2K3YA

Solution structure of eaf3 chromo barrel domain bound to histone h3 with a dimethyllysine analog h3k36me2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
134
structure length
133
Chain Sequence
MVDLEQEFALGGRVLAFHGPLMYEAKILKIWDPSSKMYTSIPNDKPGGSSQATKEIKPQKLGEDESIPEEIINGKSFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAGSTGSAPATGGVKPHRYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin modification-related protein EAF3
publication title Structural Basis for the Recognition of Methylated Histone H3K36 by the Eaf3 Subunit of Histone Deacetylase Complex Rpd3S.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulator
total genus 27
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k3yA01
3DLMA 4X34A 2B8AA 2M1HA 3OY9A 5FRNA 3MEAA 2RHYA 2RJDA 2X35A 2M0OA 3OMCA 2XK0A 4N4GA 4QQ6A 2QQSA 2EQUA 2LVMA 4PLLA 1WJSA 3DB3A 3OA6A 4EDUA 3OS0A 4C5IA 3BDLA 2DAQA 4PL6A 2DIQA 3OYIA 3OMGA 3MEVA 3ZEHA 5C6SA 3OYBA 3ME9A 3P8HA 5KE3A 2E5QA 3LLRA 4FL6A 2O4XA 4OVAA 2M16A 3QIIA 3MEWA 4NS5A 4A4EA 3PMTA 3OYMA 2JTFA 4BE0A 2LDMA 5D6XA 4BDYA 3OYFA 2F5KA 3QKJA 2XDPA 4IUVA 3NTHA 2JZ2A 2PQWA 2RI5A 3ASKA 3H6ZA 3PNWC 4FU6A 4QQGA 5IAYA 5J39A 2EQKA 2RHIA 4Q5WA 2RHZA 3PMIA 3QJ6A 4IUUA 4QVZA 2RHUA 2BKDN 5CIUA 3UWNA 3FC3A 3F70A 2RJFA 1OZ3A 3O8VA 5M9OA 4E7LA 3S3MA 4IUQA 2K3YA 4E7IA 4C5EA 2X4XA 3OYDA 3L2WA 2CKKA 3EAEA 2R58A 3L42A 2O4XB 2RI3A 3OYLA 3M9QA 4QQDA 3H8ZA 5C0MA 4BE2A 4BD3A 3LGFA 3UT1A 2R5AA 1OZ2A 3FEOA 3E9GA 3LH0A 3PFSA 5D6YA 4Z02A 2G3RA 4B9XA 4B9WA 4CRIA 3OYHA 4A4HA 3LYIA 4RG2A 2L8DA 2YRVA 4UC4A 3META 1RI0A 4N4IA 1H3ZA 3MP6A 2IG0A 4II1A 2GFAA 4BDZA 1SSFA 3OB9A 2X4WA 3QBYA 3L2RA 5J26A 2HQEA 1WJQA 2FHDA 2VYTA 4N4HA 1G5VA 3OYCA 2LRQA 3KUFA 4ZTFA 3LGLA 4GY5A 2RI2A 1MHNA 3NTIA 4QW2A 3MEUA 5KCHA 3MP1A 2X4YA 3MO8A 2RO0A 3DB4A 3OYGA 4IKFA 5D6WA 2E6NA 4A4GA 5FRMA 2P0KA 5IN1A 4C5HA 4BE1A 3OQ5A 3E9FA 2MWPA 2L3RA 2RJCA 4IUTA 5KE2A 3S3NA 3S3OA 2L89A 4E7KA 3SD4A 3OS2A 4ZTJA 3GOXA 1WJRA 3FDRA 4E7JA 4A4FA 2EKOA 2RJEA 2RHXA 2WACA 3LX7A 3P8DA 4E7HA 4PLIA 2LTOA 2BIVA 2EFIA 2EQMA 4LD6A 2MWOA 3NTKA 1XNIA 3Q1JA 5FROA 3OYAA 4HCZA 1OI1A 2QQRA 1OYXA 2HQXA 3L2UA 3OYNA 4BACA 2GFUA 2D9TA 3L2VA 2R5MA 3OYKA 2LCCA 5KH6A 3L2QA 1WGSA 4L59A 2R57A 4IURA 1KHCA 2BUDA 3CEYA 3C4SA 2K3XA 1N27A 2GF7A 3MP8A 3OS1A 4IUPA 3OYEA 2EQJA 3S6WA 3OYJA 4C5GA 2DIGA 2NLUA 5KCOA 3FLGA
chains in the Genus database with same CATH superfamily
1N8RC 1RAIB 3RR6A 2X35A 3ULRB 1PWTA 4PLLA 3G4SQ 4ATOA 1RAAB 3MEVA 5J3BA 1WIEA 4PJOC 4P5NA 4V2SA 5GAOq 2YRCA 1YIJT 3JCMe 3MEWA 4A4EA 5CKFA 2LJ1A 2NUTB 1VQKQ 4D8DA 2RI5A 3CCUT 4ME7A 2NUZA 2E12A 3JB9F 4LE9A 1YI2A 5DLOA 4Z8AA 1H8KA 3HRTA 4M77F 3EFOA 2COWA 4KUIA 4LDUA 3V7RA 1WZOA 4M7AF 2RI3A 1RUWA 2QDLA 1R0BG 2A3LA 4A4HA 5CQXA 2KROA 1RI0A 2K79A 4HXJA 3OB9A 2YUNA 1S72T 4C8QB 3UF4A 2E4HA 3CCUA 4N4HA 2LCSA 2CT3A 3SDZA 3BE3A 2CGHA 4C0GA 3RMQA 2JT4A 2FEIA 2OTJQ 2O31A 4M4ZA 5CVIA 2EAYA 2ROTA 3NFCA 2X3XD 3OS2A 2DK3A 2FB7A 1QVFS 3VU3C 3VRYA 2QQ9A 2LX9A 2EFIA 5GMKl 2EQMA 2JTEA 3NTKA 3CPFA 3CCEA 5ECAA 1K8AU 4OMOA 1ZA1B 2FO0A 3L2VA 1Q86R 5GMKh 1BU1A 2EJGA 2ABLA 1B34A 3M0QA 1D0YA 2EQJA 2L3PA 2ZPFB 3VUBA 1NE8A 3A8LB 1SEMA 2O01E 4X34A 2M1HA 4X1VA 1BCMA 2RHYA 1K8AC 1K9AA 2VKNA 1HSQA 1RLPC 3WXMB 1WHGA 3M5AA 3RESA 1W2BA 3RUXA 1D3BB 2C0OA 2JMCA 4M78F 1JXOA 2OTLA 3EH1A 4IIOA 2LMJA 4D8KA 3VS5A 1VQMQ 3CCJT 2QI2A 3HHTB 1QP3A 2RK2A 2HKQB 1D1AA 4KUDK 3F70A 2K2MA 4NL3A 3O8VA 2VV5A 4E7LA 2FRYA 2VC8A 1FWZA 1FMVA 3OYDA 2COYA 1KK7A 4M77E 3M9QA 4QQDA 1O9SA 3LWHA 2KGTA 1UUEA 3PFSA 3HFNA 4B9XA 1BBZA 1NEGA 4M7AE 1J3TA 2C0TA 2E3IA 4OF1A 4MDXA 4N4IA 1TXQA 5LJ5d 2GFAA 2E10A 2L2PA 2QQBA 2CP2A 2LZ6B 4HT9A 1YITT 3EG0A 1YIJQ 3CCJA 1MHNA 1RAGB 1KD1R 5KCHA 1WQWA 2LQ8A 2RO0A 4B6MA 3WVDB 3CCUQ 2QK0A 4C5HA 4BE1A 2Z0WA 1MUZA 5FU6C 1AWXA 4ZTJA 1PG5B 5CK9A 4Y28E 4FYYB 2RJEA 3HRSA 3H0IA 2XDBA 4PJOF 3JAME 5LJ3d 3OYNA 5GAOm 3JCMX 3CCSQ 1YITA 1PSFA 4L59A 1E7OA 4M75E 1Q86U 4ESRA 5FW9A 3OYJA 4OP0A 4A53A 2IVWA 4M7DC 1MNEA 3DLMA 2XHCA 5FWCA 1WXUA 2B8AA 1S72Q 3OY9A 5A0LA 3GBQA 3HKSA 2RJDA 2DVJA 3M0UA 3DB3A 2GQVA 3OA6A 1KIKA 3JCMf 4PL6A 3N5BB 2E6ZA 2RD1A 1IB8A 3JCMW 1Q86C 5IHNA 4YTLA 1CSKA 3VYGA 1M90U 5GMKj 1GCPA 1PNJA 4DBFA 1UB4A 3JSCA 1KHIA 4IUVA 1SHGA 1IREB 3H6ZA 2A08A 2KE9A 2DVEA 1JXMA 1K9MR 1U1TA 4M78E 1ZSZB 3UA7A 5GAMg 2A0FB 2EYXA 1M90C 2X4XA 5GAMe 4JRQA 3JB9G 2LQNA 4JJBA 1C0MA 4M77G 2YWWA 4BD3A 4MDWA 5FLXE 1GCQC 3JB9D 2D8HA 2ZGWA 1QCOA 2C0IA 4M77D 1NPPA 2PU9B 3QZ9B 5I11A 2VGMA 4M7AD 5GAOr 2VYTA 3V7CA 3CMAT 3HP9A 4E6RA 2RI2A 1PCXA 2ZZDA 2QTVA 5LJ5e 1YBYA 1I8FA 5KYXB 1KD1U 4NOYA 1JB0E 5DLQE 1WJRA 4C92F 1RI9A 3VYHB 4E7HA 1EFNA 1VQ9T 3OYYA 2CZ7B 2MWOA 2OAWA 2AIRB 2AK5A 4ZGJB 3NMZC 4EMKC 1YJWA 1KD1C 3NGPA 1ZUKA 3PT9A 3CMAA 1IGUA 4PJOE 2YXYA 2E70A 2DZ9A 1T3SA 1WXTA 3X20B 2DIGA 1TUGB 5LJ3e 5GAOl 2LQWA 1Q82C 1WJSA 2PZ1A 2HAXA 4C0ZA 3PVLA 4C5IA 2DIQA 1NLPC 4AG2C 4LNPA 1MNDA 2DBKA 4J83A 2CP6A 3M53A 2FPFA 2XI9A 1I5OB 2JJ9A 1VQLT 5GJWB 3E19A 1IHWA 3I55T 4OMPA 4PNOA 2KMTA 4GLKA 1UECA 2EYZA 5LJ3h 2X9HA 3OYLA 3GNGA 4QQGA 4BY6C 2D0QB 4TVRA 2E41A 3VS6A 1SPKA 2FPDA 4M78G 1YJNQ 2YUOA 4OMQA 3C95A 4M78D 1K4US 2ZAEA 5C0MA 2AKKA 3HTRA 1HK9A 3UT1A 1VIFA 2B86A 2RQVA 1VQLA 2A36A 1G3WA 2L8DA 1AD5A 3I55A 4RTWA 1X69A 1VQOA 1X6GA 2ECZA 5GANg 2QXFA 3M57A 4ZTFA 3KBGA 5GANe 4JUVA 4XU3A 3MO8A 4DBQA 1R0CB 2QTXA 4M7DF 3VJPA 1ACMB 1OQKA 2AKLA 2P0KA 5IN1A 1M2OA 1X27A 3OQ5A 2JVVA 2L3RA 3CBPA 4IUTA 5KE2A 2EGAA 4XTWA 4F04B 1GRIA 3P8DA 2RMOA 4RG8A 1X43A 3GLXA 5CKDA 2HL5C 2I2LA 4C92E 4E7ZA 3CC7T 2BZYA 1UGSB 4LD9K 3G4ST 5GAN7 4CC4B 3L2QA 1QKWA 1AZEA 4IURA 4PJOG 1N27A 2JOYA 2ESWA 3S6WA 1Y71A 1UGRB 2EIFA 2QDYB 4PJOD 1PRMC 5FRNA 4JS5A 1T0HA 2LVMA 3CC4T 1H3HA 4HVWA 2K5FA 2CH4W 4FSSA 2VXEA 3M55A 2LX7A 3JB9H 4OB2B 3VS2A 1M8MA 5CAIA 1KQSS 2E64A 3JRZA 1WQ7A 3G4SA 3QSUA 5DM7R 4PFPA 1VQ9Q 3DKMA 4Q5WA 1FXXA 3CC2T 2EJ9A 2G6FX 1OULA 3A8MB 1RLQC 4E7IA 3CC4A 3TSZA 4RUGA 4HA8A 1MV3A 1M1FA 4F14A 3EAEA 4JRPA 2O4XB 4WCIA 1OU8A 3TCJA 5L23A 1CKAA 4J9GA 2P0QA 2OX7A 4FCYA 4F7UB 1CKBA 1Q95G 3NHNA 1IHVA 3CD6Q 3VRZA 2OTJT 4UC4A 2PVDB 2D1XA 2KSSA 3MP6A 1SG5A 2MIOA 1WLPB 3OW2A 2WSCE 5LJ5f 3CCMQ 2LRQA 2QASA 3KUFA 5IT9E 1UGPB 5GAOn 2DXBA 1G83A 3CC2A 3SEMA 1TU0B 1Q7YU 3MEUA 1JJ2P 2M02A 5FU7B 2KT8A 3DLLA 1PD1A 4FM4B 4O5VA 2EPDA 2DEQA 4FW2A 4E7JA 4N0AC 3URGA 4M7DE 1WHLA 4C8QC 1VOMA 4DEXA 3LX7A 2HEQA 1Q7YC 1X01A 2OTJA 2YRDA 3CXCP 1I1JA 5KYNA 1YWPA 1ZA2B 5LJ3f 4BB7A 1SHFA 2RQRA 3BFMA 2R57A 4ELYC 3L1AA 4FIBA 4IIMA 2GF7A 2MYSA 4E2FB 3OYCA 2AZVA 1QW1A 2KRSA 4QQ6A 4N4GA 1N9RA 4JS4A 4CC3A 1VUBA 1QWFA 2DAQA 1M4ZA 2F5TX 1VQMT 5KE3A 2LNVA 2NYSA 4RTTA 5I21A 5IHIA 2RF0A 2BE9B 2O4XA 