;  2F5K A;  4UC4 A;  4A4F A;  2QQR A;  4C5I A;  5D6W A;  3NTK A;  3MP1 A;  2E6N A;  4CRI A;  1OZ3 A;  4NS5 A;  5J39 A;  3E9F A;  2EQM A;  2WAC A;  4E7K A;  2L89 A;  2RHI A;  3MET A;  4N4I A;  2LDM A;  3L2V A;  4QW2 A;  2PQW A;  2EQK A;  1N27 A;  3LGL A;  3LLR A;  3OYG A;  4IUR A;  2K3Y A;  3OA6 A;  5M9O A; 
#chains in the Genus database with same CATH topology
 3INZ A;  3QII A;  4F04 B;  1GFD A;  1FMK A;  2RI5 A;  1M3A A;  3UF4 A;  3OYB A;  2C0I A;  1JB0 E;  3EAE A;  1YNZ A;  5KYU B;  3CC7 T;  2F2X A;  3M57 A;  3CCM Q;  4EPC A;  1NPP A;  2FPE A;  3I55 T;  3CCU T;  1YJ9 Q;  5FU7 C;  5AT1 B;  1VYV A;  4A4H A;  4FW2 A;  1M1K U;  2MI6 A;  1W6X A;  3H0I A;  2L8D A;  5GMK h;  2QGG A;  1KQS S;  3P8H A;  2AZV A;  3ZFJ A;  2H8H A;  2BUD A;  4NOY A;  4XK8 E;  2O4X B;  1YIJ Q;  1M5Q 1;  1Y71 A;  2KXC A;  3CXC A;  2RPN A;  3OQ5 A;  4RUG A;  1UUE A;  4KH0 B;  4AFS C;  3A98 A;  2V26 A;  3PFS A;  1ZUK A;  3I55 A;  1B3Q A;  4OMP A;  2W10 A;  4KGX B;  1BCO A;  1M8V A;  2KVQ G;  1M2V B;  5KE3 A;  1VQ8 A;  1U8R A;  1I07 A;  2DM1 A;  2LJ3 A;  2A08 A;  4GLM A;  2KYB A;  1G83 A;  1HJD A;  3TCJ A;  4N4G A;  2DF6 A;  4AFQ C;  1UGP B;  1BI1 A;  1QP2 A;  5IHI A;  4Z89 A;  4MML A;  5KYW B;  2FO0 A;  1LJO A;  4EMG A;  4ZTJ A;  2KRO A;  2JZ2 A;  2NWM A;  2E70 A;  5GAO q;  2VVK A;  5GAM h;  1E6G A;  3FRN A;  2JTM A;  7AT1 B;  1GRI A;  2LT4 A;  1N8R U;  4HXJ A;  5CCA A;  2LMJ A;  4OMF B;  2YXY A;  2K2V A;  4L5G A;  1C6V X;  1K9A A;  2L5Q A;  2RQR A;  1BI0 A;  4LUD A;  4ZNX A;  1X01 A;  2K3Y A;  1IXD A;  6AT1 B;  2KEA A;  2XDD A;  3REA B;  3UAT A;  1T0J A;  1CKA A;  2E41 A;  1X2K A;  2L2P A;  3ASK A;  4HCZ A;  4FYW B;  3RDV A;  4PJO B;  3QBY A;  3CCU Q;  4C92 B;  3CPW P;  4C8Q F;  2QXF A;  4HCC A;  1WHH A;  4XTZ A;  3OYH A;  3CCE T;  4EIK A;  3MEA A;  3DB3 A;  1ZBX A;  4J6W A;  3ME9 A;  4XTY A;  1EZZ B;  1VQ5 Q;  1FXX A;  1WDX A;  2FHD A;  3HHT B;  5GAN 5;  1RAF B;  5KYY A;  2R5M A;  4M7D A;  2KRM A;  4KGZ B;  2GBQ A;  2RQW A;  4IIO A;  1I4K 1;  5CKD A;  4L59 A;  1SF9 A;  3EFR A;  4O6J A;  1KSW A;  1XNI A;  2O88 A;  3O8V A;  4JS4 A;  4JLG A;  3OB9 A;  3V7S A;  2ED0 A;  2YLC A;  3L2R A;  4DBR A;  1S72 Q;  4M7D F;  3Q1J A;  3G4S T;  3EH1 A;  4M78 A;  4HT8 A;  3S3N A;  4OB2 B;  1D09 B;  2E65 A;  2P0P A;  2F5T X;  1Z9Q A;  3LH5 A;  3VUB A;  4QT7 A;  4X1V A;  4KUI A;  1W1F A;  1JXO A;  3VV0 A;  2E6N A;  4F7U A;  4NS5 A;  1NJI R;  4FYY B;  2WAC A;  4XTX A;  4WCI A;  1FMW A;  1AVZ C;  2PUK B;  3QXE B;  4N4I A;  2EQK A;  4JJB A;  4J7F A;  5GAN 4;  2YDL A;  4QQ6 A;  2LCC A;  2NUZ A;  3F70 A;  1WJR A;  1GFC A;  4FSX A;  1JJ2 A;  2LQK A;  2EQJ A;  2IG0 A;  3FLG A;  1QVF S;  2ZGW A;  5LJ3 f;  4F7U F;  3E2U A;  4MDX A;  2LJ0 A;  4E7L A;  2CS7 A;  1VIF A;  2EQU A;  2KSS A;  3L2Q A;  2Y4X A;  5IAY A;  1SKU B;  2ZPB B;  5LJ3 d;  2OJ2 A;  1MMN A;  3GOX A;  2GFA A;  4ZTF A;  4A54 A;  1VQ6 T;  1VQ6 A;  2J6O A;  2VYT A;  1H8K A;  1YJ9 A;  2DVE A;  4OVA A;  3S3O A;  2HBW A;  2E5Q A;  4RCB A;  1BB9 A;  1Q86 U;  2LJ1 A;  1RL2 A;  4M7A F;  5CR2 A;  1ZSZ A;  3EG3 A;  1N9S A;  2V8J A;  5DLO A;  1YHQ A;  2IPO B;  3VRY A;  3OYI A;  1YP5 A;  1KC8 U;  2QQ9 A;  3TEE A;  4KUL A;  4JJN K;  1VQ9 A;  1AZE A;  3HFN A;  1TU0 B;  1VQK Q;  1TWB A;  4DBH A;  2DL3 A;  2DXB A;  3DB4 A;  2VV5 A;  3CPW A;  3CXC S;  1VQ8 Q;  1UTI A;  1J3T A;  1MHN A;  1M90 U;  2HZY A;  2P0K A;  5ECA A;  2GF7 A;  1WA7 A;  2A3L A;  2K2M A;  1X75 C;  2DL8 A;  1Q81 R;  2M1H A;  1VQ8 T;  1XQH A;  1BIA A;  3JSC A;  1YFN A;  1AEY A;  2GQV A;  2F1L A;  3HSB A;  2QDL A;  1PC0 A;  2RHI A;  3I9Q A;  1YCY A;  1Y07 A;  2OAU A;  