2K4BA

Copr repressor structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
FNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The copper-responsive repressor CopR of Lactococcus lactis is a 'winged helix' protein.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Dna binding protein
molecule keywords Transcriptional regulator
total genus 16
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k4bA00
4BXUA 3TO7A 1LDJA 1DDNA 1MJ9A 2H6BA 2CWEA 1KYZA 5HDNA 2Y48A 2H27A 2HR3A 3QAHA 2PJPA 5HS7A 1K79A 2GIVA 1QZZA 3BPVA 1BBYA 2FSWA 2JPBA 3WTXC 3SZPA 3MEXA 3AAFA 4O3MA 3WTYC 2DBBA 5D6FA 3J80K 5K5RA 2QZ8A 1HSJA 1CGPA 3I58A 2PG4A 4LG0A 1S7OA 1MJAA 2XAQA 1ZG5A 2R3SA 5LGTA 2BV6A 4HLXA 3J81Z 5ILUA 5ED4A 2EFOA 3CLOA 2K4JA 1SD6A 3REOA 2HWVA 3P9CA 4EM2A 3KEOA 3I53A 3KP7A 1R5GA 3EUHA 4YIFA 1WSUA 1FC3A 1DP7P 3K1NA 1FLIA 3IWZA 2RVCA 1R7JA 3RKXA 3JSOA 1HKTA 2BGCA 2F2EA 4BHPA 2XAGA 4L9VA 5JHUA 3QP5A 1OYIA 1BC7C 3FXQA 1G3YA 3F8FA 5D8LB 2VT3A 3PQJA 1IXCA 1P4WA 1SMTA 5J6XA 1BM9A 3GXOA 5ILSA 1SD4A 3HRTA 4EM1A 4LLLA 4I7HA 1KGSA 1FBSA 1PP8F 2QM3A 1ZH5A 4EGZA 4G6DA 3RYPA 2HTJA 2KJBA 5A2QK 2O8XA 1MD0A 3E5QA 5CVJA 4JQFA 2V9VA 4R8HA 2HGCA 3I59B 4A6DA 2P5LC 5DCMB 2RC4A 4LJZF 2OAZA 1ON1A 4BYYA 3WTSC 3DQVC 2STTA 3T1BA 1TBXA 2FOKA 1YS6A 1MDMB 1USSA 5DUKA 2H6CA 1ZGJA 3L7WA 1BI3A 2LDUA 2VBZA 3FMSA 4MEYF 1U6GA 2QUFA 5ERIA 3HRSA 3L2CA 2STWA 1SMYF 1H9GA 3JSPA 1FY7A 1XD7A 3ZN1A 4KA4A 1FP1D 1FYMA 2RKHA 3WTZA 4HF2A 4HZFA 1HW1A 4OMZA 2A07F 3E6MA 3FMQA 2W57A 3R0AA 3EQLF 3TOAA 1U78A 1J2XA 1FSEA 2YR2A 2A6HF 5F1RA 4ETSA 1FPQA 4DNCA 2K86A 2R7FA 1KQ8A 5ICFA 4WF2A 2XAHA 1WWXA 5D8KB 3BROA 2QYOA 1H0MA 2DTRA 5HLGA 5D6EA 2NRAC 2WC2A 5TJJA 4GO1A 3FM3A 3R0JA 4Q5SF 5LGNA 1FT9A 3KP6A 3IKVA 2XKPA 2VN2A 1F1ZA 3BZ6A 5FLXZ 3MZHA 5K5OA 2OQRA 4KIBA 4Q4ZF 2OA4A 4M6YA 3JTGA 2COMA 2EWNA 3H3UA 1BIAA 1IN4A 1S6LA 2GAUA 1P4AA 2IW5A 3LFKA 2WWYA 1FBQA 5AONA 4M72A 2V1UA 2HKXA 2Z5UA 5FD6A 1RUOA 3I71A 2CSOA 3K1PA 2DQRA 4MNUA 1Y0UA 3FXRA 4H0EA 4CDGA 3SZTA 1KU3A 1TQMA 3HSRA 5DEQA 3GLXA 3W6JB 4B8XA 3N97A 4P9FA 4U7DA 3M1EA 1B59A 3TGNA 1TLHB 1F4KA 4A5MA 2PI0A 1R1TA 2IJLA 1I5ZA 5K1YA 4OIQF 2CGPA 1KU9A 3RYRA 2FBHA 2RGVA 3HUGA 1FOKA 1Z9CA 3HOSA 4ZYHA 2EFPA 4LK0F 3RI4A 1FWZA 3H3ZA 4ZYGA 3K1MA 2GA1A 2Q2EA 4A12A 1P92A 5L3EA 3CUQB 2MLKA 1DUXC 5IT9Z 2FNPA 5FO5A 2QBYA 3ABTA 3IC7A 1QQIA 4U88A 1Z05A 6PAXA 4RAZA 1ODDA 2FF4A 4KYWA 3CUOA 1ONVA 1K7AA 4I0AA 3E6CC 3CUQA 4CXFA 2CG4A 3TQNA 4KFCA 1OKRA 2OU2A 2QWWA 4CZZA 2QQAA 4KIGA 2J5OA 2PMUA 3J80Z 4XBFA 4BH9A 3C18A 4RGRA 1BIBA 2Z33A 3F6VA 1KQ9A 2OD5A 2V79A 1USTA 2LSOA 2GA2A 1R5HA 4ASNA 1R36A 4G8XA 3WTTC 2OQGA 1J7KA 1FYLA 2A68F 4M6XA 2PQ8A 4JBAA 1L3LA 1DPRA 2ELHA 1OR7A 5D5WB 1BC8C 4P55A 4OU0A 2DI3A 5E8GA 4ENMA 3QU6A 2ZBKA 2IVMA 5F64A 1IF1A 4A0XA 1E2XA 1O57A 5KK1A 4R1HA 2A69F 4KUMA 2EV0A 1YYVA 3T5XA 1UHWA 3BJOA 1O7LA 4KICA 3KETA 3ZMSA 3GF2A 1R1UA 1B1BA 1B4AA 4WX9A 1ON2A 4EGYA 4ZYEA 2IA0A 1XDUA 4GYIA 3KLOA 1XSXA 3T8TA 2ZJ2A 2XVCA 4OIOF 3G73A 1L0OC 2G7HA 3VODA 3ZN0A 1XMKA 3KZYA 2MBFA 1W7PA 3DV8A 2UWMA 2F5FA 1YLFA 4CICA 1FX7A 3B02A 2ZCWA 1JE8A 4BNCA 5CJ9A 5IT9K 3HYIA 3QPHA 2PFBA 5DDGA 3LA7A 4ESBA 4LK1F 4L9NA 4HV5A 4LLGF 4UVAA 4GXOA 1AWCA 3RIRA 1HXDA 2VBXA 4HX4A 1R1VA 3E97A 4A6EA 1KYWA 3JTHA 4RGXA 1SFEA 2A5YB 1KQ0A 4XSZF 4BAYA 1R23A 2MD5A 1G4DA 2HDCA 2OBPA 5EEGA 3K0LA 3TOBA 4IRIA 3LQQA 3WTVC 5DD8A 2F5CA 1OMIA 3LA3A 2WV0A 5HDGA 5DV5A 3DEUA 4RAYA 2FRHA 4P9UA 4FT8A 4HDVA 5IT3A 4HOBA 4NQWA 2BYVE 2Z99A 3ML6A 4RB1A 3SHFA 3NRVA 2G9WA 3HOTA 4EQQA 2ZXJA 1YFHA 2O03A 2DQLA 4PDKA 4N0BA 1STZA 2YSRA 1XSVA 3SFZA 2E7XA 1ZRDA 2KRFA 4RB2C 2MA3A 1O3QA 1ZARA 3CDHA 5CVRA 2G7UA 4KN7X 3K2ZA 3HRMA 4FX0A 2RNJA 3RKYA 3CJNA 3V7SA 1Z6RA 5ICCA 1ZLJA 2HYGD 4Q47A 1LVAA 1U5TC 3RPUA 3RKWA 5E20A 3ZMZA 2ADUA 4M74A 2Z3YA 1YW8A 5L3BA 2PMHA 3LSTA 3HIFA 3ROUA 2KKOA 4RGUA 1T0FA 2IP2A 1O3SA 4RB0A 3WE2A 3VEPA 3IWFA 4Z2YA 5FB2A 3Q9SA 4P96A 3TDZC 5CYVA 3HTSB 2K4BA 2EFNA 4M9SA 3T0YA 2D2WA 2PBIA 3W6KB 4EVIA 3LA2A 1RZ4A 2XAFA 4HA8A 2BEOA 2L01A 4HW0A 3GWZA 1BJAA 4MQ9F 2HOEA 4FX4A 1F5TA 4AIJA 5DD4A 5LLQA 1P6RA 5LHGA 2HEOA 1O7FA 2KIUA 2QQ9A 4AWXB 5AIQA 1IAWA 2P5VA 5CVUA 3GX4X 5CVVA 3WU1B 1FSHA 4ENNA 4EJVA 2DAOA 2EA2A 1I1GA 2RV8A 1S3JA 3E5XA 3M7GA 2XASA 3DPLC 1PP7U 3U1DA 3WTWC 2XGXA 1GXPA 4RS8A 1ZHFA 4ZH4F 2P7CB 5DCMA 1JGSA 3V8LA 2AXLA 4EJUA 3E6DA 4RGSA 1FZPB 1A04A 4N9HA 4RB3C 3J81K 1MZBA 2M45A 1BI2A 2HS5A 1HQCA 1EH6A 1XB4A 1XN7A 2FBIA 1ZREA 4GGGA 5L3GA 1I27A 4HX8A 1YTYA 3H92A 3GYHX 4XRFA 3V8KA 4BQAA 4UVBA 1DPUA 2HZTA 2H09A 3HSFA 3HHHA 3BJAA 1IN6A 3T8RA 5HS8A 3WTUC 1NHAA 2W85A 2FNAA 1C0WA 4NHJA 3BY6A 1O3RA 2KJCA 5BS6A 4IPAA 2DK8A 4QLCU 1GVJA 1U5TB 3DFGA 2BBYA 2GXBA 2CFXA 1TW2A 1X3UA 2A3SA 1GHCA 4FHTA 1F9NA 2XKOA 1IN7A 2V1XA 4A5NA 1JHFA 5LBQA 5A2QZ 1H9TA 4KIFA 2J5PA 4G94A 1HSTA 1WKMA 3DF8A 2Y0MA 1ZAOA 2EV6A 4KMUX 3VB2A 4UHTA 3WG9A 1S7AA 3EYIA 3IKTA 1R22A 4XSXF 3GFIA 4HYEA 2A6EF 4MEXF 1W7PD 2LF8A 2VE8A 1HBXG 2NS0A 3F8BA 2XUBA 3S2WA 4BHCA 1K78B 3GVAA 1O3TA 3V4GA 1TNTA 4NB5A 4HQMA 3P9KA 3FZVA 3DPTA 5JR3A 2O61A 3O6BB 3KP2A 2W84A 3HRUA 4ESFA 1R00A 4S05A 1K78A 2VODA 2GXGA 3LWFA 2PLYA 5EEHA 4G6QA 2ISZA 2P8TA 3HSEA 2TDXA 1E17A 1UHMA 3K9TA 2HYFA 4CYDA 2ZNZA 3MCZA 3EDPA 2JPCA 1OPCA 1J75A 4HQEA 5DCFA 4AIKA 3D0SA 4WXHA 1U8RA 1D8JA 3WODF 1HKQA 4S04A 4UVCA 5D5VB 1J0RA 2ESNA 3KP4A 2MC3A 3KP3A 2VC0A 2XRNA 1QNTA 4OMYA 1RIOH 2JT1A 1ZN2A 2EFWA 2O0YA 3KP5A 5CLSA 2L54A 3VFZA 5BQTA 1XGSA 5JI6A 3GFLA 3V7CA 3U9GA 3BWGA 2P6SA 3M9AA 2WTEA 4HV6A 3CUQC 3O2PE 5AIPA 2KIFA 3BJ6A 3I64A 3JW4A 4IHSA 2VOOA 1FP2A 3G3ZA 4I98B 2F5DA 3L9FA 2L4MA 1XDSA 1BOAA 1W4MA 1SD5A 3ZMVA 2ZO4A 1LNWA 1D3YA 1FBUA 4M73A 2DU9A 1WI9A 5FFXA 4MTEA 3I59A 2MH9A 3F72A 5LGUA 1ULYA 4EMSA 4G7HF 5HS9A 2HQNA 2B0LA 1V4RA 3F22A 1HW5A 1G3SA 1PUEE 4B09A 2M1BA 3KEQA 4MQVA 1SFXA 2Z9OA 1WQ2A 4L9TA 5LEKA 1G3WA 4ESJA 3F23A 2LNBA 4LFUA 1IRGA 1TW3A 3ECOA 2Y75A 1G3TA 1FNNA 2ETHA 2IPQX 4ZZDA 3GFJA 5L3DA 3B73A 1FYKA 1T6SA 2JRTA 1KA8A 2DO7A 1ZG3A 5D4SA 3V8JA 4GYGA 1ZRFA 3I54A 2D45A 3DP7A 2VE9A 4CHUA 3BDDA 4ZYDA 2M8EA 3KZZA 4L5IA 2XROA 1OYYA 5FLXK 1U3EM 3BOQA 1GXQA 2K02A 3MQ0A 1LQ1A 1UB9A 4O6JA 1LJ9A 3QPTA 4AIHA 3RJPA 1JHHA 3ZP5A 2ACJA 4OINF 3FWEA 1B9NA 1XCVA 2D1VA 1BI0A 2NNNA 4Y13A 4PGGA 4EJTA 4I02A 3O3KA 4IF4A 2C6YA 4OIRF 1MDMA 1QO0D 2O3FA 1SAXA 3LAJA 1BI1A 1CF7B 2EFQA 3MAJA 5ICGA 1XSDA 1JXSA 4XLPF 2MLGA 3CO7C 3TO6A 2V6CA 3ZMDA 1TTYA 4WWCA 2YU3A 2VONA 1YW9A 2BE5F 3WGGA 3F8NA 2OZUA 2CW0F 1XCBA 4F7ZA 1QPMA 2QLZA 1PDNC 5LHIA 3L00A 3KCCA 4A2UA 2FE3A 3JAMZ 5HOOA 4G9YA 5JVTA 1UFMA 2IT0A 2V1DA 2IRFG 4U7BA 2W24A 1ZLKA 2H94A 3BP8A 3OV8A 2VC1A 2QBYB 1U2WA 3P7NA 5LRRA 4YFXF 5D5XB 2CYYA 4M71A 3MZYA 1RNLA 4KT5C 4I0BA 4ON0A 1QBJA 2FXAA 4LB5A 5K5QA 4IRGA 4A0ZA 4P5OA 3R61A 3ZQ7A 4HX7A 2DK5A 1T39A 4EV0A 2DW4A 2XV4S 1SFUA 4WXCA 2VXZA 2PN6A 3ISPA 3RPQA 3ZPLA 4XLNF 3GZ6A 5D4RA 2XIGA 2L02A 5HLIA 1CF7A 3NQOA 1RI7A 1IZ1A 1TQPA 2E1CA 5H20A 2ZNYA 2RQPA 2NNYA 1D8KA 3IRQA 2M5WA 2GZWA 4HAMA 3ECHA 4IRHA 4O5VA 3TKYA 5JFRA 4QWQA 2UZKA 2W25A 3R60A 1J5YA 3F21A 1W5TA 3RTRA 5L3FA 1IRFA 2F5EA 4OIPF 2UXXA 4YG2F 1ZRCA 3FF5A 3TO9A 3DKWA 1LDKB 4UV8A 5L3CA 5DYMA 3E3VA 5E8IA 2DLLA 3F8CA 3WU0A 3F8MA 3C7JA 4K2EA 1B9MA 3L09A 1EH8A 1LDDA 2HFHA 2QENA 3V7RA 4ENKA 2QVOA 4EM0B 2RDPA 3BPXA 1KU7A 4LMYA 1TQIA 4M9ZA 2VT2A 2YX4A 5BMZA 4UV9A 2JZYA 1QZYA 2GWRA 3HTUA 3QU3A 3WGIA 2K7LA 3C3WA 2EA4A 3COAC 2VBYA 4HDUA 4L0YB 4L18B 1ZGAA 1P2FA 5ILVA 1J59A 4EJWA 3ELKA 1XGNA 3C1DA 4GCVA 3DXJF 4EJOA 3IRRA 3F6OA 5KVRA 4I2OA 2ISYA 3IL2A 3F3XA 2EV5A 1TNSA 5DUIA 3QP6A 2CQKA 4I01A 3FXUA 4L0ZB 5BPIA 4HF1A 3LAPA 4LB6B 3Q5FA 2HKOA 4KMFA 3CTAA 3QOPA 1IW7F 2CO5A 4HBLA 4U0VA 4IJAA 5FFZA 4WXDA 2AS5F 1YIOA 4BHBA 1Z91A 4E70A 4CGZA 3GW2A 1T98A 1VTNC 2JSCA 3JAMK 1MGTA 1SD7A 2FQ3A 5J8FA 2FMYA 1D5VA 1LEBA 2P5KA 2D1HA 1R58A 3WE3A 3GFMA 3MWMA 4M9XA 1AOYA 3HHGA 1LB2A 1Z6TA 2XAJA 3EETA 4PGHA 4DQ2A 3ZMUA 2PEXA 4WCGA 2LKPA 3SQNA 1Q1HA 5LEJA 2ZMEA 4L9JA 4LD5A 3ULQB 2NYXA 3ABUA 2EK5A 3OOPA 4TV7A 5LRSA 5FGMA 2MH2A 4UXNA 3CO6C 3LQRA 5E1WA 3FHZA 3EYYA 2GQQA 1V3FA 3FMRA 1S29A 2VOPA 2ESHA 3I4PA 3RDIA 2E7WA 3GZ5A 3GEZA 2IA1A 1I1SA 2YX7A 1W7PB 3M8FA 4YFKF 2P6TA 1YO5C 5BPDA 5TRDA 1XGMA 2YPRA 3KLNA 1T2KA 2M87A 1HW2A 4MTDA 5J8CA 4IHTA 5LHHA 5E17F 5HVQC 5HLHA 3E6BA 1KU2A 1WRJA 3U2RA 1Z7UA 4I09A 4YIIA 3QRFF 2DT5A 1RUNA 1W5SA 3K69A 4MGRA 4R79A 4KDPA 2DPUA 5E1ZB 5HDKA 4HF0A 2O6GE 2ZMEB 4N9IA 2E1NA 3E5UA 4ENJA 3I5UA 2QQBA 1YQAA 4LG0B 4YFNF 4LLNA 5D5UB 2FA5A 4JK1X 4Q48A 3WGHA 4D0PA 2ZFWA 3FM5A 1K6OA 5CVIA 1T38A 2KIMA 2K27A 1IXRC 2DPDA 2FBKA 5BOXA 1XMAA 2UXNA 2IA2A 1IUYA 3M8EA 2OZ6A 3KFWX 5E1XA 3SXYA 1UCRA 1OYWA 1EH7A 4PCQA 4AD9A 1Z1DA 2RN7A 1S8NA 1ZG1A 4Y17A 2HTSA 1YS7A 3N4MA 3P9IA 2Q0OA 1P4XA 1MJBA 2VBWA 3GO5A 3I0TA 1IN8A 3R4KA 3KE2A 1IXSB 1REPC 5ICEA 2HQRA 3IHUA 4IVNA 2NAZA 4Y15A 4UUVA 3ZMTA 3NEUA 2Q8KA 2DFIA 1I6XA 1XGOA 4PZJA 1U5TA 3TDUC 5H6RA 2X0LA 2X4HA 1G6NA 1IN5A 4WK8F 2LF7A 4L5JA 4KN4X 4CO8A 4U0YA 4LGWA 5FD5A 1EV7A 1ZYRF 2JTVA 1QGPA 2XHKA 5H6QA 2FU4A 3VOEA 1LEAA 3Q9VA 3FX3A 1YW7A 3GUDA 2A61A 4KNYA 1YG2A 1BN5A 2EJRA 4MHGA 1B6AA 3PQKA 3MFKA 2EB7A 3R6SA 2L3DA 4HLYA 4AVPA 4G7OF 4IXAA 2M30A 2ZKZA 5F6FA 2L4AA 4A0YA 2R7DA 3J7AO 3ERED 4G7ZF 1MKMA 1HKSA 4U0WA 1J9IA 3D5LA 2FMLA 4UNOA 4OOIA 2FEZA 2P4WA 2P7VB 4ZZLA 3PFIA 5E18F
chains in the Genus database with same CATH superfamily
1N77A 4BXUA 3TO7A 1LDJA 4A3BJ 1MMGA 3PSIA 1DDNA 1YJWI 1MJ9A 2H6BA 2CWEA 1KYZA 1GV2A 2LFBA 2Y48A 5HDNA 5EG0B 1VQMI 1VQOI 2H27A 2HR3A 2VJIA 3QAHA 5HODA 2PJPA 3OMYA 3MMYB 5HS7A 1K79A 2GIVA 1BW5A 2VKEA 1SFKA 5GAEJ 4E6KG 2QSFX 3E0JB 5FRNA 2ELKA 1QZZA 1R4MB 1T0FC 3BPVA 1BBYA 2HXOA 2FSWA 2JPBA 4V2FA 1RPWA 2L7FP 5F08A 2HPMA 4ZC3A 2F5VA 3WTXC 3SZPA 1LE8A 4UB6C 5J4VA 5CQEA 1BJZA 1JGGA 3BT9A 4IQJA 3MEXA 2VPLA 3ZXSA 3AAFA 5H2FC 1IDZA 2AQFA 2DFHA 4X1EA 3WTYC 4O3MA 1Y8QB 2DBBA 5D6FA 3J80K 2RQQA 1FOYA 5K5RA 3LNQA 3HGYA 4RAGA 2QZ8A 2X6YA 4ITVA 3A03A 2DDBA 1W36C 1RKWA 1HSJA 1U9OA 1CGPA 3I58A 5IYCJ 2PG4A 4LG0A 3OOUA 4DYRA 1S7OA 1MJAA 4XLAA 2XAQA 1ZG5A 2R3SA 1WGXA 2XB0X 4XL9A 3JRGA 5LGTA 3ASNH 2BV6A 2BOLA 4HLXA 3J81Z 5ILUA 4NBQA 1JKOC 2MD0A 5ED4A 2A5WA 4UUTA 4BBSJ 1XC5A 2EFOA 1IRXA 2R7SA 3CLOA 2K4JA 1ZR2A 3UNGC 5GTIC 1SD6A 2LKXA 3REOA 2HWVA 3ZR8X 1WH7A 1B72B 3P9CA 4EM2A 3KEOA 3I53A 3KP7A 5F0HA 2R92J 1R5GA 2DMNA 3EUHA 4DJAA 4YIFA 3CDIA 1WSUA 5JVGF 1FC3A 4W1UA 3BG7A 1DP7P 1YRNB 3K1NA 1FLIA 2LY9A 3IWZA 2RVCA 4Y33A 3K10A 2R7XA 3AFHA 4FE7A 1R7JA 2O8KA 5GPAA 3VWBA 5FRMA 3RZOJ 3RKXA 3JSOA 1HKTA 2BGCA 1FMVA 3OYCA 2KQRA 1XS9A 2HPIA 2F2EA 1MBEA 4BHPA 2XAGA 4L9VA 5JHUA 3CF2A 4HG2A 3S2DJ 3QP5A 1OYIA 3QYFA 4CCKA 1BC7C 3FXQA 1G3YA 3F8FA 5D8LB 2VT3A 3PQJA 2Z16A 1IXCA 1P4WA 2X6OA 1SMTA 5J6XA 3E7LA 4AC0A 3HB9A 1XX5A 1BM9A 3GXOA 3LSJA 5ILSA 2EIKH 1SD4A 4ZDPA 3HRTA 4EM1A 2XDVA 4LLLA 3KZIC 4I7HA 1KGSA 3S16J 4L5EA 1FBSA 1PP8F 3FXJA 3W6VA 2QM3A 4ZJZA 4F91B 1ZH5A 4EGZA 2G0EA 3FBIB 4G6DA 3RYPA 2HTJA 2KJBA 5A2QK 3LSIA 3AL0C 2BHZA 2O8XA 1MD0A 2WAFA 2QKMB 3E5QA 3BR6A 5CVJA 3S17J 4XR6A 4JQFA 3DPUA 2V9VA 3C2HA 2JQ7A 1ZTRA 1NH3A 4R8HA 2YU9J 1M1EB 2R5ZB 