2K40A

Nmr structure of hesx-1 homeodomain double mutant r31l/e42l
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
GRRPRTAFTQNQIEVLENVFRVNCYPGIDILEDLAQKLNLELDRIQIWFQNRRAKLKRSHRESQFLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeobox expressed in ES cells 1
publication title The role of conserved salt-bridges on homeodomain stability
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2008-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2k40A00
4XRSG 2QF7A 4MO7A 1JTXA 3LNQA 2MW8A 3WHBA 1HF0A 2IEKA 1MBKA 4AC0A 4BBSJ 1IUFA 4A3IJ 1FTTA 2MSYA 3CCYA 5K7ZA 2XB5A 2LP0A 3BR0A 1JKPC 4JX5A 2DMNA 5GPAA 2G0EA 1FIPA 1FIAA 4Y52J 1S7EA 1ZTRA 3FISA 3JRCA 4Y7NJ 2ECBA 1ETQA 1X2NA 2W48A 1W0TA 3GTGJ 4NDLA 1UHSA 2CUFA 1I50J 2LVSA 1ZK8A 1I6HJ 4IHWA 5J1YA 1LFBA 1JUSA 1ZKGA 5IYCJ 3RZDJ 2EZLA 5GPCA 4A3MJ 3S1NJ 4BBRJ 3HEFA 3JRFA 1JKQC 2JA8J 1WCMJ 1F36A 1QVTA 1IV6A 5K7HA 2JN6A 2WAQN 5IOYA 2E2JJ 5EG0B 2R93J 2L7MP 1B8IA 5EEAA 1Z0XA 3HGGA 4D5FA 3Q3SA 1NK3P 2E19A 4UUTA 1MSFC 2CQQA 4XIDA 1X2MA 5IOZA 3ZQFA 2ECCA 3GTKJ 2XPWA 2HOTA 3FK6A 1JJ6C 1SFOJ 3QPLA 2GM4A 2L9RA 5IP7J 2R5ZB 3TP0A 2Y0SN 1UG2A 3JR9A 1PUFB 1MBFA 1HDPA 1MBGA 2VKEA 5FKKA 2CJJA 1BW5A 4M6VA 1MBHA 3LSGA 2CRGA 4DYRA 3JRDA 3GTOJ 2Y30A 5E3NA 3JRHA 1IC8A 5EF6A 4AUXA 2ELKA 5GP9A 1U8BA 3ZQLA 3S16J 2AO9A 3SDGA 2E2IJ 3FK7A 3RZOJ 1VF9A 5F04A 3IH2A 3ZQHA 1MBJA 3MKLA 1ZR4A 5FLVA 1D5YA 2NVQJ 4DW6A 3Q0WA 1NTCA 1JT0A 2R5YB 1GV5A 2DA3A 3HKZN 4RDUA 2I10A 2FQ4A 1Q1VA 4G12A 2JA7J 5JLWA 2JA5J 3RQIA 5IP9J 1ETWA 4XRSA 2O7OA 2CU7A 2WB1N 3CDLA 3LSJA 5M5YJ 4EEFG 3M4OJ 4C3HJ 3UKGA 5EGOA 1GVDA 3NARA 3BG5A 5BNGA 3RKQA 1ZGWA 2EH3A 4BY1J 4MIMA 4XRMA 4GFBA 3BR6A 4XICA 2X6OA 3HBLA 4C3JJ 4HNVA 5E3MA 3TEDA 4A3JJ 2DN0A 4QIWN 5IYDJ 3G1LA 3HB9A 1GDTA 3S17J 4A3EJ 4A3LJ 1WI3A 3K2AA 3LSPA 5IYBJ 1EF4A 1CQTA 1O4XA 3IH3A 3QQAA 1YRNB 1BA5A 4I76A 3G1OA 2LKXA 1I3QJ 5C4JJ 2AHQA 3FIWA 3O8GA 2TRTA 2VPRA 2K40A 2O8KA 2D5VA 1HCRA 5IPAA 3H0GJ 3PO2J 4CYCA 2QCOA 3ZOBA 4X1EA 2H1KA 4BY7J 2FJ1A 3FKIJ 3BG3A 2VUMJ 1AKHB 5FJ8J 1JUMA 3JRBA 3M3YJ 4BKXA 2E2HJ 3S1RJ 3GTJJ 4M3BA 3HOUJ 4X6AJ 2M34A 1T33A 3BTIA 2YS9A 1DU6A 4M3DA 2DA2A 1B72B 2K9SA 1FEXA 3S2HJ 5E3LA 3CQZJ 2DA5A 3S15J 1JKRC 3I4MJ 1F43A 3CMYA 1ETKA 4A3KJ 1RKTA 1VI0A 4JX6A 1RETA 2CQXA 2LK2A 4DZJA 2XGCA 1OFCX 2HYJA 4MFDA 1WGXA 2ZB9A 2ID3A 3HM5A 2R5YA 3IV5A 1MSEC 4FE7A 1K83J 2L0KA 3SJMA 5EZGA 5C44J 9ANTA 4MFEA 2HOSA 5JLXA 2YU9J 2LY9A 1MH4A 5M3MJ 3ZQCA 1H88C 3K7AJ 2GLOA 2P81A 2KT0A 2Y31A 1H8AC 1TWGJ 4IHXA 4ABZA 3O8HA 3PM1A 3BTCA 5EYRA 4B3AA 3A01A 2EQRA 2NS7A 1RR7A 1G2HA 2OF7A 2FX0A 3JREA 1JT6A 1RESA 3Q0UA 1B8IB 5F27A 3A03A 4XK4A 3JRGA 3JRAA 4DYQA 3B6AA 2EZKA 1LE8A 2DA4A 5EZHA 2IBDA 3I4NJ 3B6CA 2EZIA 1R9TJ 2R7ZJ 3HOZJ 2HI3A 2M8GX 2JA6J 3GBGA 4DYCA 1T56A 3IH4A 5FKLA 4DZPA 1P7IA 1GUUA 3BR2A 1Y1WJ 3ZQGA 3F0CA 5FLMJ 2HDDA 3PO3J 4A3CJ 3HDDA 3JRIA 1GV2A 3BTJA 1TWHJ 5EDNA 4D5CA 2DMTA 2OPTA 4D7MA 2Y9YA 1HDDC 5IP6A 1WH7A 2H8RA 4L5EA 2HXIA 5HODA 2M2EA 2DA1A 1JKOC 3TP3A 3VPRA 2B63J 3GTQJ 4JX4A 4RBOA 1ETVA 1HOMA 2XGEA 1VFCA 5K7FA 2NVXJ 1XG1A 1LFUP 3L1PA 4M3GA 4QTRA 2L7FP 1E3OC 1ETYA 2DMUA 4C3IJ 5EG0A 2O9LA 2K9NA 1WH5A 4UUSB 2NS8A 2VKVA 4MLOA 1GT0C 4BXXJ 2KDZA 5DTDA 1FJLA 2TCTA 1B72A 3BTLA 5M5WJ 4M3FA 5F0CA 1ETOA 1Z77A 3G1MA 3H3VK 1XS9A 5EGOB 4S0HB 1IRZA 1APLC 3LSRA 3Q0VA 1XC5A 5FKOA 2R5ZA 1U78A 4JP0A 4AYBN 1NK2P 3S1QJ 1MBEA 1PUFA 1MH3A 2ME6A 2DTZA 2JK3A 2VI6A 2EBIA 2X48A 1ETXA 2HXOA 3GTPJ 5M3FJ 3S2DJ 2COBA 2HOAA 2JMWA 3HGYA 1JTYA 4IEJA 4FISA 1JJ8C 4B4CA 4D7NA 1X58A 1IGNA 1ORKA 4A3GJ 1ZQ3P 1Y1VJ 2LTPA 3OIOA 1HLVA 5F0HA 2LLKA 1MNMC 1P7JA 1RKWA 3LOCA 1QVUA 4A69C 4A3DJ 2CUEA 4M3EA 2NVTJ 4FE4A 1BW6A 1UMQA 4I6ZA 1JGGA 3HOXJ 3C2BA 2N8GA 4IHYA 1TWFJ 5FKMA 3WHCA 2M0CA 5DS9A 3BT9A 4CYCB 2YUSA 3GTLJ 1H89C 2M9HA 4JYKA 1A5JA 1IDZA 2MG4A 1QRYA 5J1RA 1RPWA 1IJWC 5F1JA 4C2MJ 4A3BJ 4B1RA 1U9NA 4FTHA 1IDYA 2LFBA 2NOGA 2RAEA 4IHVA 3BR5A 2R0QC 3OSFA 2Y9ZA 4LOCA 2PMZN 3TW6A 4FCYA 1FTZA 2JJ7A 2ME0A 1K61A 5FKNA 2MGQA 4V2FA 1A6IA 3D1NI 3HOWJ 3S14J 3BR1A 3E7LA 1IG7A 4A93J 1QPIA 1OJLA 4W1UA 3HOYJ 2XGDA 2DA7A 2DMQA 3BQZA 1DU0A 2ID6A 1ENHA 1TC3C 1ITYA 2XPUA 1BL0A 5C4XJ 1ZR2A 2DA6A 2NVYJ 4J19A 3SFIA 1W0UA 3HOVJ 2WV1A 1AU7A 2XSDC 3BQYA 3MN2A 5J1UA 2L7ZA 5J3LA 2GBYA 1BJZA 3GTMJ 1OCTC 2EZHA 1YRNA 2R92J 1JUPA 2IAIA 5E3OA 2JWTA 3DEWA 3TW7A 3BR3A 3OOUA 1VNDA 5F0FA 1OCPA 1AHDP 4UUSA 2X9DA 3BG9A 3MVPA 2XPVA 2LR8A 2DJNA 3A02A 3ZQIA 4A3FJ 2FD5A 2K9QA 3A01B 2DMPA 1U9OA 2HQ5A 3S1MJ 2XRLA 5M5XJ 1POGA 2E1OA 3DCFA 4W97A 1TWCJ 1TWAJ 4QSHA 5C3EJ 1AKHA 3NAUA 5F08A 2Y2ZA 3W6VA 1SANA 3QPSA 2LD5A 2XB0X 1LE8B 4V2GA 3OSGA 1WPKA
chains in the Genus database with same CATH superfamily
1JTXA 3ZMDA 4EQQA 1IW7F 2JRMA 2ZBKA 5CVUA 2VJ4A 1R1UA 4WX9A 3KZIC 1HW2A 1B1BA 4UHTA 3HXLA 2LBFB 1ZG1A 2MH2A 1X4PA 3A0BC 3CCYA 5K7ZA 3OYCA 4NHJA 1HXDA 2Z2SB 3P7NA 4EJVA 1KGSA 3S3NA 2G0EA 1FIPA 1MKMA 1JHHA 1VZ0A 1XGNA 2QKMB 1W7PB 4IXAA 4OWRB 3TKYA 5LRSA 3K69A 4L5JA 4BS9A 3IKTA 2W57A 2ECBA 1ETQA 3JSOA 1BR4A 1W0TA 4ITVA 2HTSA 4NDLA 3WTVC 4BYYA 2KRFA 1G3SA 2QBYA 4IHWA 5J1YA 2R4GA 2X0LA 1Y0NA 4XSXF 1JI8A 5IYCJ 1KU3A 2CMPA 3BZCA 4XLEA 2O0YA 2Y69H 4KJZA 4CUGA 2JA8J 1FOWA 5DEQA 1WCMJ 2V1NA 2JN6A 1WRJA 2R3SA 3FF5A 2YX4A 3CJNA 5FLXZ 3E6BA 2R93J 2IP2A 2LYCA 3HGGA 2XF7A 2MC3A 1NK3P 2E19A 2HZTA 3MZ8A 4XLHA 4Z6YA 4LGWA 3IRQA 5HNHA 2PQ8A 1R71A 1ZGJA 2BY3A 5FROA 4PUSA 1MMAA 4I02A 2E60A 2HOTA 3FK6A 3CMMA 3CC4I 5IP7J 1D8KA 2ZSHB 2Q2EB 3A1YA 4TV7A 1BM9A 4OOIA 2XGXA 3FXOA 1IRFA 4C9YA 4DJAA 1S7AA 3PL8A 3W2WA 4XQFA 1O3SA 1D5VA 4U0YA 2Q1ZB 4C30A 1KA8A 4DYRA 3JRDA 3N4MA 3GTOJ 4I99C 3CP2A 5E3NA 1T95A 3BROA 3FX3A 1IC8A 5EF6A 2QUFA 4AUXA 3J7ZI 2JTVA 5A2QK 2EFWA 5D4RA 2MABA 3EDPA 2ZFWA 1HW1A 3HSRA 3PFIA 3IH2A 1ZR4A 4BQOA 1CGPA 3QP6A 1ZRFA 2NVQJ 3V8KA 2JVGA 4XSZF 3LSHA 3DTKA 1GV5A 3CCVI 2FQ4A 2I10A 3I71A 1Q1VA 4G12A 1SVOA 3F72A 1JXSA 4E4HA 3KP2A 1KYZA 2OAZA 5IP9J 3OR1C 1IN8A 2O7OA 4D0PA 1UG0A 4IHSA 1WHUA 5D6EA 2L9NA 3LA7A 6PAXA 1WJBA 2MD5A 4C3HJ 3F6VA 1Z7LA 2PG4A 3QPHA 2HU9A 4DBQA 3IRRA 1R1TA 5E8IA 5CVRA 1GXPA 1QGPA 4OAYA 2R7VA 3CUQB 3W6JB 2EH3A 5HS9A 4KN4X 1PP8F 4LIUA 4RGUA 3WE2A 3HBLA 4C3JJ 3I4PA 4CCLA 3B73A 4XBFA 4A3EJ 2XVCA 4IL6C 3H5AA 4MNUA 4YEJA 1WI3A 4NC6A 3MCZA 1FSEA 2XHKA 3HL2A 3ERMA 5IYBJ 5E20A 2C6YA 4XORA 1X3UA 1O4XA 3IH3A 4BHPA 4I76A 1IN4A 1FOKA 2ZO4A 3G1OA 3LFUA 2LKXA 1XD7A 4YFNF 3K4LA 3M07A 4QWQA 4F91B 3CCEI 4YELA 1GHCA 2X85A 3L2RA 1FZPB 2W4SA 1T8IA 3GFMA 3O3KA 2QCOA 1N77A 4BY7J 1SFXA 1OMIA 4ZC3A 2DTRA 2VUMJ 4M9SA 1I39A 3M8EA 4KIGA 1WJFA 1U5TB 2QQAA 5DDGA 3EYYA 4M3BA 2P0WA 3OYBA 3HOUJ 4X6AJ 2MC4A 2ZXJA 1LVKA 3WG9A 2PX9A 3BTIA 2IA0A 2DA2A 1K78B 2K9SA 2NOJB 2FOWA 3ZQQA 3MFKA 2FOKA 1FEXA 1CF7A 5E3LA 3CQZJ 5HLIA 2DA5A 3S15J 2IS2A 4LB6B 2LKPA 3U2RA 3MWMA 1S72I 1ETKA 1VI0A 2NNNA 2LK2A 3KP5A 3R0AA 1OFCX 1D0ZA 2JZYA 5KVRA 3DPLC 4MFDA 5IT3A 2ZB9A 3DU5A 2ID3A 4G7ZF 1Y39A 3CDHA 1JE8A 4M74A 4XOPA 4M9ZA 1YW8A 3IV5A 2NXNB 3WU0A 9ANTA 2YU9J 2LY9A 3WU1B 2DDAA 2K02A 1O57A 2P81A 1BR2A 4BEHB 3CF2A 1TWGJ 1FYKA 2VJJA 3W2AA 3BTCA 5EYRA 5CVIA 3I53A 1RESA 5F27A 4PSWA 3ZGKA 2Y75A 1K7AA 3JRAA 4DYQA 2JSPA 1Y0UA 3BZKA 1MMNA 1FP1D 2KIQA 2B0LA 3BCBA 3I4NJ 2DK5A 3B6CA 2M4KA 1FOYA 4F7ZA 5D8LB 2M8GX 2JA6J 3GBGA 2GIVA 2LBFA 3ZRGA 3NWTA 3D0SA 1GUUA 1HBXG 2HDDA 2KZGA 2K85A 3BWGA 4F3QA 1FLIA 3H3ZA 2JRTA 1YYVA 2WY8Q 2MBFA 5EDNA 1Z05A 2Z16A 1W7PA 4JOMA 4AIKA 1UHMA 1W1WE 1T2KA 1LDKB 2L4MA 3ASNH 2R7RA 2BY2A 2H8RA 5J6XA 1FPQA 1ZLJA 2FXAA 3AFHA 1TQMA 2HEOA 1SEUA 4HX4A 1JKOC 4IOCF 2CV1A 2RGVA 3L2UA 5ICCA 3FHZA 3TOBA 4JX4A 2A68F 4RBOA 4DNCA 2HQNA 2VLAA 3ESWB 2V9VA 1VFCA 5J47A 3D5SC 3ECOA 2W84A 5K7FA 2NVXJ 1OR7A 3PUFA 1LFUP 5GAHJ 2KKOA 2FBKA 1ETYA 1TZLA 4Y4RA 3GUDA 2IGNA 3MKYB 2V7FA 5L3GA 4UUSB 1V5EA 2BHZA 3C3WA 1SFEA 4K2EA 3HKZA 3WODF 1ETOA 2DBBA 1R7JA 3MAJA 4B09A 3TL4X 4ZTFA 3OYDA 2FF4A 3H3VK 3QYFA 1YJNI 3DQVC 3DF8A 2ESNA 1HSJA 1U6GA 2WB1A 5FKOA 1KZHA 4Y13A 5E18F 4Q47A 4Y33A 3WG7H 1RC9A 1Y56A 2Q2EA 3HSEA 2DPUA 2MYSA 5JHFA 2EBIA 2V9PA 3K4MA 4E7KA 3KP4A 2HXOA 2HOEA 3S2DJ 2HOAA 3HGYA 4IEJA 4FISA 1JJ8C 4B4CA 1S7OA 1R5ID 1ORKA 1LUJB 3E5QA 2LTPA 4E70A 2QA4I 1RKWA 3HC7A 3K70D 4HNUA 1MMDA 2OZ6A 2OCCH 5D5XB 1O3RA 2NVTJ 3WU2C 1G3YA 4CXFA 3CC2I 2M0MA 2ZJ2A 4GDFA 1SD4A 3TDZC 4D9JA 1JGGA 1R5GA 3HOXJ 4I01A 3BJ6A 4IHYA 2GWRA 3CO6C 5IT9Z 3V8LA 2VXZA 2M0CA 3KIOA 2BGCA 2ZKZA 3BT9A 3DKXA 4RLQA 4XRFA 5HLHA 3BPVA 1HKQA 4N4OB 3GTLJ 3C18A 1ZELA 3K4NA 3S3MA 1QRYA 1X1PA 4KIBA 5FD6A 4A3BJ 3RQ4A 4FTHA 2NOGA 3ZMVA 1G3TA 2AQEA 3CCSI 2JJ7A 4ZYGA 3GYHX 3HRTA 4KITB 3FMSA 1A6IA 3CUQA 3ZR8X 4FT8A 1HC8A 2E1NA 3K0LA 3JW4A 2ACJA 3S14J 1P9QC 2WWYA 2H09A 3DTEA 1LQ1A 4W1UA 1TT0A 