3LGL A;  3QWY A;  5I22 A;  4LDY A;  1WIE A;  2QA4 T;  2QA4 A;  3JCM c;  2ABL A;  2ZPE B;  1K0S A;  3OYY A;  2KT8 A;  3QO3 A;  2CZ6 B;  5IXF A;  5D6Y A;  3CCJ Q;  2J05 A;  1Q82 R;  1VQM A;  2MIO A;  2RHZ A;  5HY6 A;  3EGX A;  3OSS C;  5GJV B;  4BD3 A;  3M56 A;  2BIV A;  3WVD B;  2L0A A;  5CKH A;  3I56 Q;  5KH6 A;  1VQ9 Q;  1V76 A;  3C4S A;  5KYX B;  3CCV T;  1SRM A;  5FRO A;  2LX9 A;  1S1N A;  2H3J A;  3CD6 A;  1D0Z A;  2QK0 A;  1VIE A;  3VS6 A;  1QCO A;  3CMA T;  3UWN A;  4LD9 K;  1QWF A;  2L3Q A;  5CO7 A;  3SEM A;  2HEQ A;  2K57 A;  4LNP A;  1Q7Y C;  2COZ A;  5LJ3 g;  3OSV A;  2OTL A;  2VGM A;  2M0Y A;  4OGE A;  2RN8 A;  2O4X A;  4RTY A;  5I2M A;  1G8X A;  4ATO A;  3HRT A;  1O9S A;  4M75 D;  1QVG A;  1ACM B;  2KMT A;  1ABO A;  3JB9 F;  3G71 A;  3NHN A;  4C92 E;  1RI9 A;  3OYE A;  4AT1 B;  3A8M B;  2AHJ B;  4RCC A;  4LD6 A;  2DFU A;  2ZPI B;  3MKD A;  3CEY A;  3EFO B;  2GFU A;  3FDR A;  2FPF A;  4HA8 A;  1GCP A;  3QUI A;  4X34 A;  3S6W A;  4C92 G;  2RHY A;  1UHC A;  2HBP A;  2HQX A;  2DTI A;  1ARK A;  2NUP B;  3L2Z A;  2JS0 A;  3DKM A;  2VWF A;  3CME Q;  1PWT A;  3EGU A;  3SWN A;  1S72 A;  2MMP A;  1VA7 A;  3LWH A;  3A8H B;  1GXI E;  3NPF A;  2E3I A;  4C0F A;  4C5I A;  5GAM j;  5D6W A;  2LQW A;  4C92 C;  3RBB B;  2EQM A;  1NE8 A;  2ZAE A;  3A8L B;  4AFU C;  4HT9 A;  4ZGE B;  4JZ3 A;  1H3H A;  3OA6 A;  2XID A;  4A4K A;  1K9M U;  3QZ9 B;  5LJ3 e;  4Y91 A;  4M7A D;  1IRX A;  5A0G A;  3JCM f;  2EJG A;  2OTL Q;  1KG1 A;  5HKC A;  2LC4 A;  3PNW C;  3CPW S;  2HAX A;  2L3S A;  5GAO m;  3H6Z A;  2YHT A;  4FL6 A;  3CXC P;  4EDU A;  3SFM A;  4C92 A;  4XTU A;  1OYX A;  1NEG A;  2J06 A;  3V7R A;  3QG1 A;  8AT1 B;  3LX7 A;  2CZ1 B;  2DNU A;  3P8D A;  2JXB A;  2YUP A;  1UEB A;  3MO8 A;  3QHS A;  2CSQ A;  5CQX A;  1WPY A;  4BUG A;  1HSQ A;  4BB7 A;  1QVF A;  3V8K A;  3A8O B;  2PUO B;  2X4Y A;  1K73 C;  1VQ7 T;  4OMQ A;  3GP8 A;  2P4R A;  2EBP A;  4C92 F;  4C8Q B;  4EMK B;  5GAN d;  1YJ9 T;  1JU5 C;  2C0T A;  1B34 B;  2DD4 A;  1OX8 A;  2R57 A;  3UDC A;  2RO0 A;  5GAO l;  3AHU A;  3X26 B;  2O2O A;  4M7A A;  1YIT Q;  2XI9 A;  4K11 A;  5I2S A;  1Z9Z A;  2JM9 A;  3GIB A;  2LQN A;  1OU8 A;  3HFO A;  2HQE A;  1UJY A;  2JTE A;  3TSW A;  1Q82 C;  3VS5 A;  2DET A;  1JQQ A;  3OW2 P;  2YSQ A;  2NLU A;  5GAN 3;  3MPU B;  2FEI A;  1PG5 B;  2C0O A;  4A4F A;  1AZG B;  1VQO Q;  4J6Y A;  4OF1 A;  3M0P A;  3QDF A;  3ER0 A;  1BI3 A;  5DY9 A;  1WFW A;  2DXT A;  3H0H A;  2DTO A;  4XQ3 A;  1YIJ A;  4PLI A;  4ZN1 A;  3E9G A;  2V1R A;  3R6N A;  4YTL A;  1RAB B;  4J9G A;  4ELZ C;  3CBM A;  2QAS A;  3L2W A;  2X3W D;  2ZPG B;  4J9C A;  4E7Z A;  3X24 B;  3CCS A;  1JO8 A;  2RHX A;  2M16 A;  4M75 F;  1KD1 C;  2I0N A;  4E7J A;  3SHW A;  1Q7Y U;  1X27 A;  4N0A A;  3RKX A;  4QKU A;  3JCM h;  3JB9 H;  1G5V A;  2KBT A;  4FYV B;  2DZC A;  4JRP A;  1SRL A;  1K73 R;  2AK5 A;  1W70 A;  3MEW A;  4J5Y A;  3I56 A;  2RHU A;  3X28 B;  4IUT A;  2DL7 A;  4MMK A;  4D6W A;  4ANJ A;  5CQY A;  3OYJ A;  1ZHI A;  4LDU A;  4DBF A;  1TXQ A;  3JCM P;  1KHC A;  3PMT A;  2GCX A;  3VYH B;  1A0N B;  4CC3 A;  3JCM g;  5L8R E;  1JEG A;  3BFM A;  3QYG B;  1G3S A;  4PNO A;  4J9I A;  4RTX A;  2BZY A;  5AYF A;  2DLP A;  2LP5 A;  3H8Z A;  2I2L A;  4J7I A;  4ELY C;  5EC7 A;  4A53 A;  1IHV A;  1NM7 A;  2YT6 A;  1RLP C;  2HQH A;  1E7O A;  4M77 D;  3VS3 A;  3CCS Q;  3CC2 Q;  1N8R R;  1K9M C;  2DBK A;  5FLX E;  2DIL A;  2D0Q B;  1YJN T;  2K9G A;  3SWN C;  5LJ5 f;  3EHQ A;  3QKJ A;  5GAM f;  3C94 A;  2PVG B;  4M75 G;  2DJQ A;  1I5L A;  5GAM g;  4QVC A;  4XU0 A;  1TOV A;  2LT1 A;  3RMQ A;  1K73 U;  1I81 A;  1OEB