3SWNB 1D0XA 1VQ5Q 5FWBA 3T9NA 3X24B 4FU6A 1YNZA 1RABB 3CC7Q 2JS2A 1G2BA 2AZSA 4QVZA 2DXCA 3JCMg 1JBMA 5AT1B 3TVTA 4DQ2A 4WF2A 1B34B 4BI8B 4EMGA 3I5RA 1VQ8Q 4PJNA 1VQMA 1M3CA 2G3RA 3CC4Q 1TOVA 4NL2A 3LWIA 1B07A 1OX8A 2YRVA 2I0NA 5GANf 4JJDA 4II1A 3INZA 2X4WA 4MZMA 3HRUA 2KI7A 1WJQA 2FHDA 4J9EA 3L2ZA 4GY5A 4XU2A 1QVGA 1HJDA 1V1CA 2DJQA 3CXCS 3PE0A 2E5KA 3KXTA 3QDRB 4M75B 3S3OA 3CCST 2L89A 3CC2Q 1YIJA 1LNXA 4M7DG 2EJFA 2VVKA 4HKEA 1OX9A 5HY6A 4LUEA 1C6VX 2CZ0B 4M7DD 2DF6A 4QVDA 3PIPA 1M27C 2CZ6B 3OYKA 5KH6A 5GMKe 1WGSA 1NPRA 3BY7A 3GPLA 3CEYA 1A0NB 3TQ7P 2K3XA 3I35A 3SWNA 4IUPA 2LT4A 1LVKA 4AFZC 2AT1B 2ED0A 5IHKA 3JB9I 1I07A 4XU1A 2DA9A 1NYGA 3QZ5B 4M7AA 2JM9A 3FRNA 2P84A 4AFQC 2KK4A 3CCSA 2HKNA 1K73U 1WXBA 2RQTA 1O75A 3JB9J 2NUPB 3P8BB 1BK2A 3ME9A 2MI6A 2DTHA 2JNGA 1S72A 1VQPQ 1N9SA 4OMNA 2CT4A 5D6XA 1RAFB 1K73C 1GBQA 4J6WA 2J06A 3NTHA 3UDCA 2PVGB 1NG2A 4KGVB 2EQKA 4IUUA 1QVPA 1ZX6A 2K2VA 3MPUB 1JRIA 5GAN4 1YCSB 1M90R 5HKCA 1X6OA 3X25B 1TUDA 3WVEB 1U8RA 2RQWA 4C8QF 3BDUA 4M75A 1YHQQ 3ZFJA 4XU0A 4E7SA 2JW4A 3EGXB 1I5LA 1OV3A 1ZSZC 3A8GB 5CQYA 2ZPHB 4QVCA 2HQEA 1RAEB 4XTUA 4XTZA 3LGLA 2ZPIB 4QW2A 2V1RA 4FSXA 2QGGA 1HXDA 4JZ3A 1MMNA 5I2SA 3HSBA 5GJVB 4ZGDB 9ATCB 1PD0A 4M78A 2LJ3A 3M59A 1VQNT 2NUPA 1OOTA 2GFUA 1GFCA 2DD5A 2R5MA 2YLCA 2RM4A 2HBPA 1D1CA 2J7IA 3JCMb 1KHCA 3OS1A 1WYXA 3G6EQ 2DFUA 1Y57A 3QXEB 4F16A 5HK3A 2NLUA 1NBEB 2KBTA 3CPWA 2QQSA 2BZXA 2YUPA 1K0SA 1Q82R 4LDXA 2KXDA 2CP3A 3QHSA 3QYHB 1I0CA 2QA4Q 1SRLA 2E5QA 5A2QE 3GP8A 1JO8A 1YJNT 1ABOA 1RL2A 4F7UG 1VQ7T 1JEGA 3FJ5A 1ZUYA 4PJLA 3ASKA 1KQSA 3EGXA 2DL4A 2WSEE 3RIRA 1AVZC 2EYQA 4OMMA 3L2WA 3A98A 1VQ4Q 2D0NA 4PJOA 2CZ1B 5D6YA 2VGNA 2E3HA 4LDYA 2JMAA 2FZCB 1YJNA 1VQ7A 4ZN1A 3RKWA 1SSFA 4C8QE 1IGQA 4KH0B 2RB6A 1X75C 1WDXA 3G7ZA 2JUFA 3J81E 1X2KA 3OYGA 1HD3A 2L3QA 4DBHA 4OMLA 2DRKA 4Z89A 1HYOA 2BE7D 2RPNA 4O6JA 1OEBA 2QYZA 1AZGB 1BIAA 2CUDA 4HCZA 2F2XA 4J9DA 1OYXA 2DL5A 3H0HA 5LJ5g 3QWYA 3BW1A 1W2BP 3CBMA 1BI1A 2CP7A 2DZCA 1X6BA 2O2OA 3OYEA 3A1PA 1SF9A 1MMGA 2FZKB 3MEAA 5GAN2 2XK0A 2KYBA 2JM8A 5EC7A 2EW3A 2LP5A 1Q82U 2DBMA 1VQ6T 5IXBA 3TU4K 2L3SA 1U5SA 1M5Q1 2JTFA 3E1SA 5LJ3g 3A8HB 2HL3A 1RACB 3M0RA 2P0PA 1MV0B 1VQNQ 2JTMA 2PVOB 3OS5A 4RCBA 4PK4A 3FC3A 2DERA 4GBQA 3CD6T 1H92A 3OBYA 4J9FA 2K3YA 4C92A 3JCMJ 1UEBA 4C0DC 1VQ9A 3THKA 2YSQA 2R58A 1Z9ZA 1QP2A 3CCMT 4BE2A 1ZBXA 2CS7A 1BB9A 1OZ2A 1IRXA 1VQ6A 4LUDA 1VYVA 3LYIA 3EFRA 3M0SA 5GAN3 3MKDA 4BDZA 5GAN5 4C8QG 3L2RA 3SB2A 1BCOA 4DOWA 1AT1B 2QEXT 2K5IA 1VQ7Q 4FW1A 4R0KA 4C8QD 3MP1A 2MF2A 3CD6A 4IKFA 3I5SA 2HQHA 1N5ZA 8AT1B 2DD4A 2V8KA 4Z88A 3SD4A 3CCMA 3VS3A 1W2BS 2GTOA 1WA7A 2IPOB 4PLIA 5CCAA 4QKUA 3D7SB 1OPLA 4JLIA 1Q7YR 3UPUA 2Y4XA 2MAMA 1WHHA 2A7YA 5FU7C 4LXCA 1M3BA 2MCNA 3RKYA 1YFNA 2XIDA 1D09B 2HD0A 4JJCA 2BUDA 2YDLA 1EZZB 2K6DA 2DXUA 4C5GA 4L5GA 3G1JA 2K3BA 2K4YA 2F2VA 3EG3A 1R77A 2HBWA 2QAZA 3CCLQ 2DMOA 1VQ5T 3V8JA 4R55A 3OYIA 2JXBA 1QVFA 1UGQB 4ZNXA 2EYWA 4OB3B 3P8HA 4JZ4A 1UE9A 2RH2A 3CMEQ 1TSFA 3M4YA 1YJ9T 3OSVA 3QYGB 4NS5A 3PMTA 4FT4A 1BI2A 2LDMA 1U3OA 1AWJA 2EKHA 1G8XA 4M7DA 2SEMA 1VQ8T 3JCMQ 2ZPEB 2ENMA 5LL6S 3EHRA 2YUQA 5M9OA 1V29B 2WSFE 2X4JA 3SWNC 1VQ5A 2DO3A 5GAMj 1TH7A 1D1BA 3V8KA 4RCCA 1SKUB 4DBRA 3LGFA 4C0DB 3CC7A 2ZPBB 5HCKA 4PFOA 1K0XA 3OYHA 1W4SA 1YJ9A 2O9SA 4RTYA 4OB1B 2MOXA 1PRLC 5J26A 4AG1C 1GL5A 1VQ6Q 5CR2A 3AT1B 1QQJA 3VV0A 1VQ8A 1YWOA 2DM1A 2FRWA 3DB4A 1FMWA 2ROLA 3GNFB 2HMAA 2K57A 2HSPA 1QLYA 2MWPA 2RJCA 4K11A 2F69A 2DL7A 5DY9A 1KG1A 1NM7A 3QWXX 3JCMd 2PTKA 1W70A 3QPHA 1BI0A 4FT2A 1Y7XA 1XNIA 3RMSA 3OYAA 2VXFA 3M56A 4M75C 1Q81R 3E2UA 4CI0C 1S1NA 2O88A 1SSHA 3C4SA 4J6YA 1U06A 3CCQT 4HT8A 2CSQA 1VQPT 1YN8A 2QEXQ 3CCRT 2M0OA 1XTDA 1M3AA 2DX1A 4VUBA 2J6OA 1M1KU 1XOVA 5C6SA 2YLBA 1KC8U 4RTVA 1NEBA 3QO3A 5I22A 4RTXA 3H0FA 4EMKA 2EGEA 3FJPA 2DETA 3VS1A 1E6HA 1MGQA 4BDYA 2KDSA 3R6NA 4C0FA 3SFMA 3QKJA 1K73R 3REAB 2M51A 1M1KC 4A4KA 1YHQT 1KC8C 4KULA 1ARKA 1VQPA 1LJOA 2DYBA 4F7UF 1T3LA 1TTHB 2KRNA 2L5QA 2XU8A 3LW5E 1QCFA 1ZUUA 3CBOA 4M77B 4EMHA 2DE0X 4JDSA 3E9GA 1XJWB 3R6OA 3PIOA 2LT1A 4M7AB 5D7UA 3QBYA 4FYWB 4HCKA 1P92A 3ER0A 3VS7A 1G5VA 3NPFA 1YJ9Q 1YHQA 2Y90A 2KVQG 1TG0A 5FRMA 1Y96B 1YI2T 3E9FA 1Z9QA 4J7IA 1JJ2S 1I4K1 4X9CA 3G6ET 4LD6A 3VKIA 1AWOA 1VYUA 2DTOA 3L2UA 2DEUA 2X3WD 2EWNA 3MP8A 2BZ8A 2D8JA 2L0AA 2QA4T 1Q81U 4A63B 2ZPGB 2KRMA 1B3QA 2M9UA 4HVUA 2KXCA 2EGCA 2LC4A 4XQ3A 2CUBA 2GCXA 2OI3A 1QCNA 3RNJA 3FIFA 3G6EA 2DJZA 3QDFA 1Q81C 2J05A 1UDLA 2D6FA 3V8LA 3JCMh 3TREA 2M16A 1LPLA 4M77A 1TWBA 5KYYA 3EGUA 1X2QA 2CSIA 2F5KA 1VQ4T 3ZBDA 5J39A 3CCET 3PNWC 2QA4A 1M2VA 1W1FA 3KFVA 1IO6A 1WFWA 2FZGB 2HSEB 3UWNA 2X51A 2ZCFB 4M78B 3I56T 4C5EA 3REBB 3OW2P 1M9SA 3CCQQ 4Y92A 2CDTA 4F7UE 3CCRQ 1Y96A 1UHCA 4CRIA 1R8OB 4F17A 2XDDA 4JJNK 2P4TA 4EPCA 1UFFA 1MMAA 1QWEA 1H3ZA 8ATCB 1VQ4A 4M75F 3GF5A 3I9QA 4HCCA 1KFZA 1FYNA 1K76A 1N6AA 2OTLT 5GAN8 3HL8A 5CKHA 2A28A 2DLPA 3I56A 3S3NA 3IQLA 2PUKB 2NUTA 1WNLA 3HFOA 3H41A 1XQHA 4C92C 3OSSC 4XAXB 5FROA 2QGFB 1PKTA 1LOJA 3RKXA 4WTOB 2HQXA 4J9HA 4BACA 3A8OB 4E47A 2RNAA 1NYFA 2DTIA 2GQIA 2O9VA 3GIBA 2DL8A 4PJOB 4LDVA 1BYMA 1AOJA 2KNBB 5GAMd 3S3MA 2EBPA 4ZGEB 2VB6A 4DEYA 3OMCA 4ORZA 3JV3A 5CKBA 2DILA 4N0AA 5IXFA 1JQQA 4C8QA 2ATCB 1RAHB 3OYBA 1YI2Q 3JCMc 3MJXA 3QUIA 1WHMA 2DRMA 4OVAA 3EG1A 3OYMA 3OW2S 1G3YA 4RTUA 1GFDA 2XDPA 4DA4A 1M8VA 2LNHB 3V7SA 4LN2A 1JU5C 1ZHIA 1H641 4OGEA 4IUQA 3RBBB 5IH2A 1WPYA 1Y0MA 1AWWA 1VQNA 1QVGP 2R5AA 3LH0A 3FEOA 4B9WA 1OPKA 1YP5A 2V8JA 1G3SA 4KGXB 4KH1B 2J6FA 1PHTA 1ABQA 7AT1B 4J9BA 4GLMA 2QG9B 2GTJA 5I2MA 2GNCA 3JCMV 2HDAA 1D3BA 3CCEQ 1GXIE 2HZYA 3VUZA 3RDVA 4E7KA 2COZA 4J8OA 2MMPA 4A4FA 2K9GA 2QQAA 3UA6A 1F1BB 3I56Q 2LTOA 1AEYA 2P4RA 1ZLMA 3M0TA 3TEEA 4C92B 2D9TA 1QMCA 4OB0B 3CCLT 5L8RE 2HCKA 1T0JA 1WHKA 2RN8A 3CMET 2DPPB 3C94A 2Y4YA 3OS0A 3X28B 3BDLA 2OTLQ 3CCVT 4RMOA 1FMKA 1BI3A 3LLRA 5KYUB 2KAFA 5EG2A 3PTAA 1BIBA 2XG8D 3CCLA 2MPXC 1UHFA 5GANd 3OYFA 3MHXA 2CREA 2YHTA 4M7AG 2HNIA 1VA7A 2JZ2A 1MMDA 1Y07A 5IAYA 1QVGS 2JN0A 4PFZA 1YJWT 3CMEA 1PSEA 3EG9B 2RJFA 3PGGA 2EVRA 4XTVA 2FYKA 4HCBA 5GAMh 3HPWA 2DL3A 5HK0A 3J7AF 3CCVA 4JPBW 2RQUA 3G71T 2IIMA 4Z02A 3CCJQ 3OBWA 1WHJA 3EGDB 3TSWA 4AFUC 1GBRA 1B7TA 2FG0A 4MZTA 3META 5FU6B 2K5LA 3RERA 4MZPA 1ZQ1A 2GBQA 2JS0A 2W0ZA 3C0CA 2KT1A 2V1QA 3J80E 2NWMA 4RKUE 3NTIA 3ZL7C 1PM3A 4LDWA 1UTIA 1WX6A 5LJ5h 4M75G 2H8HA 3X26B 2XKOC 5GAN6 3GOXA 1YITQ 4M75D 3G71A 2XICA 3EG2A 4M7DB 2WACA 2H3EB 4OMFB 1JJ2A 1ZSZA 1WI7A 3CPWP 2XD0A 2QQRA 2LJ0A 3M58A 1EIFA 3M54A 1UJYA 1U1SA 2FPEA 3EHQA 4AFSC 5KYUA 2VASA 2LCLA 4AT1B 1C1AA 4J9CA 4JRKA 1VQOT 1W6XA 2DYIA 4L6V5 3CXCA 1UGVA 2CP5A 4ZN3A 2EQUA 2KY9A 1ZBJA 1V76A 