2OA4A 3KP3A 2WADA 1S3JA 2DMQA 2IJLA 1DU0A 2ID6A 1ITYA 4RAFA 1TC3C 5ILSA 2K86A 2IGOA 1ZR2A 1RIOH 1HA8A 2NVYJ 1W0UA 2IGMA 3KFWX 3OYIA 2VJ5A 3Q9VA 3EUKL 2XSDC 2ZMEC 1XMXA 2GBYA 2EFNA 5J3LA 2IRFG 1WJDA 2IA1A 3LL7A 4G8XA 2R92J 1JUPA 2X4HA 4NB5A 3KP7A 2WC2A 4Q4ZF 1BI1A 4II3A 1X1BA 5F0FA 3J7YJ 1IAWA 1AHDP 1NH3A 3MVPA 1Z9CA 2XPVA 2EV5A 5TRDA 2BVLA 1EH6A 1RUOA 4PCQA 4A3FJ 2FD5A 4KDPA 2HQ5A 2KRHA 3MKWB 1TTYA 4P9UA 1U8RA 4U7BA 4W97A 5J4VA 2CG4A 5F08A 2Y2ZA 3W6VA 2DJIA 3G73A 4ZYDA 3OSGA 2BV6A 3S3OA 5CYVA 1FX7A 2QEXI 1ZGAA 2MW8A 3MZYA 4EJWA 4AVZA 1QNTA 3FKJA 1EH7A 2QGUA 2IEKA 1HKSA 1K78A 1MBKA 3SHFA 4BBSJ 4F52A 3W3CA 5TGTA 1IF1A 4L18B 3H5NA 5JFRA 4OMYA 1D1AA 1YX5A 3DBLB 4EGYA 2CWEA 4IKFA 2FMYA 1SAXA 1JKPC 3VSLA 3RJPA 4UV9A 1I1SA 2HKOA 3RDIA 5E1WA 3ZN0A 2ZC2A 4Y52J 1S7EA 4Z2YA 3ML6A 2HKXA 3K4CA 3TMOA 2ZXWH 3A2KA 2LNBA 1ZTRA 3JTGA 4KMFA 4Y7NJ 4HW0A 2RC4A 3GLLA 3GTGJ 1YTYA 3BLYA 1UHSA 2CUFA 4LIVA 3CCRI 1I50J 3FHNA 3FXJA 4ASNA 2CFOA 5F6FA 3E3VA 2IPQX 3QOEA 4H4KC 1LFBA 2PMHA 3FXRA 4BEHA 5L3CA 1ZKGA 3L09A 3S1NJ 3HEFA 3JRFA 4HDUA 1JKQC 1MJBA 3I64A 1QVTA 1UZCA 1IV6A 2RQQA 2E2JJ 2DDBA 3DFGA 1ZN2A 2DYRH 2VC0A 2R7QA 2LF7A 2A61A 3T1BA 5LFAA 5J40A 3GXOA 3Q3SA 3WTZA 4AU7A 1SD6A 4AIDA 4UUTA 1VQ5I 4XIDA 5IOZA 2BOLA 3BDDA 1U2WA 3GZ6A 1G3WA 2ECCA 2L4AA 3GTKJ 2XPWA 4HX8A 1R00A 3WTSC 1W36D 2M4GA 2BBYA 2X6WA 2ZJRF 1T08B 2GZWA 2VKEA 3GZNB 2QSHX 2X51A 4GCVA 3MZHA 1BW5A 3K70C 3IC7A 3ZXSA 4GO1A 4LG3A 3RTRA 2RVCA 3ZCOA 2VASA 1ON2A 1MBHA 5E79C 3LSGA 1DPRA 3H5RA 4A5MA 2Y30A 3FMQA 3VYSB 3M8FA 4B47A 3JRHA 2VT3A 3EUAA 3LWFA 2O6GE 3OR2C 5BQTA 1OQYA 2KP6A 2AO9A 1P4AA 2LSOA 2E2IJ 1OCOH 5LHIA 3MKLA 4DGWB 2M7AA 4NQWA 5FLVA 3RSNA 2QSFX 3Q0WA 3HOTA 1NTCA 3KE2A 4I09A 2XKOA 2DA3A 2OV7A 3HKZN 4RDUA 1D1BA 4ON0A 1YE9A 2WAQA 3E5XA 3OYKA 3KP6A 2JA7J 2DYSH 3RQIA 1ETWA 4XRSA 4XKVA 1R4NB 2WB1N 3CDLA 3LSJA 3IAS2 5M5YJ 2M87A 4EEFG 4QLCU 3M4OJ 1Z1DA 4M73A 1J75A 1OYWA 3N05A 2VKDA 4HG2A 1IN7A 4XONA 3EUHA 3HHHA 1GVDA 3ELKA 2OD5A 3NARA 2M3AA 2XAFA 3OIQA 3RKQA 2QYOA 2OUMA 2A5WA 3G6EI 5J4YA 2Y0SA 2PMZA 4BY1J 4MIMA 2IXSA 4BDZA 4GFBA 2LG4A 2VE8A 4XICA 2JPCA 3DU6A 5E3MA 4BE0A 2DN0A 5IYDJ 3D5LA 5HS7A 3ZMUA 1GDTA 1XDSA 3I9V2 4WK8F 3BJAA 2HDWA 3H36A 3BCAA 2A69F 1D3YA 3K2AA 3LSPA 5TISC 2WA0A 4FQGA 3L9FA 1OYIA 1YRNB 1O3QA 2FNPA 4RMNA 1I3QJ 3CJQB 3ZPLA 5H2FC 2GXAA 3FIWA 4A0YA 4B3XA 3J81K 2M30A 3LMMA 2A6HF 2VPRA 2O8KA 1JGSA 4Y3OA 2PEXA 3SZPA 2QVOA 1WJAA 1FNNA 4BNCA 5F1RA 2FJ1A 3FKIJ 4IVNA 2O3FA 3GO5A 3C2GA 4XKWA 2CH0A 3ABUA 1AKHB 2QZ8A 3E1SA 1A35A 2ZFUA 1OKRA 5GTHC 4RGRA 4BKXA 1VQKI 3GTJJ 3R61A 3SDBA 1TQIA 1TW2A 3GCMA 4NUBA 4JK1X 2AS5F 4CCJA 1YS6A 5EEHA 2UV1A 4P5OA 3TDUC 3ZP5A 3H9JA 2FEZA 1W5CC 2L01A 4LLNA 3EPZA 3E6CC 1VQNI 2CV2A 2E5ZA 4Y17A 3K1MA 1F43A 1GXQA 4IZZA 2VQLA 4II2A 2DU9A 2HVSA 2R7TA 2XGCA 4KNYA 2QM3A 2Z3YA 2VOOA 3HUGB 3WGHA 3SZTA 2VBYA 4RB3C 1UAAA 2R5YA 1FP2A 1SMYF 3E5UA 5BS6A 3SJMA 5C44J 4N0BA 2L54A 4MFEA 2DI3A 5JLXA 1U0JA 4HQEA 1H88C 2GLOA 1B9NA 2Y31A 1H8AC 2MFZA 3L2CA 3RCOA 4WXCA 2JUCA 1VQ4I 2KZVA 1V5FA 2IT0A 2WTEA 2D1VA 2VKHA 2EFQA 1KYWA 1MZBA 2QENA 4OIPF 1FMWA 2EQRA 2NS7A 2BEOA 1RR7A 2OF7A 1DP7P 4IF4A 4BXUA 2OTJI 4XK4A 5FRNA 3B6AA 2D1HA 2LOOA 2XF5A 5DM7F 1GLNA 1X1CA 4E7LA 1W36C 2FU4A 3O6BB 5EZHA 2V26A 2IBDA 1RRJA 3QWLA 2EZIA 1R9TJ 2YU3A 5HLTA 2HDCA 3BZ6A 3HOZJ 3K1NA 4QPOA 2W82A 4P1WA 1NG7A 1T56A 3IH4A 5FKLA 4DZPA 5CKTA 3I56I 2GAUA 4D1QA 1R1VA 1WJ5A 3MQ0A 2V1XA 5FLMJ 2R7OA 3MD2A 3JRIA 4UY8I 1F1ZA 4PJ0C 1R49A 3DTIA 3DLLF 2L5QA 3L00A 1TWHJ 1K6YA 2NVUB 2DMTA 2P4WA 1REPC 1J2XA 5FB2A 5CQEA 1ULYA 4FX4A 1H9GA 1YIJI 1WH7A 1KU2A 4CCMA 1XCVA 1X4OA 2W00A 2HXIA 4BE2A 2DAOA 3VEPA 2Q0OA 2HYGD 5CLSA 3H9QA 4LMYA 1LB2A 3KEOA 3SEQA 2HVRA 4KISA 1KQ9A 3KCCA 4A0XA 2Z33A 1ETVA 2XRNA 4P9FA 3HYIA 2VODA 2RKHA 2I5UA 3CO7C 3FM5A 4M3GA 4QTRA 4AIJA 3OMYA 2KL4A 1E3OC 2L2OA 4O5VA 2K9NA 1D0YA 2ESHA 2UXXA 2NS8A 4BXXJ 1PJRA 2TCTA 4A2UA 5CVVA 3BTLA 2JSCA 2KJCA 5D4SA 3LSIA 3G1MA 4PJNA 1RR8C 3VSKA 2XAUA 4S0HB 3WTXC 2KIFA 3L2WA 1PVEA 1XC5A 4XMYA 1IV8A 4E6KG 4JP0A 1NK2P 4UB6C 1MBEA 1X19A 1MH3A 3IHUA 4PZJA 2ME6A 2E35A 2JK3A 2W25A 2VI6A 3WTUC 1GVJA 3OYGA 5M3FJ 2EB7A 3J80Z 3R4KA 1P6RA 2JMWA 3CCUI 1IN5A 2WBMA 1IGNA 3HSFA 3VODA 1ZQ3P 3OIOA 1HLVA 5FGMA 2LLKA 1MNMC 1XTAA 3I5UA 1QVUA 1X3WB 4FE4A 4ETSA 2CW0F 1BW6A 2WAEA 1BI3A 2EFOA 2FBHA 4YIIA 2MD0A 3NQOA 5IY5H 4AD9A 4BQNA 2OU2A 3BG7A 4B44A 1TWFJ 1XPXA 3I54A 1B59A 3H1CA 1XGMA 5BPIA 3PIOF 4CYCB 2I8DA 1K79A 3RKYA 1LEAA 1OLTA 2L9SA 3A4CA 4JYKA 2MG4A 1H89C 2HPMA 5J1RA 2W1OA 5F1JA 4CDGA 5AONA 5H20A 2F5FA 4ANJA 3OSFA 2PMZN 4LLLA 2W24A 2EPFA 1FTZA 1HKTA 4GXOA 2EIMH 3G2BA 3JAMK 4PK4A 2DFEA 4EJUA 1QZEA 2P5VA 3T8TA 1G59A 4MTDA 1QQIA 1QPIA 3HJEA 3HOYJ 2XGDA 3V42A 2XAJA 2DA7A 3BQZA 1EV7A 1ENHA 3HPHA 3GZ5A 4BHCA 4F55A 4BJ6C 1TBXA 1H9TA 2P8TA 4J19A 1R36A 4OIQF 4OINF 3F3XA 4BQQA 1LJ9A 1X3ZB 3SFZA 4Q48A 2ELHA 3MN2A 1YHQI 4N9HA 4CSWA 1BJZA 3AG2H 4HQMA 2EZHA 4G6QA 2JUGA 3BP8A 1YRNA 1D1CA 2K9MA 2V6EA 2JWTA 3ZMTA 2QQ8A 5E1XA 3BR3A 3FXUA 3OOUA 2R7XA 3TOAA 1SD5A 4ZZDA 4FHTA 1E3PA 3DKWA 5ERIA 4N4NB 4MHGA 4XOTA 2DJNA 4XN0A 1VQOI 4L0YB 3ZQIA 1F5TA 2DMPA 3UNGC 1RUNA 4HYEA 2XRLA 2E1OA 2WY7Q 5K5QA 1TWCJ 1AKHA 2R7DA 2A6TA 4N9IA 4NQWB 2KJBA 2QKLB 1B9MA 3PSFA 2DT5A 4WF2A 4IPAA 1KU9A 3CTAA 1LE8B 3J7AO 3M1CA 1WPKA 3SYTA 2QF7A 5HS8A 1H0MA 1UFMA 2ZMEB 1F4KA 1U5TC 4ZJZA 5F64A 2XROA 4AC0A 1DUXC 2O5RA 2H27A 4HRIA 2KRCA 1S9HA 1W5TA 4U7DA 4PDKA 1VQMI 4M6YA 2LP0A 3BR0A 2CSOA 2LMDA 3PUBA 2HPIA 1YW9A 2DMNA 2DOFA 2H8WA 3CF5F 4XM3A 5JVTA 3PIPF 3T0YA 3HUGA 3G71I 5D5VB 1MJ9A 2OZUA 3O2PE 3JRCA 1X2NA 3AG4H 3U9GA 4HBLA 5LEKA 4DIQA 2BYVE 3D5RC 2ZXHA 4J01A 3OYMA 2JQ7A 3BY6A 1EKEA 4WXHA 3AKZA 3HG9A 1R4MB 3GW2A 2E1MC 2EZLA 2EINH 3CUOA 3DPTA 3GFJA 2WV0A 5GPCA 4LG0B 1L0OC 4BBRJ 1FYLA 5D6FA 1DP3A 2ZCWA 2AXLA 4HAMA 4E7HA 5H6QA 2ZJPF 5EG0B 2RQPA 2A05A 5CQGA 1OCCH 1FBUA 4RB1A 4BL0B 1QBJA 5JR3A 5L3EA 1QPMA 3F8NA 4PGGA 4I0BA 3U21A 3VYUB 3ABLH 1T0FA 2CQQA 3K4KA 2RNJA 2VQCA 1TL8A 1YJWI 1QZYA 2A5YB 1BIAA 3K2ZA 2GM4A 2HS5A 2O03A 3CLOA 3TP0A 1UG2A 4KICA 1PUFB 1AOYA 4HOBA 1FOXA 2HVQA 2V4JC 3AG1H 3LFKA 3E0JB 3KLOA 4S04A 1HDPA 3TQNA 4AM3A 1XMKA 2DOEA 4EM0B 2ETHA 3AL0C 2K3PA 2CJJA 5J8CA 5LLQA 4M6VA 4LLGF 4MQ9F 2CRGA 4KIFA 3OS1A 5AIPA 4BDYA 4ZTJA 2QSGX 1USSA 3KYCB 1FT9A 3TO7A 1MMSA 1IXSB 2EA2A 2LKSA 3CP8A 3VWBA 2ELKA 4XLPF 2FUG2 3CLQA 1U8BA 1AA7A 1J9IA 3ZQLA 3SDGA 4LFUA 5K5RA 2P6TA 1MDMB 5GTIC 1MBJA 2HQAA 1TT5B 4EJTA 1D5YA 3RKXA 3LSTA 4RGSA 2R5YB 4HSTA 4XLAA 4CCOA 4XN3A 4HF1A 2L02A 3P5JA 1Y6IA 2JA2A 1Q1HA 3C2HA 2LY2A 2CU7A 4CO8A 4KMUX 5B3SH 2STTA 3ONQA 3OV8A 4CH7A 2QQBA 1QZZA 1LKXA 2BY1A 2Y0MA 4L9TA 1B4AA 3PSIA 3E6MA 1BIBA 2E7WA 3SQNA 5LBQA 1P2FA 4RAZA 2XV4S 4UVBA 2H94A 3FMRA 4BAYA 2KISA 4XRMA 4EV0A 3EUHC 1XGSA 2L9VA 4KA4A 3BR6A 1TNSA 3H0DA 1G8XA 3S93A 1P92A 3TEDA 4HNVA 1SVMA 4QIWN 5FFZA 3G1LA 3HB9A 1A36A 5GAGJ 1WJCA 3JCUC 2O8XA 3OL3A 4UUVA 2XF6A 4ENMA 1EF4A 2EV6A 2O61A 3I59B 5JVGF 3HTSB 2JPBA 1BA5A 3C7JA 4CYDA 1YG2A 1Z21A 2OQGA 2AHQA 3O8GA 1MJAA 3QYEA 2M7BA 3GX4X 2D5VA 1D8JA 1TLHB 1E0EA 2JVHA 3OYAA 3H0GJ 4CYCA 2P7VB 3R60A 3V7RA 3G4SI 4X1EA 2H1KA 2IS1A 1O7FA 3K4JA 3BG3A 5BMZA 3M9AA 5FJ8J 2NNYA 3F22A 1JUMA 3FXQA 4ENNA 2BVMA 2D45A 3RIRA 3JRBA 3IL2A 3M3YJ 4OAZA 3M8JA 3JSPA 1SAUA 3M7GA 4DOZA 2B7EA 3HIFA 2F2EA 3OS0A 2CW7A 4XLFA 3QP5A 4M9XA 1DU6A 2X1CA 4YIFA 3HRMA 4PFPA 4L9NA 4Y15A 3ABKH 4CCKA 4Q5SF 5A2QZ 3FBNB 1ERDA 3I4MJ 3ABMH 1YQAA 2D2WA 5E8GA 3CMYA 3V7SA 4A3KJ 1RETA 2CQXA 1BJAA 2CYYA 4DZJA 4RM3A 5CVJA 5ILVA 4OIOF 1VQ6I 1I1GA 4KFCA 2EA4A 2HYJA 4EVIA 1WGXA 4GYIA 2EIKH 5LGTA 3T5XA 1USTA 3DEEA 1R23A 3E97A 3FDYA 3I0TA 1STZA 5DCMB 2X1EA 4L9VA 2J5OA 1IUYA 3L7WA 3Q9SA 5KHDA 4BU2A 1YITI 4FE7A 1K83J 4LK0F 1FC3A 1IO2A 1MH4A 4M6XA 5M3MJ 4L0ZB 2KT0A 4CICA 2IA2A 1ZYRF 3QU3A 3RI4A 3EYIA 1J0RA 2PFBA 2ICWG 4HF0A 4L5IA 2BHYA 4LITA 3QAHA 3RPUA 3OYHA 1WKMA 1RI7A 2MA3A 4CZZA 2FX0A 3KX2A 3JREA 3JTHA 3F21A 1B8IB 1OCRH 1FBQA 3C1DA 4U0WA 4GYGA 1W7PD 1G6NA 1YOVB 2EZKA 3LSKA 4ZYEA 4G7HF 3E6DA 1T38A 1LE8A 5IT9K 3RYPA 3VB2A 1G4DA 5GADJ 1R22A 1ODDA 2ZMEA 4GGGA 1Z67A 2HNHA 3PQJA 2OBPA 2DODA 3FWEA 2HI3A 3U1DA 4DYCA 2VN2A 1BI2A 3EQLF 2QQ9A 5DYMA 1DDNA 2ZNYA 2NRAC 3VDXA 2DQRA 1Y1WJ 3ZQGA 3F0CA 4IRHA 4MTEA 2Z99A 1K4SA 3F8BA 4IRGA 1UHWA 2Y48A 2YSRA 1IRXA 3BTJA 1SMTA 2PLYA 2OPTA 4HPQA 2Y9YA 5KNLA 1HDDC 3IAM2 1ZAOA 2HYFA 2LF8A 1XN7A 4L5EA 4NBQA 3N97A 1FY7A 3LAPA 1ZHFA 2DA1A 3TP3A 2B63J 3F8FA 5BOXA 2VQHA 2MLGA 3VFZA 1S5LC 2HWVA 4UV8A 4R79A 1DGRM 2ISZA 1HOMA 1PP7U 1ZRDA 4LG0A 3GLXA 1M1EB 1XG1A 2E71A 3QODA 3GFIA 3PNTA 2DMUA 2EV0A 2BXYA 5EG0A 3KZYA 2Z5UA 1UELB 1WH5A 2YPRA 2VKVA 1TQPA 1XB4A 3FXKA 4MLOA 