A;  4C8Q E;  5GAO p;  1Y96 A;  2JOY A;  1WJS A;  2YUO A;  1AWW A;  2KYM A;  4C5H A;  3FJ5 A;  4J9F A;  2NUT A;  2HKQ B;  4X9D A;  2DL5 A;  2DRK A;  1QCN A;  3PE0 A;  5FW9 A;  4LE9 A;  4M78 B;  2CP6 A;  1SHG A;  2FVU A;  2CT4 A;  2VAS A;  2X51 A;  4JS5 A;  2DX1 A;  2LCL A;  1NLP C;  3HTR A;  1YCS B;  4LXC A;  3R6O A;  3ZL7 C;  1U1S A;  1QLY A;  4JZ4 A;  1RAH B;  1QKW A;  2ENM A;  4P5N A;  1RLQ C;  4M75 C;  3CC2 A;  1QVF P;  1D3B A;  2CP7 A;  3CCV Q;  3CCQ A;  3NMZ C;  3LH0 A;  4RG8 A;  1YWP A;  2QEX T;  2OX7 A;  3C12 A;  4N0A C;  1K8A R;  3X20 B;  2XU8 A;  2M51 A;  1QKX A;  3HP9 A;  2PTK A;  3BDL A;  4C0G A;  4KGV B;  2FZC B;  1IGQ A;  2XG8 D;  3HRU A;  3V7C A;  3OYA A;  1R0C B;  3PTA A;  1U3O A;  3G1J A;  4JRI A;  1BI2 A;  1KQ2 A;  2RA2 A;  1ZA2 B;  3KBG A;  1NJI U;  3GPL A;  3OYF A;  4B9W A;  1M3C A;  4OMO A;  3I5R A;  2NUT B;  2BZ8 A;  4J9B A;  3KUF A;  2CUD A;  1MV3 A;  2KNB B;  1X6G A;  4M7D D;  4OML A;  3H41 A;  1OZ3 A;  5D7U A;  5J39 A;  1ZBJ A;  2KRS A;  3L2V A;  4AG1 C;  1RAE B;  3VU3 C;  2FL7 A;  3PGG A;  2QI2 A;  1QVG P;  5KYY B;  1M90 C;  2YLB A;  1G3W A;  3G4S Q;  2XIC A;  4KUD K;  3V8J A;  4M7D B;  1DJ7 B;  2PVO B;  3IQL A;  3L2U A;  1VQN T;  2D0N A;  5CKF A;  1C1A A;  4C0D B;  1D1A A;  4IIM A;  2V1Q A;  4M78 D;  2ED1 A;  2K5F A;  1D1C A;  1KC8 C;  1KIK A;  2AZS A;  2K3B A;  1KFZ A;  2NYS A;  1AD5 A;  1VQK A;  4VUB A;  1NPR A;  1UDL A;  3C95 A;  2DEU A;  2KR3 A;  2EW3 A;  2HL5 C;  4Y28 E;  4M77 F;  2CH4 A;  2CUB A;  2Y4Y A;  4IKF A;  3QSU A;  1RI0 A;  4O5V A;  1VQL A;  5GAO r;  1OPL A;  5LJ3 j;  4IUU A;  3OMC A;  2COY A;  3JCM J;  1WNL A;  1WJQ A;  2JNG A;  2LRQ A;  3RKW A;  2DZ9 A;  3G6E A;  1W2B A;  1BBZ A;  4KRT A;  5EG2 A;  1AWO A;  3CCM T;  2CDT A;  1UHF A;  2MWP A;  4PJO C;  2XHC A;  2NUP A;  1Y7X A;  3MEU A;  1OV3 A;  1M30 A;  1NYF A;  3OS0 A;  3PVL A;  4L6V 5;  2PNI A;  4J8O A;  3THK A;  4E2F B;  3G4S A;  1M1K C;  2RJD A;  4E7I A;  2QQS A;  2BE9 B;  2F2W A;  1TUC A;  3CCJ A;  1KD1 U;  1VOM A;  1AT1 B;  5GJW B;  1ZUU A;  3OYC A;  1RUW A;  4E47 A;  3V8L A;  4FU6 A;  2DRM A;  1NEB A;  1M9S A;  1QWE A;  4PJO A;  2B8A A;  5CKB A;  4D8K A;  1XJW B;  4E6R A;  3LWI A;  2A7Y A;  5FU7 B;  4FW1 A;  2L3P A;  4KBM B;  5GAO n;  2X3X D;  3EG0 A;  1Y0M A;  1N8R C;  3CME T;  4DBQ A;  2PQW A;  3JV3 A;  3CD6 Q;  2JUF A;  2H3E B;  1ZA1 B;  1M1G A;  4MZT A;  5IHK A;  5GMK e;  1TUD A;  3O5Z A;  1BU1 A;  5IHN A;  3CCL A;  4XU3 A;  3CCL T;  3CBP A;  3GBQ A;  2HD0 A;  3BDU A;  1MV0 B;  4JRK A;  4BE2 A;  5DM7 R;  3L42 A;  1Y57 A;  3G6E Q;  2EVR A;  2JM8 A;  5KYU A;  3MJX A;  3TQ7 P;  3OBW A;  1K8A C;  1VQ7 Q;  4RKU E;  2QGF B;  2RJF A;  1U1T A;  1OUL A;  4JLI A;  1GBQ A;  4J83 A;  2JMA A;  1C0M A;  3M4G A;  1MND A;  2E4H A;  1M2O A;  1HYO A;  1X69 A;  3HKS A;  4ESR A;  5GMK l;  4PJO E;  3FC3 A;  2DYB A;  4M4Z A;  1M8M A;  4OB3 B;  3CME A;  2KE9 A;  4DOW A;  1VUB A;  3VS0 A;  3QJY A;  2RQV A;  1KHI A;  1WXB A;  2ZCF B;  4M75 B;  1VQP T;  5IH2 A;  1ABQ A;  3GNG A;  3VJP A;  3CCQ Q;  2OTL T;  2KDS A;  3RUX A;  3SD4 A;  3JCM X;  2VUB A;  2DIQ A;  3QWX X;  4M7A C;  1YHQ Q;  4D8D A;  1WGS A;  2EYY A;  5L23 A;  1YJN A;  1EFN A;  1FMV A;  2RJC A;  2EJ9 A;  2RMO A;  2CZ7 B;  4MZP A;  1VQ4 A;  3TU4 K;  1VQL T;  2DBM A;  4M78 F;  1PKT A;  4XAX B;  3KXT A;  1Q86 R;  2KK4 A;  1WQ7 A;  2D9T A;  2ZPF B;  3JCM d;  3ZEH A;  3G6E T;  2G6F X;  3J81 E;  2DVJ A;  2PU9 B;  3MET A;  2MK5 A;  4JPB W;  3TSZ A;  1VQN Q;  3VS2 A;  4M75 A;  4C0Z A;  2D6F A;  4MZM A;  3FB9 A;  4FT2 A;  3GNF B;  4ORZ A;  2DXU A;  4GLK A;  1OU9 A;  5FRN A;  4B6M A;  3H9N A;  