1V5FA 3LSKA 4Y3OA 2HGCA 3I59B 4PSXA 4A6DA 2P5LC 5DCMB 2RC4A 2QEXI 4LJZF 2OAZA 2E36A 1A35A 1ON1A 3H0DA 4BYYA 3WTSC 3DQVC 3HEFA 3T1BA 2STTA 1TBXA 1UMQA 2FOKA 1YS6A 1VNDA 2QQ8A 1MDMB 1USSA 5DUKA 4D1QA 1WHUA 2H6CA 1ZGJA 3L7WA 3PNVA 3F9KA 2K5CA 1BI3A 2LDUA 4YEJA 2VBZA 2ZFUA 3FMSA 4MEYF 1U6GA 4RM3A 4XOPA 2QUFA 3G1LA 2OJED 3HZJA 5ERIA 3LSRA 2F4IA 3HRSA 3L2CA 2STWA 1SMYF 1H9GA 1B8IA 5J3LA 3SFIA 3JSPA 2L9SA 1FY7A 1XD7A 3ZN1A 4KA4A 1FP1D 2NXNB 1FYMA 2K85A 4BE2A 2LBFA 2RKHA 3WTZA 2H1KA 4HF2A 2Z2SB 4HZFA 1LKXA 3GTGJ 1HW1A 2X85A 1OFCX 2CV2A 4OMZA 2X51A 2A07F 1X2MA 1Y8RB 3E6MA 2F48A 3FMQA 2W57A 3GCMA 3R0AA 1WJDA 3EQLF 2XRLA 3TOAA 4JX5A 2HVRA 1U78A 1J2XA 2L0KA 4KITB 1FSEA 5F04A 2CJJA 2A6HF 2YR2A 1TL8A 1G2HA 1I39A 1ETWA 5F1RA 4ETSA 1FPQA 4DNCA 1W0UA 2K86A 2AHQA 3H9JA 2EIJH 3VYUB 2R7FA 1KQ8A 5ICFA 4WF2A 3B6CA 2QA4I 1HDPA 2XAHA 4NC7A 2D5VA 2DN0A 1WVRA 1WWXA 4XNFA 5D8KB 1UG0A 3BROA 1X1AA 2QYOA 2WB1N 3VYRB 1H0MA 2DTRA 1T8IA 3DBHB 3OS0A 3FXLA 5IP7J 1MBHA 5HLGA 5M5XJ 5D6EA 2NRAC 2WC2A 5TJJA 2FQ4A 3IH2A 3QYBA 4GO1A 4PUSA 1HLVA 3FM3A 1RKTA 4F3QA 2TRTA 3R0JA 4Q5SF 5LGNA 1FT9A 3ZOBA 3KP6A 2M34A 3IKVA 2XKPA 2VN2A 1F1ZA 1MMSA 3BZ6A 2VXDA 5FLXZ 2ICWG 2JSPA 3MZHA 2KZGA 3LL7A 5K5OA 2OQRA 4KIBA 4Q4ZF 2OA4A 4C3HJ 3NARA 4M6YA 4CCJA 3JTGA 2COMA 2EWNA 3H3UA 1BIAA 3L2QA 1IN4A 2EILH 1S6LA 2QGUA 5DS9A 1SVOA 2GAUA 1P4AA 2IW5A 2F4OB 2WV1A 3LFKA 1MMNA 2WWYA 3LSGA 4OAZA 4BEHB 1FBQA 5AONA 1IV6A 3GTLJ 1UZCA 4M72A 2E1OA 1TT5B 3N05A 3VYTB 2HNHA 3PL8A 1DP3A 2E35A 2V1UA 2HKXA 2H8RA 3BQYA 3CP2A 4KJZA 4B3AA 4UB8C 2Z5UA 5FD6A 1MBJA 1RUOA 3I71A 3I3LA 2XPUA 3A1YA 4BUPA 3KEYA 2CSOA 3K1PA 5HLTA 3Q0UA 2DQRA 1JJ8C 5C3EJ 4X0GA 4MNUA 2GM4A 1Y0UA 3FXRA 2OTLI 3WHBA 1WZ2A 4H0EA 1TT0A 2GBYA 4XRSG 4CDGA 3OYNA 3SZTA 1KU3A 1E3HA 2XB5A 1TQMA 3HSRA 1I50J 1N75A 5HNFA 5DEQA 5IYDJ 3GLXA 3W6JB 2EBIA 2R0QC 4B8XA 3N97A 4P9FA 5EDNA 1YRNA 4U7DA 3M1EA 1B59A 3TGNA 2H1LA 5B3SH 1TLHB 2GXAA 2JUGA 2X1DA 3DTIA 3OYBA 3BG5A 1R1TA 4A5MA 3GMEA 2IJLA 1F4KA 2PI0A 4A3DJ 4ZDOA 4A3FJ 1T33A 3KPHA 1I5ZA 5K1YA 2R7RA 2DA3A 3A02A 5KAFC 4OIQF 2CGPA 1KU9A 3RYRA 2FBHA 2RGVA 3HUGA 1FOKA 3OR2C 3Q3SA 3IV5A 1Z9CA 3HKZN 3IH4A 4XRSA 1TWHJ 3HOSA 2X9DA 4ZYHA 4YIRX 3LSHA 4DIQA 2EFPA 3NWSA 4LK0F 1QRYA 5IY5H 2L5QA 2E5ZA 2EH3A 5E3LA 1QA6A 1R49A 3JRBA 1LVKA 1KONA 2ZXWH 3RI4A 2L2OA 2OV7A 4CCLA 1FWZA 3HPHA 3H3ZA 3CMAI 3HOVJ 4ZYGA 3K1MA 2GA1A 2X48A 3MZ8A 2Q2EA 1ETYA 4A12A 4BKXA 2VI6A 1P92A 5L3EA 2X1CA 3CUQB 2HZDA 1UG2A 3CCMI 4HPQA 1A31A 2MLKA 1DUXC 5IT9Z 1W5CC 4XLEA 2FNPA 5FO5A 1DU0A 2QBYA 5M3MJ 3ZQCA 2BY0A 3ABTA 3OY9A 3IC7A 2R5YA 1WJ5A 1X3ZB 3OYJA 1QQIA 3ZQFA 4U88A 3OIOA 1Z05A 6PAXA 1YJ9I 4RAZA 3BC8A 3HL2A 1ODDA 4XMYA 2FF4A 1WCMJ 4M3DA 3CP8A 5EJCA 4KYWA 3FBNB 2IS2A 3CUOA 1R4NB 1ONVA 4PJNA 1LUJB 3VYSB 4OWRB 4HNVA 1Z0XA 1K7AA 3CD6I 4I0AA 3A01B 3E6CC 5FKLA 4XLHA 3FIWA 2VIXA 1VQ5I 3CUQA 4N4NB 1ZKGA 4CXFA 2CG4A 3TQNA 4KFCA 1OKRA 2OU2A 5FJ8J 2QWWA 4V19K 1ZGWA 4CZZA 2DT7B 2QQAA 5LFAA 2GIZA 4KIGA 2E71A 2WBMA 2J5OA 4LG3A 2PMUA 3J80Z 2ZMEC 3PNYA 4XBFA 4BH9A 4FCYA 3C18A 2R7UA 4RGRA 3WU2C 1BIBA 2Z33A 3OSGA 1ZR4A 3F6VA 1KQ9A 2JUCA 2OD5A 2V79A 3CCRI 1USTA 2AO9A 1OQYA 2CH0A 2LSOA 4HRIA 4IHVA 2GA2A 1FJLA 1R5HA 3HUGB 4ASNA 1R36A 4G8XA 4D9JA 1VF9A 3WTTC 2NVQJ 1GUUA 2OQGA 1J7KA 3OYHA 1FYLA 2A68F 4M6XA 5BNGA 2PQ8A 4JBAA 2N8GA 1SFOJ 1L3LA 1DPRA 1BOBA 2ELHA 1OR7A 1RESA 2DMUA 4XM3A 5D5WB 1BC8C 4P55A 5FLVA 3ABLH 3EUHC 4OU0A 2DI3A 5E8GA 4ENMA 1MNDA 3DTEA 3OL4A 3K4KA 2JK3A 3QU6A 2ZBKA 4X6AJ 2IVMA 5F64A 4CH7A 3G1OA 1IF1A 1HF0A 2E1MC 4A0XA 1PUFA 1E2XA 1O57A 5KK1A 5TGTA 4R1HA 2A69F 4KUMA 3TBIA 3CJQB 1MIJA 2EV0A 2HU9A 5F1JA 5B1BH 1EKEA 1YYVA 3T5XA 1UHWA 2M7AA 3BJOA 1O7LA 4KICA 3KETA 3ZMSA 3GF2A 3QQAA 1VQ8I 1R1UA 1B1BA 1B4AA 1P7JA 4DBQA 3VPRA 4WX9A 3CC7I 1ON2A 4ABZA 4EGYA 4ZYEA 2IA0A 1XDUA 4GYIA 1X4OA 4BEHA 3KLOA 1XSXA 3T8TA 4EEFG 4B43A 3CESA 4IHYA 2ZJ2A 2XVCA 2IXSA 4OIOF 3G73A 1L0OC 3BTJA 4B48A 1Y39A 4D7MA 2G7HA 5JHFA 2W7NA 3VODA 2CV1A 1N25A 2WAQA 2MYSA 3ZN0A 2VUMJ 2Y9YA 1U8BA 1IUFA 1XMKA 2NVUB 3KZYA 3QOEA 2MBFA 2IGOA 1W7PA 4BXFA 3DV8A 4XRMA 2E2IJ 2UWMA 4DYQA 3I4NJ 2F5FA 1R5ID 2Y31A 3JRAA 2W1OA 1YLFA 4CICA 1FX7A 2Y0SN 1T08B 3B02A 2BXZA 2ZCWA 1JE8A 4BNCA 1S72I 2ZB9A 5CJ9A 3K4JA 5IT9K 3HYIA 3QPHA 2PFBA 4A3MJ 5DDGA 1LFUP 3LA7A 4ESBA 4HSRA 4LK1F 4L9NA 4HV5A 2OTJI 4CYCB 4LLGF 4UVAA 3O8GA 4GXOA 3PJRA 1POGA 3RIRA 1AWCA 2V26A 1HXDA 3JRHA 2VBXA 4HX4A 2LP0A 1OR7C 1R1VA 2ZXIA 3E97A 4U87A 1KYWA 4A6EA 2Y30A 3K4NA 3JTHA 4RGXA 1SFEA 2A5YB 4BJTA 1KQ0A 4XSZF 4BAYA 1MNEA 1R23A 1TZLA 2MD5A 5C4JJ 4MIMA 1G4DA 2HDCA 2OBPA 5EEGA 3K0LA 4Y52J 3TOBA 4IRIA 3H36A 3LQQA 3WTVC 2AXTC 2HDWA 5DD8A 2F5CA 2KDOA 1MSEC 5F0FA 2ZXHA 2JVHA 2R4GA 2DMTA 1TWFJ 1OMIA 3V42A 3LA3A 3CC4I 2WV0A 2MGQA 1I3AA 3M07A 5HDGA 5DV5A 3DEUA 4RAYA 2FRHA 4P9UA 4FT8A 4B1RA 4HDVA 5IT3A 4HOBA 3K4LA 4NQWA 2BYVE 4DOZA 2Z99A 2LC2A 3ML6A 1X1BA 4RB1A 2Z1DA 2DTZA 3WHCA 3SHFA 3NRVA 1WPKA 2G9WA 4EQQA 3HOTA 4HEA2 1ITYA 3CC2I 2ZXJA 2IBDA 1YFHA 2O03A 2DQLA 4PDKA 4N0BA 1STZA 2YSRA 1XSVA 2XF6A 3SFZA 2E7XA 3TW6A 3DBLB 5C4XJ 2TCTA 3C2BA 5GP9A 1ZRDA 2KRFA 3PO2J 1IG7A 2JJ7A 3TP3A 2MA3A 4RB2C 4ZDLA 1O3QA 4IHWA 1ZARA 3OS2A 3CDHA 5CVRA 2G7UA 4KN7X 4F55A 3BR2A 3OSFA 5IYBJ 2XPVA 5J1RA 3H5RA 3K2ZA 3HRMA 3K4BA 4FE4A 3CCYA 1YHQI 3HOYJ 4FX0A 2DMQA 2RNJA 1OCOH 3RKYA 3CJNA 4QIWN 1R6RA 3V7SA 4M6VA 3ABKH 1Z6RA 5ICCA 1JUMA 1ZLJA 2HYGD 4Q47A 1LVAA 1D1BA 1U5TC 4XICA 3MKYB 4J01A 3RPUA 3RKWA 5E20A 3ZMZA 2ADUA 3IUOA 4BU2A 4RA2A 3JRFA 1NK2P 4M74A 1MW7A 2Z3YA 1YW8A 5L3BA 2PMHA 2VL8A 3LSTA 3HIFA 3ROUA 2KKOA 2LRDA 3DEWA 1JTYA 4RGUA 3BZCA 1T0FA 2IP2A 3HC7A 1O3SA 4RB0A 3WE2A 3VEPA 2XGEA 4GDFA 2EZKA 3IWFA 1KZHA 1D1AA 4Z2YA 2R7VA 5FB2A 3Q9SA 2W48A 3MKWB 2HOSA 4FISA 4C3JJ 1VQ4I 4P96A 2VASA 4XKCA 1OCRH 1DGWY 1K83J 4BY7J 3TDZC 5CYVA 1Q1VA 1ZK8A 1Z77A 3HTSB 2K4BA 2EFNA 4M9SA 3T0YA 1OJLA 2D2WA 2PBIA 2L7KA 2LD5A 1GLNA 3W6KB 2CQQA 4EVIA 3LA2A 4FQGA 1RZ4A 2XAFA 4HA8A 2BEOA 4AM3A 1JUPA 2L01A 4HW0A 3GWZA 1BJAA 4IHXA 4MQ9F 2HI3A 3BCAA 2PX9A 2HOEA 4FX4A 4E7HA 1D5YA 4JP0A 1F5TA 4AIJA 3TP0A 4A69C 1YI2I 5EGOB 1IV8A 5DD4A 5LLQA 3FDYA 1P6RA 5K7HA 5LHGA 1F43A 2H8WA 1O7FA 2KIUA 2QQ9A 1IAWA 4AWXB 5AIQA 2HEOA 3L1PA 2P5VA 3H35A 1VQKI 3FHNA 2BVLA 4E7SA 5CVUA 2XF5A 5CPRB 4A3KJ 3GX4X 1PUFB 5CVVA 4MLOA 3WU1B 3MD2A 1Z7LA 1FSHA 3Q0WA 4P1WA 4ENNA 4EJVA 3JRIA 2V6EA 2DAOA 1VFCA 2EA2A 1I1GA 2RV8A 1S3JA 2CRGA 3IAS2 3E5XA 3M7GA 3DEEA 3PUFA 2XASA 3EUKL 2NOJB 2MG4A 3DPLC 2R7TA 1PP7U 3HKZA 2V4JC 3U1DA 3WTWC 1MH4A 2XGXA 3GTQJ 3FK6A 5EGOA 1A6QA 1GXPA 3OYKA 1GVDA 3BZKA 4RS8A 1H89C 1S7EA 1ZHFA 4ZH4F 2P7CB 5DCMA 1VI0A 2MABA 2L9NA 1JGSA 3V8LA 3QODA 2AXLA 4EJUA 1X1DA 1YX5A 3E6DA 4RGSA 1FZPB 1A04A 4JOMA 2VB6A 4N9HA 4RB3C 2RNGA 3J81K 4HNTA 1LFPA 2MW8A 5TISC 1MZBA 2OCCH 4YRVA 2V1NA 1YOVB 2M45A 1BI2A 2HS5A 1AKHB 1HQCA 4EATA 2IGKA 1EH6A 1XB4A 1XN7A 2FBIA 1ZREA 3S3MA 4GGGA 4XN0A 2LH9A 2XC7A 1UHSA 1I27A 5L3GA 2VJ4A 4BJ6C 1P7IA 1TWCJ 4HX8A 1YTYA 4CCMA 1DU6A 4AIDA 1X1PA 3H92A 2JRMA 3GYHX 4XRFA 1Y0NA 2XGCA 3V8KA 2LOOA 4BQAA 1JKQC 4CZCA 4UVBA 1DPUA 2X6XA 2HZTA 1YITI 1U0JA 2H09A 2OC6A 1QVUA 3HSFA 3HHHA 3BJAA 1V54H 2ECCA 1IN6A 2JA6J 3T8RA 5HS8A 4IO9F 3WTUC 1NHAA 2W85A 2E2HJ 2V7FA 1JT6A 2B9SA 3F0CA 4D5FA 2FNAA 2HQAA 1C0WA 4NHJA 3BY6A 1O3RA 2KJCA 1V55H 4IPAA 2DK8A 4QLCU 5BS6A 1GVJA 2PJRA 1BL0A 1U5TB 4BGDA 3DFGA 2BXYA 2BBYA 2GXBA 4CCOA 2CFXA 5E3OA 5FKMA 1GT0C 1J09A 1TW2A 2O5RA 1X3UA 2A3SA 1GHCA 4FHTA 1TWAJ 3KX2A 1F9NA 5J47A 2XKOA 4GFBA 1IN7A 2BY3A 2V1XA 4A5NA 4BDYA 1JHFA 3ASOH 1X3WB 5LBQA 5EZGA 5A2QZ 2CQ7A 4IEJA 4C2MJ 1H9TA 4KIFA 2J5PA 4G94A 1G59A 3VDXA 1HSTA 1WKMA 3HDDA 3DF8A 5M3FJ 4ZTJA 1QHGA 2KDZA 1E0EA 2LKSA 3OYMA 2Y0MA 4NNJA 3SEQA 2HOTA 2HDDA 1ZAOA 2EV6A 4KMUX 3VB2A 4UHTA 2JA5J 3WG9A 1S7AA 3EYIA 3JCUC 2JMWA 2W4SA 3IKTA 3CCSI 1MMDA 1R22A 4XSXF 3HBLA 3GFIA 3W2VA 4A3CJ 3QPLA 2VPRA 4HYEA 2A6EF 4MEXF 1W7PD 1MBFA 1FMWA 4Y4RA 1ENHA 4XN3A 4D7NA 1WJEA 3J7AY 2LF8A 2VE8A 3CJTB 3LFUA 4CA0A 1HBXG 2DDAA 2NS0A 2XUBA 3F8BA 3S2WA 4C3IJ 3UKGA 4BHCA 2ME0A 3RSNA 1IO2A 3GVAA 1K78B 4XIDA 1O3TA 3PO3J 4RLQA 3EUAA 3V4GA 1TNTA 4NB5A 3OYGA 2F6CA 3G6EI 1X19A 4HQMA 3P9KA 1BW6A 2KMUA 3D1NI 3FZVA 1HCRA 2QKLB 3DPTA 1PVEA 3AG2H 4W97A 1ETOA 3CMEI 5JR3A 2O61A 3O6BB 2OF7A 3KP2A 2W84A 3HRUA 4ESFA 1R00A 1SVLA 4S05A 1K78A 2Y0SA 2VODA 2GXGA 3MKZA 3LWFA 2M7BA 2PLYA 5EEHA 2K40A 4G6QA 2QF7A 2ISZA 2P8TA 2KPMA 3HGGA 2LREA 3HSEA 3ZCOA 3BG9A 4M3BA 2TDXA 1E17A 1UHMA 3K9TA 2HYFA 3S1RJ 4CYDA 1B8IB 1UJ8A 3OYIA 1WI3A 1ETQA 3AG4H 2ZNZA 5HNHA 3MCZA 3EDPA 1LE8B 2JPCA 2IS1A 3KIOA 1OPCA 3KYDB 1J75A 4HQEA 5DCFA 1FOWA 3D0SA 4AIKA 5KCMA 3CCQI 3CCLI 3K70D 1VQNI 3BLYA 4V2GA 4WXHA 1QZEA 3WG7H 1U8RA 1D8JA 3BR3A 2DOFA 4ZTFA 2DJNA 3OR1C 3WODF 1HKQA 4FETA 2XAUA 4S04A 4UVCA 3IH3A 5D5VB 5GTHC 2KHMA 4LITA 1IJWC 1NG7A 4RM2A 1J0RA 2ESNA 3KP4A 2ID6A 2MC3A 3AKZA 2NS8A 1EA3A 3KP3A 2VC0A 2NOGA 4ZYAA 4II3A 2XRNA 1QNTA 2IEKA 4RDUA 4A3JJ 4OMYA 1YE9A 1RIOH 4IZZA 2JT1A 1ZN2A 2EFWA 2X1EA 2IAIA 3OYAA 2O0YA 3KP5A 5CLSA 2L54A 2E34A 3W2WA 3VFZA 3H5AA 3S1NJ 5BQTA 2DJIA 3OIPA 2ME6A 1XGSA 5JI6A 1OCTC 3GFLA 1K4TA 3V7CA 3U9GA 3BWGA 2P6SA 3M9AA 2WTEA 2DFEA 4IOCF 3I55I 9ANTA 4HV6A 3CUQC 3O2PE 5J1UA 5AIPA 2KIFA 3BJ6A 5FKOA 4A3IJ 5CKTA 3H0GJ 3I64A 3JW4A 4IHSA 2VOOA 1FP2A 2QSHX 3G3ZA 2KFDA 4I98B 2F5DA 3L9FA 4UUSB 4PJMA 2L4MA 2VQCA 1XDSA 4XKWA 1BOAA 1W4MA 5J40A 1SD5A 3ZMVA 2HXIA 2ZO4A 3LSPA 3SYTA 1LNWA 3CQZJ 1NTCA 2FJ1A 2VKVA 1D3YA 1FBUA 3BR1A 2LG4A 2IGMA 3HG9A 4M73A 4PFOA 2NVXJ 1IGNA 2DXIA 2WADA 4YELA 2DU9A 1WI9A 5FFXA 4MTEA 4CCNA 2JA8J 3I59A 1QPIA 2MH9A 3F72A 5LGUA 1ULYA 4XKVA 4EMSA 4G7HF 2M2EA 5HS9A 2HQNA 3TEDA 2P81A 1X2NA 2B0LA 4S0HB 1V4RA 3F22A 3OYDA 1HW5A 1MBKA 4XONA 5DM7F 1G3SA 1X58A 1Z3YA 4JYKA 3ZQLA 1PUEE 2MC4A 3LSMA 3S2HJ 1VQPI 2VJJA 3PIPF 1OCZH 1P9QC 2M1BA 3KEQA 3BTLA 4MQVA 1SFXA 4B09A 2Z9OA 1DGRM 5JLXA 1WQ2A 4L9TA 2JWTA 2A6TA 5LEKA 1G3WA 2LY2A 1FIPA 4ESJA 3W3CA 4G6TB 3F23A 2LNBA 2BY1A 2DA7A 4C2TA 4LOCA 2QCOA 4LFUA 5C44J 1IRGA 1TW3A 3ECOA 2KL4A 2Y75A 1G3TA 4C9YA 4FTHA 1FNNA 2R7ZJ 3K7AJ 2ETHA 3PIOF 2IPQX 4ZZDA 1AKHA 3GFJA 4RLFA 1HOMA 4GRIA 2L9RA 5L3DA 2EPFA 3B73A 1FYKA 1VQ6I 5KAIC 1T6SA 2JRTA 1KA8A 4PSWA 2DO7A 1WJBA 1ZG3A 5D4SA 3V8JA 3G4SI 4GYGA 3RCOA 1ZRFA 2BY2A 3DU6A 3I54A 2D45A 1HA8A 5JLWA 4N4OB 3DP7A 2VE9A 5IOYA 4CHUA 3BDDA 3AG3H 3G71I 4F52A 4IX7A 3RKQA 4ZYDA 2M8EA 3KZZA 2HVSA 4M3FA 2I10A 4QSHA 2CMPA 4L5IA 1MMAA 2XROA 3BR0A 2WA0A 1OYYA 3GTMJ 4M3GA 5FLXK 1T95A 1U3EM 3BOQA 1GXQA 2PJRB 2K02A 3OYLA 3I56I 4NUBA 4E7JA 1PJRA 2XSDC 4NDLA 1Y1WJ 3MQ0A 1LQ1A 1UB9A 2MFZA 3M8JA 4O6JA 3H9QA 2OCEA 3A0HC 1LJ9A 3QPTA 4AIHA 3FKJA 3RJPA 1JHHA 1D0ZA 3ZP5A 4OINF 2ACJA 3FWEA 1B9NA 1XCVA 2D1VA 5F27A 4LIUA 1BI0A 3U1KA 1JKRC 2ZJRF 3HXLA 2NNNA 3U21A 4Y13A 4PGGA 4EJTA 4I02A 3O3KA 4IF4A 1TP4A 2HQ5A 2C6YA 4OIRF 3H3VK 2WAQN 3CMYA 3CJRB 1MDMA 3A2KA 2WY8Q 1QO0D 1PYVA 2O3FA 1SAXA 3JRCA 3FXOA 3LAJA 3CMMA 3I4MJ 1BI1A 3QWLA 1CF7B 2EFQA 3MAJA 2DOAA 5ICGA 1XSDA 1JXSA 4UUSA 3L2UA 3GTKJ 4E7LA 4XLPF 2MLGA 3CO7C 3TO6A 1D1CA 5E3MA 2LTPA 2V6CA 3KYCB 3ZMDA 1ACIA 5EG0A 2E2JJ 1TTYA 4WWCA 2YU3A 2VONA 1YW9A 2KLOA 2BE5F 3WGGA 2V9PA 