3GMEA 5KAIC 3S8PA 5DTDA 1GT0C 1B72A 4BJ5C 2PI0A 1WFXA 1TP4A 5M5WJ 5E1ZB 4ESBA 2DW4A 3FXMA 3QYBA 5L3DA 4NC7A 5EGOB 4B43A 1QHHD 3OYFA 5D8KB 2FE3A 4EJOA 3I55I 1APLC 3LSRA 1IRZA 4RA2A 3ERED 4RAGA 2FNAA 1U78A 3S1QJ 1PUFA 1R6RA 2VL8A 1QU3A 2LRDA 1YX3A 2GA2A 3H35A 2X48A 1BR1A 2QLZA 3H3UA 4PJLA 5K1YA 2GXBA 4I0AA 2HGCA 3GTPJ 5JI6A 2NS0A 1FSHA 4ZZLA 1JTYA 1XCBA 3EETA 4G7OF 4D7NA 1X58A 1Y1VJ 3WTWC 5F0HA 3LOCA 2CUEA 2K7LA 2OCEA 3JAMZ 5JHUA 3BG6A 2FMLA 1UMQA 1I5ZA 2FRHA 1ZG3A 4EM1A 2VOPA 1MDMA 3L2QA 2EK5A 5KAFC 4I6ZA 2EILH 4PGHA 3SZGA 2RNGA 2DXIA 3WHCA 4ZYAA 4RM2A 2VIXA 3HHGA 3V8JA 5HDGA 1E3HA 2BE5F 5HVQC 5ICEA 4WWCA 2YUSA 4R8HA 1KONA 2M9HA 1IDZA 4KT6A 2KPMA 4HF2A 1RPWA 1IJWC 4C2MJ 1A31A 3OS2A 3DKYA 3LA3A 2XASA 1NHAA 4B1RA 2LFBA 4LOCA 3QPTA 5L3BA 2MLKA 3TW6A 3K9TA 1YFHA 1K61A 5FKNA 2MGQA 2IW5A 4A6EA 1QHGA 4V2FA 3V4GA 3IKVA 5FRMA 4RB2C 1AWCA 1IG7A 3M1EA 3ISPA 2ISYA 1OJLA 1XX5A 4DBRA 1Z6RA 1W5SA 5HNFA 4CHUA 1BBYA 2KMUA 1ON1A 1BL0A 4A0ZA 1PUEE 1V3FA 1V5GA 3DV8A 1J09A 1W4MA 1T98A 3HOVJ 1OCZH 4O3MA 4ZDPA 3S2WA 2KIMA 5J1UA 3FZVA 4B48A 1XSDA 1E17A 1Z6TA 2VQGA 1OCTC 3I59A 3PNVA 1SC7A 2CUJA 4PSXA 1VTNC 2IAIA 3WTYC 3IWFA 2KIUA 3DEWA 3TW7A 2XDVA 5DV5A 1BC7C 2DCEA 1OCPA 4JBAA 1VQ7I 4IRIA 2VPLA 2E1CA 3KETA 2IS6A 2RN7A 2X9DA 1YS7A 1KU7A 3DBHB 3BG9A 5LGUA 3KPHA 5B1BH 4YG2F 3A02A 1BI0A 2VB6A 3A01B 3F9KA 1U9OA 1VQPI 5M5XJ 1POGA 3PQKA 2F5VA 3LQQA 4G9YA 3DCFA 3OYEA 5FFXA 3HTUA 2HR3A 3MMYB 4LB5A 3RPQA 1YIOA 2XSJC 3QPSA 4M72A 4PJMA 2LD5A 4DQ2A 2K9LA 2DO7A 2FBIA 5TJJA 4XRSG 5LHHA 2E5NA 4MO7A 3NEUA 3LNQA 3LQRA 4I98B 2LREA 3HPGA 3WHBA 3CMAI 1UCRA 3FBIB 1HF0A 3SEZA 1OR7C 2P6SA 4M71A 2AXTC 1IUFA 1TNTA 4CA0A 4A3IJ 1FTTA 3Q5FA 2MSYA 3RYRA 2DQLA 2XB5A 4MQVA 2L7KA 1A04A 1MD0A 3G3ZA 4JX5A 5GPAA 4HNTA 2R7WA 1C0WA 1FIAA 2B9SA 4ZDLA 1MGTA 4FX0A 1FWZA 2ADUA 4P55A 1VQLI 2A3SA 5DCMA 3FISA 2DOAA 4R1HA 1UJ8A 3WGIA 2H1LA 2GA1A 2XKPA 2LC2A 2W48A 3FM3A 3F6OA 1N78A 1PDNC 1Z3YA 1O7LA 4IJAA 1DQUA 2V9KA 4XR6A 2DK8A 2A07F 2OJED 3MEXA 2LVSA 1HSTA 1ZK8A 3I58A 3K1PA 1I6HJ 2P5LC 2VXDA 2CS3A 2F6CA 2OTLI 1JUSA 1XSVA 3RZDJ 4A3MJ 1S8NA 1F36A 5K7HA 2WAQN 5IOYA 1Y8RB 3B02A 1XMAA 1ZARA 1K6OA 4UVCA 2F4MB 3TGNA 5FD5A 2L7MP 1B8IA 5EEAA 2R7FA 3IUOA 2G9WA 3V7CA 4YIRX 1Z0XA 1Y8QB 1V54H 4D5FA 2F4IA 5DUIA 5DM6F 2MH9A 1MSFC 1N75A 2XAQA 3DEUA 1X2MA 3BC8A 3BJOA 3ZQFA 1IXCA 2EIJH 1MNEA 2PN6A 3HRUA 3RPUD 3OYNA 1JJ6C 1SFOJ 2DLLA 3QPLA 2L9RA 1L3LA 2ZXIA 1LEBA 1ONVA 2R5ZB 1Z7UA 3ASOH 2PBIA 2Y0SN 3JR9A 4FETA 2G7HA 1T0FC 2PJPA 3F8MA 1B6AA 1MBFA 3REOA 3AAFA 3WE3A 1MBGA 3KEYA 2E1MB 1IRGA 4RGXA 5FKKA 4ZDOA 1OYYA 4AYBA 1WQ2A 5FLXK 4J00A 3ABTA 2UXNA 3K10A 5ILUA 2A6EF 3HRSA 2HTJA 4MEYF 5LEJA 3CESA 4YRVA 5GP9A 3CUQC 2BZTA 1TW3A 3CCQI 3S16J 2VJIA 1LDDA 3FK7A 3RZOJ 1IXRC 1VF9A 2PJRB 5F04A 5K5OA 2CQ7A 3ZQHA 2GXGA 2Z9OA 1WZ2A 4IHTA 3H92A 2BW3B 2EFPA 3WGGA 4DW6A 3ZN1A 4X0GA 3CCJI 1JT0A 1S29A 4HEA2 2VONA 1OISA 2F5CA 4KN7X 4EATA 1P4XA 3KEQA 1HQCA 5JLWA 2COMA 2JA5J 2ZSIB 2VBZA 3KZZA 1KQ8A 3NRVA 4A5NA 4LJZF 3ROUA 3PJRA 1SD7A 3AL0B 2Z1DA 2UUZA 4AVPA 5B66C 5HDNA 1T39A 5B5EC 2K4BA 4BGDA 3PFYA 2CFXA 3UKGA 2KDOA 5EGOA 3ZQ7A 3BG5A 2E7XA 1KQ0A 1I3AA 2M5WA 2YR2A 3R0JA 4XKCA 5BNGA 1ZGWA 3U1KA 2V1UA 4ENJA 2KLOA 2V1DA 3OWTA 3X2QH 3OIPA 4AWXB 5GAEJ 4RLFA 2CUZA 2X6OA 4A3JJ 3L2VA 4WCGA 1NG6A 1WJEA 5HDKA 3S17J 1LVAA 3CCMI 2BY0A 2OC6A 4I7HA 2H6BA 4A3LJ 3GF2A 3OOPA 4LK1F 1O3TA 2CQNA 4XLCA 1SFUA 3OL4A 4MEXF 3DPUA 1CQTA 4ESFA 3QQAA 2PMUA 4NNJA 1IZ1A 3KYLA 2VC1A 2VE9A 2ELJA 1X1DA 1PYVA 3GFLA 5EJCA 5BPDA 5B1AH 4A12A 3P9KA 3TBIA 5C4JJ 3S32A 4C2UA 2TRTA 3P9IA 3TO9A 4P96A 1V4RA 2K40A 2YX7A 5ICFA 1HCRA 5IPAA 3PO2J 1BOBA 1R5HA 1MIJA 1N25A 2CQKA 1MMGA 3ZOBA 2JT1A 5AIQA 1LNWA 2RREA 3CD6I 4PJJA 3F23A 2F5DA 3FXLA 3DWLE 4U88A 2Q8KA 5LHGA 3OYLA 2DT7B 1ZREA 4BE1A 3KYDB 2W85A 2E2HJ 1E2XA 3DLAA 3S1RJ 1U3EM 3DBRB 2M34A 3WTTC 1T33A 3VOEA 4MGRA 2TDXA 4G6TB 4F93B 1MNDA 1DPUA 5LD2C 3RKWA 4UVAA 1A6QA 2YS9A 2EJRA 3ECHA 3R6SA 4M3DA 1LPQA 1B72B 3S2HJ 3MKZA 1EJ9A 1JKRC 1SVLA 3ZMSA 4ESJA 2DPDA 1RKTA 4JX6A 2F4OB 2GQQA 1MW7A 4HZFA 4XL9A 3HM5A 2UZKA 2W7NA 3GEZA 4B8XA 3COAC 1BC8C 4EMSA 1MSEC 3F8CA 2L0KA 4L9JA 5EZGA 3T8RA 2HOSA 1RNLA 2P7CB 4BHBA 2K27A 2QBYB 2VBWA 5J8FA 3ZQCA 3K7AJ 3J80K 1BN5A 3UR3C 1XDUA 4HA8A 4HV6A 4FASD 4ZYHA 3IWZA 4JQFA 4IHXA 4ABZA 1JHFA 1D0XA 3O8HA 3PM1A 3CJTB 3LSMA 4B3AA 3I3LA 3A01A 2AQFA 2EWNA 1QA6A 4HV5A 3TO6A 1ZG5A 3CMEI 1G2HA 1JT6A 1R58A 3Q0UA 4U0VA 4IX7A 2KHMA 3A03A 2V79A 3JRGA 2HZDA 4CCNA 4A6DA 1RZ4A 2DA4A 2M8EA 2BXZA 1HW5A 3KLNA 4I2OA 1YI2I 1Z3XA 2DFIA 2R7ZJ 2IVMA 2FA5A 5EEGA 1XGOA 2RV8A 2LH9A 4AIHA 4BACA 2R7UA 1P7IA 3BR2A 4A3CJ 3PO3J 3HDDA 3CDIA 5E17F 1GV2A 2M45A 3J7AY 3H9GA 3J81Z 4IQJA 3ZMZA 2XAHA 2CO5A 4D5CA 1YO5C 4D7MA 1I6XA 2H6CA 2LY1A 5IP6A 2CGPA 1VQ9I 2X6YA 4E7IA 2LDUA 4RB0A 5HODA 1LFPA 2XC7A 2M2EA 4E7SA 5FO5A 4XKBA 3VPRA 3LAJA 4H0EA 3GTQJ 3OY9A 1LDJA 5CPRB 1I27A 2M1BA 5H6RA 1YJ9I 1U5TA 3AG3H 2XGEA 2X1DA 1X1AA 3VYTB 5LGNA 3L1PA 5DD8A 5ICGA 2L7FP 4RAYA 4EGZA 4C3IJ 1J59A 2O9LA 1OPCA 4HLXA 1XSXA 5HLGA 2KDZA 1FJLA 2V6CA 4OMZA 3BPXA 1Z91A 4E7JA 4M3FA 2UWMA 5F0CA 4V19K 4YFKF 4BXFA 1Z77A 1FBSA 1XS9A 2CV0A 5DD4A 3Q0VA 1IN6A 4ZH4F 3GVAA 2F48A 2R5ZA 2DFHA 3VYRB 3DP7A 4AYBN 2HQRA 1S6LA 2VBXA 3K6GA 1YW7A 2DTZA 4E7ZA 3CJRB 1K4TA 1EA3A 1VQ8I 1ETXA 3CZ6A 4YFXF 2K3FA 2COBA 2FQ3A 1WI9A 5L3FA 4IO9F 1ACIA 1V55H 5DCFA 4OU0A 2X6XA 5HOOA 5DUKA 2DFFA 4A3GJ 2GOMA 4G94A 2P5KA 1P4WA 1FYMA 1P7JA 3DXJF 4A69C 4XNFA 2GOXB 4A3DJ 4M3EA 4OIRF 2STWA 3A0HC 2FSWA 2L3DA 2PJRA 4XLNF 4BJTA 4HSRA 3C2BA 5KCMA 2N8GA 5FKMA 1SFKA 2BW3A 4BUPA 5DS9A 2OQRA 1ZLKA 4F92B 1FMVA 4NC8A 1BOAA 4KYWA 1A5JA 1ZRCA 3NWSA 3PNYA 4HX7A 5ED4A 4EM2A 1U9NA 4WXDA 1J7KA 1IDYA 3QRFF 3CCLI 3ULQB 2RAEA 4IHVA 3BR5A 2R0QC 3BOQA 2G7UA 5LRRA 5D5WB 2Y9ZA 2J5PA 1WVRA 3P9CA 4FCYA 2ME0A 2R7SA 2IS4A 4PFOA 2E36A 1EH8A 2CW8A 2E34A 3SXYA 2XUBA 3D1NI 3OYJA 4RS8A 2KFDA 3HOWJ 4IOAF 1CF7B 3BR1A 3E7LA 4A93J 1F9NA 3GWZA 2K4JA 1WWXA 2XPUA 5C4XJ 4QPQA 4U87A 2DA6A 2VT2A 1T6SA 2NYXA 4G6DA 3SFIA 3QU6A 4GRIA 1J5YA 2HFHA 2WV1A 1AU7A 2K5CA 3K4BA 4CZCA 3BQYA 2DT6A 2L7ZA 2ZNZA 5D5UB 4BH9A 3GTMJ 2XAGA 4HDVA 3LA2A 2GIZA 5E3OA 3CC7I 3QOPA 4ENKA 1VNDA 2KQRA 4UUSA 4BQAA 5CJ9A 2XIGA 2QWWA 2LR8A 2IGKA 2ZJQF 4KT5C 4C2TA 2K9QA 4UNOA 1WSUA 3S1MJ 4KUMA 2RDPA 4O6JA 2F5EA 4IQ4A 3HOSA 4QSHA 1TWAJ 5C3EJ 3NAUA 2WAFA 4UB8C 3W2VA 4HLYA 1SANA 1YLFA 1UB9A 1QO0D 3IP4B 4CGZA 2XB0X 3HZJA 5KK1A 1ZH5A 4UXNA 2NAZA 4V2GA 4S05A 1DGWY 3W6KB 4LD5A
chains in the Genus database with same CATH topology
4XRSG 2QF7A 4MO7A 1JTXA 3LNQA 2MW8A 3WHBA 1HF0A 2IEKA 1MBKA 4AC0A 4BBSJ 1IUFA 4A3IJ 1FTTA 2MSYA 3CCYA 5K7ZA 2XB5A 2LP0A 3BR0A 1JKPC 4JX5A 2DMNA 5GPAA 2G0EA 1FIPA 1FIAA 4Y52J 1S7EA 1ZTRA 3FISA 3JRCA 4Y7NJ 2ECBA 1ETQA 1X2NA 2W48A 1W0TA 3GTGJ 4NDLA 1UHSA 2CUFA 1I50J 2LVSA 1ZK8A 1I6HJ 4IHWA 5J1YA 1LFBA 1JUSA 1ZKGA 5IYCJ 3RZDJ 2EZLA 5GPCA 4A3MJ 3S1NJ 4BBRJ 3HEFA 3JRFA 1JKQC 2JA8J 1WCMJ 1F36A 1QVTA 1IV6A 5K7HA 2JN6A 2WAQN 5IOYA 2E2JJ 5EG0B 2R93J 2L7MP 1B8IA 5EEAA 1Z0XA 3HGGA 4D5FA 3Q3SA 1NK3P 2E19A 4UUTA 1MSFC 2CQQA 4XIDA 1X2MA 5IOZA 3ZQFA 2ECCA 3GTKJ 2XPWA 2HOTA 3FK6A 1JJ6C 1SFOJ 3QPLA 2GM4A 2L9RA 5IP7J 2R5ZB 3TP0A 2Y0SN 1UG2A 3JR9A 1PUFB 1MBFA 1HDPA 1MBGA 2VKEA 5FKKA 2CJJA 1BW5A 4M6VA 1MBHA 3LSGA 2CRGA 4DYRA 3JRDA 3GTOJ 2Y30A 5E3NA 3JRHA 1IC8A 5EF6A 4AUXA 2ELKA 5GP9A 1U8BA 3ZQLA 3S16J 2AO9A 3SDGA 2E2IJ 3FK7A 3RZOJ 1VF9A 5F04A 3IH2A 3ZQHA 1MBJA 3MKLA 1ZR4A 5FLVA 1D5YA 2NVQJ 4DW6A 3Q0WA 1NTCA 1JT0A 2R5YB 1GV5A 2DA3A 3HKZN 4RDUA 2I10A 2FQ4A 1Q1VA 4G12A 2JA7J 5JLWA 2JA5J 3RQIA 5IP9J 1ETWA 4XRSA 2O7OA 2CU7A 2WB1N 3CDLA 3LSJA 5M5YJ 4EEFG 3M4OJ 4C3HJ 3UKGA 5EGOA 1GVDA 3NARA 3BG5A 5BNGA 3RKQA 1ZGWA 2EH3A 4BY1J 4MIMA 4XRMA 4GFBA 3BR6A 4XICA 2X6OA 3HBLA 4C3JJ 4HNVA 5E3MA 3TEDA 4A3JJ 2DN0A 4QIWN 5IYDJ 3G1LA 3HB9A 1GDTA 3S17J 4A3EJ 4A3LJ 1WI3A 3K2AA 3LSPA 5IYBJ 1EF4A 1CQTA 1O4XA 3IH3A 3QQAA 1YRNB 1BA5A 4I76A 3G1OA 2LKXA 1I3QJ 5C4JJ 2AHQA 3FIWA 3O8GA 2TRTA 2VPRA 2K40A 2O8KA 2D5VA 1HCRA 5IPAA 3H0GJ 3PO2J 4CYCA 2QCOA 3ZOBA 4X1EA 2H1KA 4BY7J 2FJ1A 3FKIJ 3BG3A 2VUMJ 1AKHB 5FJ8J 1JUMA 3JRBA 3M3YJ 4BKXA 2E2HJ 3S1RJ 3GTJJ 4M3BA 3HOUJ 4X6AJ 2M34A 1T33A 3BTIA 2YS9A 1DU6A 4M3DA 2DA2A 1B72B 2K9SA 1FEXA 3S2HJ 5E3LA 3CQZJ 2DA5A 3S15J 1JKRC 3I4MJ 1F43A 3CMYA 1ETKA 4A3KJ 1RKTA 1VI0A 4JX6A 1RETA 2CQXA 2LK2A 4DZJA 2XGCA 1OFCX 2HYJA 4MFDA 1WGXA 2ZB9A 2ID3A 3HM5A 2R5YA 3IV5A 1MSEC 4FE7A 1K83J 2L0KA 3SJMA 5EZGA 5C44J 9ANTA 4MFEA 2HOSA 5JLXA 2YU9J 2LY9A 1MH4A 5M3MJ 3ZQCA 1H88C 3K7AJ 2GLOA 2P81A 2KT0A 2Y31A 1H8AC 1TWGJ 4IHXA 4ABZA 3O8HA 3PM1A 3BTCA 5EYRA 4B3AA 3A01A 2EQRA 2NS7A 1RR7A 1G2HA 2OF7A 2FX0A 3JREA 1JT6A 1RESA 