2KEAA 2KR3A 2PUOB 1KQSP 3EG9A 3OMGA 3ZEHA 1K9MU 5KYWB 4BUGA 4FL6A 1AHJB 1DJ7B 2QEXA 4CC2A 3O5ZA 3QIIA 6AT1B 5KYXA 1PC0A 4J7FA 3M4GA 1UG1A 3EGDA 3LH5A 1NZ9A 2RHIA 1K9MC 1M1KR 1E6GA 3PMIA 3QJ6A 4R56A 1KC8R 1OU9A 2CKKA 4BI3A 3H8ZA 1NJIR 4XK8E 2KYMA 1UJ0A 4KGZB 1YCYA 4RG2A 3CCVQ 5CKEA 2IG0A 2AHJB 4XTXA 4KRTA 2F2WA 5GANh 2E65A 4M77C 2K7AA 2X4YA 2YT6A 4X9DA 2GGRA 5D6WA 3CPWS 4EMKB 2E6NA 1KSWA 4A4GA 4AMCA 4M7AC 1YJWQ 4HVVA 3CQTA 1N8RR 1ZSGA 2M0YA 2EYYA 3CMAQ 2F1LA 4J5YA 4KT0E 1EX4A 1IZ6A 2EKOA 4OGCA 2RHXA 2DKGA 1VQKT 2BIVA 1M1GA 1OI1A 3G71Q 1VIEA 4KBMB 1BKBA 5KYWA 4PJMA 4J9IA 3U23A 2V26A 1TS9A 4XTYA 5LJ5j 1K1ZA 1PKSA 4RTZA 3EFSA 3JCMP 5GAMf 1GCQA 4EDUA 5GAOp 4ANJA 4BY6B 4ELZC 2RA2A 2J6KA 1KJWA 4A54A 3C12A 3EH2A 1LCKA 1VQKA 4MMKA 2H3JA 2SRCA 2C06A 2E1HA 4BE0A 2PQWA 1G3TA 2A37A 5LJ3j 2RHZA 3A5ZB 5A0DA 4J6XA 1VQLQ 2RHUA 2BKDN 5CIUA 1OZ3A 2CYZB 2BTTA 2ED1A 4DOVA 5AYFA 3I55Q 1RADB 2FVUA 3L42A 4JRIA 1VQOQ 2OAUA 3VS0A 2CH4A 4MMLA 2DXTA 2VWFA 3FB9A 4FYVB 1SRMA 5CO7A 2MK5A 2PNIA 1NJIU 3PVQA 2W10A 4M78C 2CP0A 3CCQA 3EFOB 1D0ZA 4PKCC 3M0PA 4C92G 3H9NA 4FYXB 2LQKA 3CCRA 2DNUA 2V8IA 4PJJA 4JLGA 2FL7A 5GMKi 4C92D 1QKXA 4BI4A 1NJIC 3UATA 2OJ2A 5GMKm 1FX7A 1KQ2A 5KYYB 2EQIA 3SHWA 3AHUA 4EIKA 4Y91A 3FDRA 4QT7A 5A0GA 2RK1A 3QJYA 2VUBA 1M2VB 1K8AR 1N8RU 1NLOC 3Q1JA 1I81A 2XMFA 1KQ1A 1TUCA 2LCCA 4CC7A 1VYTA 5GANj 1M30A 3MCAB 1QVFP 2KQWA 3QG1A 4D6WA 4F7UA 1IXDA 3VS4A 5KCOA 3FLGA
chains in the Genus database with same CATH topology
1N8RC 4PJOD 4ZGEB 5FRNA 3MEAA 4JS5A 5GAN2 2X35A 3OMCA 2XK0A 2LVMA 4PLLA 5CKBA 3CC4T 4N0AA 4ATOA 4C8QA 2K5FA 3MEVA 5J3BA 3OYBA 3JCMc 1Q82U 4PJOC 4P5NA 2VXEA 4V2SA 3M55A 5GAOq 1VQ6T 4OB2B 1YIJT 5CAIA 3QUIA 3JB9H 3TU4K 3JCMe 1KQSS 4OVAA 1M5Q1 2E64A 3JRZA 3MEWA 1WQ7A 4A4EA 2JTFA 5CKFA 3E1SA 3OYMA 5LJ3g 5DM7R 3G4SA 3OW2S 3QSUA 3A8HB 1G3YA 3DKMA 2XDPA 4DA4A 2RI5A 3CCUT 1M8VA 4ME7A 2P0PA 3V7SA 2E12A 3JB9F 2JTMA 2PVOB 3OS5A 4RCBA 4Q5WA 5DLOA 1YI2A 1FXXA 3CC2T 3HRTA 4M77F 2EJ9A 3FC3A 3CD6T 1ZHIA 4KUIA 3A8MB 4LDUA 1H641 3S3MA 4OGEA 3OBYA 4IUQA 2K3YA 4E7IA 3CC4A 3V7RA 4C92A 1UEBA 4C0DC 3JCMJ 1VQ9A 4HA8A 4M7AF 1M1FA 3EAEA 1WPYA 2R58A 4JRPA 2O4XB 1QP2A 2RI3A 3TCJA 3CCMT 4BE2A 1VQNA 1ZBXA 2CS7A 2P0QA 2R5AA 1OZ2A 3FEOA 3LH0A 4F7UB 4B9WA 2A3LA 1VQ6A 4A4HA 3LYIA 2OTJT 2V8JA 4UC4A 5CQXA 3EFRA 1RI0A 2PVDB 5GAN3 2KSSA 3MP6A 1G3SA 4BDZA 3OB9A 5GAN5 4C8QG 3L2RA 3SB2A 4DOWA 2WSCE 4C8QB 3OW2A 5LJ5f 1S72T 3CCUA 4N4HA 2QEXT 2LRQA 2K5IA 3KUFA 5IT9E 1UGPB 5GAOn 2DXBA 3SDZA 4C8QD 3CC2A 1Q7YU 3MEUA 3MP1A 2CGHA 4C0GA 2MF2A 5I2MA 3RMQA 3CD6A 3JCMV 4IKFA 1D3BA 5FU7B 3DLLA 1GXIE 4FM4B 4O5VA 5CVIA 3VUZA 2EAYA 3NFCA 4HCBA 2DD4A 2V8KA 4E7KA 2DEQA 4J8OA 2DK3A 3SD4A 2FB7A 3OS2A 3CCMA 4E7JA 1QVFS 4N0AC 2MMPA 3URGA 1W2BS 3VU3C 4M7DE 4C8QC 4A4FA 2QQ9A 2QQAA 3LX7A 2LX9A 4PLIA 2LTOA 5CCAA 1X01A 2EFIA 1Q7YC 5GMKl 4JLIA 2OTJA 2EQMA 3UPUA 3NTKA 2Y4XA 2MAMA 3CPFA 3CCEA 1K8AU 2A7YA 3TEEA 5FU7C 4C92B 2D9TA 4OB0B 5LJ3f 4BB7A 3L2VA 5L8RE 5GMKh 3CCLT 2EJGA 3RKYA 2XIDA 1B34A 3BFMA 2R57A 2HD0A 4ELYC 2BUDA 3L1AA 4FIBA 2GF7A 2DXUA 2EQJA 2ZPFB 3VUBA 4C5GA 1NE8A 3A8LB 3OYCA 4L5GA 2O01E 3CMET 4X34A 2M1HA 2K4YA 2DPPB 3C94A 1QW1A 2RHYA 4QQ6A 1K8AC 4N4GA 1N9RA 4JS4A 2Y4YA 1VUBA 3OS0A 3X28B 1VQ5T 3WXMB 3BDLA 3V8JA 4R55A 2DAQA 1M4ZA 3OYIA 3CCVT 4RMOA 3M5AA 1QVFA 3RESA 1W2BA 1UGQB 2F5TX 1BI3A 4OB3B 1VQMT 3P8HA 3RUXA 5KE3A 2LNVA 2RH2A 5I21A 3LLRA 2O4XA 1D3BB 2KAFA 5EG2A 3M4YA 3SWNB 1BIBA 3OSVA 3QYGB 4NS5A 3PTAA 2XG8D 3PMTA 1YJ9T 4FT4A 3CCLA 1BI2A 2LDMA 4M78F 3OYFA 5GANd 3MHXA 3T9NA 3X24B 2YHTA 4M7AG 2OTLA 2HNIA 2JZ2A 1Y07A 4FU6A 5IAYA 1QVGS 4M7DA 1VQ8T 3JCMQ 2ZPEB 2JN0A 1YJWT 5LL6S 3CCJT 2QI2A 3HHTB 1QP3A 3CMEA 2RK2A 4QVZA 1PSEA 4KUDK 3F70A 2RJFA 4NL3A 3O8VA 3PGGA 2VV5A 1V29B 2DXCA 2FYKA 2VC8A 2WSFE 1FWZA 4XTVA 5M9OA 3HPWA 5GAMh 4E7LA 2X4JA 5HK0A 3SWNC 3OYDA 1VQ5A 2DO3A 3J7AF 5GAMj 1TH7A 3JCMg 1JBMA 3CCVA 4DQ2A 4M77E 4WF2A 1B34B 3M9QA 4QQDA 4RCCA 3V8KA 4BI8B 4EMGA 3G71T 1O9SA 3LGFA 4C0DB 3LWHA 3CC7A 1VQMA 4Z02A 2ZPBB 3PFSA 2G3RA 3HFNA 3OBWA 4B9XA 4NL2A 1W4SA 3OYHA 3LWIA 4M7AE 1YJ9A 2YRVA 4MZTA 4OF1A 4MDXA 3META 5GANf 5FU6B 4N4IA 2K5LA 3RERA 4MZPA 1ZQ1A 4II1A 3INZA 2GFAA 2E10A 4OB1B 5LJ5d 2X4WA 2QQBA 4MZMA 5J26A 3HRUA 4HT9A 1YITT 1WJQA 2FHDA 5CR2A 3VV0A 1VQ8A 3L2ZA 4GY5A 4XU2A 3J80E 4RKUE 3CCJA 1QVGA 1MHNA 3NTIA 5KCHA 4LDWA 1WQWA 2LQ8A 2RO0A 3DB4A 5LJ5h 3CXCS 4M75G 3QDRB 3WVDB 3KXTA 4M75B 3GNFB 4C5HA 2K57A 4BE1A 2MWPA 2RJCA 3S3OA 2F69A 5FU6C 2XKOC 3X26B 2L89A 3CCST 5GAN6 4ZTJA 5DY9A 3GOXA 4M75D 1YIJA 3G71A 1KG1A 5CK9A 4Y28E 1LNXA 4M7DG 2RJEA 2XICA 3HRSA 2EJFA 4M7DB 2WACA 4HKEA 3JCMd 2XDBA 3QPHA 1BI0A 4OMFB 5HY6A 4FT2A 4PJOF 2CZ0B 1JJ2A 1Y7XA 4M7DD 1XNIA 3RMSA 3OYAA 4QVDA 3JAME 5LJ3d 2QQRA 3PIPA 2XD0A 2VXFA 3M58A 2CZ6B 3M56A 3OYNA 1EIFA 3M54A 5GAOm 3OYKA 4M75C 3JCMX 1U1SA 4CI0C 5KH6A 1PSFA 5GMKe 1YITA 1WGSA 1NPRA 3BY7A 4L59A 3GPLA 3CEYA 3C4SA 2K3XA 4M75E 3SWNA 2LCLA 4IUPA 4J6YA 1Q86U 2LT4A 3OYJA 4OP0A 4JRKA 4A53A 2IVWA 4M7DC 3CCQT 3DLMA 2XHCA 3JB9I 1VQOT 2B8AA 4XU1A 3OY9A 4L6V5 5A0LA 1VQPT 4HT8A 3QZ5B 3HKSA 4M7AA 3CXCA 2RJDA 3CCRT 2M0OA 1XTDA 4ZN3A 2EQUA 2KY9A 3FRNA 3CCSA 2KK4A 3DB3A 1K73U 2GQVA 3OA6A 2PUOB 3JCMf 4PL6A 4VUBA 1O75A 3JB9J 3N5BB 3OMGA 1M1KU 2E6ZA 3ZEHA 1XOVA 3P8BB 1K9MU 5C6SA 2RD1A 2YLBA 3ME9A 2MI6A 3JCMW 1Q86C 1KC8U 4BUGA 2DTHA 2JNGA 1S72A 4YTLA 4FL6A 1DJ7B 1AHJB 3QO3A 3VYGA 4EMKA 1N9SA 2QEXA 1M90U 3QIIA 5GMKj 3FJPA 1UB4A 1MGQA 3JSCA 4J7FA 3M4GA 2KDSA 5D6XA 4BDYA 1K73C 1KHIA 3SFMA 4C0FA 3QKJA 4IUVA 4J6WA 3NTHA 1IREB 3H6ZA 3UDCA 2PVGB 1NZ9A 2EQKA 2RHIA 4A4KA 1M1KC 1K9MC 2DVEA 1YHQT 3PMIA 3QJ6A 4IUUA 1KC8C 1QVPA 4KULA 4R56A 1U1TA 1VQPA 4M78E 1LJOA 5GAMg 4F7UF 2K2VA 2XU8A 1JRIA 2L5QA 3LW5E 5GAN4 1M90C 2X4XA 5GAMe 2CKKA 5HKCA 4JRQA 3JB9G 1X6OA 3X25B 4BI3A 3WVEB 3CBOA 4M77G 3H8ZA 4M77B 1U8RA 4EMHA 4XK8E 4BD3A 4MDWA 4C8QF 5FLXE 3BDUA 4M75A 3JB9D 4JDSA 3E9GA 3R6OA 3ZFJA 4XU0A 2ZGWA 1YCYA 4M77D 4RG2A 3PIOA 1NPPA 2PU9B 2LT1A 4M7AB 1I5LA 3A8GB 5CKEA 3QZ9B 2IG0A 5CQYA 3QBYA 2AHJB 2VGMA 2ZPHB 4XTXA 4M7AD 4QVCA 5GAOr 2HQEA 4XTUA 1P92A 2VYTA 3ER0A 3V7CA 3CMAT 1G5VA 4XTZA 3HP9A 3LGLA 2ZPIB 5GANh 2E65A 4PJOB 1YHQA 2RI2A 2Y90A 4M77C 4QW2A 2ZZDA 2X4YA 2KVQG 4X9DA 4FSXA 1HXDA 5D6WA 3CPWS 4EMKB 2E6NA 5LJ5e 4A4GA 5FRMA 1Y96B 1YBYA 1I8FA 1YI2T 1KD1U 4M7AC 5I2SA 3E9FA 4J7IA 3HSBA 4NOYA 1JJ2S 1JB0E 1I4K1 1WJRA 5DLQE 4J5YA 4C92F 4KT0E 4ZGDB 1IZ6A 2EKOA 4OGCA 2RHXA 3VYHB 2DKGA 4X9CA 4E7HA 3G6ET 1VQ9T 1VQKT 2BIVA 3OYYA 5GAMd 4LD6A 2CZ7B 2MWOA 3VKIA 4M78A 1M1GA 1OI1A 3M59A 4ZGJB 1VQNT 2DTOA 3L2UA 4EMKC 1VIEA 2GFUA 1YJWA 1KD1C 2DD5A 2R5MA 1BKBA 4KBMB 2YLCA 3PT9A 2RM4A 2HBPA 3CMAA 2EWNA 3JCMb 