3F8NA 2OZUA 1QHHD 2CW0F 2LR8A 3MKLA 4FASD 1XCBA 2GOXB 4F7ZA 1QPMA 2QLZA 4IL6C 1W1WE 2P0WA 4BQOA 1PDNC 5LHIA 1K4SA 4Z6YA 3L00A 3KCCA 2NVYJ 4UY8I 4A2UA 2FE3A 3OYFA 5FKNA 3JAMZ 5HOOA 4G9YA 5JVTA 1UFMA 4F93B 1JKPC 4B3XA 2IT0A 2K9LA 2V1DA 3JRDA 3CCEI 2IRFG 4U7BA 2W24A 1ZLKA 2H94A 3SDBA 4M3EA 3BP8A 1Z21A 3OV8A 2Y2ZA 2EQRA 2VC1A 3A4CA 2QBYB 1U2WA 4PJLA 3P7NA 5LRRA 3DWLE 4YFXF 1I6HJ 2E60A 5D5XB 2CYYA 4M71A 4CSWA 3MZYA 1RNLA 2B7EA 4BY1J 4KT5C 2BHYA 3M1CA 1OLTA 3S8PA 3PNTA 4I0BA 4PK4A 1SVMA 4HSTA 4ON0A 1JTXA 1QBJA 2FXAA 3OL3A 4AYBA 4LB5A 5K5QA 2FD5A 2VJ5A 1A6IA 5DTDA 4IRGA 4E4HA 4PFPA 1ETKA 5K7ZA 4A0ZA 4P5OA 3R61A 3ZQ7A 4HX7A 2CFOA 2DK5A 1T39A 4EV0A 2DW4A 2XV4S 2WB1A 3RQIA 1SFUA 2EZLA 2K3FA 2O7OA 5EEAA 1R9TJ 4B47A 4WXCA 2VXZA 2PN6A 2ID3A 3ISPA 2VQHA 1JT0A 4H4KC 3RPQA 3ZPLA 2NVTJ 4XLNF 3GZ6A 5D4RA 1W36D 3PFYA 2XIGA 2L02A 4XK4A 5HLIA 1CF7A 1GV5A 3K4MA 3H9GA 3NQOA 1RI7A 1IZ1A 1EJ9A 4I6ZA 5KHDA 1TQPA 4C2UA 2L9VA 1S9HA 1X4PA 2E1CA 5H20A 1FEXA 2ZNYA 1ETXA 4XQFA 2RQPA 2NNYA 1D8KA 4MO7A 2M5WA 3IRQA 2GZWA 3GBGA 4HAMA 4A3LJ 2OPTA 3ECHA 4IRHA 4O5VA 4BQQA 5IP6A 3TKYA 5JFRA 4QWQA 1AU7A 2UZKA 2W25A 3R60A 1J5YA 2DODA 3F21A 1W5TA 2BZTA 3RTRA 5L3FA 4A3GJ 4KT6A 2I8DA 1IRFA 2JVGA 3H1CA 3K6GA 2F5EA 2UXXA 4OIPF 2XSJC 4YG2F 1ZRCA 4Y7NJ 1RETA 2K9NA 3FF5A 3ZQIA 3TO9A 3DKWA 1LDKB 3PM1A 2K3PA 4IKFA 2ZJQF 2KRCA 4UV8A 2COBA 1NG6A 5L3CA 5DYMA 3DU5A 3E3VA 5E8IA 1ETVA 2DLLA 2RAEA 1OISA 3F8CA 3W2AA 2CV0A 3WU0A 4JX4A 3DCFA 3C7JA 3F8MA 4K2EA 1B9MA 1MH3A 1XG1A 3L09A 1FTTA 1EH8A 1LDDA 2HFHA 2QENA 2ZSHB 3V7RA 1VZ0A 2R7QA 4ENKA 1FIAA 2QVOA 4EM0B 2RDPA 1A5JA 2CUZA 3BPXA 4RAFA 2QSGX 1KU7A 5J4YA 4LMYA 4CYCA 3KYLA 4DYCA 2BW3B 2Y69H 1TQIA 3LOCA 4XORA 4M9ZA 3ABMH 2M8GX 2VT2A 2YX4A 1QU3A 5BMZA 4UV9A 2JZYA 1IC8A 1QZYA 1RC9A 3ZRGA 4XLFA 3GTPJ 5F0CA 4BE0A 2DT6A 2GWRA 3HTUA 1H88C 3QU3A 1R71A 3WGIA 2K7LA 3C3WA 2CQXA 4J19A 1ZELA 2EA4A 3S1MJ 1MBGA 2ELJA 3COAC 4BE1A 2VBYA 4HDUA 4L0YB 2CW8A 1NK3P 4L18B 1ZGAA 2V9KA 1P2FA 5ILVA 1J59A 4EJWA 2M3AA 1MSFC 3ELKA 2O9LA 1XGNA 3C1DA 3FXKA 2CUFA 4GCVA 3AL0B 3DXJF 4XOTA 3FK7A 4EJOA 3IRRA 3F6OA 3OS1A 5KVRA 4I2OA 2PMZA 2HYJA 2ISYA 3IL2A 3F3XA 1OCCH 3S3NA 2EV5A 5EZHA 1TNSA 3S93A 5DUIA 3QP6A 5K7FA 2CQKA 1W0TA 3G2BA 2M0CA 4I01A 4QPQA 3FXUA 1VQLI 3OWTA 4L0ZB 4AUXA 5BPIA 4MFDA 1BR4A 2ZSIB 4HF1A 3CLQA 3LAPA 4LB6B 3Q5FA 2HKOA 4F92B 4KMFA 3CTAA 3QOPA 4DGWB 3FKIJ 1IW7F 3I9V2 3G1MA 3S3OA 3TW7A 2DYRH 2VLAA 3S15J 2CO5A 4HBLA 4U0VA 5IP9J 2EIMH 5KNLA 2JN6A 4IJAA 2PMZN 1UELB 1U9NA 2VKHA 3SJMA 1BA5A 2HVQA 1TWGJ 5FFZA 4AVZA 4D5CA 3H5NA 4WXDA 2AS5F 1YIOA 2CS3A 2VQGA 1WFXA 3PUBA 4OAYA 4BHBA 3MVPA 2W00A 1Z91A 4E70A 1T56A 4MFEA 4CGZA 3GW2A 1T98A 3ESWB 4E7KA 2DCEA 1VTNC 1E3OC 2JSCA 3JAMK 3RPUD 1MGTA 4CUGA 1SD7A 5M5WJ 2FQ3A 2KP6A 5J8FA 2FMYA 5GADJ 1XPXA 1CQTA 2CU7A 5GPCA 1D5VA 2IS4A 3NWTA 1LEBA 2P5KA 2D1HA 3K4CA 1R58A 2UV1A 3WE3A 3UR3C 4DW6A 3CF5F 2VKDA 3SZGA 4BQNA 2EZIA 2DMPA 3GFMA 2L7MP 5EYRA 3MWMA 4M9XA 1AOYA 3HHGA 1LB2A 1Z6TA 2WAEA 1DQUA 4XLCA 2XAJA 1TC3C 1VQ9I 3HOWJ 3EETA 4PGHA 4DBRA 4DQ2A 1ORKA 2DYSH 4C30A 3ZMUA 1LPQA 2PEXA 5FLMJ 3BG6A 5B5EC 4WCGA 2M4GA 5IPAA 4QPOA 3TL4X 2MSYA 2LKPA 3GTOJ 1D0YA 3SQNA 3X2QH 1Q1HA 3CCJI 3K2AA 5LEJA 3JR9A 2ZMEA 4L9JA 4LD5A 2M0MA 3CCUI 1Y1VJ 2DA4A 2NYXA 3ULQB 3ABUA 3VSLA 4J00A 2EK5A 2CQNA 3OOPA 4TV7A 5LRSA 5FGMA 2LLKA 2MH2A 4UXNA 3CO6C 2CW7A 3LQRA 5M5YJ 5E1WA 3S32A 3FHZA 4BDZA 3EYYA 2GQQA 1V3FA 1G8XA 3FMRA 2KRHA 4B4CA 3DLLF 1S29A 4XKBA 2VOPA 2ESHA 3SDGA 3I4PA 2R5ZA 3RDIA 2E7WA 3GZ5A 2W82A 3GEZA 2IA1A 2IGNA 1I1SA 2YX7A 1FTZA 2FUG2 3RQ4A 5E3NA 1W7PB 3M8FA 4YFKF 2P6TA 4BBRJ 3P5JA 3CCVI 2XPWA 3E1SA 3BR5A 4A3EJ 1YO5C 5BPDA 3L2RA 3L2WA 5J1YA 3JREA 4PJ0C 5TRDA 1XGMA 3EPZA 4G12A 2YPRA 3KLNA 3ZGKA 1UAAA 3A01A 1T2KA 3J7YJ 1K6YA 2M87A 2E5NA 1HW2A 3HOUJ 3ZQGA 2E1MB 4MTDA 2K9SA 5GAHJ 2DA1A 3M3YJ 1H8AC 1WJAA 2HOAA 5J8CA 4IHTA 1GDTA 5LHHA 5E17F 5HVQC 5HLHA 2CUJA 3E6BA 1KU2A 4AYBN 2AQEA 3AG1H 1WRJA 3U2RA 1APLC 1Y6IA 1Z7UA 2VQLA 4KISA 4I09A 1X1CA 2A05A 1IDYA 4YIIA 4DZJA 5CQGA 2LK2A 3QRFF 4BS9A 3IP4B 1VQ7I 2DT5A 1RUNA 1W5SA 2JA7J 2M4KA 3K69A 2FX0A 4MGRA 4AU7A 4R79A 2X6WA 1SANA 2WY7Q 4KDPA 2DPUA 5B1AH 1JUSA 5LD2C 4A93J 2M9HA 5E1ZB 4HF0A 5HDKA 3ZQHA 2O6GE 2ZMEB 4N9IA 2E1NA 3E5UA 4ENJA 3I5UA 1AA7A 2QQBA 4NC8A 5GAGJ 1YQAA 3RZDJ 2BVMA 4LG0B 2K9MA 3S14J 2R7WA 1V5EA 4YFNF 4LLNA 5D5UB 4ANJA 2FA5A 4PJJA 2DOEA 3HJEA 3L2VA 4JK1X 4Q48A 3WGHA 4D0PA 3FISA 1S5LC 2YUSA 2ZFWA 1XMXA 3CZ6A 3FM5A 2DA6A 1K6OA 1WJFA 2CUEA 3IAM2 1O4XA 4I99C 5CVIA 2ECBA 1T38A 1V5GA 2KIMA 5EF6A 5B66C 4I76A 3QPSA 2K27A 1IXRC 3CDLA 4DZPA 2DPDA 1YX3A 2FBKA 2E19A 2KT0A 5BOXA 3VSKA 2DFFA 2ZC2A 3D5SC 2GLOA 1XMAA 2UXNA 2IA2A 1IUYA 3M8EA 1XTAA 2OZ6A 1Y56A 1JI8A 3KFWX 5E1XA 1HC8A 3SXYA 1UCRA 1JJ6C 1OYWA 3Q0VA 2LMDA 1EH7A 4PCQA 4BACA 4AD9A 3BG3A 3GTJJ 1Z1DA 2L7ZA 3OYEA 1BR2A 2RN7A 2B63J 1S8NA 1ZG1A 4IQ4A 4Y17A 2HTSA 1YS7A 2JA2A 3BCBA 3N4MA 1WJCA 3P9IA 2Q0OA 1P4XA 1RR8C 1MJBA 2VBWA 3GO5A 3I0TA 2YS9A 5FROA 2DA2A 1IN8A 3R4KA 1N78A 1ERDA 4BL0B 1Z67A 1IXSB 2KZVA 3C2GA 3KE2A 5FKKA 2UUZA 1REPC 1D0XA 2XF7A 2BW3A 4LIVA 2OUMA 3BTCA 1ZQ3P 1FOXA 5ICEA 1OCPA 3K70C 3A0BC 2HQRA 3IHUA 4IVNA 3PSFA 2R5YB 3ONQA 2NAZA 4Y15A 1Z3XA 4UUVA 2I5UA 3ZMTA 4RMNA 3NEUA 3QYEA 2Q8KA 2LY1A 2DFIA 4BXXJ 1I6XA 1XGOA 3HM5A 1I3QJ 3HOXJ 4PZJA 1U5TA 4HNUA 2NS7A 2Q1ZB 5H6RA 3BQZA 3TDUC 3GLLA 2X0LA 1A36A 2R93J 3GZNB 2X4HA 1SEUA 3O8HA 1G6NA 1IN5A 1HDDC 2DA5A 2LBFB 1EF4A 4WK8F 3MN2A 3SEZA 3ZQQA 2LF7A 3DLAA 4L5JA 4KN4X 5E79C 4CO8A 4BJ5C 1RR7A 3OIQA 4NC6A 1IRZA 4U0YA 2Q2EB 4LGWA 5FD5A 1EV7A 1F36A 1BR1A 1ZYRF 1LFBA 2JTVA 4JX6A 3HPGA 3B6AA 1QGPA 2FOWA 3D5RC 3ERMA 3S1QJ 1AHDP 4II2A 1RRJA 2XHKA 5H6QA 2R7OA 2FU4A 2RREA 1SC7A 3VOEA 1LEAA 3Q9VA 4RBOA 3FX3A 1YW7A 3GUDA 3J7ZI 3BTIA 2A61A 4KNYA 2EZHA 2XGDA 1YG2A 1K61A 1BN5A 2EJRA 4MHGA 3DTKA 1SAUA 1B6AA 1E3PA 2Y9ZA 3PQKA 3MFKA 2EB7A 1MNMC 3R6SA 4QTRA 2L3DA 4E7IA 4HLYA 3NAUA 3DKXA 3LMMA 4AVPA 4G7OF 4IXAA 3HOZJ 4B44A 3DBRB 2M30A 3TMOA 2GOMA 2ZKZA 5F6FA 2KISA 2L4AA 4NQWB 4A0YA 2R7DA 2LYCA 3J7AO 2K9QA 1YJNI 1QVTA 2EINH 5IOZA 3ERED 2KIQA 4G7ZF 5DM6F 1MKMA 1HKSA 4U0WA 1WH5A 1J9IA 3D5LA 2FMLA 3M4OJ 2LVSA 4E7ZA 4UNOA 3DKYA 4OOIA 1B72A 1YIJI 2FEZA 2ZJPF 4IOAF 2P4WA 2IS6A 3FXMA 2F4MB 2P7VB 4ZZLA 3PFIA 5E18F
chains in the Genus database with same CATH topology
4BXUA 3TO7A 1LDJA 1DDNA 1MJ9A 2H6BA 2CWEA 1KYZA 5HDNA 2Y48A 2H27A 2HR3A 3QAHA 2PJPA 5HS7A 1K79A 2GIVA 1QZZA 3BPVA 1BBYA 2FSWA 2JPBA 3WTXC 3SZPA 3MEXA 3AAFA 4O3MA 3WTYC 2DBBA 5D6FA 3J80K 5K5RA 2QZ8A 1HSJA 1CGPA 3I58A 2PG4A 4LG0A 1S7OA 1MJAA 2XAQA 1ZG5A 2R3SA 5LGTA 2BV6A 4HLXA 3J81Z 5ILUA 5ED4A 2EFOA 3CLOA 2K4JA 1SD6A 3REOA 2HWVA 3P9CA 4EM2A 3KEOA 3I53A 3KP7A 1R5GA 3EUHA 4YIFA 1WSUA 1FC3A 1DP7P 3K1NA 1FLIA 3IWZA 2RVCA 1R7JA 3RKXA 3JSOA 1HKTA 2BGCA 2F2EA 4BHPA 2XAGA 4L9VA 5JHUA 3QP5A 1OYIA 1BC7C 3FXQA 1G3YA 3F8FA 5D8LB 2VT3A 3PQJA 1IXCA 1P4WA 1SMTA 5J6XA 1BM9A 3GXOA 5ILSA 1SD4A 3HRTA 4EM1A 4LLLA 4I7HA 1KGSA 1FBSA 1PP8F 2QM3A 1ZH5A 4EGZA 4G6DA 3RYPA 2HTJA 2KJBA 5A2QK 2O8XA 1MD0A 3E5QA 5CVJA 4JQFA 2V9VA 4R8HA 2HGCA 3I59B 4A6DA 2P5LC 5DCMB 2RC4A 4LJZF 2OAZA 1ON1A 4BYYA 3WTSC 3DQVC 2STTA 3T1BA 1TBXA 2FOKA 1YS6A 1MDMB 1USSA 5DUKA 2H6CA 1ZGJA 3L7WA 1BI3A 2LDUA 2VBZA 3FMSA 4MEYF 1U6GA 2QUFA 5ERIA 3HRSA 3L2CA 2STWA 1SMYF 1H9GA 3JSPA 1FY7A 1XD7A 3ZN1A 4KA4A 1FP1D 1FYMA 2RKHA 3WTZA 4HF2A 4HZFA 1HW1A 4OMZA 2A07F 3E6MA 3FMQA 2W57A 3R0AA 3EQLF 3TOAA 1U78A 1J2XA 1FSEA 2YR2A 2A6HF 5F1RA 4ETSA 1FPQA 4DNCA 2K86A 2R7FA 1KQ8A 5ICFA 4WF2A 2XAHA 1WWXA 5D8KB 3BROA 2QYOA 1H0MA 2DTRA 5HLGA 5D6EA 2NRAC 2WC2A 5TJJA 4GO1A 3FM3A 3R0JA 4Q5SF 5LGNA 1FT9A 3KP6A 3IKVA 2XKPA 2VN2A 1F1ZA 3BZ6A 5FLXZ 3MZHA 5K5OA 2OQRA 4KIBA 4Q4ZF 2OA4A 4M6YA 3JTGA 2COMA 2EWNA 3H3UA 1BIAA 1IN4A 1S6LA 2GAUA 1P4AA 2IW5A 3LFKA 2WWYA 1FBQA 5AONA 4M72A 2V1UA 2HKXA 2Z5UA 5FD6A 1RUOA 3I71A 2CSOA 3K1PA 2DQRA 4MNUA 1Y0UA 3FXRA 4H0EA 4CDGA 3SZTA 1KU3A 1TQMA 3HSRA 5DEQA 3GLXA 3W6JB 4B8XA 3N97A 4P9FA 4U7DA 3M1EA 1B59A 3TGNA 1TLHB 1F4KA 4A5MA 2PI0A 1R1TA 2IJLA 1I5ZA 5K1YA 4OIQF 2CGPA 1KU9A 3RYRA 2FBHA 2RGVA 3HUGA 1FOKA 1Z9CA 3HOSA 4ZYHA 2EFPA 4LK0F 3RI4A 1FWZA 3H3ZA 4ZYGA 3K1MA 2GA1A 2Q2EA 4A12A 1P92A 5L3EA 3CUQB 2MLKA 1DUXC 5IT9Z 2FNPA 5FO5A 2QBYA 3ABTA 3IC7A 1QQIA 4U88A 1Z05A 6PAXA 4RAZA 1ODDA 2FF4A 4KYWA 3CUOA 1ONVA 1K7AA 4I0AA 3E6CC 3CUQA 4CXFA 2CG4A 3TQNA 4KFCA 1OKRA 2OU2A 2QWWA 4CZZA 2QQAA 4KIGA 2J5OA 2PMUA 3J80Z 4XBFA 4BH9A 3C18A 4RGRA 1BIBA 2Z33A 3F6VA 1KQ9A 2OD5A 2V79A 1USTA 2LSOA 2GA2A 1R5HA 4ASNA 1R36A 4G8XA 3WTTC 2OQGA 1J7KA 1FYLA 2A68F 4M6XA 2PQ8A 4JBAA 1L3LA 1DPRA 2ELHA 1OR7A 5D5WB 1BC8C 4P55A 4OU0A 2DI3A 5E8GA 4ENMA 3QU6A 2ZBKA 2IVMA 5F64A 1IF1A 4A0XA 1E2XA 1O57A 5KK1A 4R1HA 2A69F 4KUMA 2EV0A 1YYVA 3T5XA 1UHWA 3BJOA 1O7LA 4KICA 3KETA 3ZMSA 3GF2A 1R1UA 1B1BA 1B4AA 4WX9A 1ON2A 4EGYA 4ZYEA 2IA0A 1XDUA 4GYIA 3KLOA 1XSXA 3T8TA 2ZJ2A 2XVCA 4OIOF 3G73A 1L0OC 2G7HA 3VODA 3ZN0A 1XMKA 3KZYA 2MBFA 1W7PA 3DV8A 2UWMA 2F5FA 1YLFA 4CICA 1FX7A 3B02A 2ZCWA 1JE8A 4BNCA 5CJ9A 5IT9K 3HYIA 3QPHA 2PFBA 5DDGA 3LA7A 4ESBA 4LK1F 4L9NA 4HV5A 4LLGF 4UVAA 4GXOA 1AWCA 3RIRA 1HXDA 2VBXA 4HX4A 1R1VA 3E97A 4A6EA 1KYWA 3JTHA 4RGXA 1SFEA 2A5YB 1KQ0A 4XSZF 4BAYA 1R23A 2MD5A 1G4DA 2HDCA 2OBPA 5EEGA 3K0LA 3TOBA 4IRIA 3LQQA 3WTVC 5DD8A 2F5CA 1OMIA 3LA3A 2WV0A 5HDGA 5DV5A 3DEUA 4RAYA 2FRHA 4P9UA 4FT8A 4HDVA 5IT3A 4HOBA 4NQWA 2BYVE 2Z99A 3ML6A 4RB1A 3SHFA 3NRVA 2G9WA 3HOTA 4EQQA 2ZXJA 1YFHA 2O03A 2DQLA 4PDKA 4N0BA 1STZA 2YSRA 1XSVA 3SFZA 2E7XA 1ZRDA 2KRFA 4RB2C 2MA3A 1O3QA 1ZARA 3CDHA 5CVRA 2G7UA 4KN7X 3K2ZA 3HRMA 4FX0A 2RNJA 3RKYA 3CJNA 3V7SA 1Z6RA 5ICCA 1ZLJA 2HYGD 4Q47A 1LVAA 1U5TC 3RPUA 3RKWA 5E20A 3ZMZA 2ADUA 4M74A 2Z3YA 1YW8A 5L3BA 2PMHA 3LSTA 3HIFA 3ROUA 2KKOA 4RGUA 1T0FA 2IP2A 1O3SA 4RB0A 3WE2A 3VEPA 3IWFA 4Z2YA 5FB2A 3Q9SA 4P96A 3TDZC 5CYVA 3HTSB 2K4BA 2EFNA 4M9SA 3T0YA 2D2WA 2PBIA 3W6KB 4EVIA 3LA2A 1RZ4A 2XAFA 4HA8A 2BEOA 2L01A 4HW0A 3GWZA 1BJAA 4MQ9F 2HOEA 4FX4A 1F5TA 4AIJA 5DD4A 5LLQA 1P6RA 5LHGA 2HEOA 1O7FA 2KIUA 2QQ9A 4AWXB 5AIQA 1IAWA 2P5VA 5CVUA 3GX4X 5CVVA 3WU1B 1FSHA 4ENNA 4EJVA 2DAOA 2EA2A 1I1GA 2RV8A 1S3JA 3E5XA 3M7GA 2XASA 3DPLC 1PP7U 3U1DA 3WTWC 2XGXA 1GXPA 4RS8A 1ZHFA 4ZH4F 2P7CB 5DCMA 1JGSA 3V8LA 2AXLA 4EJUA 3E6DA 4RGSA 1FZPB 1A04A 4N9HA 4RB3C 3J81K 1MZBA 2M45A 1BI2A 2HS5A 1HQCA 1EH6A 1XB4A 1XN7A 2FBIA 1ZREA 4GGGA 5L3GA 1I27A 4HX8A 1YTYA 3H92A 3GYHX 4XRFA 3V8KA 4BQAA 4UVBA 1DPUA 2HZTA 2H09A 3HSFA 3HHHA 3BJAA 1IN6A 3T8RA 5HS8A 3WTUC 1NHAA 2W85A 2FNAA 1C0WA 4NHJA 3BY6A 1O3RA 2KJCA 5BS6A 4IPAA 2DK8A 4QLCU 1GVJA 1U5TB 3DFGA 2BBYA 2GXBA 2CFXA 1TW2A 1X3UA 2A3SA 1GHCA 4FHTA 1F9NA 2XKOA 1IN7A 2V1XA 4A5NA 1JHFA 5LBQA 5A2QZ 1H9TA 4KIFA 2J5PA 4G94A 1HSTA 1WKMA 3DF8A 2Y0MA 1ZAOA 2EV6A 4KMUX 3VB2A 4UHTA 3WG9A 1S7AA 3EYIA 3IKTA 1R22A 4XSXF 3GFIA 4HYEA 2A6EF 4MEXF 1W7PD 2LF8A 2VE8A 1HBXG 2NS0A 3F8BA 2XUBA 3S2WA 4BHCA 1K78B 3GVAA 1O3TA 3V4GA 1TNTA 4NB5A 4HQMA 3P9KA 3FZVA 3DPTA 5JR3A 2O61A 3O6BB 3KP2A 2W84A 3HRUA 4ESFA 1R00A 4S05A 1K78A 2VODA 2GXGA 3LWFA 2PLYA 5EEHA 4G6QA 2ISZA 2P8TA 3HSEA 2TDXA 1E17A 1UHMA 3K9TA 2HYFA 4CYDA 2ZNZA 