3Q0UA 1B8IB 5F27A 3A03A 4XK4A 3JRGA 3JRAA 4DYQA 3B6AA 2EZKA 1LE8A 2DA4A 5EZHA 2IBDA 3I4NJ 3B6CA 2EZIA 1R9TJ 2R7ZJ 3HOZJ 2HI3A 2M8GX 2JA6J 3GBGA 4DYCA 1T56A 3IH4A 5FKLA 4DZPA 1P7IA 1GUUA 3BR2A 1Y1WJ 3ZQGA 3F0CA 5FLMJ 2HDDA 3PO3J 4A3CJ 3HDDA 3JRIA 1GV2A 3BTJA 1TWHJ 5EDNA 4D5CA 2DMTA 2OPTA 4D7MA 2Y9YA 1HDDC 5IP6A 1WH7A 2H8RA 4L5EA 2HXIA 5HODA 2M2EA 2DA1A 1JKOC 3TP3A 3VPRA 2B63J 3GTQJ 4JX4A 4RBOA 1ETVA 1HOMA 2XGEA 1VFCA 5K7FA 2NVXJ 1XG1A 1LFUP 3L1PA 4M3GA 4QTRA 2L7FP 1E3OC 1ETYA 2DMUA 4C3IJ 5EG0A 2O9LA 2K9NA 1WH5A 4UUSB 2NS8A 2VKVA 4MLOA 1GT0C 4BXXJ 2KDZA 5DTDA 1FJLA 2TCTA 1B72A 3BTLA 5M5WJ 4M3FA 5F0CA 1ETOA 1Z77A 3G1MA 3H3VK 1XS9A 5EGOB 4S0HB 1IRZA 1APLC 3LSRA 3Q0VA 1XC5A 5FKOA 2R5ZA 1U78A 4JP0A 4AYBN 1NK2P 3S1QJ 1MBEA 1PUFA 1MH3A 2ME6A 2DTZA 2JK3A 2VI6A 2EBIA 2X48A 1ETXA 2HXOA 3GTPJ 5M3FJ 3S2DJ 2COBA 2HOAA 2JMWA 3HGYA 1JTYA 4IEJA 4FISA 1JJ8C 4B4CA 4D7NA 1X58A 1IGNA 1ORKA 4A3GJ 1ZQ3P 1Y1VJ 2LTPA 3OIOA 1HLVA 5F0HA 2LLKA 1MNMC 1P7JA 1RKWA 3LOCA 1QVUA 4A69C 4A3DJ 2CUEA 4M3EA 2NVTJ 4FE4A 1BW6A 1UMQA 4I6ZA 1JGGA 3HOXJ 3C2BA 2N8GA 4IHYA 1TWFJ 5FKMA 3WHCA 2M0CA 5DS9A 3BT9A 4CYCB 2YUSA 3GTLJ 1H89C 2M9HA 4JYKA 1A5JA 1IDZA 2MG4A 1QRYA 5J1RA 1RPWA 1IJWC 5F1JA 4C2MJ 4A3BJ 4B1RA 1U9NA 4FTHA 1IDYA 2LFBA 2NOGA 2RAEA 4IHVA 3BR5A 2R0QC 3OSFA 2Y9ZA 4LOCA 2PMZN 3TW6A 4FCYA 1FTZA 2JJ7A 2ME0A 1K61A 5FKNA 2MGQA 4V2FA 1A6IA 3D1NI 3HOWJ 3S14J 3BR1A 3E7LA 1IG7A 4A93J 1QPIA 1OJLA 4W1UA 3HOYJ 2XGDA 2DA7A 2DMQA 3BQZA 1DU0A 2ID6A 1ENHA 1TC3C 1ITYA 2XPUA 1BL0A 5C4XJ 1ZR2A 2DA6A 2NVYJ 4J19A 3SFIA 1W0UA 3HOVJ 2WV1A 1AU7A 2XSDC 3BQYA 3MN2A 5J1UA 2L7ZA 5J3LA 2GBYA 1BJZA 3GTMJ 1OCTC 2EZHA 1YRNA 2R92J 1JUPA 2IAIA 5E3OA 2JWTA 3DEWA 3TW7A 3BR3A 3OOUA 1VNDA 5F0FA 1OCPA 1AHDP 4UUSA 2X9DA 3BG9A 3MVPA 2XPVA 2LR8A 2DJNA 3A02A 3ZQIA 4A3FJ 2FD5A 2K9QA 3A01B 2DMPA 1U9OA 2HQ5A 3S1MJ 2XRLA 5M5XJ 1POGA 2E1OA 3DCFA 4W97A 1TWCJ 1TWAJ 4QSHA 5C3EJ 1AKHA 3NAUA 5F08A 2Y2ZA 3W6VA 1SANA 3QPSA 2LD5A 2XB0X 1LE8B 4V2GA 3OSGA 1WPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRS G;  2QF7 A;  4MO7 A;  1JTX A;  3LNQ A;  2MW8 A;  3WHB A;  1HF0 A;  2IEK A;  1MBK A;  4AC0 A;  4BBS J;  1IUF A;  4A3I J;  1FTT A;  2MSY A;  3CCY A;  5K7Z A;  2XB5 A;  2LP0 A;  3BR0 A;  1JKP C;  4JX5 A;  2DMN A;  5GPA A;  2G0E A;  1FIP A;  1FIA A;  4Y52 J;  1S7E A;  1ZTR A;  3FIS A;  3JRC A;  4Y7N J;  2ECB A;  1ETQ A;  1X2N A;  2W48 A;  1W0T A;  3GTG J;  4NDL A;  1UHS A;  2CUF A;  1I50 J;  2LVS A;  1ZK8 A;  1I6H J;  4IHW A;  5J1Y A;  1LFB A;  1JUS A;  1ZKG A;  5IYC J;  3RZD J;  2EZL A;  5GPC A;  4A3M J;  3S1N J;  4BBR J;  3HEF A;  3JRF A;  1JKQ C;  2JA8 J;  1WCM J;  1F36 A;  1QVT A;  1IV6 A;  5K7H A;  2JN6 A;  2WAQ N;  5IOY A;  2E2J J;  5EG0 B;  2R93 J;  2L7M P;  1B8I A;  5EEA A;  1Z0X A;  3HGG A;  4D5F A;  3Q3S A;  1NK3 P;  2E19 A;  4UUT A;  1MSF C;  2CQQ A;  4XID A;  1X2M A;  5IOZ A;  3ZQF A;  2ECC A;  3GTK J;  2XPW A;  2HOT A;  3FK6 A;  1JJ6 C;  1SFO J;  3QPL A;  2GM4 A;  2L9R A;  5IP7 J;  2R5Z B;  3TP0 A;  2Y0S N;  1UG2 A;  3JR9 A;  1PUF B;  1MBF A;  1HDP A;  1MBG A;  2VKE A;  5FKK A;  2CJJ A;  1BW5 A;  4M6V A;  1MBH A;  3LSG A;  2CRG A;  4DYR A;  3JRD A;  3GTO J;  2Y30 A;  5E3N A;  3JRH A;  1IC8 A;  5EF6 A;  4AUX A;  2ELK A;  5GP9 A;  1U8B A;  3ZQL A;  3S16 J;  2AO9 A;  3SDG A;  2E2I J;  3FK7 A;  3RZO J;  1VF9 A;  5F04 A;  3IH2 A;  3ZQH A;  1MBJ A;  3MKL A;  1ZR4 A;  5FLV A;  1D5Y A;  2NVQ J;  4DW6 A;  3Q0W A;  1NTC A;  1JT0 A;  2R5Y B;  1GV5 A;  2DA3 A;  3HKZ N;  4RDU A;  2I10 A;  2FQ4 A;  1Q1V A;  4G12 A;  2JA7 J;  5JLW A;  2JA5 J;  3RQI A;  5IP9 J;  1ETW A;  4XRS A;  2O7O A;  2CU7 A;  2WB1 N;  3CDL A;  3LSJ A;  5M5Y J;  4EEF G;  3M4O J;  4C3H J;  3UKG A;  5EGO A;  1GVD A;  3NAR A;  3BG5 A;  5BNG A;  3RKQ A;  1ZGW A;  2EH3 A;  4BY1 J;  4MIM A;  4XRM A;  4GFB A;  3BR6 A;  4XIC A;  2X6O A;  3HBL A;  4C3J J;  4HNV A;  5E3M A;  3TED A;  4A3J J;  2DN0 A;  4QIW N;  5IYD J;  3G1L A;  3HB9 A;  1GDT A;  3S17 J;  4A3E J;  4A3L J;  1WI3 A;  3K2A A;  3LSP A;  5IYB J;  1EF4 A;  1CQT A;  1O4X A;  3IH3 A;  3QQA A;  1YRN B;  1BA5 A;  4I76 A;  3G1O A;  2LKX A;  1I3Q J;  5C4J J;  2AHQ A;  3FIW A;  3O8G A;  2TRT A;  2VPR A;  2K40 A;  2O8K A;  2D5V A;  1HCR A;  5IPA A;  3H0G J;  3PO2 J;  4CYC A;  2QCO A;  3ZOB A;  4X1E A;  2H1K A;  4BY7 J;  2FJ1 A;  3FKI J;  3BG3 A;  2VUM J;  1AKH B;  5FJ8 J;  1JUM A;  3JRB A;  3M3Y J;  4BKX A;  2E2H J;  3S1R J;  3GTJ J;  4M3B A;  3HOU J;  4X6A J;  2M34 A;  1T33 A;  3BTI A;  2YS9 A;  1DU6 A;  4M3D A;  2DA2 A;  1B72 B;  2K9S A;  1FEX A;  3S2H J;  5E3L A;  3CQZ J;  2DA5 A;  3S15 J;  1JKR C;  3I4M J;  1F43 A;  3CMY A;  1ETK A;  4A3K J;  1RKT A;  1VI0 A;  4JX6 A;  1RET A;  2CQX A;  2LK2 A;  4DZJ A;  2XGC A;  1OFC X;  2HYJ A;  4MFD A;  1WGX A;  2ZB9 A;  2ID3 A;  3HM5 A;  2R5Y A;  3IV5 A;  1MSE C;  4FE7 A;  1K83 J;  2L0K A;  3SJM A;  5EZG A;  5C44 J;  9ANT A;  4MFE A;  2HOS A;  5JLX A;  2YU9 J;  2LY9 A;  1MH4 A;  5M3M J;  3ZQC A;  1H88 C;  3K7A J;  2GLO A;  2P81 A;  2KT0 A;  2Y31 A;  1H8A C;  1TWG J;  4IHX A;  4ABZ A;  3O8H A;  3PM1 A;  3BTC A;  5EYR A;  4B3A A;  3A01 A;  2EQR A;  2NS7 A;  1RR7 A;  1G2H A;  2OF7 A;  2FX0 A;  3JRE A;  1JT6 A;  1RES A;  3Q0U A;  1B8I B;  5F27 A;  3A03 A;  4XK4 A;  3JRG A;  3JRA A;  4DYQ A;  3B6A A;  2EZK A;  1LE8 A;  2DA4 A;  5EZH A;  2IBD A;  3I4N J;  3B6C A;  2EZI A;  1R9T J;  2R7Z J;  3HOZ J;  2HI3 A;  2M8G X;  2JA6 J;  3GBG A;  4DYC A;  1T56 A;  3IH4 A;  5FKL A;  4DZP A;  1P7I A;  1GUU A;  3BR2 A;  1Y1W J;  3ZQG A;  3F0C A;  5FLM J;  2HDD A;  3PO3 J;  4A3C J;  3HDD A;  3JRI A;  1GV2 A;  3BTJ A;  1TWH J;  5EDN A;  4D5C A;  2DMT A;  2OPT A;  4D7M A;  2Y9Y A;  1HDD C;  5IP6 A;  1WH7 A;  2H8R A;  4L5E A;  2HXI A;  5HOD A;  2M2E A;  2DA1 A;  1JKO C;  3TP3 A;  3VPR A;  2B63 J;  3GTQ J;  4JX4 A;  4RBO A;  1ETV A;  1HOM A;  2XGE A;  1VFC A;  5K7F A;  2NVX J;  1XG1 A;  1LFU P;  3L1P A;  4M3G A;  4QTR A;  2L7F P;  1E3O C;  1ETY A;  2DMU A;  4C3I J;  5EG0 A;  2O9L A;  2K9N A;  1WH5 A;  4UUS B;  2NS8 A;  2VKV A;  4MLO A;  1GT0 C;  4BXX J;  2KDZ A;  5DTD A;  1FJL A;  2TCT A;  1B72 A;  3BTL A;  5M5W J;  4M3F A;  5F0C A;  1ETO A;  1Z77 A;  3G1M A;  3H3V K;  1XS9 A;  5EGO B;  4S0H B;  1IRZ A;  1APL C;  3LSR A;  3Q0V A;  1XC5 A;  5FKO A;  2R5Z A;  1U78 A;  4JP0 A;  4AYB N;  1NK2 P;  3S1Q J;  1MBE A;  1PUF A;  1MH3 A;  2ME6 A;  2DTZ A;  2JK3 A;  2VI6 A;  2EBI A;  2X48 A;  1ETX A;  2HXO A;  3GTP J;  5M3F J;  3S2D J;  2COB A;  2HOA A;  2JMW A;  3HGY A;  1JTY A;  4IEJ A;  4FIS A;  1JJ8 C;  4B4C A;  4D7N A;  1X58 A;  1IGN A;  1ORK A;  4A3G J;  1ZQ3 P;  1Y1V J;  2LTP A;  3OIO A;  1HLV A;  5F0H A;  2LLK A;  1MNM C;  1P7J A;  1RKW A;  3LOC A;  1QVU A;  4A69 C;  4A3D J;  2CUE A;  4M3E A;  2NVT J;  4FE4 A;  1BW6 A;  1UMQ A;  4I6Z A;  1JGG A;  3HOX J;  3C2B A;  2N8G A;  4IHY A;  1TWF J;  5FKM A;  3WHC A;  2M0C A;  5DS9 A;  3BT9 A;  4CYC B;  2YUS A;  3GTL J;  1H89 C;  2M9H A;  4JYK A;  1A5J A;  1IDZ A;  2MG4 A;  1QRY A;  5J1R A;  1RPW A;  1IJW C;  5F1J A;  4C2M J;  4A3B J;  4B1R A;  1U9N A;  4FTH A;  1IDY A;  2LFB A;  2NOG A;  2RAE A;  4IHV A;  3BR5 A;  2R0Q C;  3OSF A;  2Y9Z A;  4LOC A;  2PMZ N;  3TW6 A;  4FCY A;  1FTZ A;  2JJ7 A;  2ME0 A;  1K61 A;  5FKN A;  2MGQ A;  4V2F A;  1A6I A;  3D1N I;  3HOW J;  3S14 J;  3BR1 A;  3E7L A;  1IG7 A;  4A93 J;  1QPI A;  1OJL A;  4W1U A;  3HOY J;  2XGD A;  2DA7 A;  2DMQ A;  3BQZ A;  1DU0 A;  2ID6 A;  1ENH A;  1TC3 C;  1ITY A;  2XPU A;  1BL0 A;  5C4X J;  1ZR2 A;  2DA6 A;  2NVY J;  4J19 A;  3SFI A;  1W0U A;  3HOV J;  2WV1 A;  1AU7 A;  2XSD C;  3BQY A;  3MN2 A;  5J1U A;  2L7Z A;  5J3L A;  2GBY A;  1BJZ A;  3GTM J;  1OCT C;  2EZH A;  1YRN A;  2R92 J;  1JUP A;  2IAI A;  5E3O A;  2JWT A;  3DEW A;  3TW7 A;  3BR3 A;  3OOU A;  1VND A;  5F0F A;  1OCP A;  1AHD P;  4UUS A;  2X9D A;  3BG9 A;  3MVP A;  2XPV A;  2LR8 A;  2DJN A;  3A02 A;  3ZQI A;  4A3F J;  2FD5 A;  2K9Q A;  3A01 B;  2DMP A;  1U9O A;  2HQ5 A;  3S1M J;  2XRL A;  5M5X J;  1POG A;  2E1O A;  3DCF A;  4W97 A;  1TWC J;  1TWA J;  4QSH A;  5C3E J;  1AKH A;  3NAU A;  5F08 A;  2Y2Z A;  3W6V A;  1SAN A;  3QPS A;  2LD5 A;  2XB0 X;  1LE8 B;  4V2G A;  3OSG A;  1WPK A; 
#chains in the Genus database with same CATH topology