4JJC A;  1XTD A;  4BDY A;  4XTW A;  3M0T A;  2E5K A;  4FT4 A;  2LVM A;  1X2Q A;  4DEX A;  2DJZ A;  4A4G A;  4DOV A;  4M78 G;  4HKE A;  5GAN g;  1PRM C;  2IVW A;  4GY5 A;  5KYW A;  2HNI A;  3NTI A;  1VQM Q;  2O31 A;  4EMH A;  1QQJ A;  1M2V A;  2KXD A;  4PJO G;  1W2B P;  1FX7 A;  3QJ6 A;  5KE2 A;  1YJN Q;  3QDR B;  5HK0 A;  2RJE A;  2DIG A;  1AHJ B;  2DAQ A;  1NG2 A;  1LVK A;  4F7U G;  3WXM B;  4JJD A;  5FU6 B;  5LL6 S;  1D0X A;  2SEM A;  4GBQ A;  2P84 A;  2FPD A;  3I56 T;  1ZQ1 A;  1OOT A;  3FJP A;  3L1A A;  2BZX A;  4ZGD B;  1WQW A;  2ECZ A;  3UT1 A;  1VQO A;  1SG5 A;  2KGT A;  5LJ5 e;  2YUQ A;  5A0L A;  5LJ5 j;  1TG0 A;  5GMK i;  5GAN j;  1EIF A;  1OZ2 A;  2RK1 A;  4J9D A;  3G7Z A;  4C92 D;  4FCY A;  2XDP A;  4NL3 A;  1MGQ A;  1CSK A;  1TH7 A;  4Q5W A;  2D1X A;  2DMO A;  3EG1 A;  3ZBD A;  1BK2 A;  2DK3 A;  1LCK A;  1VQ5 T;  2L3R A;  4C5E A;  3A1P A;  2DKG A;  2AIR B;  3OS5 A;  3EFO A;  4E7K A;  4FSS A;  2ZZD A;  1WHK A;  1OX9 A;  2QAZ A;  2JMC A;  3BW1 A;  1B34 A;  5LJ5 g;  2RQT A;  3VUZ A;  1U06 A;  1BKB A;  4JRQ A;  1I0C A;  3OYL A;  3RNJ A;  4E7S A;  2VKN A;  1B7T A;  2VGN A;  5LJ5 d;  4RTV A;  2JS2 A;  4M77 A;  1PCX A;  1T3S A;  4PK4 A;  4OB1 B;  1YWO A;  1MNE A;  3BE3 A;  5GAN 2;  4F7U E;  2ATC B;  3OY9 A;  1YBY A;  5GMK j;  2QDY B;  2RD1 A;  1IRE B;  3CBO A;  3OS1 A;  3CCR Q;  2K6D A;  1TUG B;  2HSE B;  2R58 A;  1VQ7 A;  4Y92 A;  2EJF A;  3FEO A;  4OP0 A;  4XTV A;  1NZ9 A;  2EYW A;  2KI7 A;  3JB9 J;  1JBM A;  1I8F A;  1Q81 C;  2E6Z A;  3TRE A;  5CK9 A;  2EKH A;  1I5O B;  1X43 A;  2PVD B;  4PLL A;  1N5Z A;  1WXU A;  1QVG S;  3PIO A;  5IN1 A;  2G3R A;  2GNC A;  3JB9 G;  4E7H A;  1GBR A;  1WHL A;  1SSF A;  2YRC A;  2AT1 B;  5GMK m;  3H0F A;  5I21 A;  3D7S B;  1T3L A;  1JXM A;  2X4J A;  4M7D E;  2HMA A;  5I11 A;  2CKK A;  2EFI A;  4LN2 A;  1MMA A;  3OYK A;  4HCK A;  4M77 E;  4DEY A;  3EG9 B;  2RNA A;  3T9N A;  5J3B A;  2AKK A;  4C0D C;  4CI0 C;  5LJ5 h;  1GL5 A;  1NYG A;  2DER A;  3EGD A;  2K5L A;  5J26 A;  2QQR A;  1KQS A;  4PJM A;  1Y96 B;  3MP1 A;  1VQP A;  2DE0 X;  1VQ4 Q;  2V8K A;  2DXC A;  5A0D A;  3CCE Q;  4WTO B;  2V8I A;  1E6H A;  3J7A F;  2CH4 W;  2JJ9 A;  3LLR A;  3M0U A;  5FWB A;  2GGR A;  3EH2 A;  1WXT A;  2ESW A;  3OYM A;  2DA9 A;  2VXF A;  3KFV A;  3MEV A;  1QCF A;  1W4S A;  3CMA A;  2WSF E;  1WI7 A;  1RAD B;  4M75 E;  3SB2 A;  1K76 A;  2JN0 A;  1XOV A;  2A36 A;  2RH2 A;  1WLP B;  1VQ5 A;  1LPL A;  1YJW T;  2D8H A;  2CP0 A;  1P92 A;  1WHM A;  2JW4 A;  1HK9 A;  1PM3 A;  3DLM A;  4QQD A;  4F17 A;  3CC4 A;  1PHT A;  1X6O A;  1VYT A;  2XKO C;  1VQ9 T;  2GTJ A;  1SPK A;  1WZO A;  4XU2 A;  1GCQ C;  2YUN A;  3FIF A;  1BYM A;  3LGF A;  4HVW A;  2RI3 A;  4X9C A;  3MP6 A;  2M02 A;  2XK0 A;  3ULR B;  3M5A A;  4PKC C;  2OTJ Q;  4F16 A;  2RB6 A;  1R8O B;  2KRN A;  1H3Z A;  2CZ0 B;  3M53 A;  4XU1 A;  1SSH A;  2Z0W A;  4Z02 A;  1D1B A;  1K0X A;  2EKO A;  5KCO A;  1UB4 A;  1B07 A;  3RR6 A;  4N4H A;  1PRL C;  4PFZ A;  4TVR A;  2CRE A;  2KAF A;  1RAI B;  3HRS A;  5LJ3 h;  4ME7 A;  2K4Y A;  1IB8 A;  4PJN A;  2X4W A;  3CC7 A;  3RIR A;  2EYX A;  3CCS T;  1SEM A;  3RER A;  3NTK A;  1M27 C;  1UEC A;  3UA6 A;  1K4U S;  4BY6 B;  1I1J A;  5IXB A;  4C8Q D;  4M77 B;  2LX7 A;  1OPK A;  3RMS A;  3JCM Q;  5FWC A;  2DTH A;  1YJW Q;  2QYZ A;  1VQL Q;  4J9H A;  5GAN h;  3REB B;  1QW1 A;  2KQW A;  1QP3 A;  1UGS B;  3CD6 T;  4IUQ A;  1UFF A;  2RK2 A;  3VKI A;  2DYI A;  3BY7 A;  4Z88 A;  4FYX B;  1TSF A;  3NFC A;  1WHJ A;  5DLQ E;  4BDZ A;  1G3Y A;  1MMG A;  1UGR B;  4PJO D;  1TTH B;  1UG1 A;  3PVQ A;  2OTJ A;  1VQ6 Q;  4J9E A;  5GAN e;  4M7D G;  