3MCZA 3EDPA 2JPCA 1OPCA 1J75A 4HQEA 5DCFA 4AIKA 3D0SA 4WXHA 1U8RA 1D8JA 3WODF 1HKQA 4S04A 4UVCA 5D5VB 1J0RA 2ESNA 3KP4A 2MC3A 3KP3A 2VC0A 2XRNA 1QNTA 4OMYA 1RIOH 2JT1A 1ZN2A 2EFWA 2O0YA 3KP5A 5CLSA 2L54A 3VFZA 5BQTA 1XGSA 5JI6A 3GFLA 3V7CA 3U9GA 3BWGA 2P6SA 3M9AA 2WTEA 4HV6A 3CUQC 3O2PE 5AIPA 2KIFA 3BJ6A 3I64A 3JW4A 4IHSA 2VOOA 1FP2A 3G3ZA 4I98B 2F5DA 3L9FA 2L4MA 1XDSA 1BOAA 1W4MA 1SD5A 3ZMVA 2ZO4A 1LNWA 1D3YA 1FBUA 4M73A 2DU9A 1WI9A 5FFXA 4MTEA 3I59A 2MH9A 3F72A 5LGUA 1ULYA 4EMSA 4G7HF 5HS9A 2HQNA 2B0LA 1V4RA 3F22A 1HW5A 1G3SA 1PUEE 4B09A 2M1BA 3KEQA 4MQVA 1SFXA 2Z9OA 1WQ2A 4L9TA 5LEKA 1G3WA 4ESJA 3F23A 2LNBA 4LFUA 1IRGA 1TW3A 3ECOA 2Y75A 1G3TA 1FNNA 2ETHA 2IPQX 4ZZDA 3GFJA 5L3DA 3B73A 1FYKA 1T6SA 2JRTA 1KA8A 2DO7A 1ZG3A 5D4SA 3V8JA 4GYGA 1ZRFA 3I54A 2D45A 3DP7A 2VE9A 4CHUA 3BDDA 4ZYDA 2M8EA 3KZZA 4L5IA 2XROA 1OYYA 5FLXK 1U3EM 3BOQA 1GXQA 2K02A 3MQ0A 1LQ1A 1UB9A 4O6JA 1LJ9A 3QPTA 4AIHA 3RJPA 1JHHA 3ZP5A 2ACJA 4OINF 3FWEA 1B9NA 1XCVA 2D1VA 1BI0A 2NNNA 4Y13A 4PGGA 4EJTA 4I02A 3O3KA 4IF4A 2C6YA 4OIRF 1MDMA 1QO0D 2O3FA 1SAXA 3LAJA 1BI1A 1CF7B 2EFQA 3MAJA 5ICGA 1XSDA 1JXSA 4XLPF 2MLGA 3CO7C 3TO6A 2V6CA 3ZMDA 1TTYA 4WWCA 2YU3A 2VONA 1YW9A 2BE5F 3WGGA 3F8NA 2OZUA 2CW0F 1XCBA 4F7ZA 1QPMA 2QLZA 1PDNC 5LHIA 3L00A 3KCCA 4A2UA 2FE3A 3JAMZ 5HOOA 4G9YA 5JVTA 1UFMA 2IT0A 2V1DA 2IRFG 4U7BA 2W24A 1ZLKA 2H94A 3BP8A 3OV8A 2VC1A 2QBYB 1U2WA 3P7NA 5LRRA 4YFXF 5D5XB 2CYYA 4M71A 3MZYA 1RNLA 4KT5C 4I0BA 4ON0A 1QBJA 2FXAA 4LB5A 5K5QA 4IRGA 4A0ZA 4P5OA 3R61A 3ZQ7A 4HX7A 2DK5A 1T39A 4EV0A 2DW4A 2XV4S 1SFUA 4WXCA 2VXZA 2PN6A 3ISPA 3RPQA 3ZPLA 4XLNF 3GZ6A 5D4RA 2XIGA 2L02A 5HLIA 1CF7A 3NQOA 1RI7A 1IZ1A 1TQPA 2E1CA 5H20A 2ZNYA 2RQPA 2NNYA 1D8KA 3IRQA 2M5WA 2GZWA 4HAMA 3ECHA 4IRHA 4O5VA 3TKYA 5JFRA 4QWQA 2UZKA 2W25A 3R60A 1J5YA 3F21A 1W5TA 3RTRA 5L3FA 1IRFA 2F5EA 4OIPF 2UXXA 4YG2F 1ZRCA 3FF5A 3TO9A 3DKWA 1LDKB 4UV8A 5L3CA 5DYMA 3E3VA 5E8IA 2DLLA 3F8CA 3WU0A 3F8MA 3C7JA 4K2EA 1B9MA 3L09A 1EH8A 1LDDA 2HFHA 2QENA 3V7RA 4ENKA 2QVOA 4EM0B 2RDPA 3BPXA 1KU7A 4LMYA 1TQIA 4M9ZA 2VT2A 2YX4A 5BMZA 4UV9A 2JZYA 1QZYA 2GWRA 3HTUA 3QU3A 3WGIA 2K7LA 3C3WA 2EA4A 3COAC 2VBYA 4HDUA 4L0YB 4L18B 1ZGAA 1P2FA 5ILVA 1J59A 4EJWA 3ELKA 1XGNA 3C1DA 4GCVA 3DXJF 4EJOA 3IRRA 3F6OA 5KVRA 4I2OA 2ISYA 3IL2A 3F3XA 2EV5A 1TNSA 5DUIA 3QP6A 2CQKA 4I01A 3FXUA 4L0ZB 5BPIA 4HF1A 3LAPA 4LB6B 3Q5FA 2HKOA 4KMFA 3CTAA 3QOPA 1IW7F 2CO5A 4HBLA 4U0VA 4IJAA 5FFZA 4WXDA 2AS5F 1YIOA 4BHBA 1Z91A 4E70A 4CGZA 3GW2A 1T98A 1VTNC 2JSCA 3JAMK 1MGTA 1SD7A 2FQ3A 5J8FA 2FMYA 1D5VA 1LEBA 2P5KA 2D1HA 1R58A 3WE3A 3GFMA 3MWMA 4M9XA 1AOYA 3HHGA 1LB2A 1Z6TA 2XAJA 3EETA 4PGHA 4DQ2A 3ZMUA 2PEXA 4WCGA 2LKPA 3SQNA 1Q1HA 5LEJA 2ZMEA 4L9JA 4LD5A 3ULQB 2NYXA 3ABUA 2EK5A 3OOPA 4TV7A 5LRSA 5FGMA 2MH2A 4UXNA 3CO6C 3LQRA 5E1WA 3FHZA 3EYYA 2GQQA 1V3FA 3FMRA 1S29A 2VOPA 2ESHA 3I4PA 3RDIA 2E7WA 3GZ5A 3GEZA 2IA1A 1I1SA 2YX7A 1W7PB 3M8FA 4YFKF 2P6TA 1YO5C 5BPDA 5TRDA 1XGMA 2YPRA 3KLNA 1T2KA 2M87A 1HW2A 4MTDA 5J8CA 4IHTA 5LHHA 5E17F 5HVQC 5HLHA 3E6BA 1KU2A 1WRJA 3U2RA 1Z7UA 4I09A 4YIIA 3QRFF 2DT5A 1RUNA 1W5SA 3K69A 4MGRA 4R79A 4KDPA 2DPUA 5E1ZB 5HDKA 4HF0A 2O6GE 2ZMEB 4N9IA 2E1NA 3E5UA 4ENJA 3I5UA 2QQBA 1YQAA 4LG0B 4YFNF 4LLNA 5D5UB 2FA5A 4JK1X 4Q48A 3WGHA 4D0PA 2ZFWA 3FM5A 1K6OA 5CVIA 1T38A 2KIMA 2K27A 1IXRC 2DPDA 2FBKA 5BOXA 1XMAA 2UXNA 2IA2A 1IUYA 3M8EA 2OZ6A 3KFWX 5E1XA 3SXYA 1UCRA 1OYWA 1EH7A 4PCQA 4AD9A 1Z1DA 2RN7A 1S8NA 1ZG1A 4Y17A 2HTSA 1YS7A 3N4MA 3P9IA 2Q0OA 1P4XA 1MJBA 2VBWA 3GO5A 3I0TA 1IN8A 3R4KA 3KE2A 1IXSB 1REPC 5ICEA 2HQRA 3IHUA 4IVNA 2NAZA 4Y15A 4UUVA 3ZMTA 3NEUA 2Q8KA 2DFIA 1I6XA 1XGOA 4PZJA 1U5TA 3TDUC 5H6RA 2X0LA 2X4HA 1G6NA 1IN5A 4WK8F 2LF7A 4L5JA 4KN4X 4CO8A 4U0YA 4LGWA 5FD5A 1EV7A 1ZYRF 2JTVA 1QGPA 2XHKA 5H6QA 2FU4A 3VOEA 1LEAA 3Q9VA 3FX3A 1YW7A 3GUDA 2A61A 4KNYA 1YG2A 1BN5A 2EJRA 4MHGA 1B6AA 3PQKA 3MFKA 2EB7A 3R6SA 2L3DA 4HLYA 4AVPA 4G7OF 4IXAA 2M30A 2ZKZA 5F6FA 2L4AA 4A0YA 2R7DA 3J7AO 3ERED 4G7ZF 1MKMA 1HKSA 4U0WA 1J9IA 3D5LA 2FMLA 4UNOA 4OOIA 2FEZA 2P4WA 2P7VB 4ZZLA 3PFIA 5E18F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXU A;  3TO7 A;  1LDJ A;  1DDN A;  1MJ9 A;  2H6B A;  2CWE A;  1KYZ A;  5HDN A;  2Y48 A;  2H27 A;  2HR3 A;  3QAH A;  2PJP A;  5HS7 A;  1K79 A;  2GIV A;  1QZZ A;  3BPV A;  1BBY A;  2FSW A;  2JPB A;  3WTX C;  3SZP A;  3MEX A;  3AAF A;  4O3M A;  3WTY C;  2DBB A;  5D6F A;  3J80 K;  5K5R A;  2QZ8 A;  1HSJ A;  1CGP A;  3I58 A;  2PG4 A;  4LG0 A;  1S7O A;  1MJA A;  2XAQ A;  1ZG5 A;  2R3S A;  5LGT A;  2BV6 A;  4HLX A;  3J81 Z;  5ILU A;  5ED4 A;  2EFO A;  3CLO A;  2K4J A;  1SD6 A;  3REO A;  2HWV A;  3P9C A;  4EM2 A;  3KEO A;  3I53 A;  3KP7 A;  1R5G A;  3EUH A;  4YIF A;  1WSU A;  1FC3 A;  1DP7 P;  3K1N A;  1FLI A;  3IWZ A;  2RVC A;  1R7J A;  3RKX A;  3JSO A;  1HKT A;  2BGC A;  2F2E A;  4BHP A;  2XAG A;  4L9V A;  5JHU A;  3QP5 A;  1OYI A;  1BC7 C;  3FXQ A;  1G3Y A;  3F8F A;  5D8L B;  2VT3 A;  3PQJ A;  1IXC A;  1P4W A;  1SMT A;  5J6X A;  1BM9 A;  3GXO A;  5ILS A;  1SD4 A;  3HRT A;  4EM1 A;  4LLL A;  4I7H A;  1KGS A;  1FBS A;  1PP8 F;  2QM3 A;  1ZH5 A;  4EGZ A;  4G6D A;  3RYP A;  2HTJ A;  2KJB A;  5A2Q K;  2O8X A;  1MD0 A;  3E5Q A;  5CVJ A;  4JQF A;  2V9V A;  4R8H A;  2HGC A;  3I59 B;  4A6D A;  2P5L C;  5DCM B;  2RC4 A;  4LJZ F;  2OAZ A;  1ON1 A;  4BYY A;  3WTS C;  3DQV C;  2STT A;  3T1B A;  1TBX A;  2FOK A;  1YS6 A;  1MDM B;  1USS A;  5DUK A;  2H6C A;  1ZGJ A;  3L7W A;  1BI3 A;  2LDU A;  2VBZ A;  3FMS A;  4MEY F;  1U6G A;  2QUF A;  5ERI A;  3HRS A;  3L2C A;  2STW A;  1SMY F;  1H9G A;  3JSP A;  1FY7 A;  1XD7 A;  3ZN1 A;  4KA4 A;  1FP1 D;  1FYM A;  2RKH A;  3WTZ A;  4HF2 A;  4HZF A;  1HW1 A;  4OMZ A;  2A07 F;  3E6M A;  3FMQ A;  2W57 A;  3R0A A;  3EQL F;  3TOA A;  1U78 A;  1J2X A;  1FSE A;  2YR2 A;  2A6H F;  5F1R A;  4ETS A;  1FPQ A;  4DNC A;  2K86 A;  2R7F A;  1KQ8 A;  5ICF A;  4WF2 A;  2XAH A;  1WWX A;  5D8K B;  3BRO A;  2QYO A;  1H0M A;  2DTR A;  5HLG A;  5D6E A;  2NRA C;  2WC2 A;  5TJJ A;  4GO1 A;  3FM3 A;  3R0J A;  4Q5S F;  5LGN A;  1FT9 A;  3KP6 A;  3IKV A;  2XKP A;  2VN2 A;  1F1Z A;  3BZ6 A;  5FLX Z;  3MZH A;  5K5O A;  2OQR A;  4KIB A;  4Q4Z F;  2OA4 A;  4M6Y A;  3JTG A;  2COM A;  2EWN A;  3H3U A;  1BIA A;  1IN4 A;  1S6L A;  2GAU A;  1P4A A;  2IW5 A;  3LFK A;  2WWY A;  1FBQ A;  5AON A;  4M72 A;  2V1U A;  2HKX A;  2Z5U A;  5FD6 A;  1RUO A;  3I71 A;  2CSO A;  3K1P A;  2DQR A;  4MNU A;  1Y0U A;  3FXR A;  4H0E A;  4CDG A;  3SZT A;  1KU3 A;  1TQM A;  3HSR A;  5DEQ A;  3GLX A;  3W6J B;  4B8X A;  3N97 A;  4P9F A;  4U7D A;  3M1E A;  1B59 A;  3TGN A;  1TLH B;  1F4K A;  4A5M A;  2PI0 A;  1R1T A;  2IJL A;  1I5Z A;  5K1Y A;  4OIQ F;  2CGP A;  1KU9 A;  3RYR A;  2FBH A;  2RGV A;  3HUG A;  1FOK A;  1Z9C A;  3HOS A;  4ZYH A;  2EFP A;  4LK0 F;  3RI4 A;  1FWZ A;  3H3Z A;  4ZYG A;  3K1M A;  2GA1 A;  2Q2E A;  4A12 A;  1P92 A;  5L3E A;  3CUQ B;  2MLK A;  1DUX C;  5IT9 Z;  2FNP A;  5FO5 A;  2QBY A;  3ABT A;  3IC7 A;  1QQI A;  4U88 A;  1Z05 A;  6PAX A;  4RAZ A;  1ODD A;  2FF4 A;  4KYW A;  3CUO A;  1ONV A;  1K7A A;  4I0A A;  3E6C C;  3CUQ A;  4CXF A;  2CG4 A;  3TQN A;  4KFC A;  1OKR A;  2OU2 A;  2QWW A;  4CZZ A;  2QQA A;  4KIG A;  2J5O A;  2PMU A;  3J80 Z;  4XBF A;  4BH9 A;  3C18 A;  4RGR A;  1BIB A;  2Z33 A;  3F6V A;  1KQ9 A;  2OD5 A;  2V79 A;  1UST A;  2LSO A;  2GA2 A;  1R5H A;  4ASN A;  1R36 A;  4G8X A;  3WTT C;  2OQG A;  1J7K A;  1FYL A;  2A68 F;  4M6X A;  2PQ8 A;  4JBA A;  1L3L A;  1DPR A;  2ELH A;  1OR7 A;  5D5W B;  1BC8 C;  4P55 A;  4OU0 A;  2DI3 A;  5E8G A;  4ENM A;  3QU6 A;  2ZBK A;  2IVM A;  5F64 A;  1IF1 A;  4A0X A;  1E2X A;  1O57 A;  5KK1 A;  4R1H A;  2A69 F;  4KUM A;  2EV0 A;  1YYV A;  3T5X A;  1UHW A;  3BJO A;  1O7L A;  4KIC A;  3KET A;  3ZMS A;  3GF2 A;  1R1U A;  1B1B A;  1B4A A;  4WX9 A;  1ON2 A;  4EGY A;  4ZYE A;  2IA0 A;  1XDU A;  4GYI A;  3KLO A;  1XSX A;  3T8T A;  2ZJ2 A;  2XVC A;  4OIO F;  3G73 A;  1L0O C;  2G7H A;  3VOD A;  3ZN0 A;  1XMK A;  3KZY A;  2MBF A;  1W7P A;  3DV8 A;  2UWM A;  2F5F A;  1YLF A;  4CIC A;  1FX7 A;  3B02 A;  2ZCW A;  1JE8 A;  4BNC A;  5CJ9 A;  5IT9 K;  3HYI A;  3QPH A;  2PFB A;  5DDG A;  3LA7 A;  4ESB A;  4LK1 F;  4L9N A;  4HV5 A;  4LLG F;  4UVA A;  4GXO A;  1AWC A;  3RIR A;  1HXD A;  2VBX A;  4HX4 A;  1R1V A;  3E97 A;  4A6E A;  1KYW A;  3JTH A;  4RGX A;  1SFE A;  2A5Y B;  1KQ0 A;  4XSZ F;  4BAY A;  1R23 A;  2MD5 A;  1G4D A;  2HDC A;  2OBP A;  5EEG A;  3K0L A;  3TOB A;  4IRI A;  3LQQ A;  3WTV C;  5DD8 A;  2F5C A;  1OMI A;  3LA3 A;  2WV0 A;  5HDG A;  5DV5 A;  3DEU A;  4RAY A;  2FRH A;  4P9U A;  4FT8 A;  4HDV A;  5IT3 A;  4HOB A;  4NQW A;  2BYV E;  2Z99 A;  3ML6 A;  4RB1 A;  3SHF A;  3NRV A;  2G9W A;  3HOT A;  4EQQ A;  2ZXJ A;  1YFH A;  2O03 A;  2DQL A;  4PDK A;  4N0B A;  1STZ A;  2YSR A;  1XSV A;  3SFZ A;  2E7X A;  1ZRD A;  2KRF A;  4RB2 C;  2MA3 A;  1O3Q A;  1ZAR A;  3CDH A;  5CVR A;  2G7U A;  4KN7 X;  3K2Z A;  3HRM A;  4FX0 A;  2RNJ A;  3RKY A;  3CJN A;  3V7S A;  1Z6R A;  5ICC A;  1ZLJ A;  2HYG D;  4Q47 A;  1LVA A;  1U5T C;  3RPU A;  3RKW A;  5E20 A;  3ZMZ A;  2ADU A;  4M74 A;  2Z3Y A;  1YW8 A;  5L3B A;  2PMH A;  3LST A;  3HIF A;  3ROU A;  2KKO A;  4RGU A;  1T0F A;  2IP2 A;  1O3S A;  4RB0 A;  3WE2 A;  3VEP A;  3IWF A;  4Z2Y A;  5FB2 A;  3Q9S A;  4P96 A;  3TDZ C;  5CYV A;  3HTS B;  2K4B A;  2EFN A;  4M9S A;  3T0Y A;  2D2W A;  2PBI A;  3W6K B;  4EVI A;  3LA2 A;  1RZ4 A;  2XAF A;  4HA8 A;  2BEO A;  2L01 A;  4HW0 A;  3GWZ A;  1BJA A;  4MQ9 F;  2HOE A;  4FX4 A;  1F5T A;  4AIJ A;  5DD4 A;  5LLQ A;  1P6R A;  5LHG A;  2HEO A;  1O7F A;  2KIU A;  2QQ9 A;  4AWX B;  5AIQ A;  1IAW A;  2P5V A;  5CVU A;  3GX4 X;  5CVV A;  3WU1 B;  1FSH A;  4ENN A;  4EJV A;  2DAO A;  2EA2 A;  1I1G A;  2RV8 A;  1S3J A;  3E5X A;  3M7G A;  2XAS A;  3DPL C;  1PP7 U;  3U1D A;  3WTW C;  2XGX A;  1GXP A;  4RS8 A;  1ZHF A;  4ZH4 F;  2P7C B;  5DCM A;  1JGS A;  3V8L A;  2AXL A;  4EJU A;  3E6D A;  4RGS A;  1FZP B;  1A04 A;  4N9H A;  4RB3 C;  3J81 K;  1MZB A;  2M45 A;  1BI2 A;  2HS5 A;  1HQC A;  1EH6 A;  1XB4 A;  1XN7 A;  2FBI A;  1ZRE A;  4GGG A;  5L3G A;  1I27 A;  4HX8 A;  1YTY A;  3H92 A;  3GYH X;  4XRF A;  3V8K A;  4BQA A;  4UVB A;  1DPU A;  2HZT A;  2H09 A;  3HSF A;  3HHH A;  3BJA A;  1IN6 A;  3T8R A;  5HS8 A;  3WTU C;  1NHA A;  2W85 A;  2FNA A;  1C0W A;  4NHJ A;  3BY6 A;  1O3R A;  2KJC A;  5BS6 A;  4IPA A;  2DK8 A;  4QLC U;  1GVJ A;  1U5T B;  3DFG A;  2BBY A;  2GXB A;  2CFX A;  1TW2 A;  1X3U A;  2A3S A;  1GHC A;  4FHT A;  1F9N A;  2XKO A;  1IN7 A;  2V1X A;  4A5N A;  1JHF A;  5LBQ A;  5A2Q Z;  1H9T A;  4KIF A;  2J5P A;  4G94 A;  1HST A;  1WKM A;  3DF8 A;  2Y0M A;  1ZAO A;  2EV6 A;  4KMU X;  3VB2 A;  4UHT A;  3WG9 A;  1S7A A;  3EYI A;  3IKT A;  1R22 A;  4XSX F;  3GFI A;  4HYE A;  2A6E F;  4MEX F;  1W7P D;  2LF8 A;  2VE8 A;  1HBX G;  2NS0 A;  3F8B A;  2XUB A;  3S2W A;  4BHC A;  1K78 B;  3GVA A;  1O3T A;  3V4G A;  1TNT A;  4NB5 A;  4HQM A;  3P9K A;  3FZV A;  3DPT A;  5JR3 A;  2O61 A;  3O6B