4PJOE 1KHCA 2E70A 2DZ9A 3MP8A 3OS1A 4XTYA 2QA4T 1Q81U 5LJ5j 3QXEB 3X20B 2DIGA 5HK3A 2NLUA 5LJ3e 2ZPGB 5GAOl 3EFSA 3JCMP 2M9UA 5GAMf 3CPWA 2QQSA 2LC4A 4XQ3A 1WJSA 1Q82C 2GCXA 4EDUA 4C0ZA 2HAXA 4C5IA 5GAOp 4LDXA 4BY6B 3FIFA 2RA2A 4ELZC 2DIQA 3QHSA 3QYHB 4A54A 4J83A 3G6EA 3C12A 3M53A 1VQKA 2DJZA 1Q81C 2E5QA 2XI9A 2D6FA 4MMKA 3V8LA 5A2QE 1VQLT 2H3JA 3GP8A 3JCMh 3TREA 3E19A 1YJNT 1VQ7T 1RL2A 2M16A 4F7UG 4M77A 3I55T 2C06A 2E1HA 4BE0A 4PNOA 2KMTA 4GLKA 5LJ3h 2F5KA 1VQ4T 3ZBDA 2PQWA 3ASKA 5J39A 1G3TA 3GNGA 3PNWC 4QQGA 3OYLA 5LJ3j 1KQSA 3CCET 2QA4A 4BY6C 2D0QB 2RHZA 3A5ZB 2E41A 4TVRA 5A0DA 2WSEE 4J6XA 3RIRA 3UWNA 2RHUA 2BKDN 5CIUA 2EYQA 4M78G 2ZCFB 4M78B 1OZ3A 2CYZB 4DOVA 5AYFA 3C95A 3I56T 4C5EA 3L2WA 2FVUA 4M78D 1M9SA 3L42A 4JRIA 2OAUA 5C0MA 4PJOA 4MMLA 2DXTA 4F7UE 1HK9A 3UT1A 3FB9A 1VIFA 1Y96A 2CZ1B 5D6YA 2VGNA 4CRIA 1R8OB 5CO7A 4LDYA 1VQLA 1YJNA 1NJIU 1VQ7A 1G3WA 2L8DA 2XDDA 4JJNK 2P4TA 4EPCA 3I55A 4M78C 3RKWA 4ZN1A 1H3ZA 1SSFA 4C8QE 3CCQA 1VQ4A 1VQOA 4M75F 4PKCC 2RB6A 3GF5A 2QXFA 3M57A 5GANg 4C92G 4ZTFA 1X75C 3CCRA 2LQKA 4HCCA 2V8IA 3KBGA 3G7ZA 2JUFA 5GANe 3J81E 4JUVA 4JLGA 4XU3A 3MO8A 1N6AA 2FL7A 2QTXA 3VJPA 5GMKi 3OYGA 4C92D 2OTLT 4M7DF 5GAN8 3HL8A 4BI4A 5CKHA 1NJIC 3I56A 2P0KA 5IN1A 5GMKm 1FX7A 3OQ5A 3S3NA 2JVVA 2L3RA 3CBPA 4IUTA 5KE2A 1KQ2A 2PUKB 3AHUA 4XTWA 4Y91A 3FDRA 5A0GA 1WNLA 2RK1A 3QJYA 2VUBA 4O6JA 3P8DA 3HFOA 4RG8A 3GLXA 1XQHA 4C92C 1N8RU 5CKDA 3OSSC 4XAXB 1BIAA 5FROA 3Q1JA 1I81A 1LOJA 3RKXA 4HCZA 1OYXA 2HQXA 2I2LA 4C92E 3A8OB 4BACA 1UGSB 4E47A 3CC7T 4LD9K 3G4ST 1KQ1A 5GAN7 2DTIA 2LCCA 3L2QA 5LJ5g 3GIBA 5GANj 3MCAB 3BW1A 4IURA 4PJOG 3CBMA 1BI1A 1N27A 2DZCA 2KQWA 4LDVA 2JOYA 3OYEA 3QG1A 4D6WA 1BYMA 4F7UA 3S6WA 1Y71A 1UGRB 2EIFA 2QDYB 5KCOA 3FLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLM A;  4X34 A;  2B8A A;  2M1H A;  3OY9 A;  5FRN A;  3MEA A;  2RHY A;  2RJD A;  2X35 A;  2M0O A;  3OMC A;  2XK0 A;  4N4G A;  4QQ6 A;  2QQS A;  2EQU A;  2LVM A;  4PLL A;  1WJS A;  3DB3 A;  3OA6 A;  4EDU A;  3OS0 A;  4C5I A;  3BDL A;  2DAQ A;  4PL6 A;  2DIQ A;  3OYI A;  3OMG A;  3MEV A;  3ZEH A;  5C6S A;  3OYB A;  3ME9 A;  3P8H A;  5KE3 A;  2E5Q A;  3LLR A;  4FL6 A;  2O4X A;  4OVA A;  2M16 A;  3QII A;  3MEW A;  4NS5 A;  4A4E A;  3PMT A;  3OYM A;  2JTF A;  4BE0 A;  2LDM A;  5D6X A;  4BDY A;  3OYF A;  2F5K A;  3QKJ A;  2XDP A;  4IUV A;  3NTH A;  2JZ2 A;  2PQW A;  2RI5 A;  3ASK A;  3H6Z A;  3PNW C;  4FU6 A;  4QQG A;  5IAY A;  5J39 A;  2EQK A;  2RHI A;  4Q5W A;  2RHZ A;  3PMI A;  3QJ6 A;  4IUU A;  4QVZ A;  2RHU A;  2BKD N;  5CIU A;  3UWN A;  3FC3 A;  3F70 A;  2RJF A;  1OZ3 A;  3O8V A;  5M9O A;  4E7L A;  3S3M A;  4IUQ A;  2K3Y A;  4E7I A;  4C5E A;  2X4X A;  3OYD A;  3L2W A;  2CKK A;  3EAE A;  2R58 A;  3L42 A;  2O4X B;  2RI3 A;  3OYL A;  3M9Q A;  4QQD A;  3H8Z A;  5C0M A;  4BE2 A;  4BD3 A;  3LGF A;  3UT1 A;  2R5A A;  1OZ2 A;  3FEO A;  3E9G A;  3LH0 A;  3PFS A;  5D6Y A;  4Z02 A;  2G3R A;  4B9X A;  4B9W A;  4CRI A;  3OYH A;  4A4H A;  3LYI A;  4RG2 A;  2L8D A;  2YRV A;  4UC4 A;  3MET A;  1RI0 A;  4N4I A;  1H3Z A;  3MP6 A;  2IG0 A;  4II1 A;  2GFA A;  4BDZ A;  1SSF A;  3OB9 A;  2X4W A;  3QBY A;  3L2R A;  5J26 A;  2HQE A;  1WJQ A;  2FHD A;  2VYT A;  4N4H A;  1G5V A;  3OYC A;  2LRQ A;  3KUF A;  4ZTF A;  3LGL A;  4GY5 A;  2RI2 A;  1MHN A;  3NTI A;  4QW2 A;  3MEU A;  5KCH A;  3MP1 A;  2X4Y A;  3MO8 A;  2RO0 A;  3DB4 A;  3OYG A;  4IKF A;  5D6W A;  2E6N A;  4A4G A;  5FRM A;  2P0K A;  5IN1 A;  4C5H A;  4BE1 A;  3OQ5 A;  3E9F A;  2MWP A;  2L3R A;  2RJC A;  4IUT A;  5KE2 A;  3S3N A;  3S3O A;  2L89 A;  4E7K A;  3SD4 A;  3OS2 A;  4ZTJ A;  3GOX A;  1WJR A;  3FDR A;  4E7J A;  4A4F A;  2EKO A;  2RJE A;  2RHX A;  2WAC A;  3LX7 A;  3P8D A;  4E7H A;  4PLI A;  2LTO A;  2BIV A;  2EFI A;  2EQM A;  4LD6 A;  2MWO A;  3NTK A;  1XNI A;  3Q1J A;  5FRO A;  3OYA A;  4HCZ A;  1OI1 A;  2QQR A;  1OYX A;  2HQX A;  3L2U A;  3OYN A;  4BAC A;  2GFU A;  2D9T A;  3L2V A;  2R5M A;  3OYK A;  2LCC A;  5KH6 A;  3L2Q A;  1WGS A;  4L59 A;  2R57 A;  4IUR A;  1KHC A;  2BUD A;  3CEY A;  3C4S A;  2K3X A;  1N27 A;  2GF7 A;  3MP8 A;  3OS1 A;  4IUP A;  3OYE A;  2EQJ A;  3S6W A;  3OYJ A;  4C5G A;  2DIG A;  2NLU A;  5KCO A;  3FLG A; 
#chains in the Genus database with same CATH topology
 1N8R C;  1RAI B;  3RR6 A;  2X35 A;  3ULR B;  1PWT A;  4PLL A;  3G4S Q;  4ATO A;  1RAA B;  3MEV A;  5J3B A;  1WIE A;  4PJO C;  4P5N A;  4V2S A;  5GAO q;  2YRC A;  1YIJ T;  3JCM e;  3MEW A;  4A4E A;  5CKF A;  2LJ1 A;  2NUT B;  1VQK Q;  4D8D A;  2RI5 A;  3CCU T;  4ME7 A;  2NUZ A;  2E12 A;  3JB9 F;  4LE9 A;  1YI2 A;  5DLO A;  4Z8A A;  1H8K A;  3HRT A;  4M77 F;  3EFO A;  2COW A;  4KUI A;  4LDU A;  3V7R A;  1WZO A;  4M7A F;  2RI3 A;  1RUW A;  2QDL A;  1R0B G;  2A3L A;  4A4H A;  5CQX A;  2KRO A;  1RI0 A;  2K79 A;  4HXJ A;  3OB9 A;  2YUN A;  1S72 T;  4C8Q B;  3UF4 A;  2E4H A;  3CCU A;  4N4H A;  2LCS A;  2CT3 A;  3SDZ A;  3BE3 A;  2CGH A;  4C0G A;  3RMQ A;  2JT4 A;  2FEI A;  2OTJ Q;  2O31 A;  4M4Z A;  5CVI A;  2EAY A;  2ROT A;  3NFC A;  2X3X D;  3OS2 A;  2DK3 A;  2FB7 A;  1QVF S;  3VU3 C;  3VRY A;  2QQ9 A;  2LX9 A;  2EFI A;  5GMK l;  2EQM A;  2JTE A;  3NTK A;  3CPF A;  3CCE A;  5ECA A;  1K8A U;  4OMO A;  1ZA1 B;  2FO0 A;  3L2V A;  1Q86 R;  5GMK h;  1BU1 A;  2EJG A;  2ABL A;  1B34 A;  3M0Q A;  1D0Y A;  2EQJ A;  2L3P A;  2ZPF B;  3VUB A;  1NE8 A;  3A8L B;  1SEM A;  2O01 E;  4X34 A;  2M1H A;  4X1V A;  1BCM A;  2RHY A;  1K8A C;  1K9A A;  2VKN A;  1HSQ A;  1RLP C;  3WXM B;  1WHG A;  3M5A A;  3RES A;  1W2B A;  3RUX A;  1D3B B;  2C0O A;  2JMC A;  4M78 F;  1JXO A;  2OTL A;  3EH1 A;  4IIO A;  2LMJ A;  4D8K A;  3VS5 A;  1VQM Q;  3CCJ T;  2QI2 A;  3HHT B;  1QP3 A;  2RK2 A;  2HKQ B;  1D1A A;  4KUD K;  3F70 A;  2K2M A;  4NL3 A;  3O8V A;  2VV5 A;  4E7L A;  2FRY A;  2VC8 A;  1FWZ A;  1FMV A;  3OYD A;  2COY A;  1KK7 A;  4M77 E;  3M9Q A;  4QQD A;  1O9S A;  3LWH A;  2KGT A;  1UUE A;  3PFS A;  3HFN A;  4B9X A;  1BBZ A;  1NEG A;  4M7A E;  1J3T A;  2C0T A;  2E3I A;  4OF1 A;  4MDX A;  4N4I A;  1TXQ A;  5LJ5 d;  2GFA A;  2E10 A;  2L2P A;  2QQB A;  2CP2 A;  2LZ6 B;  4HT9 A;  1YIT T;  3EG0 A;  1YIJ Q;  3CCJ A;  1MHN A;  1RAG B;  1KD1 R;  5KCH A;  1WQW A;  2LQ8 A;  2RO0 A;  4B6M A;  3WVD B;  3CCU Q;  2QK0 A;  4C5H A;  4BE1 A;  2Z0W A;  1MUZ A;  5FU6 C;  1AWX A;  4ZTJ A;  1PG5 B;  5CK9 A;  4Y28 E;  4FYY B;  2RJE A;  3HRS A;  3H0I A;  2XDB A;  4PJO F;  3JAM E;  5LJ3 d;  3OYN A;  5GAO m;  3JCM X;  3CCS Q;  1YIT A;  1PSF A;  4L59 A;  1E7O A;  4M75 E;  1Q86 U;  4ESR A;  5FW9 A;  3OYJ A;  4OP0 A;  4A53 A;  2IVW A;  4M7D C;  1MNE A;  