3JAM E;  4LDV A;  3MCA B;  2CP5 A;  2P4T A;  9ATC B;  5GAN f;  3OW2 S;  1YN8 A;  3MP8 A;  1LNX A;  4IUV A;  4LUE A;  2EGE A;  2J6F A;  3CC7 Q;  4C8Q A;  4EMK A;  4PL6 A;  1RAC B;  1RAA B;  5CKE A;  2Y90 A;  2OAW A;  2CP3 A;  2FRY A;  3PT9 A;  3CCV A;  4B9X A;  4LDW A;  1FWZ A;  4OMM A;  4HCB A;  4BI4 A;  2XDB A;  1LOJ A;  4CC4 B;  2J7I A;  4OMN A;  1K8A U;  4RG2 A;  3CC4 T;  1JRI A;  4JUV A;  1O75 A;  3M55 A;  2EIF A;  1AOJ A;  1YI2 Q;  2X9H A;  2K79 A;  1NLO C;  2EPD A;  1G2B A;  3VS4 A;  1OI1 A;  4UC4 A;  2F5K A;  2QA4 Q;  4WF2 A;  4CRI A;  4QVD A;  1G3T A;  5KYN A;  1ZLM A;  4QW2 A;  4PFP A;  2HL3 A;  1UGV A;  1N27 A;  3A8G B;  1BCM A;  4M77 G;  4C8Q G;  4IUR A;  2EYQ A;  2O01 E;  2YRD A;  1VQP Q;  1Q82 U;  1PKS A;  3CCE A;  5CVI A;  4AFZ C;  4M7A G;  1H64 1;  5KCH A;  2EAY A;  2HCK A;  2FZK B;  2CT3 A;  4A4E A;  1MUZ A;  4LDX A;  4PFO A;  3DLL A;  1M3B A;  5HK3 A;  3QPH A;  1YIJ T;  5GAM d;  3CMA Q;  2EYZ A;  5FRM A;  4CC7 A;  2LNH B;  2HKN A;  4R55 A;  2MYS A;  1SHF A;  3E19 A;  3JB9 I;  5CAI A;  3JCM V;  4BE0 A;  1IGU A;  3C0C A;  4AG2 C;  3UPU A;  2ROL A;  2E3H A;  1BIB A;  1YI2 T;  2BE7 D;  2DD5 A;  5FU6 C;  3OYN A;  2GTO A;  3M58 A;  1WHG A;  5GAN 6;  4RMO A;  5C0M A;  1KD1 R;  1K1Z A;  3GLX A;  3EG2 A;  4RTW A;  3JCM b;  3OS2 A;  4ZGJ B;  2VXE A;  3SWN B;  4DQ2 A;  1JJ2 S;  3CPF A;  5CIU A;  1VQN A;  1KQ1 A;  1R77 A;  2A37 A;  2RM4 A;  2MAM A;  3NTH A;  2FRW A;  3QYH B;  1N6A A;  4J6X A;  1WX6 A;  3CCQ T;  2OTJ T;  5IT9 E;  2DPP B;  3A5Z B;  1QMC A;  4PJO F;  2QQA A;  3JRZ A;  4R0K A;  3OYD A;  1IHW A;  2LQ8 A;  1PNJ A;  1D0Y A;  4BE1 A;  3VS1 A;  1PSE A;  3EFS A;  1Q81 U;  4M7A E;  3AT1 B;  2QEX Q;  3JCM e;  4JDS A;  4M7A B;  2F2V A;  2J6K A;  2W0Z A;  1FYN A;  1X6B A;  2A28 A;  3OYG A;  3J80 E;  2E64 A;  4II1 A;  3PMI A;  4CC2 A;  3M0Q A;  1ZUY A;  1Q7Y R;  1RAG B;  2FB7 A;  8ATC B;  1K9M R;  3SDZ A;  1YJW A;  3HL8 A;  1YHQ T;  1VQO T;  1Q86 C;  1S72 T;  3CCL Q;  4BI8 B;  1GCQ A;  1Q95 G;  2O9V A;  4RTZ A;  2MPX C;  3EGX B;  2ZPH B;  2MCN A;  2JTF A;  3PIP A;  2YRV A;  5D6X A;  3RES A;  1NBE B;  1HD3 A;  2RI2 A;  2E10 A;  4HVU A;  4PJL A;  2FZG B;  3LYI A;  3NGP A;  3I55 Q;  3M54 A;  4M78 E;  1ZSZ C;  1VQ4 T;  3JB9 D;  2CYZ B;  2EGC A;  2COW A;  4OGC A;  2X4X A;  4MDW A;  3VRZ A;  4QVZ A;  1YIT A;  2B86 A;  2QEX A;  1EX4 A;  2D8J A;  2MWO A;  3URG A;  2O9S A;  2K3X A;  2F69 A;  2AKL A;  4PJJ A;  2K7A A;  3M9Q A;  2XMF A;  3CC2 T;  3EHR A;  2DO3 A;  2KT1 A;  3OBY A;  2BKD N;  3UA7 A;  1MMD A;  2LNV A;  1N9R A;  3QZ5 B;  3OMG A;  1M4Z A;  4QQG A;  2ROT A;  2LTO A;  1JJ2 P;  3M0R A;  1VQK T;  2M9U A;  3M4Y A;  4FIB A;  1V29 B;  3HPW A;  4C5G A;  4F14 A;  5C6S A;  4AMC A;  1T0H A;  2X35 A;  3MHX A;  1IZ6 A;  2LZ6 B;  1TS9 A;  1UJ0 A;  3E9F A;  4V2S A;  1ZSZ B;  2C06 A;  1CKB A;  1YI2 A;  5GAN 8;  5A2Q E;  4DA4 A;  4RTU A;  3CCR A;  3VYG A;  3G71 Q;  3CCR T;  2EQI A;  2QTV A;  4A63 B;  3CCU A;  5GAN 7;  1QVP A;  2XD0 A;  1ZX6 A;  4IUP A;  3OW2 A;  2QQB A;  2R5A A;  1PSF A;  5KYX A;  1AWX A;  2E1H A;  3EG9 A;  3M59 A;  1UGQ B;  1HXD A;  1UE9 A;  2QG9 B;  2VB6 A;  4FM4 B;  4M78 C;  3P8B B;  2DEQ A;  3WVE B;  2CP2 A;  3N5B B;  3EGD B;  3U23 A;  3G71 T;  2M0O A;  3TVT A;  2MF2 A;  5GAM e;  1M1F A;  2YWW A;  4C8Q C;  4EMK C;  4BY6 C;  1U5S A;  3M0S A;  4NL2 A;  2JT4 A;  3E1S A;  1PD0 A;  1VYU A;  1M90 R;  3GF5 A;  1R0B G;  1W2B S;  3JCM W;  3S3M A;  1IO6 A;  4ZN3 A;  4M7D C;  2BTT A;  1OQK A;  1KK7 A;  2PZ1 A;  1H92 A;  4F7U B;  2FG0 A;  2HDA A;  4KH1 B;  2GQI A;  2QTX A;  3VS7 A;  4M77 C;  1AWJ A;  2CGH A;  3CCM A;  2RQU A;  1KC8 R;  2EGA A;  2LCS A;  2WSC E;  2IIM A;  3LW5 E;  2E12 A;  4OB0 B;  2A0F B;  4Z8A A;  1D3B B;  2K5I A;  2DL4 A;  3CQT A;  1KJW A;  4HVV A;  4RTT A;  4BAC A;  1NJI C;  2VC8 A;  2SRC A;  3I5S A;  1YIT T;  1ZSG A;  1PD1 A;  3X25 B;  2MOX A;  2HSP A;  2CSI A;  2KY9 A;  2WSE E;  1WYX A;  2P0Q A;  1M1K R;  4KT0 E;  2OI3 A;  4R56 A;  1F1B B;  2FYK A;  5HCK A;  2L89 A;  2LDM A;  1KQS P;  3CC4 Q;  2JVV A;  3CCJ T;  3RKY A;  3I35 A;  2RF0 A;  4BI3 A;  1V1C A;  1VQM T;  2EWN A;  5M9O A; 