B;  3KP2 A;  2W84 A;  3HRU A;  4ESF A;  1R00 A;  4S05 A;  1K78 A;  2VOD A;  2GXG A;  3LWF A;  2PLY A;  5EEH A;  4G6Q A;  2ISZ A;  2P8T A;  3HSE A;  2TDX A;  1E17 A;  1UHM A;  3K9T A;  2HYF A;  4CYD A;  2ZNZ A;  3MCZ A;  3EDP A;  2JPC A;  1OPC A;  1J75 A;  4HQE A;  5DCF A;  4AIK A;  3D0S A;  4WXH A;  1U8R A;  1D8J A;  3WOD F;  1HKQ A;  4S04 A;  4UVC A;  5D5V B;  1J0R A;  2ESN A;  3KP4 A;  2MC3 A;  3KP3 A;  2VC0 A;  2XRN A;  1QNT A;  4OMY A;  1RIO H;  2JT1 A;  1ZN2 A;  2EFW A;  2O0Y A;  3KP5 A;  5CLS A;  2L54 A;  3VFZ A;  5BQT A;  1XGS A;  5JI6 A;  3GFL A;  3V7C A;  3U9G A;  3BWG A;  2P6S A;  3M9A A;  2WTE A;  4HV6 A;  3CUQ C;  3O2P E;  5AIP A;  2KIF A;  3BJ6 A;  3I64 A;  3JW4 A;  4IHS A;  2VOO A;  1FP2 A;  3G3Z A;  4I98 B;  2F5D A;  3L9F A;  2L4M A;  1XDS A;  1BOA A;  1W4M A;  1SD5 A;  3ZMV A;  2ZO4 A;  1LNW A;  1D3Y A;  1FBU A;  4M73 A;  2DU9 A;  1WI9 A;  5FFX A;  4MTE A;  3I59 A;  2MH9 A;  3F72 A;  5LGU A;  1ULY A;  4EMS A;  4G7H F;  5HS9 A;  2HQN A;  2B0L A;  1V4R A;  3F22 A;  1HW5 A;  1G3S A;  1PUE E;  4B09 A;  2M1B A;  3KEQ A;  4MQV A;  1SFX A;  2Z9O A;  1WQ2 A;  4L9T A;  5LEK A;  1G3W A;  4ESJ A;  3F23 A;  2LNB A;  4LFU A;  1IRG A;  1TW3 A;  3ECO A;  2Y75 A;  1G3T A;  1FNN A;  2ETH A;  2IPQ X;  4ZZD A;  3GFJ A;  5L3D A;  3B73 A;  1FYK A;  1T6S A;  2JRT A;  1KA8 A;  2DO7 A;  1ZG3 A;  5D4S A;  3V8J A;  4GYG A;  1ZRF A;  3I54 A;  2D45 A;  3DP7 A;  2VE9 A;  4CHU A;  3BDD A;  4ZYD A;  2M8E A;  3KZZ A;  4L5I A;  2XRO A;  1OYY A;  5FLX K;  1U3E M;  3BOQ A;  1GXQ A;  2K02 A;  3MQ0 A;  1LQ1 A;  1UB9 A;  4O6J A;  1LJ9 A;  3QPT A;  4AIH A;  3RJP A;  1JHH A;  3ZP5 A;  2ACJ A;  4OIN F;  3FWE A;  1B9N A;  1XCV A;  2D1V A;  1BI0 A;  2NNN A;  4Y13 A;  4PGG A;  4EJT A;  4I02 A;  3O3K A;  4IF4 A;  2C6Y A;  4OIR F;  1MDM A;  1QO0 D;  2O3F A;  1SAX A;  3LAJ A;  1BI1 A;  1CF7 B;  2EFQ A;  3MAJ A;  5ICG A;  1XSD A;  1JXS A;  4XLP F;  2MLG A;  3CO7 C;  3TO6 A;  2V6C A;  3ZMD A;  1TTY A;  4WWC A;  2YU3 A;  2VON A;  1YW9 A;  2BE5 F;  3WGG A;  3F8N A;  2OZU A;  2CW0 F;  1XCB A;  4F7Z A;  1QPM A;  2QLZ A;  1PDN C;  5LHI A;  3L00 A;  3KCC A;  4A2U A;  2FE3 A;  3JAM Z;  5HOO A;  4G9Y A;  5JVT A;  1UFM A;  2IT0 A;  2V1D A;  2IRF G;  4U7B A;  2W24 A;  1ZLK A;  2H94 A;  3BP8 A;  3OV8 A;  2VC1 A;  2QBY B;  1U2W A;  3P7N A;  5LRR A;  4YFX F;  5D5X B;  2CYY A;  4M71 A;  3MZY A;  1RNL A;  4KT5 C;  4I0B A;  4ON0 A;  1QBJ A;  2FXA A;  4LB5 A;  5K5Q A;  4IRG A;  4A0Z A;  4P5O A;  3R61 A;  3ZQ7 A;  4HX7 A;  2DK5 A;  1T39 A;  4EV0 A;  2DW4 A;  2XV4 S;  1SFU A;  4WXC A;  2VXZ A;  2PN6 A;  3ISP A;  3RPQ A;  3ZPL A;  4XLN F;  3GZ6 A;  5D4R A;  2XIG A;  2L02 A;  5HLI A;  1CF7 A;  3NQO A;  1RI7 A;  1IZ1 A;  1TQP A;  2E1C A;  5H20 A;  2ZNY A;  2RQP A;  2NNY A;  1D8K A;  3IRQ A;  2M5W A;  2GZW A;  4HAM A;  3ECH A;  4IRH A;  4O5V A;  3TKY A;  5JFR A;  4QWQ A;  2UZK A;  2W25 A;  3R60 A;  1J5Y A;  3F21 A;  1W5T A;  3RTR A;  5L3F A;  1IRF A;  2F5E A;  4OIP F;  2UXX A;  4YG2 F;  1ZRC A;  3FF5 A;  3TO9 A;  3DKW A;  1LDK B;  4UV8 A;  5L3C A;  5DYM A;  3E3V A;  5E8I A;  2DLL A;  3F8C A;  3WU0 A;  3F8M A;  3C7J A;  4K2E A;  1B9M A;  3L09 A;  1EH8 A;  1LDD A;  2HFH A;  2QEN A;  3V7R A;  4ENK A;  2QVO A;  4EM0 B;  2RDP A;  3BPX A;  1KU7 A;  4LMY A;  1TQI A;  4M9Z A;  2VT2 A;  2YX4 A;  5BMZ A;  4UV9 A;  2JZY A;  1QZY A;  2GWR A;  3HTU A;  3QU3 A;  3WGI A;  2K7L A;  3C3W A;  2EA4 A;  3COA C;  2VBY A;  4HDU A;  4L0Y B;  4L18 B;  1ZGA A;  1P2F A;  5ILV A;  1J59 A;  4EJW A;  3ELK A;  1XGN A;  3C1D A;  4GCV A;  3DXJ F;  4EJO A;  3IRR A;  3F6O A;  5KVR A;  4I2O A;  2ISY A;  3IL2 A;  3F3X A;  2EV5 A;  1TNS A;  5DUI A;  3QP6 A;  2CQK A;  4I01 A;  3FXU A;  4L0Z B;  5BPI A;  4HF1 A;  3LAP A;  4LB6 B;  3Q5F A;  2HKO A;  4KMF A;  3CTA A;  3QOP A;  1IW7 F;  2CO5 A;  4HBL A;  4U0V A;  4IJA A;  5FFZ A;  4WXD A;  2AS5 F;  1YIO A;  4BHB A;  1Z91 A;  4E70 A;  4CGZ A;  3GW2 A;  1T98 A;  1VTN C;  2JSC A;  3JAM K;  1MGT A;  1SD7 A;  2FQ3 A;  5J8F A;  2FMY A;  1D5V A;  1LEB A;  2P5K A;  2D1H A;  1R58 A;  3WE3 A;  3GFM A;  3MWM A;  4M9X A;  1AOY A;  3HHG A;  1LB2 A;  1Z6T A;  2XAJ A;  3EET A;  4PGH A;  4DQ2 A;  3ZMU A;  2PEX A;  4WCG A;  2LKP A;  3SQN A;  1Q1H A;  5LEJ A;  2ZME A;  4L9J A;  4LD5 A;  3ULQ B;  2NYX A;  3ABU A;  2EK5 A;  3OOP A;  4TV7 A;  5LRS A;  5FGM A;  2MH2 A;  4UXN A;  3CO6 C;  3LQR A;  5E1W A;  3FHZ A;  3EYY A;  2GQQ A;  1V3F A;  3FMR A;  1S29 A;  2VOP A;  2ESH A;  3I4P A;  3RDI A;  2E7W A;  3GZ5 A;  3GEZ A;  2IA1 A;  1I1S A;  2YX7 A;  1W7P B;  3M8F A;  4YFK F;  2P6T A;  1YO5 C;  5BPD A;  5TRD A;  1XGM A;  2YPR A;  3KLN A;  1T2K A;  2M87 A;  1HW2 A;  4MTD A;  5J8C A;  4IHT A;  5LHH A;  5E17 F;  5HVQ C;  5HLH A;  3E6B A;  1KU2 A;  1WRJ A;  3U2R A;  1Z7U A;  4I09 A;  4YII A;  3QRF F;  2DT5 A;  1RUN A;  1W5S A;  3K69 A;  4MGR A;  4R79 A;  4KDP A;  2DPU A;  5E1Z B;  5HDK A;  4HF0 A;  2O6G E;  2ZME B;  4N9I A;  2E1N A;  3E5U A;  4ENJ A;  3I5U A;  2QQB A;  1YQA A;  4LG0 B;  4YFN F;  4LLN A;  5D5U B;  2FA5 A;  4JK1 X;  4Q48 A;  3WGH A;  4D0P A;  2ZFW A;  3FM5 A;  1K6O A;  5CVI A;  1T38 A;  2KIM A;  2K27 A;  1IXR C;  2DPD A;  2FBK A;  5BOX A;  1XMA A;  2UXN A;  2IA2 A;  1IUY A;  3M8E A;  2OZ6 A;  3KFW X;  5E1X A;  3SXY A;  1UCR A;  1OYW A;  1EH7 A;  4PCQ A;  4AD9 A;  1Z1D A;  2RN7 A;  1S8N A;  1ZG1 A;  4Y17 A;  2HTS A;  1YS7 A;  3N4M A;  3P9I A;  2Q0O A;  1P4X A;  1MJB A;  2VBW A;  3GO5 A;  3I0T A;  1IN8 A;  3R4K A;  3KE2 A;  1IXS B;  1REP C;  5ICE A;  2HQR A;  3IHU A;  4IVN A;  2NAZ A;  4Y15 A;  4UUV A;  3ZMT A;  3NEU A;  2Q8K A;  2DFI A;  1I6X A;  1XGO A;  4PZJ A;  1U5T A;  3TDU C;  5H6R A;  2X0L A;  2X4H A;  1G6N A;  1IN5 A;  4WK8 F;  2LF7 A;  4L5J A;  4KN4 X;  4CO8 A;  4U0Y A;  4LGW A;  5FD5 A;  1EV7 A;  1ZYR F;  2JTV A;  1QGP A;  2XHK A;  5H6Q A;  2FU4 A;  3VOE A;  1LEA A;  3Q9V A;  3FX3 A;  1YW7 A;  3GUD A;  2A61 A;  4KNY A;  1YG2 A;  1BN5 A;  2EJR A;  4MHG A;  1B6A A;  3PQK A;  3MFK A;  2EB7 A;  3R6S A;  2L3D A;  4HLY A;  4AVP A;  4G7O F;  4IXA A;  2M30 A;  2ZKZ A;  5F6F A;  2L4A A;  4A0Y A;  2R7D A;  3J7A O;  3ERE D;  4G7Z F;  1MKM A;  1HKS A;  4U0W A;  1J9I A;  3D5L A;  2FML A;  4UNO A;  4OOI A;  2FEZ A;  2P4W A;  2P7V B;  4ZZL A;  3PFI A;  5E18 F; 
#chains in the Genus database with same CATH topology
 1N77 A;  4BXU A;  3TO7 A;  1LDJ A;  4A3B J;  1MMG A;  3PSI A;  1DDN A;  1YJW I;  1MJ9 A;  2H6B A;  2CWE A;  1KYZ A;  1GV2 A;  2LFB A;  2Y48 A;  5HDN A;  5EG0 B;  1VQM I;  1VQO I;  2H27 A;  2HR3 A;  2VJI A;  3QAH A;  5HOD A;  2PJP A;  3OMY A;  3MMY B;  5HS7 A;  1K79 A;  2GIV A;  1BW5 A;  2VKE A;  1SFK A;  5GAE J;  4E6K G;  2QSF X;  3E0J B;  5FRN A;  2ELK A;  1QZZ A;  1R4M B;  1T0F C;  3BPV A;  1BBY A;  2HXO A;  2FSW A;  2JPB A;  4V2F A;  1RPW A;  2L7F P;  5F08 A;  2HPM A;  4ZC3 A;  2F5V A;  3WTX C;  3SZP A;  1LE8 A;  4UB6 C;  5J4V A;  5CQE A;  1BJZ A;  1JGG A;  3BT9 A;  4IQJ A;  3MEX A;  2VPL A;  3ZXS A;  3AAF A;  5H2F C;  1IDZ A;  2AQF A;  2DFH A;  4X1E A;  3WTY C;  4O3M A;  1Y8Q B;  2DBB A;  5D6F A;  3J80 K;  2RQQ A;  1FOY A;  5K5R A;  3LNQ A;  3HGY A;  4RAG A;  2QZ8 A;  2X6Y A;  4ITV A;  3A03 A;  2DDB A;  1W36 C;  1RKW A;  1HSJ A;  1U9O A;  1CGP A;  3I58 A;  5IYC J;  2PG4 A;  4LG0 A;  3OOU A;  4DYR A;  1S7O A;  1MJA A;  4XLA A;  2XAQ A;  1ZG5 A;  2R3S A;  1WGX A;  2XB0 X;  4XL9 A;  3JRG A;  5LGT A;  3ASN H;  2BV6 A;  2BOL A;  4HLX A;  3J81 Z;  5ILU A;  4NBQ A;  1JKO C;  2MD0 A;  5ED4 A;  2A5W A;  4UUT A;  4BBS J;  1XC5 A;  2EFO A;  1IRX A;  2R7S A;  3CLO A;  2K4J A;  1ZR2 A;  3UNG C;  5GTI C;  1SD6 A;  2LKX A;  3REO A;  2HWV A;  3ZR8 X;  1WH7 A;  1B72 B;  3P9C A;  4EM2 A;  3KEO A;  3I53 A;  3KP7 A;  5F0H A;  2R92 J;  1R5G A;  2DMN A;  3EUH A;  4DJA A;  4YIF A;  3CDI A;  1WSU A;  5JVG F;  1FC3 A;  4W1U A;  3BG7 A;  1DP7 P;  1YRN B;  3K1N A;  1FLI A;  2LY9 A;  3IWZ A;  2RVC A;  4Y33 A;  3K10 A;  2R7X A;  3AFH A;  4FE7 A;  1R7J A;  2O8K A;  5GPA A;  3VWB A;  5FRM A;  3RZO J;  3RKX A;  3JSO A;  1HKT A;  2BGC A;  1FMV A;  3OYC A;  2KQR A;  1XS9 A;  2HPI A;  2F2E A;  1MBE A;  4BHP A;  2XAG A;  4L9V A;  5JHU A;  3CF2 A;  4HG2 A;  3S2D J;  3QP5 A;  1OYI A;  3QYF A;  4CCK A;  1BC7 C;  3FXQ A;  1G3Y A;  3F8F A;  5D8L B;  2VT3 A;  3PQJ A;  2Z16 A;  1IXC A;  1P4W A;  2X6O A;  1SMT A;  5J6X A;  3E7L A;  4AC0 A;  3HB9 A;  1XX5 A;  1BM9 A;  3GXO A;  3LSJ A;  5ILS A;  2EIK H;  1SD4 A;  4ZDP A;  3HRT A;  4EM1 A;  2XDV A;  4LLL A;  3KZI C;  4I7H A;  1KGS A;  3S16 J;  4L5E A;  1FBS A;  1PP8 F;  3FXJ A;  3W6V A;  2QM3 A;  4ZJZ A;  4F91 B;  1ZH5 A;  4EGZ A;  2G0E A;  3FBI B;  4G6D A;  3RYP A;  2HTJ A;  2KJB A;  5A2Q K;  3LSI A;  3AL0 C;  2BHZ A;  2O8X A;  1MD0 A;  2WAF A;  2QKM B;  3E5Q A;  3BR6 A;  5CVJ A;  3S17 J;  4XR6 A;  4JQF A;  3DPU A;  2V9V A;  3C2H A;  2JQ7 A;  1ZTR A;  1NH3 A;  4R8H A;  2YU9 J;  1M1E B;  2R5Z B;  1V5F A;  3LSK A;  4Y3O A;  2HGC A;  3I59 B;  4PSX A;  4A6D A;  2P5L C;  5DCM B;  2RC4 A;  2QEX I;  4LJZ F;  2OAZ A;  2E36 A;  1A35 A;  1ON1 A;  3H0D A;  4BYY A;  3WTS C;  3DQV C;  3HEF A;  3T1B A;  2STT A;  1TBX A;  1UMQ A;  2FOK A;  1YS6 A;  1VND A;  2QQ8 A;  1MDM B;  1USS A;  5DUK A;  4D1Q A;  1WHU A;  2H6C A;  1ZGJ A;  3L7W A;  3PNV A;  3F9K A;  2K5C A;  1BI3 A;  2LDU A;  4YEJ A;  2VBZ A;  2ZFU A;  3FMS A;  4MEY F;  1U6G A;  4RM3 A;  4XOP A;  2QUF A;  3G1L A;  2OJE D;  3HZJ A;  5ERI A;  3LSR A;  2F4I A;  3HRS A;  3L2C A;  2STW A;  1SMY F;  1H9G A;  1B8I A;  5J3L A;  3SFI A;  3JSP A;  2L9S A;  1FY7 A;  1XD7 A;  3ZN1 A;  4KA4 A;  1FP1 D;  2NXN B;  1FYM A;  2K85 A;  4BE2 A;  2LBF A;  2RKH A;  3WTZ A;  2H1K A;  4HF2 A;  2Z2S B;  4HZF A;  1LKX A;  3GTG J;  1HW1 A;  2X85 A;  1OFC X;  2CV2 A;  4OMZ A;  2X51 A;  2A07 F;  1X2M A;  1Y8R B;  3E6M A;  2F48 A;  3FMQ A;  2W57 A;  3GCM A;  3R0A A;  1WJD A;  3EQL F;  2XRL A;  3TOA A;  4JX5 A;  2HVR A;  1U78 A;  1J2X A;  2L0K A;  4KIT B;  1FSE A;  5F04 A;  2CJJ A;  2A6H F;  2YR2 A;  1TL8 A;  1G2H A;  1I39 A;  1ETW A;  5F1R A;  4ETS A;  1FPQ A;  4DNC A;  1W0U A;  2K86 A;  2AHQ A;  3H9J A;  2EIJ H;  3VYU B;  2R7F A;  1KQ8 A;  5ICF A;  4WF2 A;  3B6C A;  2QA4 I;  1HDP A;  2XAH A;  4NC7 A;  2D5V A;  2DN0 A;  1WVR A;  1WWX A;  4XNF A;  5D8K B;  1UG0 A;  3BRO A;  1X1A A;  2QYO A;  2WB1 N;  3VYR B;  1H0M A;  2DTR A;  1T8I A;  3DBH B;  3OS0 A;  3FXL A;  5IP7 J;  1MBH A;  5HLG A;  5M5X J;  5D6E A;  2NRA C;  2WC2 A;  5TJJ A;  2FQ4 A;  3IH2 A;  3QYB A;  4GO1 A;  4PUS A;  1HLV A;  3FM3 A;  1RKT A;  4F3Q A;  2TRT A;  3R0J A;  4Q5S F;  5LGN A;  1FT9 A;  3ZOB A;  3KP6 A;  2M34 A;  3IKV A;  2XKP A;  2VN2 A;  1F1Z A;  1MMS A;  3BZ6 A;  2VXD A;  5FLX Z;  2ICW G;  2JSP A;  3MZH A;  2KZG A;  3LL7 A;  5K5O A;  2OQR A;  4KIB A;  4Q4Z F;  2OA4 A;  4C3H J;  3NAR A;  4M6Y A;  4CCJ A;  3JTG A;  2COM A;  2EWN A;  3H3U A;  1BIA A;  3L2Q A;  1IN4 A;  2EIL H;  1S6L A;  2QGU A;  5DS9 A;  1SVO A;  2GAU A;  1P4A A;  2IW5 A;  2F4O B;  2WV1 A;  3LFK A;  