3DLM A;  2XHC A;  5FWC A;  1WXU A;  2B8A A;  1S72 Q;  3OY9 A;  5A0L A;  3GBQ A;  3HKS A;  2RJD A;  2DVJ A;  3M0U A;  3DB3 A;  2GQV A;  3OA6 A;  1KIK A;  3JCM f;  4PL6 A;  3N5B B;  2E6Z A;  2RD1 A;  1IB8 A;  3JCM W;  1Q86 C;  5IHN A;  4YTL A;  1CSK A;  3VYG A;  1M90 U;  5GMK j;  1GCP A;  1PNJ A;  4DBF A;  1UB4 A;  3JSC A;  1KHI A;  4IUV A;  1SHG A;  1IRE B;  3H6Z A;  2A08 A;  2KE9 A;  2DVE A;  1JXM A;  1K9M R;  1U1T A;  4M78 E;  1ZSZ B;  3UA7 A;  5GAM g;  2A0F B;  2EYX A;  1M90 C;  2X4X A;  5GAM e;  4JRQ A;  3JB9 G;  2LQN A;  4JJB A;  1C0M A;  4M77 G;  2YWW A;  4BD3 A;  4MDW A;  5FLX E;  1GCQ C;  3JB9 D;  2D8H A;  2ZGW A;  1QCO A;  2C0I A;  4M77 D;  1NPP A;  2PU9 B;  3QZ9 B;  5I11 A;  2VGM A;  4M7A D;  5GAO r;  2VYT A;  3V7C A;  3CMA T;  3HP9 A;  4E6R A;  2RI2 A;  1PCX A;  2ZZD A;  2QTV A;  5LJ5 e;  1YBY A;  1I8F A;  5KYX B;  1KD1 U;  4NOY A;  1JB0 E;  5DLQ E;  1WJR A;  4C92 F;  1RI9 A;  3VYH B;  4E7H A;  1EFN A;  1VQ9 T;  3OYY A;  2CZ7 B;  2MWO A;  2OAW A;  2AIR B;  2AK5 A;  4ZGJ B;  3NMZ C;  4EMK C;  1YJW A;  1KD1 C;  3NGP A;  1ZUK A;  3PT9 A;  3CMA A;  1IGU A;  4PJO E;  2YXY A;  2E70 A;  2DZ9 A;  1T3S A;  1WXT A;  3X20 B;  2DIG A;  1TUG B;  5LJ3 e;  5GAO l;  2LQW A;  1Q82 C;  1WJS A;  2PZ1 A;  2HAX A;  4C0Z A;  3PVL A;  4C5I A;  2DIQ A;  1NLP C;  4AG2 C;  4LNP A;  1MND A;  2DBK A;  4J83 A;  2CP6 A;  3M53 A;  2FPF A;  2XI9 A;  1I5O B;  2JJ9 A;  1VQL T;  5GJW B;  3E19 A;  1IHW A;  3I55 T;  4OMP A;  4PNO A;  2KMT A;  4GLK A;  1UEC A;  2EYZ A;  5LJ3 h;  2X9H A;  3OYL A;  3GNG A;  4QQG A;  4BY6 C;  2D0Q B;  4TVR A;  2E41 A;  3VS6 A;  1SPK A;  2FPD A;  4M78 G;  1YJN Q;  2YUO A;  4OMQ A;  3C95 A;  4M78 D;  1K4U S;  2ZAE A;  5C0M A;  2AKK A;  3HTR A;  1HK9 A;  3UT1 A;  1VIF A;  2B86 A;  2RQV A;  1VQL A;  2A36 A;  1G3W A;  2L8D A;  1AD5 A;  3I55 A;  4RTW A;  1X69 A;  1VQO A;  1X6G A;  2ECZ A;  5GAN g;  2QXF A;  3M57 A;  4ZTF A;  3KBG A;  5GAN e;  4JUV A;  4XU3 A;  3MO8 A;  4DBQ A;  1R0C B;  2QTX A;  4M7D F;  3VJP A;  1ACM B;  1OQK A;  2AKL A;  2P0K A;  5IN1 A;  1M2O A;  1X27 A;  3OQ5 A;  2JVV A;  2L3R A;  3CBP A;  4IUT A;  5KE2 A;  2EGA A;  4XTW A;  4F04 B;  1GRI A;  3P8D A;  2RMO A;  4RG8 A;  1X43 A;  3GLX A;  5CKD A;  2HL5 C;  2I2L A;  4C92 E;  4E7Z A;  3CC7 T;  2BZY A;  1UGS B;  4LD9 K;  3G4S T;  5GAN 7;  4CC4 B;  3L2Q A;  1QKW A;  1AZE A;  4IUR A;  4PJO G;  1N27 A;  2JOY A;  2ESW A;  3S6W A;  1Y71 A;  1UGR B;  2EIF A;  2QDY B;  4PJO D;  1PRM C;  5FRN A;  4JS5 A;  1T0H A;  2LVM A;  3CC4 T;  1H3H A;  4HVW A;  2K5F A;  2CH4 W;  4FSS A;  2VXE A;  3M55 A;  2LX7 A;  3JB9 H;  4OB2 B;  3VS2 A;  1M8M A;  5CAI A;  1KQS S;  2E64 A;  3JRZ A;  1WQ7 A;  3G4S A;  3QSU A;  5DM7 R;  4PFP A;  1VQ9 Q;  3DKM A;  4Q5W A;  1FXX A;  3CC2 T;  2EJ9 A;  2G6F X;  1OUL A;  3A8M B;  1RLQ C;  4E7I A;  3CC4 A;  3TSZ A;  4RUG A;  4HA8 A;  1MV3 A;  1M1F A;  4F14 A;  3EAE A;  4JRP A;  2O4X B;  4WCI A;  1OU8 A;  3TCJ A;  5L23 A;  1CKA A;  4J9G A;  2P0Q A;  2OX7 A;  4FCY A;  4F7U B;  1CKB A;  1Q95 G;  3NHN A;  1IHV A;  3CD6 Q;  3VRZ A;  2OTJ T;  4UC4 A;  2PVD B;  2D1X A;  2KSS A;  3MP6 A;  1SG5 A;  2MIO A;  1WLP B;  3OW2 A;  2WSC E;  5LJ5 f;  3CCM Q;  2LRQ A;  2QAS A;  3KUF A;  5IT9 E;  1UGP B;  5GAO n;  2DXB A;  1G83 A;  3CC2 A;  3SEM A;  1TU0 B;  1Q7Y U;  3MEU A;  1JJ2 P;  2M02 A;  5FU7 B;  2KT8 A;  3DLL A;  1PD1 A;  4FM4 B;  4O5V A;  2EPD A;  2DEQ A;  4FW2 A;  4E7J A;  4N0A C;  3URG A;  4M7D E;  1WHL A;  4C8Q C;  1VOM A;  4DEX A;  3LX7 A;  2HEQ A;  1Q7Y C;  1X01 A;  2OTJ A;  2YRD A;  3CXC P;  1I1J A;  5KYN A;  1YWP A;  1ZA2 B;  5LJ3 f;  4BB7 A;  1SHF A;  2RQR A;  3BFM A;  2R57 A;  4ELY C;  3L1A A;  4FIB A;  4IIM A;  2GF7 A;  2MYS A;  4E2F B;  3OYC A;  2AZV A;  1QW1 A;  2KRS A;  4QQ6 A;  4N4G A;  1N9R A;  4JS4 A;  4CC3 A;  1VUB A;  1QWF A;  2DAQ A;  1M4Z A;  2F5T X;  1VQM T;  5KE3 A;  2LNV A;  2NYS A;  4RTT A;  5I21 A;  5IHI A;  2RF0 A;  2BE9 B;  2O4X A;  3SWN B;  1D0X A;  1VQ5 Q;  5FWB A;  3T9N A;  3X24 B;  4FU6 A;  1YNZ A;  1RAB B;  3CC7 Q;  2JS2 A;  1G2B A;  2AZS A;  4QVZ A;  2DXC A;  3JCM g;  1JBM A;  5AT1 B;  3TVT A;  4DQ2 A;  4WF2 A;  1B34 B;  4BI8 B;  4EMG A;  3I5R A;  1VQ8 Q;  4PJN A;  1VQM A;  1M3C A;  2G3R A;  3CC4 Q;  1TOV A;  4NL2 A;  3LWI A;  1B07 A;  1OX8 A;  2YRV A;  2I0N A;  5GAN f;  4JJD A;  4II1 A;  3INZ A;  2X4W A;  4MZM A;  3HRU A;  2KI7 A;  1WJQ A;  2FHD A;  4J9E A;  3L2Z A;  4GY5 A;  4XU2 A;  1QVG A;  1HJD A;  1V1C A;  2DJQ A;  3CXC S;  3PE0 A;  2E5K A;  3KXT A;  3QDR B;  4M75 B;  3S3O A;  3CCS T;  2L89 A;  3CC2 Q;  1YIJ A;  1LNX A;  4M7D G;  2EJF A;  2VVK A;  4HKE A;  1OX9 A;  5HY6 A;  4LUE A;  1C6V X;  2CZ0 B;  4M7D D;  2DF6 A;  4QVD A;  3PIP A;  1M27 C;  2CZ6 B;  3OYK A;  5KH6 A;  5GMK e;  1WGS A;  1NPR A;  3BY7 A;  3GPL A;  3CEY A;  1A0N B;  3TQ7 P;  2K3X A;  3I35 A;  3SWN A;  4IUP A;  2LT4 A;  1LVK A;  4AFZ C;  2AT1 B;  2ED0 A;  5IHK A;  3JB9 I;  1I07 A;  4XU1 A;  2DA9 A;  1NYG A;  3QZ5 B;  4M7A A;  2JM9 A;  3FRN A;  2P84 A;  4AFQ C;  2KK4 A;  3CCS A;  2HKN A;  1K73 U;  1WXB A;  2RQT A;  1O75 A;  3JB9 J;  2NUP B;  3P8B B;  1BK2 A;  3ME9 A;  2MI6 A;  2DTH A;  2JNG A;  1S72 A;  1VQP Q;  1N9S A;  4OMN A;  2CT4 A;  5D6X A;  1RAF B;  1K73 C;  1GBQ A;  4J6W A;  2J06 A;  3NTH A;  3UDC A;  2PVG B;  1NG2 A;  4KGV B;  2EQK A;  4IUU A;  1QVP A;  1ZX6 A;  2K2V A;  3MPU B;  1JRI A;  5GAN 4;  1YCS B;  1M90 R;  5HKC A;  1X6O A;  3X25 B;  1TUD A;  3WVE B;  1U8R A;  2RQW A;  4C8Q F;  3BDU A;  4M75 A;  1YHQ Q;  3ZFJ A;  4XU0 A;  4E7S A;  2JW4 A;  3EGX B;  1I5L A;  1OV3 A;  1ZSZ C;  3A8G B;  5CQY A;  2ZPH B;  4QVC A;  2HQE A;  1RAE B;  4XTU A;  4XTZ A;  3LGL A;  2ZPI B;  4QW2 A;  2V1R A;  4FSX A;  2QGG A;  1HXD A;  4JZ3 A;  1MMN A;  5I2S A;  3HSB A;  5GJV B;  4ZGD B;  9ATC B;  1PD0 A;  4M78 A;  2LJ3 A;  3M59 A;  1VQN T;  2NUP A;  1OOT A;  2GFU A;  1GFC A;  2DD5 A;  2R5M A;  2YLC A;  2RM4 A;  2HBP A;  1D1C A;  2J7I A;  3JCM b;  1KHC A;  3OS1 A;  1WYX A;  3G6E Q;  2DFU A;  1Y57 A;  3QXE B;  4F16 A;  5HK3 A;  2NLU A;  1NBE B;  2KBT A;  3CPW A;  2QQS A;  2BZX A;  2YUP A;  1K0S A;  1Q82 R;  4LDX A;  2KXD A;  2CP3 A;  3QHS A;  3QYH B;  1I0C A;  2QA4 Q;  1SRL A;  2E5Q A;  5A2Q E;  3GP8 A;  1JO8 A;  1YJN T;  1ABO A;  1RL2 A;  4F7U G;  1VQ7 T;  1JEG A;  3FJ5 A;  1ZUY A;  4PJL A;  3ASK A;  1KQS A;  3EGX A;  2DL4 A;  2WSE E;  3RIR A;  1AVZ C;  2EYQ A;  4OMM A;  3L2W A;  3A98 A;  1VQ4 Q;  2D0N A;  4PJO A;  2CZ1 B;  5D6Y A;  2VGN A;  2E3H A;  4LDY A;  2JMA A;  2FZC B;  1YJN A;  1VQ7 A;  4ZN1 A;  3RKW A;  1SSF A;  4C8Q E;  1IGQ A;  4KH0 B;  2RB6 A;  