 1JTX A;  3ZMD A;  4EQQ A;  1IW7 F;  2JRM A;  2ZBK A;  5CVU A;  2VJ4 A;  1R1U A;  4WX9 A;  3KZI C;  1HW2 A;  1B1B A;  4UHT A;  3HXL A;  2LBF B;  1ZG1 A;  2MH2 A;  1X4P A;  3A0B C;  3CCY A;  5K7Z A;  3OYC A;  4NHJ A;  1HXD A;  2Z2S B;  3P7N A;  4EJV A;  1KGS A;  3S3N A;  2G0E A;  1FIP A;  1MKM A;  1JHH A;  1VZ0 A;  1XGN A;  2QKM B;  1W7P B;  4IXA A;  4OWR B;  3TKY A;  5LRS A;  3K69 A;  4L5J A;  4BS9 A;  3IKT A;  2W57 A;  2ECB A;  1ETQ A;  3JSO A;  1BR4 A;  1W0T A;  4ITV A;  2HTS A;  4NDL A;  3WTV C;  4BYY A;  2KRF A;  1G3S A;  2QBY A;  4IHW A;  5J1Y A;  2R4G A;  2X0L A;  1Y0N A;  4XSX F;  1JI8 A;  5IYC J;  1KU3 A;  2CMP A;  3BZC A;  4XLE A;  2O0Y A;  2Y69 H;  4KJZ A;  4CUG A;  2JA8 J;  1FOW A;  5DEQ A;  1WCM J;  2V1N A;  2JN6 A;  1WRJ A;  2R3S A;  3FF5 A;  2YX4 A;  3CJN A;  5FLX Z;  3E6B A;  2R93 J;  2IP2 A;  2LYC A;  3HGG A;  2XF7 A;  2MC3 A;  1NK3 P;  2E19 A;  2HZT A;  3MZ8 A;  4XLH A;  4Z6Y A;  4LGW A;  3IRQ A;  5HNH A;  2PQ8 A;  1R71 A;  1ZGJ A;  2BY3 A;  5FRO A;  4PUS A;  1MMA A;  4I02 A;  2E60 A;  2HOT A;  3FK6 A;  3CMM A;  3CC4 I;  5IP7 J;  1D8K A;  2ZSH B;  2Q2E B;  3A1Y A;  4TV7 A;  1BM9 A;  4OOI A;  2XGX A;  3FXO A;  1IRF A;  4C9Y A;  4DJA A;  1S7A A;  3PL8 A;  3W2W A;  4XQF A;  1O3S A;  1D5V A;  4U0Y A;  2Q1Z B;  4C30 A;  1KA8 A;  4DYR A;  3JRD A;  3N4M A;  3GTO J;  4I99 C;  3CP2 A;  5E3N A;  1T95 A;  3BRO A;  3FX3 A;  1IC8 A;  5EF6 A;  2QUF A;  4AUX A;  3J7Z I;  2JTV A;  5A2Q K;  2EFW A;  5D4R A;  2MAB A;  3EDP A;  2ZFW A;  1HW1 A;  3HSR A;  3PFI A;  3IH2 A;  1ZR4 A;  4BQO A;  1CGP A;  3QP6 A;  1ZRF A;  2NVQ J;  3V8K A;  2JVG A;  4XSZ F;  3LSH A;  3DTK A;  1GV5 A;  3CCV I;  2FQ4 A;  2I10 A;  3I71 A;  1Q1V A;  4G12 A;  1SVO A;  3F72 A;  1JXS A;  4E4H A;  3KP2 A;  1KYZ A;  2OAZ A;  5IP9 J;  3OR1 C;  1IN8 A;  2O7O A;  4D0P A;  1UG0 A;  4IHS A;  1WHU A;  5D6E A;  2L9N A;  3LA7 A;  6PAX A;  1WJB A;  2MD5 A;  4C3H J;  3F6V A;  1Z7L A;  2PG4 A;  3QPH A;  2HU9 A;  4DBQ A;  3IRR A;  1R1T A;  5E8I A;  5CVR A;  1GXP A;  1QGP A;  4OAY A;  2R7V A;  3CUQ B;  3W6J B;  2EH3 A;  5HS9 A;  4KN4 X;  1PP8 F;  4LIU A;  4RGU A;  3WE2 A;  3HBL A;  4C3J J;  3I4P A;  4CCL A;  3B73 A;  4XBF A;  4A3E J;  2XVC A;  4IL6 C;  3H5A A;  4MNU A;  4YEJ A;  1WI3 A;  4NC6 A;  3MCZ A;  1FSE A;  2XHK A;  3HL2 A;  3ERM A;  5IYB J;  5E20 A;  2C6Y A;  4XOR A;  1X3U A;  1O4X A;  3IH3 A;  4BHP A;  4I76 A;  1IN4 A;  1FOK A;  2ZO4 A;  3G1O A;  3LFU A;  2LKX A;  1XD7 A;  4YFN F;  3K4L A;  3M07 A;  4QWQ A;  4F91 B;  3CCE I;  4YEL A;  1GHC A;  2X85 A;  3L2R A;  1FZP B;  2W4S A;  1T8I A;  3GFM A;  3O3K A;  2QCO A;  1N77 A;  4BY7 J;  1SFX A;  1OMI A;  4ZC3 A;  2DTR A;  2VUM J;  4M9S A;  1I39 A;  3M8E A;  4KIG A;  1WJF A;  1U5T B;  2QQA A;  5DDG A;  3EYY A;  4M3B A;  2P0W A;  3OYB A;  3HOU J;  4X6A J;  2MC4 A;  2ZXJ A;  1LVK A;  3WG9 A;  2PX9 A;  3BTI A;  2IA0 A;  2DA2 A;  1K78 B;  2K9S A;  2NOJ B;  2FOW A;  3ZQQ A;  3MFK A;  2FOK A;  1FEX A;  1CF7 A;  5E3L A;  3CQZ J;  5HLI A;  2DA5 A;  3S15 J;  2IS2 A;  4LB6 B;  2LKP A;  3U2R A;  3MWM A;  1S72 I;  1ETK A;  1VI0 A;  2NNN A;  2LK2 A;  3KP5 A;  3R0A A;  1OFC X;  1D0Z A;  2JZY A;  5KVR A;  3DPL C;  4MFD A;  5IT3 A;  2ZB9 A;  3DU5 A;  2ID3 A;  4G7Z F;  1Y39 A;  3CDH A;  1JE8 A;  4M74 A;  4XOP A;  4M9Z A;  1YW8 A;  3IV5 A;  2NXN B;  3WU0 A;  9ANT A;  2YU9 J;  2LY9 A;  3WU1 B;  2DDA A;  2K02 A;  1O57 A;  2P81 A;  1BR2 A;  4BEH B;  3CF2 A;  1TWG J;  1FYK A;  2VJJ A;  3W2A A;  3BTC A;  5EYR A;  5CVI A;  3I53 A;  1RES A;  5F27 A;  4PSW A;  3ZGK A;  2Y75 A;  1K7A A;  3JRA A;  4DYQ A;  2JSP A;  1Y0U A;  3BZK A;  1MMN A;  1FP1 D;  2KIQ A;  2B0L A;  3BCB A;  3I4N J;  2DK5 A;  3B6C A;  2M4K A;  1FOY A;  4F7Z A;  5D8L B;  2M8G X;  2JA6 J;  3GBG A;  2GIV A;  2LBF A;  3ZRG A;  3NWT A;  3D0S A;  1GUU A;  1HBX G;  2HDD A;  2KZG A;  2K85 A;  3BWG A;  4F3Q A;  1FLI A;  3H3Z A;  2JRT A;  1YYV A;  2WY8 Q;  2MBF A;  5EDN A;  1Z05 A;  2Z16 A;  1W7P A;  4JOM A;  4AIK A;  1UHM A;  1W1W E;  1T2K A;  1LDK B;  2L4M A;  3ASN H;  2R7R A;  2BY2 A;  2H8R A;  5J6X A;  1FPQ A;  1ZLJ A;  2FXA A;  3AFH A;  1TQM A;  2HEO A;  1SEU A;  4HX4 A;  1JKO C;  4IOC F;  2CV1 A;  2RGV A;  3L2U A;  5ICC A;  3FHZ A;  3TOB A;  4JX4 A;  2A68 F;  4RBO A;  4DNC A;  2HQN A;  2VLA A;  3ESW B;  2V9V A;  1VFC A;  5J47 A;  3D5S C;  3ECO A;  2W84 A;  5K7F A;  2NVX J;  1OR7 A;  3PUF A;  1LFU P;  5GAH J;  2KKO A;  2FBK A;  1ETY A;  1TZL A;  4Y4R A;  3GUD A;  2IGN A;  3MKY B;  2V7F A;  5L3G A;  4UUS B;  1V5E A;  2BHZ A;  3C3W A;  1SFE A;  4K2E A;  3HKZ A;  3WOD F;  1ETO A;  2DBB A;  1R7J A;  3MAJ A;  4B09 A;  3TL4 X;  4ZTF A;  3OYD A;  2FF4 A;  3H3V K;  3QYF A;  1YJN I;  3DQV C;  3DF8 A;  2ESN A;  1HSJ A;  1U6G A;  2WB1 A;  5FKO A;  1KZH A;  4Y13 A;  5E18 F;  4Q47 A;  4Y33 A;  3WG7 H;  1RC9 A;  1Y56 A;  2Q2E A;  3HSE A;  2DPU A;  2MYS A;  5JHF A;  2EBI A;  2V9P A;  3K4M A;  4E7K A;  3KP4 A;  2HXO A;  2HOE A;  3S2D J;  2HOA A;  3HGY A;  4IEJ A;  4FIS A;  1JJ8 C;  4B4C A;  1S7O A;  1R5I D;  1ORK A;  1LUJ B;  3E5Q A;  2LTP A;  4E70 A;  2QA4 I;  1RKW A;  3HC7 A;  3K70 D;  4HNU A;  1MMD A;  2OZ6 A;  2OCC H;  5D5X B;  1O3R A;  2NVT J;  3WU2 C;  1G3Y A;  4CXF A;  3CC2 I;  2M0M A;  2ZJ2 A;  4GDF A;  1SD4 A;  3TDZ C;  4D9J A;  1JGG A;  1R5G A;  3HOX J;  4I01 A;  3BJ6 A;  4IHY A;  2GWR A;  3CO6 C;  5IT9 Z;  3V8L A;  2VXZ A;  2M0C A;  3KIO A;  2BGC A;  2ZKZ A;  3BT9 A;  3DKX A;  4RLQ A;  4XRF A;  5HLH A;  3BPV A;  1HKQ A;  4N4O B;  3GTL J;  3C18 A;  1ZEL A;  3K4N A;  3S3M A;  1QRY A;  1X1P A;  4KIB A;  5FD6 A;  4A3B J;  3RQ4 A;  4FTH A;  2NOG A;  3ZMV A;  1G3T A;  2AQE A;  3CCS I;  2JJ7 A;  4ZYG A;  3GYH X;  3HRT A;  4KIT B;  3FMS A;  1A6I A;  3CUQ A;  3ZR8 X;  4FT8 A;  1HC8 A;  2E1N A;  3K0L A;  3JW4 A;  2ACJ A;  3S14 J;  1P9Q C;  2WWY A;  2H09 A;  3DTE A;  1LQ1 A;  4W1U A;  1TT0 A;  2OA4 A;  3KP3 A;  2WAD A;  1S3J A;  2DMQ A;  2IJL A;  1DU0 A;  2ID6 A;  1ITY A;  4RAF A;  1TC3 C;  5ILS A;  2K86 A;  2IGO A;  1ZR2 A;  1RIO H;  1HA8 A;  2NVY J;  1W0U A;  2IGM A;  3KFW X;  3OYI A;  2VJ5 A;  3Q9V A;  3EUK L;  2XSD C;  2ZME C;  1XMX A;  2GBY A;  2EFN A;  5J3L A;  2IRF G;  1WJD A;  2IA1 A;  3LL7 A;  4G8X A;  2R92 J;  1JUP A;  2X4H A;  4NB5 A;  3KP7 A;  2WC2 A;  4Q4Z F;  1BI1 A;  4II3 A;  1X1B A;  5F0F A;  3J7Y J;  1IAW A;  1AHD P;  1NH3 A;  3MVP A;  1Z9C A;  2XPV A;  2EV5 A;  5TRD A;  2BVL A;  1EH6 A;  1RUO A;  4PCQ A;  4A3F J;  2FD5 A;  4KDP A;  2HQ5 A;  2KRH A;  3MKW B;  1TTY A;  4P9U A;  1U8R A;  4U7B A;  4W97 A;  5J4V A;  2CG4 A;  5F08 A;  2Y2Z A;  3W6V A;  2DJI A;  3G73 A;  4ZYD A;  3OSG A;  2BV6 A;  3S3O A;  5CYV A;  1FX7 A;  2QEX I;  1ZGA A;  2MW8 A;  3MZY A;  4EJW A;  4AVZ A;  1QNT A;  3FKJ A;  1EH7 A;  2QGU A;  2IEK A;  1HKS A;  1K78 A;  1MBK A;  3SHF A;  4BBS J;  4F52 A;  3W3C A;  5TGT A;  1IF1 A;  4L18 B;  3H5N A;  5JFR A;  4OMY A;  1D1A A;  1YX5 A;  3DBL B;  4EGY A;  2CWE A;  4IKF A;  2FMY A;  1SAX A;  1JKP C;  3VSL A;  3RJP A;  4UV9 A;  1I1S A;  2HKO A;  3RDI A;  5E1W A;  3ZN0 A;  2ZC2 A;  4Y52 J;  1S7E A;  4Z2Y A;  3ML6 A;  2HKX A;  3K4C A;  3TMO A;  2ZXW H;  3A2K A;  2LNB A;  1ZTR A;  3JTG A;  4KMF A;  4Y7N J;  4HW0 A;  2RC4 A;  3GLL A;  3GTG J;  1YTY A;  3BLY A;  1UHS A;  2CUF A;  4LIV A;  3CCR I;  1I50 J;  3FHN A;  3FXJ A;  4ASN A;  2CFO A;  5F6F A;  3E3V A;  2IPQ X;  3QOE A;  4H4K C;  1LFB A;  2PMH A;  3FXR A;  4BEH A;  5L3C A;  1ZKG A;  3L09 A;  3S1N J;  3HEF A;  3JRF A;  4HDU A;  1JKQ C;  1MJB A;  3I64 A;  1QVT A;  1UZC A;  1IV6 A;  2RQQ A;  2E2J J;  2DDB A;  3DFG A;  1ZN2 A;  2DYR H;  2VC0 A;  2R7Q A;  2LF7 A;  2A61 A;  3T1B A;  5LFA A;  5J40 A;  3GXO A;  3Q3S A;  3WTZ A;  4AU7 A;  1SD6 A;  4AID A;  4UUT A;  1VQ5 I;  4XID A;  5IOZ A;  2BOL A;  3BDD A;  1U2W A;  3GZ6 A;  1G3W A;  2ECC A;  2L4A A;  3GTK J;  2XPW A;  4HX8 A;  1R00 A;  3WTS C;  1W36 D;  2M4G A;  2BBY A;  2X6W A;  2ZJR F;  1T08 B;  2GZW A;  2VKE A;  3GZN B;  2QSH X;  2X51 A;  4GCV A;  3MZH A;  1BW5 A;  3K70 C;  3IC7 A;  3ZXS A;  4GO1 A;  4LG3 A;  3RTR A;  2RVC A;  3ZCO A;  2VAS A;  1ON2 A;  1MBH A;  5E79 C;  3LSG A;  1DPR A;  3H5R A;  4A5M A;  2Y30 A;  3FMQ A;  3VYS B;  3M8F A;  4B47 A;  3JRH A;  2VT3 A;  3EUA A;  3LWF A;  2O6G E;  3OR2 C;  5BQT A;  1OQY A;  2KP6 A;  2AO9 A;  1P4A A;  2LSO A;  2E2I J;  1OCO H;  5LHI A;  3MKL A;  4DGW B;  2M7A A;  4NQW A;  5FLV A;  3RSN A;  2QSF X;  3Q0W A;  3HOT A;  1NTC A;  3KE2 A;  4I09 A;  2XKO A;  2DA3 A;  2OV7 A;  3HKZ N;  4RDU A;  1D1B A;  4ON0 A;  1YE9 A;  2WAQ A;  3E5X A;  3OYK A;  3KP6 A;  2JA7 J;  2DYS H;  3RQI A;  1ETW A;  4XRS A;  4XKV A;  1R4N B;  2WB1 N;  3CDL A;  3LSJ A;  3IAS 2;  5M5Y J;  2M87 A;  4EEF G;  4QLC U;  3M4O J;  1Z1D A;  4M73 A;  1J75 A;  1OYW A;  3N05 A;  2VKD A;  4HG2 A;  1IN7 A;  4XON A;  3EUH A;  3HHH A;  1GVD A;  3ELK A;  2OD5 A;  3NAR A;  2M3A A;  2XAF A;  