1MMN A;  2WWY A;  3LSG A;  4OAZ A;  4BEH B;  1FBQ A;  5AON A;  1IV6 A;  3GTL J;  1UZC A;  4M72 A;  2E1O A;  1TT5 B;  3N05 A;  3VYT B;  2HNH A;  3PL8 A;  1DP3 A;  2E35 A;  2V1U A;  2HKX A;  2H8R A;  3BQY A;  3CP2 A;  4KJZ A;  4B3A A;  4UB8 C;  2Z5U A;  5FD6 A;  1MBJ A;  1RUO A;  3I71 A;  3I3L A;  2XPU A;  3A1Y A;  4BUP A;  3KEY A;  2CSO A;  3K1P A;  5HLT A;  3Q0U A;  2DQR A;  1JJ8 C;  5C3E J;  4X0G A;  4MNU A;  2GM4 A;  1Y0U A;  3FXR A;  2OTL I;  3WHB A;  1WZ2 A;  4H0E A;  1TT0 A;  2GBY A;  4XRS G;  4CDG A;  3OYN A;  3SZT A;  1KU3 A;  1E3H A;  2XB5 A;  1TQM A;  3HSR A;  1I50 J;  1N75 A;  5HNF A;  5DEQ A;  5IYD J;  3GLX A;  3W6J B;  2EBI A;  2R0Q C;  4B8X A;  3N97 A;  4P9F A;  5EDN A;  1YRN A;  4U7D A;  3M1E A;  1B59 A;  3TGN A;  2H1L A;  5B3S H;  1TLH B;  2GXA A;  2JUG A;  2X1D A;  3DTI A;  3OYB A;  3BG5 A;  1R1T A;  4A5M A;  3GME A;  2IJL A;  1F4K A;  2PI0 A;  4A3D J;  4ZDO A;  4A3F J;  1T33 A;  3KPH A;  1I5Z A;  5K1Y A;  2R7R A;  2DA3 A;  3A02 A;  5KAF C;  4OIQ F;  2CGP A;  1KU9 A;  3RYR A;  2FBH A;  2RGV A;  3HUG A;  1FOK A;  3OR2 C;  3Q3S A;  3IV5 A;  1Z9C A;  3HKZ N;  3IH4 A;  4XRS A;  1TWH J;  3HOS A;  2X9D A;  4ZYH A;  4YIR X;  3LSH A;  4DIQ A;  2EFP A;  3NWS A;  4LK0 F;  1QRY A;  5IY5 H;  2L5Q A;  2E5Z A;  2EH3 A;  5E3L A;  1QA6 A;  1R49 A;  3JRB A;  1LVK A;  1KON A;  2ZXW H;  3RI4 A;  2L2O A;  2OV7 A;  4CCL A;  1FWZ A;  3HPH A;  3H3Z A;  3CMA I;  3HOV J;  4ZYG A;  3K1M A;  2GA1 A;  2X48 A;  3MZ8 A;  2Q2E A;  1ETY A;  4A12 A;  4BKX A;  2VI6 A;  1P92 A;  5L3E A;  2X1C A;  3CUQ B;  2HZD A;  1UG2 A;  3CCM I;  4HPQ A;  1A31 A;  2MLK A;  1DUX C;  5IT9 Z;  1W5C C;  4XLE A;  2FNP A;  5FO5 A;  1DU0 A;  2QBY A;  5M3M J;  3ZQC A;  2BY0 A;  3ABT A;  3OY9 A;  3IC7 A;  2R5Y A;  1WJ5 A;  1X3Z B;  3OYJ A;  1QQI A;  3ZQF A;  4U88 A;  3OIO A;  1Z05 A;  6PAX A;  1YJ9 I;  4RAZ A;  3BC8 A;  3HL2 A;  1ODD A;  4XMY A;  2FF4 A;  1WCM J;  4M3D A;  3CP8 A;  5EJC A;  4KYW A;  3FBN B;  2IS2 A;  3CUO A;  1R4N B;  1ONV A;  4PJN A;  1LUJ B;  3VYS B;  4OWR B;  4HNV A;  1Z0X A;  1K7A A;  3CD6 I;  4I0A A;  3A01 B;  3E6C C;  5FKL A;  4XLH A;  3FIW A;  2VIX A;  1VQ5 I;  3CUQ A;  4N4N B;  1ZKG A;  4CXF A;  2CG4 A;  3TQN A;  4KFC A;  1OKR A;  2OU2 A;  5FJ8 J;  2QWW A;  4V19 K;  1ZGW A;  4CZZ A;  2DT7 B;  2QQA A;  5LFA A;  2GIZ A;  4KIG A;  2E71 A;  2WBM A;  2J5O A;  4LG3 A;  2PMU A;  3J80 Z;  2ZME C;  3PNY A;  4XBF A;  4BH9 A;  4FCY A;  3C18 A;  2R7U A;  4RGR A;  3WU2 C;  1BIB A;  2Z33 A;  3OSG A;  1ZR4 A;  3F6V A;  1KQ9 A;  2JUC A;  2OD5 A;  2V79 A;  3CCR I;  1UST A;  2AO9 A;  1OQY A;  2CH0 A;  2LSO A;  4HRI A;  4IHV A;  2GA2 A;  1FJL A;  1R5H A;  3HUG B;  4ASN A;  1R36 A;  4G8X A;  4D9J A;  1VF9 A;  3WTT C;  2NVQ J;  1GUU A;  2OQG A;  1J7K A;  3OYH A;  1FYL A;  2A68 F;  4M6X A;  5BNG A;  2PQ8 A;  4JBA A;  2N8G A;  1SFO J;  1L3L A;  1DPR A;  1BOB A;  2ELH A;  1OR7 A;  1RES A;  2DMU A;  4XM3 A;  5D5W B;  1BC8 C;  4P55 A;  5FLV A;  3ABL H;  3EUH C;  4OU0 A;  2DI3 A;  5E8G A;  4ENM A;  1MND A;  3DTE A;  3OL4 A;  3K4K A;  2JK3 A;  3QU6 A;  2ZBK A;  4X6A J;  2IVM A;  5F64 A;  4CH7 A;  3G1O A;  1IF1 A;  1HF0 A;  2E1M C;  4A0X A;  1PUF A;  1E2X A;  1O57 A;  5KK1 A;  5TGT A;  4R1H A;  2A69 F;  4KUM A;  3TBI A;  3CJQ B;  1MIJ A;  2EV0 A;  2HU9 A;  5F1J A;  5B1B H;  1EKE A;  1YYV A;  3T5X A;  1UHW A;  2M7A A;  3BJO A;  1O7L A;  4KIC A;  3KET A;  3ZMS A;  3GF2 A;  3QQA A;  1VQ8 I;  1R1U A;  1B1B A;  1B4A A;  1P7J A;  4DBQ A;  3VPR A;  4WX9 A;  3CC7 I;  1ON2 A;  4ABZ A;  4EGY A;  4ZYE A;  2IA0 A;  1XDU A;  4GYI A;  1X4O A;  4BEH A;  3KLO A;  1XSX A;  3T8T A;  4EEF G;  4B43 A;  3CES A;  4IHY A;  2ZJ2 A;  2XVC A;  2IXS A;  4OIO F;  3G73 A;  1L0O C;  3BTJ A;  4B48 A;  1Y39 A;  4D7M A;  2G7H A;  5JHF A;  2W7N A;  3VOD A;  2CV1 A;  1N25 A;  2WAQ A;  2MYS A;  3ZN0 A;  2VUM J;  2Y9Y A;  1U8B A;  1IUF A;  1XMK A;  2NVU B;  3KZY A;  3QOE A;  2MBF A;  2IGO A;  1W7P A;  4BXF A;  3DV8 A;  4XRM A;  2E2I J;  2UWM A;  4DYQ A;  3I4N J;  2F5F A;  1R5I D;  2Y31 A;  3JRA A;  2W1O A;  1YLF A;  4CIC A;  1FX7 A;  2Y0S N;  1T08 B;  3B02 A;  2BXZ A;  2ZCW A;  1JE8 A;  4BNC A;  1S72 I;  2ZB9 A;  5CJ9 A;  3K4J A;  5IT9 K;  3HYI A;  3QPH A;  2PFB A;  4A3M J;  5DDG A;  1LFU P;  3LA7 A;  4ESB A;  4HSR A;  4LK1 F;  4L9N A;  4HV5 A;  2OTJ I;  4CYC B;  4LLG F;  4UVA A;  3O8G A;  4GXO A;  3PJR A;  1POG A;  3RIR A;  1AWC A;  2V26 A;  1HXD A;  3JRH A;  2VBX A;  4HX4 A;  2LP0 A;  1OR7 C;  1R1V A;  2ZXI A;  3E97 A;  4U87 A;  1KYW A;  4A6E A;  2Y30 A;  3K4N A;  3JTH A;  4RGX A;  1SFE A;  2A5Y B;  4BJT A;  1KQ0 A;  4XSZ F;  4BAY A;  1MNE A;  1R23 A;  1TZL A;  2MD5 A;  5C4J J;  4MIM A;  1G4D A;  2HDC A;  2OBP A;  5EEG A;  3K0L A;  4Y52 J;  3TOB A;  4IRI A;  3H36 A;  3LQQ A;  3WTV C;  2AXT C;  2HDW A;  5DD8 A;  2F5C A;  2KDO A;  1MSE C;  5F0F A;  2ZXH A;  2JVH A;  2R4G A;  2DMT A;  1TWF J;  1OMI A;  3V42 A;  3LA3 A;  3CC4 I;  2WV0 A;  2MGQ A;  1I3A A;  3M07 A;  5HDG A;  5DV5 A;  3DEU A;  4RAY A;  2FRH A;  4P9U A;  4FT8 A;  4B1R A;  4HDV A;  5IT3 A;  4HOB A;  3K4L A;  4NQW A;  2BYV E;  4DOZ A;  2Z99 A;  2LC2 A;  3ML6 A;  1X1B A;  4RB1 A;  2Z1D A;  2DTZ A;  3WHC A;  3SHF A;  3NRV A;  1WPK A;  2G9W A;  4EQQ A;  3HOT A;  4HEA 2;  1ITY A;  3CC2 I;  2ZXJ A;  2IBD A;  1YFH A;  2O03 A;  2DQL A;  4PDK A;  4N0B A;  1STZ A;  2YSR A;  1XSV A;  2XF6 A;  3SFZ A;  2E7X A;  3TW6 A;  3DBL B;  5C4X J;  2TCT A;  3C2B A;  5GP9 A;  1ZRD A;  2KRF A;  3PO2 J;  1IG7 A;  2JJ7 A;  3TP3 A;  2MA3 A;  4RB2 C;  4ZDL A;  1O3Q A;  4IHW A;  1ZAR A;  3OS2 A;  3CDH A;  5CVR A;  2G7U A;  4KN7 X;  4F55 A;  3BR2 A;  3OSF A;  5IYB J;  2XPV A;  5J1R A;  3H5R A;  3K2Z A;  3HRM A;  3K4B A;  4FE4 A;  3CCY A;  1YHQ I;  3HOY J;  4FX0 A;  2DMQ A;  2RNJ A;  1OCO H;  3RKY A;  3CJN A;  4QIW N;  1R6R A;  3V7S A;  4M6V A;  3ABK H;  1Z6R A;  5ICC A;  1JUM A;  1ZLJ A;  2HYG D;  4Q47 A;  1LVA A;  1D1B A;  1U5T C;  4XIC A;  3MKY B;  4J01 A;  3RPU A;  3RKW A;  5E20 A;  3ZMZ A;  2ADU A;  3IUO A;  4BU2 A;  4RA2 A;  3JRF A;  1NK2 P;  4M74 A;  1MW7 A;  2Z3Y A;  1YW8 A;  5L3B A;  2PMH A;  2VL8 A;  3LST A;  3HIF A;  3ROU A;  2KKO A;  2LRD A;  3DEW A;  1JTY A;  4RGU A;  3BZC A;  1T0F A;  2IP2 A;  3HC7 A;  1O3S A;  4RB0 A;  3WE2 A;  3VEP A;  2XGE A;  4GDF A;  2EZK A;  3IWF A;  1KZH A;  1D1A A;  4Z2Y A;  2R7V A;  5FB2 A;  3Q9S A;  2W48 A;  3MKW B;  2HOS A;  4FIS A;  4C3J J;  1VQ4 I;  4P96 A;  2VAS A;  4XKC A;  1OCR H;  1DGW Y;  1K83 J;  4BY7 J;  3TDZ C;  5CYV A;  1Q1V A;  1ZK8 A;  1Z77 A;  3HTS B;  2K4B A;  2EFN A;  4M9S A;  3T0Y A;  1OJL A;  2D2W A;  2PBI A;  2L7K A;  2LD5 A;  1GLN A;  3W6K B;  2CQQ A;  4EVI A;  3LA2 A;  4FQG A;  1RZ4 A;  2XAF A;  4HA8 A;  2BEO A;  4AM3 A;  1JUP A;  2L01 A;  4HW0 A;  3GWZ A;  1BJA A;  4IHX A;  4MQ9 F;  2HI3 A;  3BCA A;  2PX9 A;  2HOE A;  4FX4 A;  4E7H A;  1D5Y A;  4JP0 A;  1F5T A;  4AIJ A;  3TP0 A;  4A69 C;  1YI2 I;  5EGO B;  1IV8 A;  5DD4 A;  5LLQ A;  3FDY A;  1P6R A;  5K7H A;  5LHG A;  1F43 A;  2H8W A;  1O7F A;  2KIU A;  2QQ9 A;  1IAW A;  4AWX B;  5AIQ A;  2HEO A;  3L1P A;  2P5V A;  3H35 A;  1VQK I;  3FHN A;  2BVL A;  4E7S A;  5CVU A;  2XF5 A;  5CPR B;  4A3K J;  3GX4 X;  1PUF B;  5CVV A;  4MLO A;  3WU1 B;  3MD2 A;  1Z7L A;  1FSH A;  3Q0W A;  4P1W A;  4ENN A;  4EJV A;  3JRI A;  2V6E A;  2DAO A;  1VFC A;  2EA2 A;  1I1G A;  2RV8 A;  1S3J A;  2CRG A;  3IAS 2;  3E5X A;  3M7G A;  3DEE A;  3PUF A;  2XAS A;  3EUK L;  2NOJ B;  2MG4 A;  3DPL C;  2R7T A;  1PP7 U;  3HKZ A;  2V4J C;  3U1D A;  3WTW C;  1MH4 A;  2XGX A;  3GTQ J;  3FK6 A;  5EGO A;  1A6Q A;  1GXP A;  3OYK A;  1GVD A;  3BZK A;  4RS8 A;  1H89 C;  1S7E A;  1ZHF A;  4ZH4 F;  2P7C B;  5DCM A;  1VI0 A;  2MAB A;  2L9N A;  1JGS A;  3V8L A;  3QOD A;  2AXL A;  4EJU A;  1X1D A;  1YX5 A;  3E6D A;  4RGS A;  1FZP B;  1A04 A;  4JOM A;  2VB6 A;  4N9H A;  4RB3 C;  2RNG A;  3J81 K;  4HNT A;  1LFP A;  2MW8 A;  5TIS C;  1MZB A;  2OCC H;  4YRV A;  2V1N A;  1YOV B;  2M45 A;  1BI2 A;  2HS5 A;  1AKH B;  1HQC A;  4EAT A;  2IGK A;  1EH6 A;  1XB4 A;  1XN7 A;  2FBI A;  1ZRE A;  3S3M A;  4GGG A;  4XN0 A;  2LH9 A;  2XC7 A;  1UHS A;  1I27 A;  5L3G A;  2VJ4 A;  4BJ6 C;  1P7I A;  1TWC J;  4HX8 A;  1YTY A;  4CCM A;  1DU6 A;  4AID A;  1X1P A;  3H92 A;  2JRM A;  3GYH X;  4XRF A;  1Y0N A;  2XGC A;  3V8K A;  2LOO A;  4BQA A;  1JKQ C;  4CZC A;  4UVB A;  1DPU A;  2X6X A;  2HZT A;  1YIT I;  1U0J A;  2H09 A;  2OC6 A;  1QVU A;  3HSF A;  3HHH A;  3BJA A;  1V54 H;  2ECC A;  1IN6 A;  2JA6 J;  3T8R A;  5HS8 A;  4IO9 F;  3WTU C;  1NHA A;  2W85 A;  2E2H J;  2V7F A;  1JT6 A;  2B9S A;  3F0C A;  4D5F A;  2FNA A;  2HQA A;  1C0W A;  4NHJ A;  3BY6 A;  1O3R A;  2KJC A;  1V55 H;  4IPA A;  2DK8 A;  4QLC U;  5BS6 A;  1GVJ A;  2PJR A;  1BL0 A;  1U5T B;  4BGD A;  3DFG A;  2BXY A;  2BBY A;  2GXB A;  4CCO A;  2CFX A;  5E3O A;  5FKM A;  1GT0 C;  1J09 A;  1TW2 A;  2O5R A;  1X3U A;  2A3S A;  1GHC A;  4FHT A;  1TWA J;  3KX2 A;  1F9N A;  5J47 A;  2XKO A;  4GFB A;  1IN7 A;  2BY3 A;  2V1X A;  4A5N A;  4BDY A;  1JHF A;  3ASO H;  1X3W B;  5LBQ A;  5EZG A;  5A2Q Z;  2CQ7 A;  4IEJ A;  4C2M J;  1H9T A;  4KIF A;  2J5P A;  4G94 A;  1G59 A;  3VDX A;  1HST A;  1WKM A;  3HDD A;  3DF8 A;  5M3F J;  4ZTJ A;  1QHG A;  2KDZ A;  1E0E A;  2LKS A;  3OYM A;  2Y0M A;  4NNJ A;  3SEQ A;  2HOT A;  2HDD A;  1ZAO A;  2EV6 A;  4KMU X;  3VB2 A;  4UHT A;  2JA5 J;  3WG9 A;  1S7A A;  3EYI A;  3JCU C;  2JMW A;  2W4S A;  3IKT A;  3CCS I;  1MMD A;  1R22 A;  4XSX F;  3HBL A;  3GFI A;  3W2V A;  4A3C J;  3QPL A;  2VPR A;  4HYE A;  2A6E F;  4MEX F;  1W7P D;  1MBF A;  1FMW A;  4Y4R A;  1ENH A;  4XN3 A;  4D7N A;  1WJE A;  3J7A Y;  2LF8 A;  2VE8 A;  3CJT B;  3LFU A;  4CA0 A;  1HBX G;  2DDA A;  2NS0 A;  2XUB A;  3F8B A;  3S2W A;  4C3I J;  3UKG A;  4BHC A;  2ME0 A;  3RSN A;  1IO2 A;  3GVA A;  1K78 B;  4XID A;  1O3T A;  3PO3 J;  4RLQ A;  3EUA A;  3V4G A;  1TNT A;  4NB5 A;  3OYG A;  2F6C A;  3G6E I;  1X19 A;  4HQM A;  3P9K A;  1BW6 A;  2KMU A;  3D1N I;  3FZV A;  1HCR A;  2QKL B;  3DPT A;  1PVE A;  3AG2 H;  4W97 A;  1ETO A;  3CME I;  5JR3 A;  2O61 A;  3O6B B;  2OF7 A;  3KP2 A;  2W84 A;  3HRU A;  4ESF A;  1R00 A;  1SVL A;  4S05 A;  1K78 A;  2Y0S A;  2VOD A;  2GXG A;  3MKZ A;  3LWF A;  2M7B A;  2PLY A;  5EEH A;  2K40 A;  4G6Q A;  2QF7 A;  2ISZ A;  2P8T A;  2KPM A;  3HGG A;  2LRE A;  3HSE A;  3ZCO A;  3BG9 A;  4M3B A;  2TDX A;  1E17 A;  1UHM A;  3K9T A;  2HYF A;  3S1R J;  4CYD A;  1B8I B;  1UJ8 A;  3OYI A;  1WI3 A;  1ETQ A;  3AG4 H;  2ZNZ A;  5HNH A;  3MCZ A;  3EDP A;  1LE8 B;  2JPC A;  2IS1 A;  3KIO A;  1OPC A;  3KYD B;  1J75 A;  4HQE A;  5DCF A;  1FOW A;  3D0S A;  4AIK A;  5KCM A;  3CCQ I;  3CCL I;  3K70 D;  1VQN I;  3BLY A;  4V2G A;  4WXH A;  1QZE A;  3WG7 H;  1U8R A;  1D8J A;  3BR3 A;  2DOF A;  4ZTF A;  2DJN A;  3OR1 C;  3WOD F;  1HKQ A;  4FET A;  2XAU A;  4S04 A;  4UVC A;  3IH3 A;  5D5V B;  5GTH C;  2KHM A;  4LIT A;  1IJW C;  1NG7 A;  4RM2 A;  1J0R A;  2ESN A;  3KP4 A;  