1X75 C;  1WDX A;  3G7Z A;  2JUF A;  3J81 E;  1X2K A;  3OYG A;  1HD3 A;  2L3Q A;  4DBH A;  4OML A;  2DRK A;  4Z89 A;  1HYO A;  2BE7 D;  2RPN A;  4O6J A;  1OEB A;  2QYZ A;  1AZG B;  1BIA A;  2CUD A;  4HCZ A;  2F2X A;  4J9D A;  1OYX A;  2DL5 A;  3H0H A;  5LJ5 g;  3QWY A;  3BW1 A;  1W2B P;  3CBM A;  1BI1 A;  2CP7 A;  2DZC A;  1X6B A;  2O2O A;  3OYE A;  3A1P A;  1SF9 A;  1MMG A;  2FZK B;  3MEA A;  5GAN 2;  2XK0 A;  2KYB A;  2JM8 A;  5EC7 A;  2EW3 A;  2LP5 A;  1Q82 U;  2DBM A;  1VQ6 T;  5IXB A;  3TU4 K;  2L3S A;  1U5S A;  1M5Q 1;  2JTF A;  3E1S A;  5LJ3 g;  3A8H B;  2HL3 A;  1RAC B;  3M0R A;  2P0P A;  1MV0 B;  1VQN Q;  2JTM A;  2PVO B;  3OS5 A;  4RCB A;  4PK4 A;  3FC3 A;  2DER A;  4GBQ A;  3CD6 T;  1H92 A;  3OBY A;  4J9F A;  2K3Y A;  4C92 A;  3JCM J;  1UEB A;  4C0D C;  1VQ9 A;  3THK A;  2YSQ A;  2R58 A;  1Z9Z A;  1QP2 A;  3CCM T;  4BE2 A;  1ZBX A;  2CS7 A;  1BB9 A;  1OZ2 A;  1IRX A;  1VQ6 A;  4LUD A;  1VYV A;  3LYI A;  3EFR A;  3M0S A;  5GAN 3;  3MKD A;  4BDZ A;  5GAN 5;  4C8Q G;  3L2R A;  3SB2 A;  1BCO A;  4DOW A;  1AT1 B;  2QEX T;  2K5I A;  1VQ7 Q;  4FW1 A;  4R0K A;  4C8Q D;  3MP1 A;  2MF2 A;  3CD6 A;  4IKF A;  3I5S A;  2HQH A;  1N5Z A;  8AT1 B;  2DD4 A;  2V8K A;  4Z88 A;  3SD4 A;  3CCM A;  3VS3 A;  1W2B S;  2GTO A;  1WA7 A;  2IPO B;  4PLI A;  5CCA A;  4QKU A;  3D7S B;  1OPL A;  4JLI A;  1Q7Y R;  3UPU A;  2Y4X A;  2MAM A;  1WHH A;  2A7Y A;  5FU7 C;  4LXC A;  1M3B A;  2MCN A;  3RKY A;  1YFN A;  2XID A;  1D09 B;  2HD0 A;  4JJC A;  2BUD A;  2YDL A;  1EZZ B;  2K6D A;  2DXU A;  4C5G A;  4L5G A;  3G1J A;  2K3B A;  2K4Y A;  2F2V A;  3EG3 A;  1R77 A;  2HBW A;  2QAZ A;  3CCL Q;  2DMO A;  1VQ5 T;  3V8J A;  4R55 A;  3OYI A;  2JXB A;  1QVF A;  1UGQ B;  4ZNX A;  2EYW A;  4OB3 B;  3P8H A;  4JZ4 A;  1UE9 A;  2RH2 A;  3CME Q;  1TSF A;  3M4Y A;  1YJ9 T;  3OSV A;  3QYG B;  4NS5 A;  3PMT A;  4FT4 A;  1BI2 A;  2LDM A;  1U3O A;  1AWJ A;  2EKH A;  1G8X A;  4M7D A;  2SEM A;  1VQ8 T;  3JCM Q;  2ZPE B;  2ENM A;  5LL6 S;  3EHR A;  2YUQ A;  5M9O A;  1V29 B;  2WSF E;  2X4J A;  3SWN C;  1VQ5 A;  2DO3 A;  5GAM j;  1TH7 A;  1D1B A;  3V8K A;  4RCC A;  1SKU B;  4DBR A;  3LGF A;  4C0D B;  3CC7 A;  2ZPB B;  5HCK A;  4PFO A;  1K0X A;  3OYH A;  1W4S A;  1YJ9 A;  2O9S A;  4RTY A;  4OB1 B;  2MOX A;  1PRL C;  5J26 A;  4AG1 C;  1GL5 A;  1VQ6 Q;  5CR2 A;  3AT1 B;  1QQJ A;  3VV0 A;  1VQ8 A;  1YWO A;  2DM1 A;  2FRW A;  3DB4 A;  1FMW A;  2ROL A;  3GNF B;  2HMA A;  2K57 A;  2HSP A;  1QLY A;  2MWP A;  2RJC A;  4K11 A;  2F69 A;  2DL7 A;  5DY9 A;  1KG1 A;  1NM7 A;  3QWX X;  3JCM d;  2PTK A;  1W70 A;  3QPH A;  1BI0 A;  4FT2 A;  1Y7X A;  1XNI A;  3RMS A;  3OYA A;  2VXF A;  3M56 A;  4M75 C;  1Q81 R;  3E2U A;  4CI0 C;  1S1N A;  2O88 A;  1SSH A;  3C4S A;  4J6Y A;  1U06 A;  3CCQ T;  4HT8 A;  2CSQ A;  1VQP T;  1YN8 A;  2QEX Q;  3CCR T;  2M0O A;  1XTD A;  1M3A A;  2DX1 A;  4VUB A;  2J6O A;  1M1K U;  1XOV A;  5C6S A;  2YLB A;  1KC8 U;  4RTV A;  1NEB A;  3QO3 A;  5I22 A;  4RTX A;  3H0F A;  4EMK A;  2EGE A;  3FJP A;  2DET A;  3VS1 A;  1E6H A;  1MGQ A;  4BDY A;  2KDS A;  3R6N A;  4C0F A;  3SFM A;  3QKJ A;  1K73 R;  3REA B;  2M51 A;  1M1K C;  4A4K A;  1YHQ T;  1KC8 C;  4KUL A;  1ARK A;  1VQP A;  1LJO A;  2DYB A;  4F7U F;  1T3L A;  1TTH B;  2KRN A;  2L5Q A;  2XU8 A;  3LW5 E;  1QCF A;  1ZUU A;  3CBO A;  4M77 B;  4EMH A;  2DE0 X;  4JDS A;  3E9G A;  1XJW B;  3R6O A;  3PIO A;  2LT1 A;  4M7A B;  5D7U A;  3QBY A;  4FYW B;  4HCK A;  1P92 A;  3ER0 A;  3VS7 A;  1G5V A;  3NPF A;  1YJ9 Q;  1YHQ A;  2Y90 A;  2KVQ G;  1TG0 A;  5FRM A;  1Y96 B;  1YI2 T;  3E9F A;  1Z9Q A;  4J7I A;  1JJ2 S;  1I4K 1;  4X9C A;  3G6E T;  4LD6 A;  3VKI A;  1AWO A;  1VYU A;  2DTO A;  3L2U A;  2DEU A;  2X3W D;  2EWN A;  3MP8 A;  2BZ8 A;  2D8J A;  2L0A A;  2QA4 T;  1Q81 U;  4A63 B;  2ZPG B;  2KRM A;  1B3Q A;  2M9U A;  4HVU A;  2KXC A;  2EGC A;  2LC4 A;  4XQ3 A;  2CUB A;  2GCX A;  2OI3 A;  1QCN A;  3RNJ A;  3FIF A;  3G6E A;  2DJZ A;  3QDF A;  1Q81 C;  2J05 A;  1UDL A;  2D6F A;  3V8L A;  3JCM h;  3TRE A;  2M16 A;  1LPL A;  4M77 A;  1TWB A;  5KYY A;  3EGU A;  1X2Q A;  2CSI A;  2F5K A;  1VQ4 T;  3ZBD A;  5J39 A;  3CCE T;  3PNW C;  2QA4 A;  1M2V A;  1W1F A;  3KFV A;  1IO6 A;  1WFW A;  2FZG B;  2HSE B;  3UWN A;  2X51 A;  2ZCF B;  4M78 B;  3I56 T;  4C5E A;  3REB B;  3OW2 P;  1M9S A;  3CCQ Q;  4Y92 A;  2CDT A;  4F7U E;  3CCR Q;  1Y96 A;  1UHC A;  4CRI A;  1R8O B;  4F17 A;  2XDD A;  4JJN K;  2P4T A;  4EPC A;  1UFF A;  1MMA A;  1QWE A;  1H3Z A;  8ATC B;  1VQ4 A;  4M75 F;  3GF5 A;  3I9Q A;  4HCC A;  1KFZ A;  1FYN A;  1K76 A;  1N6A A;  2OTL T;  5GAN 8;  3HL8 A;  5CKH A;  2A28 A;  2DLP A;  3I56 A;  3S3N A;  3IQL A;  2PUK B;  2NUT A;  1WNL A;  3HFO A;  3H41 A;  1XQH A;  4C92 C;  3OSS C;  4XAX B;  5FRO A;  2QGF B;  1PKT A;  1LOJ A;  3RKX A;  4WTO B;  2HQX A;  4J9H A;  4BAC A;  3A8O B;  4E47 A;  2RNA A;  1NYF A;  2DTI A;  2GQI A;  2O9V A;  3GIB A;  2DL8 A;  4PJO B;  4LDV A;  1BYM A;  1AOJ A;  2KNB B;  5GAM d;  3S3M A;  2EBP A;  4ZGE B;  2VB6 A;  4DEY A;  3OMC A;  4ORZ A;  3JV3 A;  5CKB A;  2DIL A;  4N0A A;  5IXF A;  1JQQ A;  4C8Q A;  2ATC B;  1RAH B;  3OYB A;  1YI2 Q;  3JCM c;  3MJX A;  3QUI A;  1WHM A;  2DRM A;  4OVA A;  3EG1 A;  3OYM A;  3OW2 S;  1G3Y A;  4RTU A;  1GFD A;  2XDP A;  4DA4 A;  1M8V A;  2LNH B;  3V7S A;  4LN2 A;  1JU5 C;  1ZHI A;  1H64 1;  4OGE A;  4IUQ A;  3RBB B;  5IH2 A;  1WPY A;  1Y0M A;  1AWW A;  1VQN A;  1QVG P;  2R5A A;  3LH0 A;  3FEO A;  4B9W A;  1OPK A;  1YP5 A;  2V8J A;  1G3S A;  4KGX B;  4KH1 B;  2J6F A;  1PHT A;  1ABQ A;  7AT1 B;  4J9B A;  4GLM A;  2QG9 B;  2GTJ A;  5I2M A;  2GNC A;  3JCM V;  2HDA A;  1D3B A;  3CCE Q;  1GXI E;  2HZY A;  3VUZ A;  3RDV A;  4E7K A;  2COZ A;  4J8O A;  2MMP A;  4A4F A;  2K9G A;  2QQA A;  3UA6 A;  1F1B B;  3I56 Q;  2LTO A;  1AEY A;  2P4R A;  1ZLM A;  3M0T A;  3TEE A;  4C92 B;  2D9T A;  1QMC A;  4OB0 B;  3CCL T;  5L8R E;  2HCK A;  1T0J A;  1WHK A;  2RN8 A;  3CME T;  2DPP B;  3C94 A;  2Y4Y A;  3OS0 A;  3X28 B;  3BDL A;  2OTL Q;  3CCV T;  4RMO A;  1FMK A;  1BI3 A;  3LLR A;  5KYU B;  2KAF A;  5EG2 A;  3PTA A;  1BIB A;  2XG8 D;  3CCL A;  2MPX C;  1UHF A;  5GAN d;  3OYF A;  3MHX A;  2CRE A;  2YHT A;  4M7A G;  2HNI A;  1VA7 A;  2JZ2 A;  1MMD A;  1Y07 A;  5IAY A;  1QVG S;  2JN0 A;  4PFZ A;  1YJW T;  3CME A;  1PSE A;  3EG9 B;  2RJF A;  3PGG A;  2EVR A;  4XTV A;  2FYK A;  4HCB A;  5GAM h;  3HPW A;  2DL3 A;  5HK0 A;  3J7A F;  3CCV A;  4JPB W;  2RQU A;  3G71 T;  2IIM A;  4Z02 A;  3CCJ Q;  3OBW A;  1WHJ A;  3EGD B;  3TSW A;  4AFU C;  1GBR A;  1B7T A;  2FG0 A;  4MZT A;  3MET A;  5FU6 B;  2K5L