3OIQ A;  3RKQ A;  2QYO A;  2OUM A;  2A5W A;  3G6E I;  5J4Y A;  2Y0S A;  2PMZ A;  4BY1 J;  4MIM A;  2IXS A;  4BDZ A;  4GFB A;  2LG4 A;  2VE8 A;  4XIC A;  2JPC A;  3DU6 A;  5E3M A;  4BE0 A;  2DN0 A;  5IYD J;  3D5L A;  5HS7 A;  3ZMU A;  1GDT A;  1XDS A;  3I9V 2;  4WK8 F;  3BJA A;  2HDW A;  3H36 A;  3BCA A;  2A69 F;  1D3Y A;  3K2A A;  3LSP A;  5TIS C;  2WA0 A;  4FQG A;  3L9F A;  1OYI A;  1YRN B;  1O3Q A;  2FNP A;  4RMN A;  1I3Q J;  3CJQ B;  3ZPL A;  5H2F C;  2GXA A;  3FIW A;  4A0Y A;  4B3X A;  3J81 K;  2M30 A;  3LMM A;  2A6H F;  2VPR A;  2O8K A;  1JGS A;  4Y3O A;  2PEX A;  3SZP A;  2QVO A;  1WJA A;  1FNN A;  4BNC A;  5F1R A;  2FJ1 A;  3FKI J;  4IVN A;  2O3F A;  3GO5 A;  3C2G A;  4XKW A;  2CH0 A;  3ABU A;  1AKH B;  2QZ8 A;  3E1S A;  1A35 A;  2ZFU A;  1OKR A;  5GTH C;  4RGR A;  4BKX A;  1VQK I;  3GTJ J;  3R61 A;  3SDB A;  1TQI A;  1TW2 A;  3GCM A;  4NUB A;  4JK1 X;  2AS5 F;  4CCJ A;  1YS6 A;  5EEH A;  2UV1 A;  4P5O A;  3TDU C;  3ZP5 A;  3H9J A;  2FEZ A;  1W5C C;  2L01 A;  4LLN A;  3EPZ A;  3E6C C;  1VQN I;  2CV2 A;  2E5Z A;  4Y17 A;  3K1M A;  1F43 A;  1GXQ A;  4IZZ A;  2VQL A;  4II2 A;  2DU9 A;  2HVS A;  2R7T A;  2XGC A;  4KNY A;  2QM3 A;  2Z3Y A;  2VOO A;  3HUG B;  3WGH A;  3SZT A;  2VBY A;  4RB3 C;  1UAA A;  2R5Y A;  1FP2 A;  1SMY F;  3E5U A;  5BS6 A;  3SJM A;  5C44 J;  4N0B A;  2L54 A;  4MFE A;  2DI3 A;  5JLX A;  1U0J A;  4HQE A;  1H88 C;  2GLO A;  1B9N A;  2Y31 A;  1H8A C;  2MFZ A;  3L2C A;  3RCO A;  4WXC A;  2JUC A;  1VQ4 I;  2KZV A;  1V5F A;  2IT0 A;  2WTE A;  2D1V A;  2VKH A;  2EFQ A;  1KYW A;  1MZB A;  2QEN A;  4OIP F;  1FMW A;  2EQR A;  2NS7 A;  2BEO A;  1RR7 A;  2OF7 A;  1DP7 P;  4IF4 A;  4BXU A;  2OTJ I;  4XK4 A;  5FRN A;  3B6A A;  2D1H A;  2LOO A;  2XF5 A;  5DM7 F;  1GLN A;  1X1C A;  4E7L A;  1W36 C;  2FU4 A;  3O6B B;  5EZH A;  2V26 A;  2IBD A;  1RRJ A;  3QWL A;  2EZI A;  1R9T J;  2YU3 A;  5HLT A;  2HDC A;  3BZ6 A;  3HOZ J;  3K1N A;  4QPO A;  2W82 A;  4P1W A;  1NG7 A;  1T56 A;  3IH4 A;  5FKL A;  4DZP A;  5CKT A;  3I56 I;  2GAU A;  4D1Q A;  1R1V A;  1WJ5 A;  3MQ0 A;  2V1X A;  5FLM J;  2R7O A;  3MD2 A;  3JRI A;  4UY8 I;  1F1Z A;  4PJ0 C;  1R49 A;  3DTI A;  3DLL F;  2L5Q A;  3L00 A;  1TWH J;  1K6Y A;  2NVU B;  2DMT A;  2P4W A;  1REP C;  1J2X A;  5FB2 A;  5CQE A;  1ULY A;  4FX4 A;  1H9G A;  1YIJ I;  1WH7 A;  1KU2 A;  4CCM A;  1XCV A;  1X4O A;  2W00 A;  2HXI A;  4BE2 A;  2DAO A;  3VEP A;  2Q0O A;  2HYG D;  5CLS A;  3H9Q A;  4LMY A;  1LB2 A;  3KEO A;  3SEQ A;  2HVR A;  4KIS A;  1KQ9 A;  3KCC A;  4A0X A;  2Z33 A;  1ETV A;  2XRN A;  4P9F A;  3HYI A;  2VOD A;  2RKH A;  2I5U A;  3CO7 C;  3FM5 A;  4M3G A;  4QTR A;  4AIJ A;  3OMY A;  2KL4 A;  1E3O C;  2L2O A;  4O5V A;  2K9N A;  1D0Y A;  2ESH A;  2UXX A;  2NS8 A;  4BXX J;  1PJR A;  2TCT A;  4A2U A;  5CVV A;  3BTL A;  2JSC A;  2KJC A;  5D4S A;  3LSI A;  3G1M A;  4PJN A;  1RR8 C;  3VSK A;  2XAU A;  4S0H B;  3WTX C;  2KIF A;  3L2W A;  1PVE A;  1XC5 A;  4XMY A;  1IV8 A;  4E6K G;  4JP0 A;  1NK2 P;  4UB6 C;  1MBE A;  1X19 A;  1MH3 A;  3IHU A;  4PZJ A;  2ME6 A;  2E35 A;  2JK3 A;  2W25 A;  2VI6 A;  3WTU C;  1GVJ A;  3OYG A;  5M3F J;  2EB7 A;  3J80 Z;  3R4K A;  1P6R A;  2JMW A;  3CCU I;  1IN5 A;  2WBM A;  1IGN A;  3HSF A;  3VOD A;  1ZQ3 P;  3OIO A;  1HLV A;  5FGM A;  2LLK A;  1MNM C;  1XTA A;  3I5U A;  1QVU A;  1X3W B;  4FE4 A;  4ETS A;  2CW0 F;  1BW6 A;  2WAE A;  1BI3 A;  2EFO A;  2FBH A;  4YII A;  2MD0 A;  3NQO A;  5IY5 H;  4AD9 A;  4BQN A;  2OU2 A;  3BG7 A;  4B44 A;  1TWF J;  1XPX A;  3I54 A;  1B59 A;  3H1C A;  1XGM A;  5BPI A;  3PIO F;  4CYC B;  2I8D A;  1K79 A;  3RKY A;  1LEA A;  1OLT A;  2L9S A;  3A4C A;  4JYK A;  2MG4 A;  1H89 C;  2HPM A;  5J1R A;  2W1O A;  5F1J A;  4CDG A;  5AON A;  5H20 A;  2F5F A;  4ANJ A;  3OSF A;  2PMZ N;  4LLL A;  2W24 A;  2EPF A;  1FTZ A;  1HKT A;  4GXO A;  2EIM H;  3G2B A;  3JAM K;  4PK4 A;  2DFE A;  4EJU A;  1QZE A;  2P5V A;  3T8T A;  1G59 A;  4MTD A;  1QQI A;  1QPI A;  3HJE A;  3HOY J;  2XGD A;  3V42 A;  2XAJ A;  2DA7 A;  3BQZ A;  1EV7 A;  1ENH A;  3HPH A;  3GZ5 A;  4BHC A;  4F55 A;  4BJ6 C;  1TBX A;  1H9T A;  2P8T A;  4J19 A;  1R36 A;  4OIQ F;  4OIN F;  3F3X A;  4BQQ A;  1LJ9 A;  1X3Z B;  3SFZ A;  4Q48 A;  2ELH A;  3MN2 A;  1YHQ I;  4N9H A;  4CSW A;  1BJZ A;  3AG2 H;  4HQM A;  2EZH A;  4G6Q A;  2JUG A;  3BP8 A;  1YRN A;  1D1C A;  2K9M A;  2V6E A;  2JWT A;  3ZMT A;  2QQ8 A;  5E1X A;  3BR3 A;  3FXU A;  3OOU A;  2R7X A;  3TOA A;  1SD5 A;  4ZZD A;  4FHT A;  1E3P A;  3DKW A;  5ERI A;  4N4N B;  4MHG A;  4XOT A;  2DJN A;  4XN0 A;  1VQO I;  4L0Y B;  3ZQI A;  1F5T A;  2DMP A;  3UNG C;  1RUN A;  4HYE A;  2XRL A;  2E1O A;  2WY7 Q;  5K5Q A;  1TWC J;  1AKH A;  2R7D A;  2A6T A;  4N9I A;  4NQW B;  2KJB A;  2QKL B;  1B9M A;  3PSF A;  2DT5 A;  4WF2 A;  4IPA A;  1KU9 A;  3CTA A;  1LE8 B;  3J7A O;  3M1C A;  1WPK A;  3SYT A;  2QF7 A;  5HS8 A;  1H0M A;  1UFM A;  2ZME B;  1F4K A;  1U5T C;  4ZJZ A;  5F64 A;  2XRO A;  4AC0 A;  1DUX C;  2O5R A;  2H27 A;  4HRI A;  2KRC A;  1S9H A;  1W5T A;  4U7D A;  4PDK A;  1VQM I;  4M6Y A;  2LP0 A;  3BR0 A;  2CSO A;  2LMD A;  3PUB A;  2HPI A;  1YW9 A;  2DMN A;  2DOF A;  2H8W A;  3CF5 F;  4XM3 A;  5JVT A;  3PIP F;  3T0Y A;  3HUG A;  3G71 I;  5D5V B;  1MJ9 A;  2OZU A;  3O2P E;  3JRC A;  1X2N A;  3AG4 H;  3U9G A;  4HBL A;  5LEK A;  4DIQ A;  2BYV E;  3D5R C;  2ZXH A;  4J01 A;  3OYM A;  2JQ7 A;  3BY6 A;  1EKE A;  4WXH A;  3AKZ A;  3HG9 A;  1R4M B;  3GW2 A;  2E1M C;  2EZL A;  2EIN H;  3CUO A;  3DPT A;  3GFJ A;  2WV0 A;  5GPC A;  4LG0 B;  1L0O C;  4BBR J;  1FYL A;  5D6F A;  1DP3 A;  2ZCW A;  2AXL A;  4HAM A;  4E7H A;  5H6Q A;  2ZJP F;  5EG0 B;  2RQP A;  2A05 A;  5CQG A;  1OCC H;  1FBU A;  4RB1 A;  4BL0 B;  1QBJ A;  5JR3 A;  5L3E A;  1QPM A;  3F8N A;  4PGG A;  4I0B A;  3U21 A;  3VYU B;  3ABL H;  1T0F A;  2CQQ A;  3K4K A;  2RNJ A;  2VQC A;  1TL8 A;  1YJW I;  1QZY A;  2A5Y B;  1BIA A;  3K2Z A;  2GM4 A;  2HS5 A;  2O03 A;  3CLO A;  3TP0 A;  1UG2 A;  4KIC A;  1PUF B;  1AOY A;  4HOB A;  1FOX A;  2HVQ A;  2V4J C;  3AG1 H;  3LFK A;  3E0J B;  3KLO A;  4S04 A;  1HDP A;  3TQN A;  4AM3 A;  1XMK A;  2DOE A;  4EM0 B;  2ETH A;  3AL0 C;  2K3P A;  2CJJ A;  5J8C A;  5LLQ A;  4M6V A;  4LLG F;  4MQ9 F;  2CRG A;  4KIF A;  3OS1 A;  5AIP A;  4BDY A;  4ZTJ A;  2QSG X;  1USS A;  3KYC B;  1FT9 A;  3TO7 A;  1MMS A;  1IXS B;  2EA2 A;  2LKS A;  3CP8 A;  3VWB A;  2ELK A;  4XLP F;  2FUG 2;  3CLQ A;  1U8B A;  1AA7 A;  1J9I A;  3ZQL A;  3SDG A;  4LFU A;  5K5R A;  2P6T A;  1MDM B;  5GTI C;  1MBJ A;  2HQA A;  1TT5 B;  4EJT A;  1D5Y A;  3RKX A;  3LST A;  4RGS A;  2R5Y B;  4HST A;  4XLA A;  4CCO A;  4XN3 A;  4HF1 A;  2L02 A;  3P5J A;  1Y6I A;  2JA2 A;  1Q1H A;  3C2H A;  2LY2 A;  2CU7 A;  4CO8 A;  4KMU X;  5B3S H;  2STT A;  3ONQ A;  3OV8 A;  4CH7 A;  2QQB A;  1QZZ A;  1LKX A;  2BY1 A;  2Y0M A;  4L9T A;  1B4A A;  3PSI A;  3E6M A;  1BIB A;  2E7W A;  3SQN A;  5LBQ A;  1P2F A;  4RAZ A;  2XV4 S;  4UVB A;  2H94 A;  3FMR A;  4BAY A;  2KIS A;  4XRM A;  4EV0 A;  3EUH C;  1XGS A;  2L9V A;  4KA4 A;  3BR6 A;  1TNS A;  3H0D A;  1G8X A;  3S93 A;  1P92 A;  3TED A;  4HNV A;  1SVM A;  4QIW N;  5FFZ A;  3G1L A;  3HB9 A;  1A36 A;  5GAG J;  1WJC A;  3JCU C;  2O8X A;  3OL3 A;  4UUV A;  2XF6 A;  4ENM A;  1EF4 A;  2EV6 A;  2O61 A;  3I59 B;  5JVG F;  3HTS B;  2JPB A;  1BA5 A;  3C7J A;  4CYD A;  1YG2 A;  1Z21 A;  2OQG A;  2AHQ A;  3O8G A;  1MJA A;  3QYE A;  2M7B A;  3GX4 X;  2D5V A;  1D8J A;  1TLH B;  1E0E A;  2JVH A;  3OYA A;  3H0G J;  4CYC A;  2P7V B;  3R60 A;  3V7R A;  3G4S I;  4X1E A;  2H1K A;  2IS1 A;  1O7F A;  3K4J A;  3BG3 A;  5BMZ A;  3M9A A;  5FJ8 J;  2NNY A;  3F22 A;  1JUM A;  3FXQ A;  4ENN A;  2BVM A;  2D45 A;  3RIR A;  3JRB A;  3IL2 A;  3M3Y J;  4OAZ A;  3M8J A;  3JSP A;  1SAU A;  3M7G A;  4DOZ A;  2B7E A;  3HIF A;  2F2E A;  3OS0 A;  2CW7 A;  4XLF A;  3QP5 A;  4M9X A;  1DU6 A;  2X1C A;  4YIF A;  3HRM A;  4PFP A;  4L9N A;  4Y15 A;  3ABK H;  4CCK A;  4Q5S F;  5A2Q Z;  3FBN B;  1ERD A;  3I4M J;  3ABM H;  1YQA A;  2D2W A;  5E8G A;  3CMY A;  3V7S A;  4A3K J;  1RET A;  2CQX A;  1BJA A;  2CYY A;  4DZJ A;  4RM3 A;  5CVJ A;  5ILV A;  4OIO F;  1VQ6 I;  1I1G A;  4KFC A;  2EA4 A;  2HYJ A;  4EVI A;  1WGX A;  4GYI A;  2EIK H;  5LGT A;  3T5X A;  1UST A;  3DEE A;  1R23 A;  3E97 A;  3FDY A;  3I0T A;  1STZ A;  5DCM B;  2X1E A;  4L9V A;  2J5O A;  1IUY A;  3L7W A;  3Q9S A;  5KHD A;  4BU2 A;  1YIT I;  4FE7 A;  1K83 J;  4LK0 F;  1FC3 A;  1IO2 A;  1MH4 A;  4M6X A;  5M3M J;  4L0Z B;  2KT0 A;  4CIC A;  2IA2 A;  1ZYR F;  3QU3 A;  3RI4 A;  