#chains in the Genus database with same CATH homology
 3INZ A;  2XID A;  4A4K A;  5GAN h;  1QW1 A;  2KQW A;  1QP3 A;  1UGS B;  3QII A;  1K9M U;  3QZ9 B;  5LJ3 e;  3CCL A;  4XU3 A;  4Y91 A;  3CCL T;  3CD6 T;  5A0G A;  4M7A D;  3JCM f;  4IUQ A;  2EJG A;  2RK2 A;  3CBP A;  3VKI A;  5HKC A;  1KG1 A;  2RI5 A;  2HD0 A;  3BDU A;  3BY7 A;  4JRK A;  2LC4 A;  3PNW C;  5DM7 R;  3NFC A;  3CPW S;  3L42 A;  5DLQ E;  4BE2 A;  2HAX A;  3OYB A;  4BDZ A;  1G3Y A;  1JB0 E;  1UGR B;  5GAO m;  4PJO D;  3H6Z A;  2YHT A;  4FL6 A;  3EAE A;  3OBW A;  4EDU A;  1K8A C;  3CC7 T;  2OTJ A;  3M57 A;  4EPC A;  1NPP A;  4RKU E;  2RJF A;  3I55 T;  3SFM A;  3CCU T;  4C92 A;  1U1T A;  4XTU A;  5FU7 C;  1OYX A;  4JLI A;  3V7R A;  3QG1 A;  4A4H A;  3LX7 A;  5GAN e;  1M1K U;  2MI6 A;  2CZ1 B;  2L8D A;  5GMK h;  4J83 A;  3M4G A;  3P8D A;  4M7D G;  1KQS S;  3JAM E;  3P8H A;  4LDV A;  3HKS A;  3MCA B;  3ZFJ A;  1UEB A;  2BUD A;  5GMK l;  2P4T A;  4NOY A;  3MO8 A;  4XK8 E;  2O4X B;  3QHS A;  5GAN f;  3OW2 S;  4PJO E;  3FC3 A;  1M5Q 1;  1Y71 A;  1WPY A;  5CQX A;  3CXC A;  3MP8 A;  4BUG A;  3OQ5 A;  4BB7 A;  4OB3 B;  1QVF A;  3CME A;  3V8K A;  1LNX A;  4IUV A;  4DOW A;  1VUB A;  3A8O B;  3QJY A;  2PUO B;  3PFS A;  2X4Y A;  1K73 C;  1KHI A;  1VQ7 T;  4C8Q A;  4EMK A;  4PL6 A;  3I55 A;  3GP8 A;  2ZCF B;  4C92 F;  5CKE A;  4C8Q B;  4EMK B;  4M75 B;  5GAN d;  1VQP T;  1YJ9 T;  2Y90 A;  3CCV A;  1B34 B;  3GNG A;  3PT9 A;  3VJP A;  2DD4 A;  2R57 A;  3UDC A;  2KVQ G;  4B9X A;  1M8V A;  2RO0 A;  5KE3 A;  1VQ8 A;  4LDW A;  5GAO l;  2OTL T;  2KDS A;  3RUX A;  1U8R A;  3AHU A;  3SD4 A;  3X26 B;  3JCM X;  1FWZ A;  4M7A A;  2VUB A;  4HCB A;  2XI9 A;  2DIQ A;  4BI4 A;  2XDB A;  5I2S A;  4M7A C;  3TCJ A;  1LOJ A;  3GIB A;  1WGS A;  4N4G A;  1UGP B;  1YJN A;  1K8A U;  2RJC A;  3HFO A;  1BI1 A;  4RG2 A;  1QP2 A;  3CC4 T;  2EJ9 A;  1JRI A;  2HQE A;  2CZ7 B;  4JUV A;  4MML A;  4MZP A;  1Q82 C;  1VQ4 A;  1LJO A;  1O75 A;  3TU4 K;  4EMG A;  4M78 F;  4ZTJ A;  1VQL T;  2NLU A;  3M55 A;  5GAN 3;  2EIF A;  2JZ2 A;  2E70 A;  4XAX B;  3KXT A;  2KK4 A;  1WQ7 A;  5GAO q;  2D9T A;  2ZPF B;  5GAM h;  3FRN A;  1OI1 A;  3JCM d;  2JTM A;  4UC4 A;  2F5K A;  3ZEH A;  4A4F A;  4WF2 A;  2LT4 A;  4CRI A;  3G6E T;  1N8R U;  4QVD A;  5CCA A;  3J81 E;  1G3T A;  2PU9 B;  4OMF B;  3MET A;  4J6Y A;  4OF1 A;  4QW2 A;  2K2V A;  4L5G A;  3ER0 A;  1BI3 A;  1N27 A;  3A8G B;  4M77 G;  5DY9 A;  2L5Q A;  4C8Q G;  1BI0 A;  1X01 A;  4IUR A;  2K3Y A;  2DXT A;  2DTO A;  2EYQ A;  4XQ3 A;  2O01 E;  4M75 A;  4PLI A;  4C0Z A;  1YIJ A;  1Q82 U;  4ZN1 A;  3E9G A;  4YTL A;  2D6F A;  4MZM A;  4ELZ C;  2XDD A;  3FB9 A;  4FT2 A;  3CBM A;  2E41 A;  3CCE A;  4HCZ A;  3ASK A;  3L2W A;  3GNF B;  2ZPG B;  5CVI A;  2DXU A;  3X24 B;  4GLK A;  3CCS A;  4PJO B;  3QBY A;  5FRN A;  4M7A G;  4C92 B;  4C8Q F;  1H64 1;  2RHX A;  2M16 A;  2QXF A;  4M75 F;  5KCH A;  1KD1 C;  1XTD A;  2EAY A;  4XTW A;  4BDY A;  4E7J A;  4HCC A;  4FT4 A;  1Q7Y U;  2LVM A;  4A4E A;  4LDX A;  4XTZ A;  3OYH A;  3CCE T;  4N0A A;  2DJZ A;  3RKX A;  3DLL A;  4A4G A;  4DOV A;  3MEA A;  3QPH A;  