A;  3RER A;  4MZP A;  1ZQ1 A;  2GBQ A;  2JS0 A;  2W0Z A;  3C0C A;  2KT1 A;  2V1Q A;  3J80 E;  2NWM A;  4RKU E;  3NTI A;  3ZL7 C;  1PM3 A;  4LDW A;  1UTI A;  1WX6 A;  5LJ5 h;  4M75 G;  2H8H A;  3X26 B;  2XKO C;  5GAN 6;  3GOX A;  1YIT Q;  4M75 D;  3G71 A;  2XIC A;  3EG2 A;  4M7D B;  2WAC A;  2H3E B;  4OMF B;  1JJ2 A;  1ZSZ A;  1WI7 A;  3CPW P;  2XD0 A;  2QQR A;  2LJ0 A;  3M58 A;  1EIF A;  3M54 A;  1UJY A;  1U1S A;  2FPE A;  3EHQ A;  4AFS C;  5KYU A;  2VAS A;  2LCL A;  4AT1 B;  1C1A A;  4J9C A;  4JRK A;  1VQO T;  1W6X A;  2DYI A;  4L6V 5;  3CXC A;  1UGV A;  2CP5 A;  4ZN3 A;  2EQU A;  2KY9 A;  1ZBJ A;  1V76 A;  2KEA A;  2KR3 A;  2PUO B;  1KQS P;  3EG9 A;  3OMG A;  3ZEH A;  1K9M U;  5KYW B;  4BUG A;  4FL6 A;  1AHJ B;  1DJ7 B;  2QEX A;  4CC2 A;  3O5Z A;  3QII A;  6AT1 B;  5KYX A;  1PC0 A;  4J7F A;  3M4G A;  1UG1 A;  3EGD A;  3LH5 A;  1NZ9 A;  2RHI A;  1K9M C;  1M1K R;  1E6G A;  3PMI A;  3QJ6 A;  4R56 A;  1KC8 R;  1OU9 A;  2CKK A;  4BI3 A;  3H8Z A;  1NJI R;  4XK8 E;  2KYM A;  1UJ0 A;  4KGZ B;  1YCY A;  4RG2 A;  3CCV Q;  5CKE A;  2IG0 A;  2AHJ B;  4XTX A;  4KRT A;  2F2W A;  5GAN h;  2E65 A;  4M77 C;  2K7A A;  2X4Y A;  2YT6 A;  4X9D A;  2GGR A;  5D6W A;  3CPW S;  4EMK B;  2E6N A;  1KSW A;  4A4G A;  4AMC A;  4M7A C;  1YJW Q;  4HVV A;  3CQT A;  1N8R R;  1ZSG A;  2M0Y A;  2EYY A;  3CMA Q;  2F1L A;  4J5Y A;  4KT0 E;  1EX4 A;  1IZ6 A;  2EKO A;  4OGC A;  2RHX A;  2DKG A;  1VQK T;  2BIV A;  1M1G A;  1OI1 A;  3G71 Q;  1VIE A;  4KBM B;  1BKB A;  5KYW A;  4PJM A;  4J9I A;  3U23 A;  2V26 A;  1TS9 A;  4XTY A;  5LJ5 j;  1K1Z A;  1PKS A;  4RTZ A;  3EFS A;  3JCM P;  5GAM f;  1GCQ A;  4EDU A;  5GAO p;  4ANJ A;  4BY6 B;  4ELZ C;  2RA2 A;  2J6K A;  1KJW A;  4A54 A;  3C12 A;  3EH2 A;  1LCK A;  1VQK A;  4MMK A;  2H3J A;  2SRC A;  2C06 A;  2E1H A;  4BE0 A;  2PQW A;  1G3T A;  2A37 A;  5LJ3 j;  2RHZ A;  3A5Z B;  5A0D A;  4J6X A;  1VQL Q;  2RHU A;  2BKD N;  5CIU A;  1OZ3 A;  2CYZ B;  2BTT A;  2ED1 A;  4DOV A;  5AYF A;  3I55 Q;  1RAD B;  2FVU A;  3L42 A;  4JRI A;  1VQO Q;  2OAU A;  3VS0 A;  2CH4 A;  4MML A;  2DXT A;  2VWF A;  3FB9 A;  4FYV B;  1SRM A;  5CO7 A;  2MK5 A;  2PNI A;  1NJI U;  3PVQ A;  2W10 A;  4M78 C;  2CP0 A;  3CCQ A;  3EFO B;  1D0Z A;  4PKC C;  3M0P A;  4C92 G;  3H9N A;  4FYX B;  2LQK A;  3CCR A;  2DNU A;  2V8I A;  4PJJ A;  4JLG A;  2FL7 A;  5GMK i;  4C92 D;  1QKX A;  4BI4 A;  1NJI C;  3UAT A;  2OJ2 A;  5GMK m;  1FX7 A;  1KQ2 A;  5KYY B;  2EQI A;  3SHW A;  3AHU A;  4EIK A;  4Y91 A;  3FDR A;  4QT7 A;  5A0G A;  2RK1 A;  3QJY A;  2VUB A;  1M2V B;  1K8A R;  1N8R U;  1NLO C;  3Q1J A;  1I81 A;  2XMF A;  1KQ1 A;  1TUC A;  2LCC A;  4CC7 A;  1VYT A;  5GAN j;  1M30 A;  3MCA B;  1QVF P;  2KQW A;  3QG1 A;  4D6W A;  4F7U A;  1IXD A;  3VS4 A;  5KCO A;  3FLG A; 
#chains in the Genus database with same CATH homology
 1N8R C;  4PJO D;  4ZGE B;  5FRN A;  3MEA A;  4JS5 A;  5GAN 2;  2X35 A;  3OMC A;  2XK0 A;  2LVM A;  4PLL A;  5CKB A;  3CC4 T;  4N0A A;  4ATO A;  4C8Q A;  2K5F A;  3MEV A;  5J3B A;  3OYB A;  3JCM c;  1Q82 U;  4PJO C;  4P5N A;  2VXE A;  4V2S A;  3M55 A;  5GAO q;  1VQ6 T;  4OB2 B;  1YIJ T;  5CAI A;  3QUI A;  3JB9 H;  3TU4 K;  3JCM e;  1KQS S;  4OVA A;  1M5Q 1;  2E64 A;  3JRZ A;  3MEW A;  1WQ7 A;  4A4E A;  2JTF A;  5CKF A;  3E1S A;  3OYM A;  5LJ3 g;  5DM7 R;  3G4S A;  3OW2 S;  3QSU A;  3A8H B;  1G3Y A;  3DKM A;  2XDP A;  4DA4 A;  2RI5 A;  3CCU T;  1M8V A;  4ME7 A;  2P0P A;  3V7S A;  2E12 A;  3JB9 F;  2JTM A;  2PVO B;  3OS5 A;  4RCB A;  4Q5W A;  5DLO A;  1YI2 A;  1FXX A;  3CC2 T;  3HRT A;  4M77 F;  2EJ9 A;  3FC3 A;  3CD6 T;  1ZHI A;  4KUI A;  3A8M B;  4LDU A;  1H64 1;  3S3M A;  4OGE A;  3OBY A;  4IUQ A;  2K3Y A;  4E7I A;  3CC4 A;  3V7R A;  4C92 A;  1UEB A;  4C0D C;  3JCM J;  1VQ9 A;  4HA8 A;  4M7A F;  1M1F A;  3EAE A;  1WPY A;  2R58 A;  4JRP A;  2O4X B;  1QP2 A;  2RI3 A;  3TCJ A;  3CCM T;  4BE2 A;  1VQN A;  1ZBX A;  2CS7 A;  2P0Q A;  2R5A A;  1OZ2 A;  3FEO A;  3LH0 A;  4F7U B;  4B9W A;  2A3L A;  1VQ6 A;  4A4H A;  3LYI A;  2OTJ T;  2V8J A;  4UC4 A;  5CQX A;  3EFR A;  1RI0 A;  2PVD B;  5GAN 3;  2KSS A;  3MP6 A;  1G3S A;  4BDZ A;  3OB9 A;  5GAN 5;  4C8Q G;  3L2R A;  3SB2 A;  4DOW A;  2WSC E;  4C8Q B;  3OW2 A;  5LJ5 f;  1S72 T;  3CCU A;  4N4H A;  2QEX T;  2LRQ A;  2K5I A;  3KUF A;  5IT9 E;  1UGP B;  5GAO n;  2DXB A;  3SDZ A;  4C8Q D;  3CC2 A;  1Q7Y U;  3MEU A;  3MP1 A;  2CGH A;  4C0G A;  2MF2 A;  5I2M A;  3RMQ A;  3CD6 A;  3JCM V;  4IKF A;  1D3B A;  5FU7 B;  3DLL A;  1GXI E;  4FM4 B;  4O5V A;  5CVI A;  3VUZ A;  2EAY A;  3NFC A;  4HCB A;  2DD4 A;  2V8K A;  4E7K A;  2DEQ A;  4J8O A;  2DK3 A;  3SD4 A;  2FB7 A;  3OS2 A;  3CCM A;  4E7J A;  1QVF S;  4N0A C;  2MMP A;  3URG A;  1W2B S;  3VU3 C;  4M7D E;  4C8Q C;  4A4F A;  2QQ9 A;  2QQA A;  3LX7 A;  2LX9 A;  4PLI A;  2LTO A;  5CCA A;  1X01 A;  2EFI A;  1Q7Y C;  5GMK l;  4JLI A;  2OTJ A;  2EQM A;  3UPU A;  3NTK A;  2Y4X A;  2MAM A;  3CPF A;  3CCE A;  1K8A U;  2A7Y A;  3TEE A;  5FU7 C;  4C92 B;  2D9T A;  4OB0 B;  5LJ3 f;  4BB7 A;  3L2V A;  5L8R E;  5GMK h;  3CCL T;  2EJG A;  3RKY A;  2XID A;  1B34 A;  3BFM A;  2R57 A;  2HD0 A;  4ELY C;  2BUD A;  3L1A A;  4FIB A;  2GF7 A;  2DXU A;  2EQJ A;  2ZPF B;  3VUB A;  4C5G A;  1NE8 A;  3A8L B;  3OYC A;  4L5G A;  2O01 E;  3CME T;  4X34 A;  2M1H A;  2K4Y A;  2DPP B;  3C94 A;  1QW1 A;  2RHY A;  4QQ6 A;  1K8A C;  4N4G A;  1N9R A;  4JS4 A;  2Y4Y A;  1VUB A;  3OS0 A;  3X28 B;  1VQ5 T;  3WXM B;  3BDL A;  3V8J A;  4R55 A;  2DAQ A;  1M4Z A;  3OYI A;  3CCV T;  4RMO A;  3M5A A;  1QVF A;  3RES A;  1W2B A;  1UGQ B;  2F5T X;  1BI3 A;  4OB3 B;  1VQM T;  3P8H A;  3RUX A;  5KE3 A;  2LNV A;  2RH2 A;  5I21 A;  3LLR A;  2O4X A;  1D3B B;  2KAF A;  5EG2 A;  3M4Y A;  3SWN B;  1BIB A;  3OSV A;  3QYG B;  4NS5 A;  3PTA A;  2XG8 D;  3PMT A;  1YJ9 T;  4FT4 A;  3CCL A;  1BI2 A;  2LDM A;  4M78 F;  3OYF A;  5GAN d;  3MHX A;  3T9N A;  3X24 B;  2YHT A;  4M7A G;  2OTL A;  2HNI A;  2JZ2 A;  1Y07 A;  4FU6 A;  5IAY A;  1QVG S;  4M7D A;  1VQ8 T;  3JCM Q;  2ZPE B;  2JN0 A;  1YJW T;  5LL6 S;  3CCJ T;  2QI2 A;  3HHT B;  1QP3 A;  3CME A;  2RK2 A;  4QVZ A;  1PSE A;  4KUD K;  3F70 A;  2RJF A;  4NL3 A;  3O8V A;  3PGG A;  2VV5 A;  1V29 B;  2DXC A;  2FYK A;  2VC8 A;  2WSF E;  1FWZ A;  4XTV A;  5M9O A;  3HPW A;  5GAM h;  4E7L A;  2X4J A;  5HK0 A;  3SWN C;  3OYD A;  1VQ5 A;  2DO3 A;  3J7A F;  5GAM j;  1TH7 A;  3JCM g;  1JBM A;  3CCV A;  4DQ2 A;  4M77 E;  4WF2 A;  1B34 B;  3M9Q A;  4QQD A;  4RCC A;  3V8K A;  4BI8 B;  4EMG A;  3G71 T;  1O9S A;  3LGF A;  4C0D B;  3LWH A;  3CC7 A;  1VQM A;  4Z02 A;  2ZPB B;  3PFS