3EYI A;  1J0R A;  2PFB A;  2ICW G;  4HF0 A;  4L5I A;  2BHY A;  4LIT A;  3QAH A;  3RPU A;  3OYH A;  1WKM A;  1RI7 A;  2MA3 A;  4CZZ A;  2FX0 A;  3KX2 A;  3JRE A;  3JTH A;  3F21 A;  1B8I B;  1OCR H;  1FBQ A;  3C1D A;  4U0W A;  4GYG A;  1W7P D;  1G6N A;  1YOV B;  2EZK A;  3LSK A;  4ZYE A;  4G7H F;  3E6D A;  1T38 A;  1LE8 A;  5IT9 K;  3RYP A;  3VB2 A;  1G4D A;  5GAD J;  1R22 A;  1ODD A;  2ZME A;  4GGG A;  1Z67 A;  2HNH A;  3PQJ A;  2OBP A;  2DOD A;  3FWE A;  2HI3 A;  3U1D A;  4DYC A;  2VN2 A;  1BI2 A;  3EQL F;  2QQ9 A;  5DYM A;  1DDN A;  2ZNY A;  2NRA C;  3VDX A;  2DQR A;  1Y1W J;  3ZQG A;  3F0C A;  4IRH A;  4MTE A;  2Z99 A;  1K4S A;  3F8B A;  4IRG A;  1UHW A;  2Y48 A;  2YSR A;  1IRX A;  3BTJ A;  1SMT A;  2PLY A;  2OPT A;  4HPQ A;  2Y9Y A;  5KNL A;  1HDD C;  3IAM 2;  1ZAO A;  2HYF A;  2LF8 A;  1XN7 A;  4L5E A;  4NBQ A;  3N97 A;  1FY7 A;  3LAP A;  1ZHF A;  2DA1 A;  3TP3 A;  2B63 J;  3F8F A;  5BOX A;  2VQH A;  2MLG A;  3VFZ A;  1S5L C;  2HWV A;  4UV8 A;  4R79 A;  1DGR M;  2ISZ A;  1HOM A;  1PP7 U;  1ZRD A;  4LG0 A;  3GLX A;  1M1E B;  1XG1 A;  2E71 A;  3QOD A;  3GFI A;  3PNT A;  2DMU A;  2EV0 A;  2BXY A;  5EG0 A;  3KZY A;  2Z5U A;  1UEL B;  1WH5 A;  2YPR A;  2VKV A;  1TQP A;  1XB4 A;  3FXK A;  4MLO A;  3GME A;  5KAI C;  3S8P A;  5DTD A;  1GT0 C;  1B72 A;  4BJ5 C;  2PI0 A;  1WFX A;  1TP4 A;  5M5W J;  5E1Z B;  4ESB A;  2DW4 A;  3FXM A;  3QYB A;  5L3D A;  4NC7 A;  5EGO B;  4B43 A;  1QHH D;  3OYF A;  5D8K B;  2FE3 A;  4EJO A;  3I55 I;  1APL C;  3LSR A;  1IRZ A;  4RA2 A;  3ERE D;  4RAG A;  2FNA A;  1U78 A;  3S1Q J;  1PUF A;  1R6R A;  2VL8 A;  1QU3 A;  2LRD A;  1YX3 A;  2GA2 A;  3H35 A;  2X48 A;  1BR1 A;  2QLZ A;  3H3U A;  4PJL A;  5K1Y A;  2GXB A;  4I0A A;  2HGC A;  3GTP J;  5JI6 A;  2NS0 A;  1FSH A;  4ZZL A;  1JTY A;  1XCB A;  3EET A;  4G7O F;  4D7N A;  1X58 A;  1Y1V J;  3WTW C;  5F0H A;  3LOC A;  2CUE A;  2K7L A;  2OCE A;  3JAM Z;  5JHU A;  3BG6 A;  2FML A;  1UMQ A;  1I5Z A;  2FRH A;  1ZG3 A;  4EM1 A;  2VOP A;  1MDM A;  3L2Q A;  2EK5 A;  5KAF C;  4I6Z A;  2EIL H;  4PGH A;  3SZG A;  2RNG A;  2DXI A;  3WHC A;  4ZYA A;  4RM2 A;  2VIX A;  3HHG A;  3V8J A;  5HDG A;  1E3H A;  2BE5 F;  5HVQ C;  5ICE A;  4WWC A;  2YUS A;  4R8H A;  1KON A;  2M9H A;  1IDZ A;  4KT6 A;  2KPM A;  4HF2 A;  1RPW A;  1IJW C;  4C2M J;  1A31 A;  3OS2 A;  3DKY A;  3LA3 A;  2XAS A;  1NHA A;  4B1R A;  2LFB A;  4LOC A;  3QPT A;  5L3B A;  2MLK A;  3TW6 A;  3K9T A;  1YFH A;  1K61 A;  5FKN A;  2MGQ A;  2IW5 A;  4A6E A;  1QHG A;  4V2F A;  3V4G A;  3IKV A;  5FRM A;  4RB2 C;  1AWC A;  1IG7 A;  3M1E A;  3ISP A;  2ISY A;  1OJL A;  1XX5 A;  4DBR A;  1Z6R A;  1W5S A;  5HNF A;  4CHU A;  1BBY A;  2KMU A;  1ON1 A;  1BL0 A;  4A0Z A;  1PUE E;  1V3F A;  1V5G A;  3DV8 A;  1J09 A;  1W4M A;  1T98 A;  3HOV J;  1OCZ H;  4O3M A;  4ZDP A;  3S2W A;  2KIM A;  5J1U A;  3FZV A;  4B48 A;  1XSD A;  1E17 A;  1Z6T A;  2VQG A;  1OCT C;  3I59 A;  3PNV A;  1SC7 A;  2CUJ A;  4PSX A;  1VTN C;  2IAI A;  3WTY C;  3IWF A;  2KIU A;  3DEW A;  3TW7 A;  2XDV A;  5DV5 A;  1BC7 C;  2DCE A;  1OCP A;  4JBA A;  1VQ7 I;  4IRI A;  2VPL A;  2E1C A;  3KET A;  2IS6 A;  2RN7 A;  2X9D A;  1YS7 A;  1KU7 A;  3DBH B;  3BG9 A;  5LGU A;  3KPH A;  5B1B H;  4YG2 F;  3A02 A;  1BI0 A;  2VB6 A;  3A01 B;  3F9K A;  1U9O A;  1VQP I;  5M5X J;  1POG A;  3PQK A;  2F5V A;  3LQQ A;  4G9Y A;  3DCF A;  3OYE A;  5FFX A;  3HTU A;  2HR3 A;  3MMY B;  4LB5 A;  3RPQ A;  1YIO A;  2XSJ C;  3QPS A;  4M72 A;  4PJM A;  2LD5 A;  4DQ2 A;  2K9L A;  2DO7 A;  2FBI A;  5TJJ A;  4XRS G;  5LHH A;  2E5N A;  4MO7 A;  3NEU A;  3LNQ A;  3LQR A;  4I98 B;  2LRE A;  3HPG A;  3WHB A;  3CMA I;  1UCR A;  3FBI B;  1HF0 A;  3SEZ A;  1OR7 C;  2P6S A;  4M71 A;  2AXT C;  1IUF A;  1TNT A;  4CA0 A;  4A3I J;  1FTT A;  3Q5F A;  2MSY A;  3RYR A;  2DQL A;  2XB5 A;  4MQV A;  2L7K A;  1A04 A;  1MD0 A;  3G3Z A;  4JX5 A;  5GPA A;  4HNT A;  2R7W A;  1C0W A;  1FIA A;  2B9S A;  4ZDL A;  1MGT A;  4FX0 A;  1FWZ A;  2ADU A;  4P55 A;  1VQL I;  2A3S A;  5DCM A;  3FIS A;  2DOA A;  4R1H A;  1UJ8 A;  3WGI A;  2H1L A;  2GA1 A;  2XKP A;  2LC2 A;  2W48 A;  3FM3 A;  3F6O A;  1N78 A;  1PDN C;  1Z3Y A;  1O7L A;  4IJA A;  1DQU A;  2V9K A;  4XR6 A;  2DK8 A;  2A07 F;  2OJE D;  3MEX A;  2LVS A;  1HST A;  1ZK8 A;  3I58 A;  3K1P A;  1I6H J;  2P5L C;  2VXD A;  2CS3 A;  2F6C A;  2OTL I;  1JUS A;  1XSV A;  3RZD J;  4A3M J;  1S8N A;  1F36 A;  5K7H A;  2WAQ N;  5IOY A;  1Y8R B;  3B02 A;  1XMA A;  1ZAR A;  1K6O A;  4UVC A;  2F4M B;  3TGN A;  5FD5 A;  2L7M P;  1B8I A;  5EEA A;  2R7F A;  3IUO A;  2G9W A;  3V7C A;  4YIR X;  1Z0X A;  1Y8Q B;  1V54 H;  4D5F A;  2F4I A;  5DUI A;  5DM6 F;  2MH9 A;  1MSF C;  1N75 A;  2XAQ A;  3DEU A;  1X2M A;  3BC8 A;  3BJO A;  3ZQF A;  1IXC A;  2EIJ H;  1MNE A;  2PN6 A;  3HRU A;  3RPU D;  3OYN A;  1JJ6 C;  1SFO J;  2DLL A;  3QPL A;  2L9R A;  1L3L A;  2ZXI A;  1LEB A;  1ONV A;  2R5Z B;  1Z7U A;  3ASO H;  2PBI A;  2Y0S N;  3JR9 A;  4FET A;  2G7H A;  1T0F C;  2PJP A;  3F8M A;  1B6A A;  1MBF A;  3REO A;  3AAF A;  3WE3 A;  1MBG A;  3KEY A;  2E1M B;  1IRG A;  4RGX A;  5FKK A;  4ZDO A;  1OYY A;  4AYB A;  1WQ2 A;  5FLX K;  4J00 A;  3ABT A;  2UXN A;  3K10 A;  5ILU A;  2A6E F;  3HRS A;  2HTJ A;  4MEY F;  5LEJ A;  3CES A;  4YRV A;  5GP9 A;  3CUQ C;  2BZT A;  1TW3 A;  3CCQ I;  3S16 J;  2VJI A;  1LDD A;  3FK7 A;  3RZO J;  1IXR C;  1VF9 A;  2PJR B;  5F04 A;  5K5O A;  2CQ7 A;  3ZQH A;  2GXG A;  2Z9O A;  1WZ2 A;  4IHT A;  3H92 A;  2BW3 B;  2EFP A;  3WGG A;  4DW6 A;  3ZN1 A;  4X0G A;  3CCJ I;  1JT0 A;  1S29 A;  4HEA 2;  2VON A;  1OIS A;  2F5C A;  4KN7 X;  4EAT A;  1P4X A;  3KEQ A;  1HQC A;  5JLW A;  2COM A;  2JA5 J;  2ZSI B;  2VBZ A;  3KZZ A;  1KQ8 A;  3NRV A;  4A5N A;  4LJZ F;  3ROU A;  3PJR A;  1SD7 A;  3AL0 B;  2Z1D A;  2UUZ A;  4AVP A;  5B66 C;  5HDN A;  1T39 A;  5B5E C;  2K4B A;  4BGD A;  3PFY A;  2CFX A;  3UKG A;  2KDO A;  5EGO A;  3ZQ7 A;  3BG5 A;  2E7X A;  1KQ0 A;  1I3A A;  2M5W A;  2YR2 A;  3R0J A;  4XKC A;  5BNG A;  1ZGW A;  3U1K A;  2V1U A;  4ENJ A;  2KLO A;  2V1D A;  3OWT A;  3X2Q H;  3OIP A;  4AWX B;  5GAE J;  4RLF A;  2CUZ A;  2X6O A;  4A3J J;  3L2V A;  4WCG A;  1NG6 A;  1WJE A;  5HDK A;  3S17 J;  1LVA A;  3CCM I;  2BY0 A;  2OC6 A;  4I7H A;  2H6B A;  4A3L J;  3GF2 A;  3OOP A;  4LK1 F;  1O3T A;  2CQN A;  4XLC A;  1SFU A;  3OL4 A;  4MEX F;  3DPU A;  1CQT A;  4ESF A;  3QQA A;  2PMU A;  4NNJ A;  1IZ1 A;  3KYL A;  2VC1 A;  2VE9 A;  2ELJ A;  1X1D A;  1PYV A;  3GFL A;  5EJC A;  5BPD A;  5B1A H;  4A12 A;  3P9K A;  3TBI A;  5C4J J;  3S32 A;  4C2U A;  2TRT A;  3P9I A;  3TO9 A;  4P96 A;  1V4R A;  2K40 A;  2YX7 A;  5ICF A;  1HCR A;  5IPA A;  3PO2 J;  1BOB A;  1R5H A;  1MIJ A;  1N25 A;  2CQK A;  1MMG A;  3ZOB A;  2JT1 A;  5AIQ A;  1LNW A;  2RRE A;  3CD6 I;  4PJJ A;  3F23 A;  2F5D A;  3FXL A;  3DWL E;  4U88 A;  2Q8K A;  5LHG A;  3OYL A;  2DT7 B;  1ZRE A;  4BE1 A;  3KYD B;  2W85 A;  2E2H J;  1E2X A;  3DLA A;  3S1R J;  1U3E M;  3DBR B;  2M34 A;  3WTT C;  1T33 A;  3VOE A;  4MGR A;  2TDX A;  4G6T B;  4F93 B;  1MND A;  1DPU A;  5LD2 C;  3RKW A;  4UVA A;  1A6Q A;  2YS9 A;  2EJR A;  3ECH A;  3R6S A;  4M3D A;  1LPQ A;  1B72 B;  3S2H J;  3MKZ A;  1EJ9 A;  1JKR C;  1SVL A;  3ZMS A;  4ESJ A;  2DPD A;  1RKT A;  4JX6 A;  2F4O B;  2GQQ A;  1MW7 A;  4HZF A;  4XL9 A;  3HM5 A;  2UZK A;  2W7N A;  3GEZ A;  4B8X A;  3COA C;  1BC8 C;  4EMS A;  1MSE C;  3F8C A;  2L0K A;  4L9J A;  5EZG A;  3T8R A;  2HOS A;  1RNL A;  2P7C B;  4BHB A;  2K27 A;  2QBY B;  2VBW A;  5J8F A;  3ZQC A;  3K7A J;  3J80 K;  1BN5 A;  3UR3 C;  1XDU A;  4HA8 A;  4HV6 A;  4FAS D;  4ZYH A;  3IWZ A;  4JQF A;  4IHX A;  4ABZ A;  1JHF A;  1D0X A;  3O8H A;  3PM1 A;  3CJT B;  3LSM A;  4B3A A;  3I3L A;  3A01 A;  2AQF A;  2EWN A;  1QA6 A;  4HV5 A;  3TO6 A;  1ZG5 A;  3CME I;  1G2H A;  1JT6 A;  1R58 A;  3Q0U A;  4U0V A;  4IX7 A;  2KHM A;  3A03 A;  2V79 A;  3JRG A;  2HZD A;  4CCN A;  4A6D A;  1RZ4 A;  2DA4 A;  2M8E A;  2BXZ A;  1HW5 A;  3KLN A;  4I2O A;  1YI2 I;  1Z3X A;  2DFI A;  2R7Z J;  2IVM A;  2FA5 A;  5EEG A;  1XGO A;  2RV8 A;  2LH9 A;  4AIH A;  4BAC A;  2R7U A;  1P7I A;  3BR2 A;  4A3C J;  3PO3 J;  3HDD A;  3CDI A;  5E17 F;  1GV2 A;  2M45 A;  3J7A Y;  3H9G A;  3J81 Z;  4IQJ A;  3ZMZ A;  2XAH A;  2CO5 A;  4D5C A;  1YO5 C;  4D7M A;  1I6X A;  2H6C A;  2LY1 A;  5IP6 A;  2CGP A;  1VQ9 I;  2X6Y A;  4E7I A;  2LDU A;  4RB0 A;  5HOD A;  1LFP A;  2XC7 A;  2M2E A;  4E7S A;  5FO5 A;  4XKB A;  3VPR A;  3LAJ A;  4H0E A;  3GTQ J;  3OY9 A;  1LDJ A;  5CPR B;  1I27 A;  2M1B A;  5H6R A;  1YJ9 I;  