3DB3 A;  4HKE A;  4M78 G;  3JCM h;  5HK3 A;  5GAN g;  2IVW A;  4GY5 A;  3JB9 H;  2HNI A;  1G5V A;  1YIJ T;  5GAM d;  3NTI A;  1ZBX A;  4J6W A;  5FRM A;  3ME9 A;  4EMH A;  4XTY A;  2DZC A;  4JRP A;  4PJO G;  1FX7 A;  3QJ6 A;  5KE2 A;  3MEW A;  3E19 A;  3JB9 I;  4R55 A;  5CAI A;  3QDR B;  4J5Y A;  3JCM V;  2RJE A;  5HK0 A;  3I56 A;  2DIG A;  4BE0 A;  1AHJ B;  2DAQ A;  1FXX A;  2FHD A;  3UPU A;  2RHU A;  3X28 B;  4IUT A;  3HHT B;  3WXM B;  1BIB A;  4F7U G;  5GAN 5;  4MMK A;  2R5M A;  4D6W A;  4M7D A;  5FU6 B;  1YI2 T;  5LL6 S;  5CQY A;  2DD5 A;  3OYJ A;  1ZHI A;  5FU6 C;  4LDU A;  3I56 T;  3OYN A;  3JCM P;  1KHC A;  3PMT A;  2GCX A;  3M58 A;  1ZQ1 A;  3FJP A;  3VYH B;  5GAN 6;  3L1A A;  1I4K 1;  5C0M A;  4ZGD B;  4RMO A;  5CKD A;  1WQW A;  3JCM g;  3UT1 A;  3GLX A;  5L8R E;  1VQO A;  5LJ5 e;  3BFM A;  3QYG B;  3JCM b;  1G3S A;  4L59 A;  5A0L A;  5LJ5 j;  3OS2 A;  4PNO A;  3EFR A;  4O6J A;  4ZGJ B;  2VXE A;  3SWN B;  4DQ2 A;  1XNI A;  3CPF A;  1JJ2 S;  3O8V A;  5CIU A;  5GMK i;  4JS4 A;  4JLG A;  5GAN j;  5AYF A;  1VQN A;  1KQ1 A;  3OB9 A;  2RM4 A;  1EIF A;  1OZ2 A;  2MAM A;  2RK1 A;  3H8Z A;  2I2L A;  4J7I A;  3NTH A;  3V7S A;  4ELY C;  3QYH B;  2YLC A;  3L2R A;  1N6A A;  4A53 A;  4J6X A;  4M7D F;  3Q1J A;  3G4S T;  3G7Z A;  3CCQ T;  4C92 D;  2OTJ T;  5IT9 E;  2DPP B;  2XDP A;  3A5Z B;  4NL3 A;  4M78 A;  4M77 D;  4PJO F;  1K9M C;  4HT8 A;  5GMK e;  2QQA A;  1MGQ A;  3JRZ A;  5FLX E;  3S3N A;  4OB2 B;  2E65 A;  3OYD A;  1TH7 A;  2P0P A;  4Q5W A;  2D0Q B;  2F5T X;  2LQ8 A;  3ZBD A;  1YJN T;  4BE1 A;  3SWN C;  2DK3 A;  1H3Z A;  1VQ5 T;  1PSE A;  3VUB A;  2L3R A;  3EFS A;  4C5E A;  5LJ5 f;  1Q81 U;  3QKJ A;  2DKG A;  4M7A E;  4KUI A;  3JCM e;  4JDS A;  3OS5 A;  4M7A B;  5GAM f;  3C94 A;  2PVG B;  3VV0 A;  2E6N A;  4F7U A;  4NS5 A;  4M75 G;  2WAC A;  4XTX A;  4E7K A;  1I5L A;  5GAM g;  2PUK B;  2ZZD A;  3QXE B;  4N4I A;  4XU0 A;  4QVC A;  3BW1 A;  1B34 A;  2EQK A;  5LJ5 g;  2LT1 A;  3RMQ A;  1K73 U;  1I81 A;  3OYG A;  4C8Q E;  3VUZ A;  5GAO p;  1Y96 A;  2JOY A;  1BKB A;  4J7F A;  5GAN 4;  2E64 A;  4II1 A;  1WJS A;  3J80 E;  4JRQ A;  4C5H A;  3PMI A;  4QQ6 A;  2LCC A;  3OYL A;  3F70 A;  2VGN A;  1WJR A;  5LJ5 d;  4FSX A;  1JJ2 A;  2LQK A;  2EQJ A;  2FB7 A;  4X9D A;  2IG0 A;  4M77 A;  3SDZ A;  3FLG A;  3HL8 A;  1YJW A;  4OB1 B;  4M78 B;  1QVF S;  2ZGW A;  5LJ3 f;  4F7U F;  1YHQ T;  4MDX A;  2FVU A;  1VQO T;  5GAN 2;  1Q86 C;  4JS5 A;  4E7L A;  1S72 T;  4F7U E;  4BI8 B;  2LCL A;  2CS7 A;  3OY9 A;  1VIF A;  1YBY A;  2ZPH B;  2EQU A;  2JTF A;  2KSS A;  3PIP A;  5GMK j;  3L2Q A;  2YRV A;  3R6O A;  2Y4X A;  5IAY A;  5D6X A;  2QDY B;  2ZPB B;  5LJ3 d;  3RES A;  2RD1 A;  2RI2 A;  1IRE B;  2E10 A;  1U1S A;  3CBO A;  3OS1 A;  3GOX A;  2R58 A;  2GFA A;  4ZTF A;  4A54 A;  3LYI A;  1VQ7 A;  2EJF A;  3M54 A;  4M78 E;  4P5N A;  1VQ6 T;  1VQ6 A;  3FEO A;  2VYT A;  4M75 C;  3CC2 A;  4OP0 A;  1VQ4 T;  3JB9 D;  1D3B A;  1YJ9 A;  2CYZ B;  2DVE A;  4OVA A;  3S3O A;  4XTV A;  1NZ9 A;  4RCB A;  2E5Q A;  3JB9 J;  1JBM A;  1I8F A;  4OGC A;  2X4X A;  2E6Z A;  3CCQ A;  3TRE A;  5CK9 A;  1Q81 C;  1Q86 U;  3LH0 A;  4MDW A;  4QVZ A;  1RL2 A;  4RG8 A;  1YIT A;  2PVD B;  4PLL A;  4M7A F;  2QEX A;  5CR2 A;  1QVG S;  2QEX T;  3PIO A;  1N9S A;  2MWO A;  5IN1 A;  2G3R A;  2V8J A;  3URG A;  5DLO A;  1YHQ A;  3JB9 G;  4E7H A;  3OYI A;  2K3X A;  3C12 A;  4N0A C;  2F69 A;  1KC8 U;  2QQ9 A;  3TEE A;  3X20 B;  2XU8 A;  3HP9 A;  1SSF A;  4KUL A;  3M9Q A;  5GMK m;  4JJN K;  1VQ9 A;  3HFN A;  5I21 A;  3CC2 T;  3BDL A;  4C0G A;  2DXB A;  3DB4 A;  2DO3 A;  2XG8 D;  3HRU A;  3OBY