2ID6 A;  2MC3 A;  3AKZ A;  2NS8 A;  1EA3 A;  3KP3 A;  2VC0 A;  2NOG A;  4ZYA A;  4II3 A;  2XRN A;  1QNT A;  2IEK A;  4RDU A;  4A3J J;  4OMY A;  1YE9 A;  1RIO H;  4IZZ A;  2JT1 A;  1ZN2 A;  2EFW A;  2X1E A;  2IAI A;  3OYA A;  2O0Y A;  3KP5 A;  5CLS A;  2L54 A;  2E34 A;  3W2W A;  3VFZ A;  3H5A A;  3S1N J;  5BQT A;  2DJI A;  3OIP A;  2ME6 A;  1XGS A;  5JI6 A;  1OCT C;  3GFL A;  1K4T A;  3V7C A;  3U9G A;  3BWG A;  2P6S A;  3M9A A;  2WTE A;  2DFE A;  4IOC F;  3I55 I;  9ANT A;  4HV6 A;  3CUQ C;  3O2P E;  5J1U A;  5AIP A;  2KIF A;  3BJ6 A;  5FKO A;  4A3I J;  5CKT A;  3H0G J;  3I64 A;  3JW4 A;  4IHS A;  2VOO A;  1FP2 A;  2QSH X;  3G3Z A;  2KFD A;  4I98 B;  2F5D A;  3L9F A;  4UUS B;  4PJM A;  2L4M A;  2VQC A;  1XDS A;  4XKW A;  1BOA A;  1W4M A;  5J40 A;  1SD5 A;  3ZMV A;  2HXI A;  2ZO4 A;  3LSP A;  3SYT A;  1LNW A;  3CQZ J;  1NTC A;  2FJ1 A;  2VKV A;  1D3Y A;  1FBU A;  3BR1 A;  2LG4 A;  2IGM A;  3HG9 A;  4M73 A;  4PFO A;  2NVX J;  1IGN A;  2DXI A;  2WAD A;  4YEL A;  2DU9 A;  1WI9 A;  5FFX A;  4MTE A;  4CCN A;  2JA8 J;  3I59 A;  1QPI A;  2MH9 A;  3F72 A;  5LGU A;  1ULY A;  4XKV A;  4EMS A;  4G7H F;  2M2E A;  5HS9 A;  2HQN A;  3TED A;  2P81 A;  1X2N A;  2B0L A;  4S0H B;  1V4R A;  3F22 A;  3OYD A;  1HW5 A;  1MBK A;  4XON A;  5DM7 F;  1G3S A;  1X58 A;  1Z3Y A;  4JYK A;  3ZQL A;  1PUE E;  2MC4 A;  3LSM A;  3S2H J;  1VQP I;  2VJJ A;  3PIP F;  1OCZ H;  1P9Q C;  2M1B A;  3KEQ A;  3BTL A;  4MQV A;  1SFX A;  4B09 A;  2Z9O A;  1DGR M;  5JLX A;  1WQ2 A;  4L9T A;  2JWT A;  2A6T A;  5LEK A;  1G3W A;  2LY2 A;  1FIP A;  4ESJ A;  3W3C A;  4G6T B;  3F23 A;  2LNB A;  2BY1 A;  2DA7 A;  4C2T A;  4LOC A;  2QCO A;  4LFU A;  5C44 J;  1IRG A;  1TW3 A;  3ECO A;  2KL4 A;  2Y75 A;  1G3T A;  4C9Y A;  4FTH A;  1FNN A;  2R7Z J;  3K7A J;  2ETH A;  3PIO F;  2IPQ X;  4ZZD A;  1AKH A;  3GFJ A;  4RLF A;  1HOM A;  4GRI A;  2L9R A;  5L3D A;  2EPF A;  3B73 A;  1FYK A;  1VQ6 I;  5KAI C;  1T6S A;  2JRT A;  1KA8 A;  4PSW A;  2DO7 A;  1WJB A;  1ZG3 A;  5D4S A;  3V8J A;  3G4S I;  4GYG A;  3RCO A;  1ZRF A;  2BY2 A;  3DU6 A;  3I54 A;  2D45 A;  1HA8 A;  5JLW A;  4N4O B;  3DP7 A;  2VE9 A;  5IOY A;  4CHU A;  3BDD A;  3AG3 H;  3G71 I;  4F52 A;  4IX7 A;  3RKQ A;  4ZYD A;  2M8E A;  3KZZ A;  2HVS A;  4M3F A;  2I10 A;  4QSH A;  2CMP A;  4L5I A;  1MMA A;  2XRO A;  3BR0 A;  2WA0 A;  1OYY A;  3GTM J;  4M3G A;  5FLX K;  1T95 A;  1U3E M;  3BOQ A;  1GXQ A;  2PJR B;  2K02 A;  3OYL A;  3I56 I;  4NUB A;  4E7J A;  1PJR A;  2XSD C;  4NDL A;  1Y1W J;  3MQ0 A;  1LQ1 A;  1UB9 A;  2MFZ A;  3M8J A;  4O6J A;  3H9Q A;  2OCE A;  3A0H C;  1LJ9 A;  3QPT A;  4AIH A;  3FKJ A;  3RJP A;  1JHH A;  1D0Z A;  3ZP5 A;  4OIN F;  2ACJ A;  3FWE A;  1B9N A;  1XCV A;  2D1V A;  5F27 A;  4LIU A;  1BI0 A;  3U1K A;  1JKR C;  2ZJR F;  3HXL A;  2NNN A;  3U21 A;  4Y13 A;  4PGG A;  4EJT A;  4I02 A;  3O3K A;  4IF4 A;  1TP4 A;  2HQ5 A;  2C6Y A;  4OIR F;  3H3V K;  2WAQ N;  3CMY A;  3CJR B;  1MDM A;  3A2K A;  2WY8 Q;  1QO0 D;  1PYV A;  2O3F A;  1SAX A;  3JRC A;  3FXO A;  3LAJ A;  3CMM A;  3I4M J;  1BI1 A;  3QWL A;  1CF7 B;  2EFQ A;  3MAJ A;  2DOA A;  5ICG A;  1XSD A;  1JXS A;  4UUS A;  3L2U A;  3GTK J;  4E7L A;  4XLP F;  2MLG A;  3CO7 C;  3TO6 A;  1D1C A;  5E3M A;  2LTP A;  2V6C A;  3KYC B;  3ZMD A;  1ACI A;  5EG0 A;  2E2J J;  1TTY A;  4WWC A;  2YU3 A;  2VON A;  1YW9 A;  2KLO A;  2BE5 F;  3WGG A;  2V9P A;  3F8N A;  2OZU A;  1QHH D;  2CW0 F;  2LR8 A;  3MKL A;  4FAS D;  1XCB A;  2GOX B;  4F7Z A;  1QPM A;  2QLZ A;  4IL6 C;  1W1W E;  2P0W A;  4BQO A;  1PDN C;  5LHI A;  1K4S A;  4Z6Y A;  3L00 A;  3KCC A;  2NVY J;  4UY8 I;  4A2U A;  2FE3 A;  3OYF A;  5FKN A;  3JAM Z;  5HOO A;  4G9Y A;  5JVT A;  1UFM A;  4F93 B;  1JKP C;  4B3X A;  2IT0 A;  2K9L A;  2V1D A;  3JRD A;  3CCE I;  2IRF G;  4U7B A;  2W24 A;  1ZLK A;  2H94 A;  3SDB A;  4M3E A;  3BP8 A;  1Z21 A;  3OV8 A;  2Y2Z A;  2EQR A;  2VC1 A;  3A4C A;  2QBY B;  1U2W A;  4PJL A;  3P7N A;  5LRR A;  3DWL E;  4YFX F;  1I6H J;  2E60 A;  5D5X B;  2CYY A;  4M71 A;  4CSW A;  3MZY A;  1RNL A;  2B7E A;  4BY1 J;  4KT5 C;  2BHY A;  3M1C A;  1OLT A;  3S8P A;  3PNT A;  4I0B A;  4PK4 A;  1SVM A;  4HST A;  4ON0 A;  1JTX A;  1QBJ A;  2FXA A;  3OL3 A;  4AYB A;  4LB5 A;  5K5Q A;  2FD5 A;  2VJ5 A;  1A6I A;  5DTD A;  4IRG A;  4E4H A;  4PFP A;  1ETK A;  5K7Z A;  4A0Z A;  4P5O A;  3R61 A;  3ZQ7 A;  4HX7 A;  2CFO A;  2DK5 A;  1T39 A;  4EV0 A;  2DW4 A;  2XV4 S;  2WB1 A;  3RQI A;  1SFU A;  2EZL A;  2K3F A;  2O7O A;  5EEA A;  1R9T J;  4B47 A;  4WXC A;  2VXZ A;  2PN6 A;  2ID3 A;  3ISP A;  2VQH A;  1JT0 A;  4H4K C;  3RPQ A;  3ZPL A;  2NVT J;  4XLN F;  3GZ6 A;  5D4R A;  1W36 D;  3PFY A;  2XIG A;  2L02 A;  4XK4 A;  5HLI A;  1CF7 A;  1GV5 A;  3K4M A;  3H9G A;  3NQO A;  1RI7 A;  1IZ1 A;  1EJ9 A;  4I6Z A;  5KHD A;  1TQP A;  4C2U A;  2L9V A;  1S9H A;  1X4P A;  2E1C A;  5H20 A;  1FEX A;  2ZNY A;  1ETX A;  4XQF A;  2RQP A;  2NNY A;  1D8K A;  4MO7 A;  2M5W A;  3IRQ A;  2GZW A;  3GBG A;  4HAM A;  4A3L J;  2OPT A;  3ECH A;  4IRH A;  4O5V A;  4BQQ A;  5IP6 A;  3TKY A;  5JFR A;  4QWQ A;  1AU7 A;  2UZK A;  2W25 A;  3R60 A;  1J5Y A;  2DOD A;  3F21 A;  1W5T A;  2BZT A;  3RTR A;  5L3F A;  4A3G J;  4KT6 A;  2I8D A;  1IRF A;  2JVG A;  3H1C A;  3K6G A;  2F5E A;  2UXX A;  4OIP F;  2XSJ C;  4YG2 F;  1ZRC A;  4Y7N J;  1RET A;  2K9N A;  3FF5 A;  3ZQI A;  3TO9 A;  3DKW A;  1LDK B;  3PM1 A;  2K3P A;  4IKF A;  2ZJQ F;  2KRC A;  4UV8 A;  2COB A;  1NG6 A;  5L3C A;  5DYM A;  3DU5 A;  3E3V A;  5E8I A;  1ETV A;  2DLL A;  2RAE A;  1OIS A;  3F8C A;  3W2A A;  2CV0 A;  3WU0 A;  4JX4 A;  3DCF A;  3C7J A;  3F8M A;  4K2E A;  1B9M A;  1MH3 A;  1XG1 A;  3L09 A;  1FTT A;  1EH8 A;  1LDD A;  2HFH A;  2QEN A;  2ZSH B;  3V7R A;  1VZ0 A;  2R7Q A;  4ENK A;  1FIA A;  2QVO A;  4EM0 B;  2RDP A;  1A5J A;  2CUZ A;  3BPX A;  4RAF A;  2QSG X;  1KU7 A;  5J4Y A;  4LMY A;  4CYC A;  3KYL A;  4DYC A;  2BW3 B;  2Y69 H;  1TQI A;  3LOC A;  4XOR A;  4M9Z A;  3ABM H;  2M8G X;  2VT2 A;  2YX4 A;  1QU3 A;  5BMZ A;  4UV9 A;  2JZY A;  1IC8 A;  1QZY A;  1RC9 A;  3ZRG A;  4XLF A;  3GTP J;  5F0C A;  4BE0 A;  2DT6 A;  2GWR A;  3HTU A;  1H88 C;  3QU3 A;  1R71 A;  3WGI A;  2K7L A;  3C3W A;  2CQX A;  4J19 A;  1ZEL A;  2EA4 A;  3S1M J;  1MBG A;  2ELJ A;  3COA C;  4BE1 A;  2VBY A;  4HDU A;  4L0Y B;  2CW8 A;  1NK3 P;  4L18 B;  1ZGA A;  2V9K A;  1P2F A;  5ILV A;  1J59 A;  4EJW A;  2M3A A;  1MSF C;  3ELK A;  2O9L A;  1XGN A;  3C1D A;  3FXK A;  2CUF A;  4GCV A;  3AL0 B;  3DXJ F;  4XOT A;  3FK7 A;  4EJO A;  3IRR A;  3F6O A;  3OS1 A;  5KVR A;  4I2O A;  2PMZ A;  2HYJ A;  2ISY A;  3IL2 A;  3F3X A;  1OCC H;  3S3N A;  2EV5 A;  5EZH A;  1TNS A;  3S93 A;  5DUI A;  3QP6 A;  5K7F A;  2CQK A;  1W0T A;  3G2B A;  2M0C A;  4I01 A;  4QPQ A;  3FXU A;  1VQL I;  3OWT A;  4L0Z B;  4AUX A;  5BPI A;  4MFD A;  1BR4 A;  2ZSI B;  4HF1 A;  3CLQ A;  3LAP A;  4LB6 B;  3Q5F A;  2HKO A;  4F92 B;  4KMF A;  3CTA A;  3QOP A;  4DGW B;  3FKI J;  1IW7 F;  3I9V 2;  3G1M A;  3S3O A;  3TW7 A;  2DYR H;  2VLA A;  3S15 J;  2CO5 A;  4HBL A;  4U0V A;  5IP9 J;  2EIM H;  5KNL A;  2JN6 A;  4IJA A;  2PMZ N;  1UEL B;  1U9N A;  2VKH A;  3SJM A;  1BA5 A;  2HVQ A;  1TWG J;  5FFZ A;  4AVZ A;  4D5C A;  3H5N A;  4WXD A;  2AS5 F;  1YIO A;  2CS3 A;  2VQG A;  1WFX A;  3PUB A;  4OAY A;  4BHB A;  3MVP A;  2W00 A;  1Z91 A;  4E70 A;  1T56 A;  4MFE A;  4CGZ A;  3GW2 A;  1T98 A;  3ESW B;  4E7K A;  2DCE A;  1VTN C;  1E3O C;  2JSC A;  3JAM K;  3RPU D;  1MGT A;  4CUG A;  1SD7 A;  5M5W J;  2FQ3 A;  2KP6 A;  5J8F A;  2FMY A;  5GAD J;  1XPX A;  1CQT A;  2CU7 A;  5GPC A;  1D5V A;  2IS4 A;  3NWT A;  1LEB A;  2P5K A;  2D1H A;  3K4C A;  1R58 A;  2UV1 A;  3WE3 A;  3UR3 C;  4DW6 A;  3CF5 F;  2VKD A;  3SZG A;  4BQN A;  2EZI A;  2DMP A;  3GFM A;  2L7M P;  5EYR A;  3MWM A;  4M9X A;  1AOY A;  3HHG A;  1LB2 A;  1Z6T A;  2WAE A;  1DQU A;  4XLC A;  2XAJ A;  1TC3 C;  1VQ9 I;  3HOW J;  3EET A;  4PGH A;  4DBR A;  4DQ2 A;  1ORK A;  2DYS H;  4C30 A;  3ZMU A;  1LPQ A;  2PEX A;  5FLM J;  3BG6 A;  5B5E C;  4WCG A;  2M4G A;  5IPA A;  4QPO A;  3TL4 X;  2MSY A;  2LKP A;  3GTO J;  1D0Y A;  3SQN A;  3X2Q H;  1Q1H A;  3CCJ I;  3K2A A;  5LEJ A;  3JR9 A;  2ZME A;  4L9J A;  4LD5 A;  2M0M A;  3CCU I;  1Y1V J;  2DA4 A;  2NYX A;  3ULQ B;  3ABU A;  3VSL A;  4J00 A;  2EK5 A;  2CQN A;  3OOP A;  4TV7 A;  5LRS A;  5FGM A;  2LLK A;  2MH2 A;  4UXN A;  3CO6 C;  2CW7 A;  3LQR A;  5M5Y J;  5E1W A;  3S32 A;  3FHZ A;  4BDZ A;  3EYY A;  2GQQ A;  1V3F A;  1G8X A;  3FMR A;  2KRH A;  4B4C A;  3DLL F;  1S29 A;  4XKB A;  2VOP A;  2ESH A;  3SDG A;  3I4P A;  2R5Z A;  3RDI A;  2E7W A;  3GZ5 A;  2W82 A;  3GEZ A;  2IA1 A;  2IGN A;  1I1S A;  2YX7 A;  1FTZ A;  2FUG 2;  3RQ4 A;  5E3N A;  1W7P B;  3M8F A;  4YFK F;  2P6T A;  4BBR J;  3P5J A;  3CCV I;  2XPW A;  3E1S A;  3BR5 A;  4A3E J;  1YO5 C;  5BPD A;  3L2R A;  3L2W A;  5J1Y A;  3JRE A;  4PJ0 C;  5TRD A;  1XGM A;  3EPZ A;  4G12 A;  2YPR A;  3KLN A;  3ZGK A;  1UAA A;  3A01 A;  1T2K A;  3J7Y J;  1K6Y A;  2M87 A;  2E5N A;  1HW2 A;  3HOU J;  3ZQG A;  2E1M B;  4MTD A;  2K9S A;  5GAH J;  2DA1 A;  3M3Y J;  1H8A C;  1WJA A;  2HOA A;  5J8C A;  4IHT A;  1GDT A;  5LHH A;  5E17 F;  5HVQ C;  5HLH A;  2CUJ A;  3E6B A;  1KU2 A;  4AYB N;  2AQE A;  3AG1 H;  1WRJ A;  3U2R A;  1APL C;  1Y6I A;  1Z7U A;  2VQL A;  4KIS A;  4I09 A;  1X1C A;  2A05 A;  1IDY A;  4YII A;  4DZJ A;  5CQG A;  2LK2 A;  3QRF F;  4BS9 A;  3IP4 B;  1VQ7 I;  2DT5 A;  1RUN A;  1W5S A;  2JA7 J;  2M4K A;  3K69 A;  2FX0 A;  4MGR A;  4AU7 A;  4R79 A;  2X6W A;  1SAN A;  2WY7 Q;  4KDP A;  2DPU A;  5B1A H;  1JUS A;  5LD2 C;  4A93 J;  2M9H A;  5E1Z B;  4HF0 A;  5HDK A;  3ZQH A;  2O6G E;  2ZME B;  4N9I A;  2E1N A;  3E5U A;  4ENJ A;  3I5U A;  1AA7 A;  2QQB A;  4NC8 A;  5GAG J;  1YQA A;  3RZD J;  2BVM A;  4LG0 B;  2K9M A;  3S14 J;  2R7W A;  1V5E A;  4YFN F;  4LLN A;  5D5U B;  4ANJ A;  2FA5 A;  4PJJ A;  2DOE A;  3HJE A;  3L2V A;  4JK1 X;  4Q48 A;  3WGH A;  4D0P A;  3FIS A;  1S5L C;  2YUS A;  2ZFW A;  1XMX A;  3CZ6 A;  3FM5 A;  2DA6 A;  1K6O A;  1WJF A;  2CUE A;  3IAM 2;  1O4X A;  4I99 C;  5CVI A;  2ECB A;  1T38 A;  1V5G A;  2KIM A;  5EF6 A;  5B66 C;  4I76 A;  3QPS A;  2K27 A;  1IXR C;  3CDL A;  4DZP A;  2DPD A;  1YX3 A;  2FBK A;  2E19 A;  2KT0 A;  5BOX A;  3VSK A;  2DFF A;  2ZC2 A;  3D5S C;  2GLO A;  1XMA A;  2UXN A;  2IA2 A;  1IUY A;  3M8E A;  1XTA A;  2OZ6 A;  1Y56 A;  1JI8 A;  3KFW X;  5E1X A;  1HC8 A;  3SXY A;  1UCR A;  1JJ6 C;  1OYW A;  3Q0V A;  2LMD A;  1EH7 A;  4PCQ A;  4BAC A;  4AD9 A;  3BG3 A;  3GTJ J;  1Z1D A;  2L7Z A;  3OYE A;  1BR2 A;  2RN7 A;  2B63 J;  1S8N A;  1ZG1 A;  4IQ4 A;  4Y17 A;  2HTS A;  1YS7 A;  2JA2 A;  3BCB A;  3N4M A;  1WJC A;  3P9I A;  2Q0O A;  1P4X A;  1RR8 C;  1MJB A;  2VBW A;  3GO5 A;  3I0T A;  2YS9 A;  5FRO A;  2DA2 A;  1IN8 A;  3R4K A;  1N78 A;  1ERD A;  4BL0 B;  1Z67 A;  1IXS B;  2KZV A;  3C2G A;  3KE2 A;  5FKK A;  2UUZ A;  1REP C;  1D0X A;  2XF7 A;  2BW3 A;  4LIV A;  2OUM A;  3BTC