A;  2G3R A;  3HFN A;  3OBW A;  4B9X A;  4NL2 A;  1W4S A;  3OYH A;  3LWI A;  4M7A E;  1YJ9 A;  2YRV A;  4MZT A;  4OF1 A;  4MDX A;  3MET A;  5GAN f;  5FU6 B;  4N4I A;  2K5L A;  3RER A;  4MZP A;  1ZQ1 A;  4II1 A;  3INZ A;  2GFA A;  2E10 A;  4OB1 B;  5LJ5 d;  2X4W A;  2QQB A;  4MZM A;  5J26 A;  3HRU A;  4HT9 A;  1YIT T;  1WJQ A;  2FHD A;  5CR2 A;  3VV0 A;  1VQ8 A;  3L2Z A;  4GY5 A;  4XU2 A;  3J80 E;  4RKU E;  3CCJ A;  1QVG A;  1MHN A;  3NTI A;  5KCH A;  4LDW A;  1WQW A;  2LQ8 A;  2RO0 A;  3DB4 A;  5LJ5 h;  3CXC S;  4M75 G;  3QDR B;  3WVD B;  3KXT A;  4M75 B;  3GNF B;  4C5H A;  2K57 A;  4BE1 A;  2MWP A;  2RJC A;  3S3O A;  2F69 A;  5FU6 C;  2XKO C;  3X26 B;  2L89 A;  3CCS T;  5GAN 6;  4ZTJ A;  5DY9 A;  3GOX A;  4M75 D;  1YIJ A;  3G71 A;  1KG1 A;  5CK9 A;  4Y28 E;  1LNX A;  4M7D G;  2RJE A;  2XIC A;  3HRS A;  2EJF A;  4M7D B;  2WAC A;  4HKE A;  3JCM d;  2XDB A;  3QPH A;  1BI0 A;  4OMF B;  5HY6 A;  4FT2 A;  4PJO F;  2CZ0 B;  1JJ2 A;  1Y7X A;  4M7D D;  1XNI A;  3RMS A;  3OYA A;  4QVD A;  3JAM E;  5LJ3 d;  2QQR A;  3PIP A;  2XD0 A;  2VXF A;  3M58 A;  2CZ6 B;  3M56 A;  3OYN A;  1EIF A;  3M54 A;  5GAO m;  3OYK A;  4M75 C;  3JCM X;  1U1S A;  4CI0 C;  5KH6 A;  1PSF A;  5GMK e;  1YIT A;  1WGS A;  1NPR A;  3BY7 A;  4L59 A;  3GPL A;  3CEY A;  3C4S A;  2K3X A;  4M75 E;  3SWN A;  2LCL A;  4IUP A;  4J6Y A;  1Q86 U;  2LT4 A;  3OYJ A;  4OP0 A;  4JRK A;  4A53 A;  2IVW A;  4M7D C;  3CCQ T;  3DLM A;  2XHC A;  3JB9 I;  1VQO T;  2B8A A;  4XU1 A;  3OY9 A;  4L6V 5;  5A0L A;  1VQP T;  4HT8 A;  3QZ5 B;  3HKS A;  4M7A A;  3CXC A;  2RJD A;  3CCR T;  2M0O A;  1XTD A;  4ZN3 A;  2EQU A;  2KY9 A;  3FRN A;  3CCS A;  2KK4 A;  3DB3 A;  1K73 U;  2GQV A;  3OA6 A;  2PUO B;  3JCM f;  4PL6 A;  4VUB A;  1O75 A;  3JB9 J;  3N5B B;  3OMG A;  1M1K U;  2E6Z A;  3ZEH A;  1XOV A;  3P8B B;  1K9M U;  5C6S A;  2RD1 A;  2YLB A;  3ME9 A;  2MI6 A;  3JCM W;  1Q86 C;  1KC8 U;  4BUG A;  2DTH A;  2JNG A;  1S72 A;  4YTL A;  4FL6 A;  1DJ7 B;  1AHJ B;  3QO3 A;  3VYG A;  4EMK A;  1N9S A;  2QEX A;  1M90 U;  3QII A;  5GMK j;  3FJP A;  1UB4 A;  1MGQ A;  3JSC A;  4J7F A;  3M4G A;  2KDS A;  5D6X A;  4BDY A;  1K73 C;  1KHI A;  3SFM A;  4C0F A;  3QKJ A;  4IUV A;  4J6W A;  3NTH A;  1IRE B;  3H6Z A;  3UDC A;  2PVG B;  1NZ9 A;  2EQK A;  2RHI A;  4A4K A;  1M1K C;  1K9M C;  2DVE A;  1YHQ T;  3PMI A;  3QJ6 A;  4IUU A;  1KC8 C;  1QVP A;  4KUL A;  4R56 A;  1U1T A;  1VQP A;  4M78 E;  1LJO A;  5GAM g;  4F7U F;  2K2V A;  2XU8 A;  1JRI A;  2L5Q A;  3LW5 E;  5GAN 4;  1M90 C;  2X4X A;  5GAM e;  2CKK A;  5HKC A;  4JRQ A;  3JB9 G;  1X6O A;  3X25 B;  4BI3 A;  3WVE B;  3CBO A;  4M77 G;  3H8Z A;  4M77 B;  1U8R A;  4EMH A;  4XK8 E;  4BD3 A;  4MDW A;  4C8Q F;  5FLX E;  3BDU A;  4M75 A;  3JB9 D;  4JDS A;  3E9G A;  3R6O A;  3ZFJ A;  4XU0 A;  2ZGW A;  1YCY A;  4M77 D;  4RG2 A;  3PIO A;  1NPP A;  2PU9 B;  2LT1 A;  4M7A B;  1I5L A;  3A8G B;  5CKE A;  3QZ9 B;  2IG0 A;  5CQY A;  3QBY A;  2AHJ B;  2VGM A;  2ZPH B;  4XTX A;  4M7A D;  4QVC A;  5GAO r;  2HQE A;  4XTU A;  1P92 A;  2VYT A;  3ER0 A;  3V7C A;  3CMA T;  1G5V A;  4XTZ A;  3HP9 A;  3LGL A;  2ZPI B;  5GAN h;  2E65 A;  4PJO B;  1YHQ A;  2RI2 A;  2Y90 A;  4M77 C;  4QW2 A;  2ZZD A;  2X4Y A;  2KVQ G;  4X9D A;  4FSX A;  1HXD A;  5D6W A;  3CPW S;  4EMK B;  2E6N A;  5LJ5 e;  4A4G A;  5FRM A;  1Y96 B;  1YBY A;  1I8F A;  1YI2 T;  1KD1 U;  4M7A C;  5I2S A;  3E9F A;  4J7I A;  3HSB A;  4NOY A;  1JJ2 S;  1JB0 E;  1I4K 1;  1WJR A;  5DLQ E;  4J5Y A;  4C92 F;  4KT0 E;  4ZGD B;  1IZ6 A;  2EKO A;  4OGC A;  2RHX A;  3VYH B;  2DKG A;  4X9C A;  4E7H A;  3G6E T;  1VQ9 T;  1VQK T;  2BIV A;  3OYY A;  5GAM d;  4LD6 A;  2CZ7 B;  2MWO A;  3VKI A;  4M78 A;  1M1G A;  1OI1 A;  3M59 A;  4ZGJ B;  1VQN T;  2DTO A;  3L2U A;  4EMK C;  1VIE A;  2GFU A;  1YJW A;  1KD1 C;  2DD5 A;  2R5M A;  1BKB A;  4KBM B;  2YLC A;  3PT9 A;  2RM4 A;  2HBP A;  3CMA A;  2EWN A;  3JCM b;  4PJO E;  1KHC A;  2E70 A;  2DZ9 A;  3MP8 A;  3OS1 A;  4XTY A;  2QA4 T;  1Q81 U;  5LJ5 j;  3QXE B;  3X20 B;  2DIG A;  5HK3 A;  2NLU A;  5LJ3 e;  2ZPG B;  5GAO l;  3EFS A;  3JCM P;  2M9U A;  5GAM f;  3CPW A;  2QQS A;  2LC4 A;  4XQ3 A;  1WJS A;  1Q82 C;  2GCX A;  4EDU A;  4C0Z A;  2HAX A;  4C5I A;  5GAO p;  4LDX A;  4BY6 B;  3FIF A;  2RA2 A;  4ELZ C;  2DIQ A;  3QHS A;  3QYH B;  4A54 A;  4J83 A;  3G6E A;  3C12 A;  3M53 A;  1VQK A;  2DJZ A;  1Q81 C;  2E5Q A;  2XI9 A;  2D6F A;  4MMK A;  3V8L A;  5A2Q E;  1VQL T;  2H3J A;  3GP8 A;  3JCM h;  3TRE A;  3E19 A;  1YJN T;  1VQ7 T;  1RL2 A;  2M16 A;  4F7U G;  4M77 A;  3I55 T;  2C06 A;  2E1H A;  4BE0 A;  4PNO A;  2KMT A;  4GLK A;  5LJ3 h;  2F5K A;  1VQ4 T;  3ZBD A;  2PQW A;  3ASK A;  5J39 A;  1G3T A;  3GNG A;  3PNW C;  4QQG A;  3OYL A;  5LJ3 j;  1KQS A;  3CCE T;  2QA4 A;  4BY6 C;  2D0Q B;  2RHZ A;  3A5Z B;  2E41 A;  4TVR A;  5A0D A;  2WSE E;  4J6X A;  3RIR A;  3UWN A;  2RHU A;  2BKD N;  5CIU A;  2EYQ A;  4M78 G;  2ZCF B;  4M78 B;  1OZ3 A;  2CYZ B;  4DOV A;  5AYF A;  3C95 A;  3I56 T;  4C5E A;  3L2W A;  2FVU A;  4M78 D;  1M9S A;  3L42 A;  4JRI A;  2OAU A;  5C0M A;  4PJO A;  4MML A;  2DXT A;  4F7U E;  1HK9 A;  3UT1 A;  3FB9 A;  1VIF A;  1Y96 A;  2CZ1 B;  5D6Y A;  2VGN A;  4CRI A;  1R8O B;  5CO7 A;  4LDY A;  1VQL A;  1YJN A;  1NJI U;  1VQ7 A;  1G3W A;  2L8D A;  2XDD A;  4JJN K;  2P4T A;  4EPC A;  3I55 A;  4M78 C;  3RKW A;  4ZN1 A;  1H3Z A;  1SSF A;  4C8Q E;  3CCQ A;  1VQ4 A;  1VQO A;  4M75 F;  4PKC C;  2RB6 A;  3GF5 A;  2QXF A;  3M57 A;  5GAN g;  4C92 G;  4ZTF A;  1X75 C;  3CCR A;  2LQK A;  4HCC A;  2V8I A;  3KBG A;  3G7Z A;  2JUF A;  5GAN e;  3J81 E;  4JUV A;  4JLG A;  4XU3 A;  3MO8 A;  1N6A A;  2FL7 A;  2QTX A;  3VJP A;  5GMK i;  3OYG A;  4C92 D;  2OTL T;  4M7D F;  5GAN 8;  3HL8 A;  4BI4 A;  5CKH A;  1NJI C;  3I56 A;  2P0K A;  5IN1 A;  5GMK m;  1FX7 A;  3OQ5 A;  3S3N A;  2JVV A;  2L3R A;  3CBP A;  4IUT A;  5KE2 A;  1KQ2 A;  2PUK B;  3AHU A;  4XTW A;  4Y91 A;  3FDR A;  5A0G A;  1WNL A;  2RK1 A;  3QJY A;  2VUB A;  4O6J A;  3P8D A;  3HFO A;  4RG8 A;  3GLX A;  1XQH A;  4C92 C;  1N8R U;  5CKD A;  3OSS C;  4XAX B;  1BIA A;  5FRO A;  3Q1J A;  1I81 A;  1LOJ A;  3RKX A;  4HCZ A;  1OYX A;  2HQX A;  2I2L A;  4C92 E;  3A8O B;  4BAC A;  1UGS B;  4E47 A;  3CC7 T;  4LD9 K;  3G4S T;  1KQ1 A;  5GAN 7;  2DTI A;  2LCC A;  3L2Q A;  5LJ5 g;  3GIB A;  5GAN j;  3MCA B;  3BW1 A;  4IUR A;  4PJO G;  3CBM A;  1BI1 A;  1N27 A;  2DZC A;  2KQW A;  4LDV A;  2JOY A;  3OYE A;  3QG1 A;  4D6W A;  1BYM A;  4F7U A;  3S6W A;  1Y71 A;  1UGR B;  2EIF A;  2QDY B;  5KCO A;  3FLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...