A;  2BKD N;  3V7C A;  2X4J A;  2VV5 A;  2LNV A;  3OYA A;  4M7D E;  1N9R A;  3PTA A;  3QZ5 B;  3CXC S;  3OMG A;  3CPW A;  2CKK A;  4JRI A;  1M4Z A;  1BI2 A;  1KQ2 A;  2RA2 A;  4QQG A;  1MHN A;  2EFI A;  3KBG A;  3OYK A;  2LTO A;  4M77 E;  3GPL A;  1NJI U;  3OYF A;  1M90 U;  1VQK T;  2M9U A;  3M4Y A;  2P0K A;  4C0D C;  3T9N A;  2GF7 A;  2A3L A;  4FIB A;  5J3B A;  4B9W A;  4CI0 C;  1X75 C;  1V29 B;  5LJ5 h;  3HPW A;  4C5G A;  2M1H A;  5C6S A;  1VQ8 T;  2K5L A;  2X35 A;  3MHX A;  1XQH A;  1IZ6 A;  5J26 A;  1BIA A;  3JSC A;  3KUF A;  2QQR A;  1KQS A;  1Y96 B;  4M7D D;  3MP1 A;  1VQP A;  1OZ3 A;  2GQV A;  3HSB A;  2V8K A;  3E9F A;  5J39 A;  4V2S A;  2DXC A;  2C06 A;  5A0D A;  2RHI A;  1YI2 A;  3L2V A;  5GAN 8;  5A2Q E;  1YCY A;  4DA4 A;  2V8I A;  1Y07 A;  3CCR A;  3VYG A;  3CCR T;  3J7A F;  2OAU A;  3LGL A;  3LLR A;  3VU3 C;  4LDY A;  1VQM T;  3CCU A;  2FL7 A;  2QA4 T;  3PGG A;  2QA4 A;  3JCM c;  5GAN 7;  1QVP A;  2QI2 A;  2XD0 A;  1M90 C;  2YLB A;  1G3W A;  2ZPE B;  4IUP A;  2XIC A;  3OYY A;  3OYM A;  3OW2 A;  4KUD K;  3V8J A;  4M7D B;  2VXF A;  2QQB A;  1DJ7 B;  2R5A A;  3QO3 A;  3MEV A;  2PVO B;  2CZ6 B;  5D6Y A;  1PSF A;  3L2U A;  2E1H A;  1VQN T;  3M59 A;  1W4S A;  1UGQ B;  1HXD A;  3CMA A;  1VQM A;  5CKF A;  2WSF E;  4FM4 B;  4M78 C;  4C0D B;  3P8B B;  2RHZ A;  2DEQ A;  4M75 E;  3SB2 A;  5HY6 A;  3WVE B;  2JN0 A;  3OSS C;  4BD3 A;  1XOV A;  3M56 A;  4M78 D;  2RH2 A;  3N5B B;  2K5F A;  2BIV A;  3WVD B;  5CKH A;  1VQ5 A;  5KH6 A;  1KC8 C;  3G71 T;  2M0O A;  1YJW T;  2MF2 A;  1VQK A;  1P92 A;  1NPR A;  3C95 A;  4VUB A;  5GAM e;  3C4S A;  3CCV T;  1M1F A;  4C8Q C;  4EMK C;  1HK9 A;  4Y28 E;  5FRO A;  2LX9 A;  4BY6 C;  4M77 F;  3DLM A;  4QQD A;  2H3J A;  3CD6 A;  3CC4 A;  2Y4Y A;  1X6O A;  4IKF A;  4NL2 A;  3QSU A;  1VIE A;  2XKO C;  1VQ9 T;  3E1S A;  1RI0 A;  4O5V A;  3CMA T;  1VQL A;  5GAO r;  3UWN A;  5LJ3 j;  4LD9 K;  3GF5 A;  4IUU A;  3OMC A;  4XU2 A;  1W2B S;  3JCM W;  5CO7 A;  3S3M A;  2K57 A;  3FIF A;  1Q7Y C;  4ZN3 A;  5LJ3 g;  3OSV A;  3JCM J;  2OTL A;  1WNL A;  1WJQ A;  2JNG A;  4M7D C;  1BYM A;  2LRQ A;  2VGM A;  3LGF A;  4OGE A;  3RKW A;  2O4X A;  5I2M A;  2DZ9 A;  3G6E A;  1W2B A;  2RI3 A;  4X9C A;  4F7U B;  5EG2 A;  3MP6 A;  2QTX A;  4ATO A;  4M77 C;  2XK0 A;  3HRT A;  1O9S A;  2CGH A;  3M5A A;  4PKC C;  4M75 D;  3CCM T;  1QVG A;  3CCM A;  2KMT A;  3JB9 F;  2MWP A;  4PJO C;  2WSC E;  2XHC A;  2RB6 A;  4C92 E;  1R8O B;  3LW5 E;  1Y7X A;  2E12 A;  3MEU A;  3OYE A;  3G71 A;  2CZ0 B;  3A8M B;  3M53 A;  4OB0 B;  2AHJ B;  4XU1 A;  3OS0 A;  4L6V 5;  4RCC A;  4LD6 A;  1D3B B;  2K5I A;  4Z02 A;  2ZPI B;  3CEY A;  4J8O A;  2EKO A;  2GFU A;  5KCO A;  3FDR A;  4HA8 A;  3G4S A;  1M1K C;  2RJD A;  1UB4 A;  4E7I A;  4N4H A;  4BAC A;  2QQS A;  3QUI A;  1NJI C;  2VC8 A;  4TVR A;  4X34 A;  3S6W A;  4C92 G;  3CCJ A;  1YIT T;  1KD1 U;  2KAF A;  3X25 B;  3OYC A;  2RHY A;  2HBP A;  2HQX A;  2DTI A;  3V8L A;  4E47 A;  4FU6 A;  3L2Z A;  3DKM A;  3HRS A;  4ME7 A;  5LJ3 h;  1M9S A;  4PJO A;  2K4Y A;  3SWN A;  1S72 A;  2B8A A;  2KY9 A;  2MMP A;  2WSE E;  5CKB A;  2X4W A;  3A8H B;  3LWH A;  3CC7 A;  3RIR A;  1GXI E;  3LWI A;  3CCS T;  2A7Y A;  5FU7 B;  4C0F A;  4C5I A;  2P0Q A;  5GAM j;  4KBM B;  5GAO n;  3RER A;  5D6W A;  4KT0 E;  3NTK A;  4C92 C;  4R56 A;  2EQM A;  4BY6 B;  2FYK A;  1NE8 A;  1N8R C;  2L89 A;  3CME T;  4C8Q D;  2LDM A;  4M77 B;  2PQW A;  3A8L B;  3RMS A;  4HT9 A;  3JCM Q;  2JUF A;  2JVV A;  4ZGE B;  1M1G A;  2DTH A;  3RKY A;  4MZT A;  3CCJ T;  4BI3 A;  3OA6 A;  2EWN A;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...