1U5T A;  3AG3 H;  2XGE A;  2X1D A;  1X1A A;  3VYT B;  5LGN A;  3L1P A;  5DD8 A;  5ICG A;  2L7F P;  4RAY A;  4EGZ A;  4C3I J;  1J59 A;  2O9L A;  1OPC A;  4HLX A;  1XSX A;  5HLG A;  2KDZ A;  1FJL A;  2V6C A;  4OMZ A;  3BPX A;  1Z91 A;  4E7J A;  4M3F A;  2UWM A;  5F0C A;  4V19 K;  4YFK F;  4BXF A;  1Z77 A;  1FBS A;  1XS9 A;  2CV0 A;  5DD4 A;  3Q0V A;  1IN6 A;  4ZH4 F;  3GVA A;  2F48 A;  2R5Z A;  2DFH A;  3VYR B;  3DP7 A;  4AYB N;  2HQR A;  1S6L A;  2VBX A;  3K6G A;  1YW7 A;  2DTZ A;  4E7Z A;  3CJR B;  1K4T A;  1EA3 A;  1VQ8 I;  1ETX A;  3CZ6 A;  4YFX F;  2K3F A;  2COB A;  2FQ3 A;  1WI9 A;  5L3F A;  4IO9 F;  1ACI A;  1V55 H;  5DCF A;  4OU0 A;  2X6X A;  5HOO A;  5DUK A;  2DFF A;  4A3G J;  2GOM A;  4G94 A;  2P5K A;  1P4W A;  1FYM A;  1P7J A;  3DXJ F;  4A69 C;  4XNF A;  2GOX B;  4A3D J;  4M3E A;  4OIR F;  2STW A;  3A0H C;  2FSW A;  2L3D A;  2PJR A;  4XLN F;  4BJT A;  4HSR A;  3C2B A;  5KCM A;  2N8G A;  5FKM A;  1SFK A;  2BW3 A;  4BUP A;  5DS9 A;  2OQR A;  1ZLK A;  4F92 B;  1FMV A;  4NC8 A;  1BOA A;  4KYW A;  1A5J A;  1ZRC A;  3NWS A;  3PNY A;  4HX7 A;  5ED4 A;  4EM2 A;  1U9N A;  4WXD A;  1J7K A;  1IDY A;  3QRF F;  3CCL I;  3ULQ B;  2RAE A;  4IHV A;  3BR5 A;  2R0Q C;  3BOQ A;  2G7U A;  5LRR A;  5D5W B;  2Y9Z A;  2J5P A;  1WVR A;  3P9C A;  4FCY A;  2ME0 A;  2R7S A;  2IS4 A;  4PFO A;  2E36 A;  1EH8 A;  2CW8 A;  2E34 A;  3SXY A;  2XUB A;  3D1N I;  3OYJ A;  4RS8 A;  2KFD A;  3HOW J;  4IOA F;  1CF7 B;  3BR1 A;  3E7L A;  4A93 J;  1F9N A;  3GWZ A;  2K4J A;  1WWX A;  2XPU A;  5C4X J;  4QPQ A;  4U87 A;  2DA6 A;  2VT2 A;  1T6S A;  2NYX A;  4G6D A;  3SFI A;  3QU6 A;  4GRI A;  1J5Y A;  2HFH A;  2WV1 A;  1AU7 A;  2K5C A;  3K4B A;  4CZC A;  3BQY A;  2DT6 A;  2L7Z A;  2ZNZ A;  5D5U B;  4BH9 A;  3GTM J;  2XAG A;  4HDV A;  3LA2 A;  2GIZ A;  5E3O A;  3CC7 I;  3QOP A;  4ENK A;  1VND A;  2KQR A;  4UUS A;  4BQA A;  5CJ9 A;  2XIG A;  2QWW A;  2LR8 A;  2IGK A;  2ZJQ F;  4KT5 C;  4C2T A;  2K9Q A;  4UNO A;  1WSU A;  3S1M J;  4KUM A;  2RDP A;  4O6J A;  2F5E A;  4IQ4 A;  3HOS A;  4QSH A;  1TWA J;  5C3E J;  3NAU A;  2WAF A;  4UB8 C;  3W2V A;  4HLY A;  1SAN A;  1YLF A;  1UB9 A;  1QO0 D;  3IP4 B;  4CGZ A;  2XB0 X;  3HZJ A;  5KK1 A;  1ZH5 A;  4UXN A;  2NAZ A;  4V2G A;  4S05 A;  1DGW Y;  3W6K B;  4LD5 A; 
#chains in the Genus database with same CATH homology
 4XRS G;  2QF7 A;  4MO7 A;  1JTX A;  3LNQ A;  2MW8 A;  3WHB A;  1HF0 A;  2IEK A;  1MBK A;  4AC0 A;  4BBS J;  1IUF A;  4A3I J;  1FTT A;  2MSY A;  3CCY A;  5K7Z A;  2XB5 A;  2LP0 A;  3BR0 A;  1JKP C;  4JX5 A;  2DMN A;  5GPA A;  2G0E A;  1FIP A;  1FIA A;  4Y52 J;  1S7E A;  1ZTR A;  3FIS A;  3JRC A;  4Y7N J;  2ECB A;  1ETQ A;  1X2N A;  2W48 A;  1W0T A;  3GTG J;  4NDL A;  1UHS A;  2CUF A;  1I50 J;  2LVS A;  1ZK8 A;  1I6H J;  4IHW A;  5J1Y A;  1LFB A;  1JUS A;  1ZKG A;  5IYC J;  3RZD J;  2EZL A;  5GPC A;  4A3M J;  3S1N J;  4BBR J;  3HEF A;  3JRF A;  1JKQ C;  2JA8 J;  1WCM J;  1F36 A;  1QVT A;  1IV6 A;  5K7H A;  2JN6 A;  2WAQ N;  5IOY A;  2E2J J;  5EG0 B;  2R93 J;  2L7M P;  1B8I A;  5EEA A;  1Z0X A;  3HGG A;  4D5F A;  3Q3S A;  1NK3 P;  2E19 A;  4UUT A;  1MSF C;  2CQQ A;  4XID A;  1X2M A;  5IOZ A;  3ZQF A;  2ECC A;  3GTK J;  2XPW A;  2HOT A;  3FK6 A;  1JJ6 C;  1SFO J;  3QPL A;  2GM4 A;  2L9R A;  5IP7 J;  2R5Z B;  3TP0 A;  2Y0S N;  1UG2 A;  3JR9 A;  1PUF B;  1MBF A;  1HDP A;  1MBG A;  2VKE A;  5FKK A;  2CJJ A;  1BW5 A;  4M6V A;  1MBH A;  3LSG A;  2CRG A;  4DYR A;  3JRD A;  3GTO J;  2Y30 A;  5E3N A;  3JRH A;  1IC8 A;  5EF6 A;  4AUX A;  2ELK A;  5GP9 A;  1U8B A;  3ZQL A;  3S16 J;  2AO9 A;  3SDG A;  2E2I J;  3FK7 A;  3RZO J;  1VF9 A;  5F04 A;  3IH2 A;  3ZQH A;  1MBJ A;  3MKL A;  1ZR4 A;  5FLV A;  1D5Y A;  2NVQ J;  4DW6 A;  3Q0W A;  1NTC A;  1JT0 A;  2R5Y B;  1GV5 A;  2DA3 A;  3HKZ N;  4RDU A;  2I10 A;  2FQ4 A;  1Q1V A;  4G12 A;  2JA7 J;  5JLW A;  2JA5 J;  3RQI A;  5IP9 J;  1ETW A;  4XRS A;  2O7O A;  2CU7 A;  2WB1 N;  3CDL A;  3LSJ A;  5M5Y J;  4EEF G;  3M4O J;  4C3H J;  3UKG A;  5EGO A;  1GVD A;  3NAR A;  3BG5 A;  5BNG A;  3RKQ A;  1ZGW A;  2EH3 A;  4BY1 J;  4MIM A;  4XRM A;  4GFB A;  3BR6 A;  4XIC A;  2X6O A;  3HBL A;  4C3J J;  4HNV A;  5E3M A;  3TED A;  4A3J J;  2DN0 A;  4QIW N;  5IYD J;  3G1L A;  3HB9 A;  1GDT A;  3S17 J;  4A3E J;  4A3L J;  1WI3 A;  3K2A A;  3LSP A;  5IYB J;  1EF4 A;  1CQT A;  1O4X A;  3IH3 A;  3QQA A;  1YRN B;  1BA5 A;  4I76 A;  3G1O A;  2LKX A;  1I3Q J;  5C4J J;  2AHQ A;  3FIW A;  3O8G A;  2TRT A;  2VPR A;  2K40 A;  2O8K A;  2D5V A;  1HCR A;  5IPA A;  3H0G J;  3PO2 J;  4CYC A;  2QCO A;  3ZOB A;  4X1E A;  2H1K A;  4BY7 J;  2FJ1 A;  3FKI J;  3BG3 A;  2VUM J;  1AKH B;  5FJ8 J;  1JUM A;  3JRB A;  3M3Y J;  4BKX A;  2E2H J;  3S1R J;  3GTJ J;  4M3B A;  3HOU J;  4X6A J;  2M34 A;  1T33 A;  3BTI A;  2YS9 A;  1DU6 A;  4M3D A;  2DA2 A;  1B72 B;  2K9S A;  1FEX A;  3S2H J;  5E3L A;  3CQZ J;  2DA5 A;  3S15 J;  1JKR C;  3I4M J;  1F43 A;  3CMY A;  1ETK A;  4A3K J;  1RKT A;  1VI0 A;  4JX6 A;  1RET A;  2CQX A;  2LK2 A;  4DZJ A;  2XGC A;  1OFC X;  2HYJ A;  4MFD A;  1WGX A;  2ZB9 A;  2ID3 A;  3HM5 A;  2R5Y A;  3IV5 A;  1MSE C;  4FE7 A;  1K83 J;  2L0K A;  3SJM A;  5EZG A;  5C44 J;  9ANT A;  4MFE A;  2HOS A;  5JLX A;  2YU9 J;  2LY9 A;  1MH4 A;  5M3M J;  3ZQC A;  1H88 C;  3K7A J;  2GLO A;  2P81 A;  2KT0 A;  2Y31 A;  1H8A C;  1TWG J;  4IHX A;  4ABZ A;  3O8H A;  3PM1 A;  3BTC A;  5EYR A;  4B3A A;  3A01 A;  2EQR A;  2NS7 A;  1RR7 A;  1G2H A;  2OF7 A;  2FX0 A;  3JRE A;  1JT6 A;  1RES A;  3Q0U A;  1B8I B;  5F27 A;  3A03 A;  4XK4 A;  3JRG A;  3JRA A;  4DYQ A;  3B6A A;  2EZK A;  1LE8 A;  2DA4 A;  5EZH A;  2IBD A;  3I4N J;  3B6C A;  2EZI A;  1R9T J;  2R7Z J;  3HOZ J;  2HI3 A;  2M8G X;  2JA6 J;  3GBG A;  4DYC A;  1T56 A;  3IH4 A;  5FKL A;  4DZP A;  1P7I A;  1GUU A;  3BR2 A;  1Y1W J;  3ZQG A;  3F0C A;  5FLM J;  2HDD A;  3PO3 J;  4A3C J;  3HDD A;  3JRI A;  1GV2 A;  3BTJ A;  1TWH J;  5EDN A;  4D5C A;  2DMT A;  2OPT A;  4D7M A;  2Y9Y A;  1HDD C;  5IP6 A;  1WH7 A;  2H8R A;  4L5E A;  2HXI A;  5HOD A;  2M2E A;  2DA1 A;  1JKO C;  3TP3 A;  3VPR A;  2B63 J;  3GTQ J;  4JX4 A;  4RBO A;  1ETV A;  1HOM A;  2XGE A;  1VFC A;  5K7F A;  2NVX J;  1XG1 A;  1LFU P;  3L1P A;  4M3G A;  4QTR A;  2L7F P;  1E3O C;  1ETY A;  2DMU A;  4C3I J;  5EG0 A;  2O9L A;  2K9N A;  1WH5 A;  4UUS B;  2NS8 A;  2VKV A;  4MLO A;  1GT0 C;  4BXX J;  2KDZ A;  5DTD A;  1FJL A;  2TCT A;  1B72 A;  3BTL A;  5M5W J;  4M3F A;  5F0C A;  1ETO A;  1Z77 A;  3G1M A;  3H3V K;  1XS9 A;  5EGO B;  4S0H B;  1IRZ A;  1APL C;  3LSR A;  3Q0V A;  1XC5 A;  5FKO A;  2R5Z A;  1U78 A;  4JP0 A;  4AYB N;  1NK2 P;  3S1Q J;  1MBE A;  1PUF A;  1MH3 A;  2ME6 A;  2DTZ A;  2JK3 A;  2VI6 A;  2EBI A;  2X48 A;  1ETX A;  2HXO A;  3GTP J;  5M3F J;  3S2D J;  2COB A;  2HOA A;  2JMW A;  3HGY A;  1JTY A;  4IEJ A;  4FIS A;  1JJ8 C;  4B4C A;  4D7N A;  1X58 A;  1IGN A;  1ORK A;  4A3G J;  1ZQ3 P;  1Y1V J;  2LTP A;  3OIO A;  1HLV A;  5F0H A;  2LLK A;  1MNM C;  1P7J A;  1RKW A;  3LOC A;  1QVU A;  4A69 C;  4A3D J;  2CUE A;  4M3E A;  2NVT J;  4FE4 A;  1BW6 A;  1UMQ A;  4I6Z A;  1JGG A;  3HOX J;  3C2B A;  2N8G A;  4IHY A;  1TWF J;  5FKM A;  3WHC A;  2M0C A;  5DS9 A;  3BT9 A;  4CYC B;  2YUS A;  3GTL J;  1H89 C;  2M9H A;  4JYK A;  1A5J A;  1IDZ A;  2MG4 A;  1QRY A;  5J1R A;  1RPW A;  1IJW C;  5F1J A;  4C2M J;  4A3B J;  4B1R A;  1U9N A;  4FTH A;  1IDY A;  2LFB A;  2NOG A;  2RAE A;  4IHV A;  3BR5 A;  2R0Q C;  3OSF A;  2Y9Z A;  4LOC A;  2PMZ N;  3TW6 A;  4FCY A;  1FTZ A;  2JJ7 A;  2ME0 A;  1K61 A;  5FKN A;  2MGQ A;  4V2F A;  1A6I A;  3D1N I;  3HOW J;  3S14 J;  3BR1 A;  3E7L A;  1IG7 A;  4A93 J;  1QPI A;  1OJL A;  4W1U A;  3HOY J;  2XGD A;  2DA7 A;  2DMQ A;  3BQZ A;  1DU0 A;  2ID6 A;  1ENH A;  1TC3 C;  1ITY A;  2XPU A;  1BL0 A;  5C4X J;  1ZR2 A;  2DA6 A;  2NVY J;  4J19 A;  3SFI A;  1W0U A;  3HOV J;  2WV1 A;  1AU7 A;  2XSD C;  3BQY A;  3MN2 A;  5J1U A;  2L7Z A;  5J3L A;  2GBY A;  1BJZ A;  3GTM J;  1OCT C;  2EZH A;  1YRN A;  2R92 J;  1JUP A;  2IAI A;  5E3O A;  2JWT A;  3DEW A;  3TW7 A;  3BR3 A;  3OOU A;  1VND A;  5F0F A;  1OCP A;  1AHD P;  4UUS A;  2X9D A;  3BG9 A;  3MVP A;  2XPV A;  2LR8 A;  2DJN A;  3A02 A;  3ZQI A;  4A3F J;  2FD5 A;  2K9Q A;  3A01 B;  2DMP A;  1U9O A;  2HQ5 A;  3S1M J;  2XRL A;  5M5X J;  1POG A;  2E1O A;  3DCF A;  4W97 A;  1TWC J;  1TWA J;  4QSH A;  5C3E J;  1AKH A;  3NAU A;  5F08 A;  2Y2Z A;  3W6V A;  1SAN A;  3QPS A;  2LD5 A;  2XB0 X;  1LE8 B;  4V2G A;  3OSG A;  1WPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...