A;  1ZQ3 P;  1FOX A;  5ICE A;  1OCP A;  3K70 C;  3A0B C;  2HQR A;  3IHU A;  4IVN A;  3PSF A;  2R5Y B;  3ONQ A;  2NAZ A;  4Y15 A;  1Z3X A;  4UUV A;  2I5U A;  3ZMT A;  4RMN A;  3NEU A;  3QYE A;  2Q8K A;  2LY1 A;  2DFI A;  4BXX J;  1I6X A;  1XGO A;  3HM5 A;  1I3Q J;  3HOX J;  4PZJ A;  1U5T A;  4HNU A;  2NS7 A;  2Q1Z B;  5H6R A;  3BQZ A;  3TDU C;  3GLL A;  2X0L A;  1A36 A;  2R93 J;  3GZN B;  2X4H A;  1SEU A;  3O8H A;  1G6N A;  1IN5 A;  1HDD C;  2DA5 A;  2LBF B;  1EF4 A;  4WK8 F;  3MN2 A;  3SEZ A;  3ZQQ A;  2LF7 A;  3DLA A;  4L5J A;  4KN4 X;  5E79 C;  4CO8 A;  4BJ5 C;  1RR7 A;  3OIQ A;  4NC6 A;  1IRZ A;  4U0Y A;  2Q2E B;  4LGW A;  5FD5 A;  1EV7 A;  1F36 A;  1BR1 A;  1ZYR F;  1LFB A;  2JTV A;  4JX6 A;  3HPG A;  3B6A A;  1QGP A;  2FOW A;  3D5R C;  3ERM A;  3S1Q J;  1AHD P;  4II2 A;  1RRJ A;  2XHK A;  5H6Q A;  2R7O A;  2FU4 A;  2RRE A;  1SC7 A;  3VOE A;  1LEA A;  3Q9V A;  4RBO A;  3FX3 A;  1YW7 A;  3GUD A;  3J7Z I;  3BTI A;  2A61 A;  4KNY A;  2EZH A;  2XGD A;  1YG2 A;  1K61 A;  1BN5 A;  2EJR A;  4MHG A;  3DTK A;  1SAU A;  1B6A A;  1E3P A;  2Y9Z A;  3PQK A;  3MFK A;  2EB7 A;  1MNM C;  3R6S A;  4QTR A;  2L3D A;  4E7I A;  4HLY A;  3NAU A;  3DKX A;  3LMM A;  4AVP A;  4G7O F;  4IXA A;  3HOZ J;  4B44 A;  3DBR B;  2M30 A;  3TMO A;  2GOM A;  2ZKZ A;  5F6F A;  2KIS A;  2L4A A;  4NQW B;  4A0Y A;  2R7D A;  2LYC A;  3J7A O;  2K9Q A;  1YJN I;  1QVT A;  2EIN H;  5IOZ A;  3ERE D;  2KIQ A;  4G7Z F;  5DM6 F;  1MKM A;  1HKS A;  4U0W A;  1WH5 A;  1J9I A;  3D5L A;  2FML A;  3M4O J;  2LVS A;  4E7Z A;  4UNO A;  3DKY A;  4OOI A;  1B72 A;  1YIJ I;  2FEZ A;  2ZJP F;  4IOA F;  2P4W A;  2IS6 A;  3FXM A;  2F4M B;  2P7V B;  4ZZL A;  3PFI A;  5E18 F; 
#chains in the Genus database with same CATH homology
 4BXU A;  3TO7 A;  1LDJ A;  1DDN A;  1MJ9 A;  2H6B A;  2CWE A;  1KYZ A;  5HDN A;  2Y48 A;  2H27 A;  2HR3 A;  3QAH A;  2PJP A;  5HS7 A;  1K79 A;  2GIV A;  1QZZ A;  3BPV A;  1BBY A;  2FSW A;  2JPB A;  3WTX C;  3SZP A;  3MEX A;  3AAF A;  4O3M A;  3WTY C;  2DBB A;  5D6F A;  3J80 K;  5K5R A;  2QZ8 A;  1HSJ A;  1CGP A;  3I58 A;  2PG4 A;  4LG0 A;  1S7O A;  1MJA A;  2XAQ A;  1ZG5 A;  2R3S A;  5LGT A;  2BV6 A;  4HLX A;  3J81 Z;  5ILU A;  5ED4 A;  2EFO A;  3CLO A;  2K4J A;  1SD6 A;  3REO A;  2HWV A;  3P9C A;  4EM2 A;  3KEO A;  3I53 A;  3KP7 A;  1R5G A;  3EUH A;  4YIF A;  1WSU A;  1FC3 A;  1DP7 P;  3K1N A;  1FLI A;  3IWZ A;  2RVC A;  1R7J A;  3RKX A;  3JSO A;  1HKT A;  2BGC A;  2F2E A;  4BHP A;  2XAG A;  4L9V A;  5JHU A;  3QP5 A;  1OYI A;  1BC7 C;  3FXQ A;  1G3Y A;  3F8F A;  5D8L B;  2VT3 A;  3PQJ A;  1IXC A;  1P4W A;  1SMT A;  5J6X A;  1BM9 A;  3GXO A;  5ILS A;  1SD4 A;  3HRT A;  4EM1 A;  4LLL A;  4I7H A;  1KGS A;  1FBS A;  1PP8 F;  2QM3 A;  1ZH5 A;  4EGZ A;  4G6D A;  3RYP A;  2HTJ A;  2KJB A;  5A2Q K;  2O8X A;  1MD0 A;  3E5Q A;  5CVJ A;  4JQF A;  2V9V A;  4R8H A;  2HGC A;  3I59 B;  4A6D A;  2P5L C;  5DCM B;  2RC4 A;  4LJZ F;  2OAZ A;  1ON1 A;  4BYY A;  3WTS C;  3DQV C;  2STT A;  3T1B A;  1TBX A;  2FOK A;  1YS6 A;  1MDM B;  1USS A;  5DUK A;  2H6C A;  1ZGJ A;  3L7W A;  1BI3 A;  2LDU A;  2VBZ A;  3FMS A;  4MEY F;  1U6G A;  2QUF A;  5ERI A;  3HRS A;  3L2C A;  2STW A;  1SMY F;  1H9G A;  3JSP A;  1FY7 A;  1XD7 A;  3ZN1 A;  4KA4 A;  1FP1 D;  1FYM A;  2RKH A;  3WTZ A;  4HF2 A;  4HZF A;  1HW1 A;  4OMZ A;  2A07 F;  3E6M A;  3FMQ A;  2W57 A;  3R0A A;  3EQL F;  3TOA A;  1U78 A;  1J2X A;  1FSE A;  2YR2 A;  2A6H F;  5F1R A;  4ETS A;  1FPQ A;  4DNC A;  2K86 A;  2R7F A;  1KQ8 A;  5ICF A;  4WF2 A;  2XAH A;  1WWX A;  5D8K B;  3BRO A;  2QYO A;  1H0M A;  2DTR A;  5HLG A;  5D6E A;  2NRA C;  2WC2 A;  5TJJ A;  4GO1 A;  3FM3 A;  3R0J A;  4Q5S F;  5LGN A;  1FT9 A;  3KP6 A;  3IKV A;  2XKP A;  2VN2 A;  1F1Z A;  3BZ6 A;  5FLX Z;  3MZH A;  5K5O A;  2OQR A;  4KIB A;  4Q4Z F;  2OA4 A;  4M6Y A;  3JTG A;  2COM A;  2EWN A;  3H3U A;  1BIA A;  1IN4 A;  1S6L A;  2GAU A;  1P4A A;  2IW5 A;  3LFK A;  2WWY A;  1FBQ A;  5AON A;  4M72 A;  2V1U A;  2HKX A;  2Z5U A;  5FD6 A;  1RUO A;  3I71 A;  2CSO A;  3K1P A;  2DQR A;  4MNU A;  1Y0U A;  3FXR A;  4H0E A;  4CDG A;  3SZT A;  1KU3 A;  1TQM A;  3HSR A;  5DEQ A;  3GLX A;  3W6J B;  4B8X A;  3N97 A;  4P9F A;  4U7D A;  3M1E A;  1B59 A;  3TGN A;  1TLH B;  1F4K A;  4A5M A;  2PI0 A;  1R1T A;  2IJL A;  1I5Z A;  5K1Y A;  4OIQ F;  2CGP A;  1KU9 A;  3RYR A;  2FBH A;  2RGV A;  3HUG A;  1FOK A;  1Z9C A;  3HOS A;  4ZYH A;  2EFP A;  4LK0 F;  3RI4 A;  1FWZ A;  3H3Z A;  4ZYG A;  3K1M A;  2GA1 A;  2Q2E A;  4A12 A;  1P92 A;  5L3E A;  3CUQ B;  2MLK A;  1DUX C;  5IT9 Z;  2FNP A;  5FO5 A;  2QBY A;  3ABT A;  3IC7 A;  1QQI A;  4U88 A;  1Z05 A;  6PAX A;  4RAZ A;  1ODD A;  2FF4 A;  4KYW A;  3CUO A;  1ONV A;  1K7A A;  4I0A A;  3E6C C;  3CUQ A;  4CXF A;  2CG4 A;  3TQN A;  4KFC A;  1OKR A;  2OU2 A;  2QWW A;  4CZZ A;  2QQA A;  4KIG A;  2J5O A;  2PMU A;  3J80 Z;  4XBF A;  4BH9 A;  3C18 A;  4RGR A;  1BIB A;  2Z33 A;  3F6V A;  1KQ9 A;  2OD5 A;  2V79 A;  1UST A;  2LSO A;  2GA2 A;  1R5H A;  4ASN A;  1R36 A;  4G8X A;  3WTT C;  2OQG A;  1J7K A;  1FYL A;  2A68 F;  4M6X A;  2PQ8 A;  4JBA A;  1L3L A;  1DPR A;  2ELH A;  1OR7 A;  5D5W B;  1BC8 C;  4P55 A;  4OU0 A;  2DI3 A;  5E8G A;  4ENM A;  3QU6 A;  2ZBK A;  2IVM A;  5F64 A;  1IF1 A;  4A0X A;  1E2X A;  1O57 A;  5KK1 A;  4R1H A;  2A69 F;  4KUM A;  2EV0 A;  1YYV A;  3T5X A;  1UHW A;  3BJO A;  1O7L A;  4KIC A;  3KET A;  3ZMS A;  3GF2 A;  1R1U A;  1B1B A;  1B4A A;  4WX9 A;  1ON2 A;  4EGY A;  4ZYE A;  2IA0 A;  1XDU A;  4GYI A;  3KLO A;  1XSX A;  3T8T A;  2ZJ2 A;  2XVC A;  4OIO F;  3G73 A;  1L0O C;  2G7H A;  3VOD A;  3ZN0 A;  1XMK A;  3KZY A;  2MBF A;  1W7P A;  3DV8 A;  2UWM A;  2F5F A;  1YLF A;  4CIC A;  1FX7 A;  3B02 A;  2ZCW A;  1JE8 A;  4BNC A;  5CJ9 A;  5IT9 K;  3HYI A;  3QPH A;  2PFB A;  5DDG A;  3LA7 A;  4ESB A;  4LK1 F;  4L9N A;  4HV5 A;  4LLG F;  4UVA A;  4GXO A;  1AWC A;  3RIR A;  1HXD A;  2VBX A;  4HX4 A;  1R1V A;  3E97 A;  4A6E A;  1KYW A;  3JTH A;  4RGX A;  1SFE A;  2A5Y B;  1KQ0 A;  4XSZ F;  4BAY A;  1R23 A;  2MD5 A;  1G4D A;  2HDC A;  2OBP A;  5EEG A;  3K0L A;  3TOB A;  4IRI A;  3LQQ A;  3WTV C;  5DD8 A;  2F5C A;  1OMI A;  3LA3 A;  2WV0 A;  5HDG A;  5DV5 A;  3DEU A;  4RAY A;  2FRH A;  4P9U A;  4FT8 A;  4HDV A;  5IT3 A;  4HOB A;  4NQW A;  2BYV E;  2Z99 A;  3ML6 A;  4RB1 A;  3SHF A;  3NRV A;  2G9W A;  3HOT A;  4EQQ A;  2ZXJ A;  1YFH A;  2O03 A;  2DQL A;  4PDK A;  4N0B A;  1STZ A;  2YSR A;  1XSV A;  3SFZ A;  2E7X A;  1ZRD A;  2KRF A;  4RB2 C;  2MA3 A;  1O3Q A;  1ZAR A;  3CDH A;  5CVR A;  2G7U A;  4KN7 X;  3K2Z A;  3HRM A;  4FX0 A;  2RNJ A;  3RKY A;  3CJN A;  3V7S A;  1Z6R A;  5ICC A;  1ZLJ A;  2HYG D;  4Q47 A;  1LVA A;  1U5T C;  3RPU A;  3RKW A;  5E20 A;  3ZMZ A;  2ADU A;  4M74 A;  2Z3Y A;  1YW8 A;  5L3B A;  2PMH A;  3LST A;  3HIF A;  3ROU A;  2KKO A;  4RGU A;  1T0F A;  2IP2 A;  1O3S A;  4RB0 A;  3WE2 A;  3VEP A;  3IWF A;  4Z2Y A;  5FB2 A;  3Q9S A;  4P96 A;  3TDZ C;  5CYV A;  3HTS B;  2K4B A;  2EFN A;  4M9S A;  3T0Y A;  2D2W A;  2PBI A;  3W6K B;  4EVI A;  3LA2 A;  1RZ4 A;  2XAF A;  4HA8 A;  2BEO A;  2L01 A;  4HW0 A;  3GWZ A;  1BJA A;  4MQ9 F;  2HOE A;  4FX4 A;  1F5T A;  4AIJ A;  5DD4 A;  5LLQ A;  1P6R A;  5LHG A;  2HEO A;  1O7F A;  2KIU A;  2QQ9 A;  4AWX B;  5AIQ A;  1IAW A;  2P5V A;  5CVU A;  3GX4 X;  5CVV A;  3WU1 B;  1FSH A;  4ENN A;  4EJV A;  2DAO A;  2EA2 A;  1I1G A;  2RV8 A;  1S3J A;  3E5X A;  3M7G A;  2XAS A;  3DPL C;  1PP7 U;  3U1D A;  3WTW C;  2XGX A;  1GXP A;  4RS8 A;  1ZHF A;  4ZH4 F;  2P7C B;  5DCM A;  1JGS A;  3V8L A;  2AXL A;  4EJU A;  3E6D A;  4RGS A;  1FZP B;  1A04 A;  4N9H A;  4RB3 C;  3J81 K;  1MZB A;  2M45 A;  1BI2 A;  2HS5 A;  1HQC A;  1EH6 A;  1XB4 A;  1XN7 A;  2FBI A;  1ZRE A;  4GGG A;  5L3G A;  1I27 A;  4HX8 A;  1YTY A;  3H92 A;  3GYH X;  4XRF A;  3V8K A;  4BQA A;  4UVB A;  1DPU A;  2HZT A;  2H09 A;  3HSF A;  3HHH A;  3BJA A;  1IN6 A;  3T8R A;  5HS8 A;  3WTU C;  1NHA A;  2W85 A;  2FNA A;  1C0W A;  4NHJ A;  3BY6 A;  1O3R A;  2KJC A;  5BS6 A;  4IPA A;  2DK8 A;  4QLC U;  1GVJ A;  1U5T B;  3DFG A;  2BBY A;  2GXB A;  2CFX A;  1TW2 A;  1X3U A;  2A3S A;  1GHC A;  4FHT A;  1F9N A;  2XKO A;  1IN7 A;  2V1X A;  4A5N A;  1JHF A;  5LBQ A;  5A2Q Z;  1H9T A;  4KIF A;  2J5P A;  4G94 A;  1HST A;  1WKM A;  3DF8 A;  2Y0M A;  1ZAO A;  2EV6 A;  4KMU X;  3VB2 A;  4UHT A;  3WG9 A;  1S7A A;  3EYI A;  3IKT A;  1R22 A;  4XSX F;  3GFI A;  4HYE A;  2A6E F;  4MEX F;  1W7P D;  2LF8 A;  2VE8 A;  1HBX G;  2NS0 A;  3F8B A;  2XUB A;  3S2W A;  4BHC A;  1K78 B;  3GVA A;  1O3T A;  3V4G A;  1TNT A;  4NB5 A;  4HQM A;  3P9K A;  3FZV A;  3DPT A;  5JR3 A;  2O61 A;  3O6B B;  3KP2 A;  2W84 A;  3HRU A;  4ESF A;  1R00 A;  4S05 A;  1K78 A;  2VOD A;  2GXG A;  3LWF A;  2PLY A;  5EEH A;  4G6Q A;  2ISZ A;  2P8T A;  3HSE A;  2TDX A;  1E17 A;  1UHM A;  3K9T A;  2HYF A;  4CYD A;  2ZNZ A;  3MCZ A;  3EDP A;  2JPC A;  1OPC A;  1J75 A;  4HQE A;  5DCF A;  4AIK A;  3D0S A;  4WXH A;  1U8R A;  1D8J A;  3WOD F;  1HKQ A;  4S04 A;  4UVC A;  5D5V B;  1J0R A;  2ESN A;  3KP4 A;  2MC3 A;  3KP3 A;  2VC0 A;  2XRN A;  1QNT A;  4OMY A;  1RIO H;  2JT1 A;  1ZN2 A;  2EFW A;  2O0Y A;  3KP5 A;  5CLS A;  2L54 A;  3VFZ A;  5BQT A;  1XGS A;  5JI6 A;  3GFL A;  3V7C A;  3U9G A;  3BWG A;  2P6S A;  3M9A A;  2WTE A;  4HV6 A;  3CUQ C;  3O2P E;  5AIP A;  2KIF A;  3BJ6 A;  3I64 A;  3JW4 A;  4IHS A;  2VOO A;  1FP2 A;  3G3Z A;  4I98 B;  2F5D A;  3L9F A;  2L4M A;  1XDS A;  1BOA A;  1W4M A;  1SD5 A;  3ZMV A;  2ZO4 A;  1LNW A;  1D3Y A;  1FBU A;  4M73 A;  2DU9 A;  1WI9 A;  5FFX A;  4MTE A;  3I59 A;  2MH9 A;  3F72 A;  5LGU A;  1ULY A;  4EMS A;  4G7H F;  5HS9 A;  2HQN A;  2B0L A;  1V4R A;  3F22 A;  1HW5 A;  1G3S A;  1PUE E;  4B09 A;  2M1B A;  3KEQ A;  4MQV A;  1SFX A;  2Z9O A;  1WQ2 A;  4L9T A;  5LEK A;  1G3W A;  4ESJ A;  3F23 A;  2LNB A;  4LFU A;  1IRG A;  1TW3 A;  3ECO A;  2Y75 A;  1G3T A;  1FNN A;  2ETH A;  2IPQ X;  4ZZD A;  3GFJ A;  5L3D A;  3B73 A;  1FYK A;  1T6S A;  2JRT A;  1KA8 A;  2DO7 A;  1ZG3 A;  5D4S A;  3V8J A;  4GYG A;  1ZRF A;  3I54 A;  2D45 A;  3DP7 A;  2VE9 A;  4CHU A;  3BDD A;  4ZYD A;  2M8E A;  3KZZ A;  4L5I A;  2XRO A;  1OYY A;  5FLX K;  1U3E M;  3BOQ A;  1GXQ A;  2K02 A;  3MQ0 A;  1LQ1 A;  1UB9 A;  4O6J A;  1LJ9 A;  3QPT A;  4AIH A;  3RJP A;  1JHH A;  3ZP5 A;  2ACJ A;  4OIN F;  3FWE A;  1B9N A;  1XCV A;  2D1V A;  1BI0 A;  2NNN A;  4Y13 A;  4PGG A;  4EJT A;  4I02 A;  3O3K A;  4IF4 A;  2C6Y A;  4OIR F;  1MDM A;  1QO0 D;  2O3F A;  1SAX A;  3LAJ A;  1BI1 A;  1CF7 B;  2EFQ A;  3MAJ A;  5ICG A;  1XSD A;  1JXS A;  4XLP F;  2MLG A;  3CO7 C;  3TO6 A;  2V6C A;  3ZMD A;  1TTY A;  4WWC A;  2YU3 A;  2VON A;  1YW9 A;  2BE5 F;  3WGG A;  3F8N A;  2OZU A;  2CW0 F;  1XCB A;  4F7Z A;  1QPM A;  2QLZ A;  1PDN C;  5LHI A;  3L00 A;  3KCC A;  4A2U A;  2FE3 A;  3JAM Z;  5HOO A;  4G9Y A;  5JVT A;  1UFM A;  2IT0 A;  2V1D A;  2IRF G;  4U7B A;  2W24 A;  1ZLK A;  2H94 A;  3BP8 A;  3OV8 A;  2VC1 A;  2QBY B;  1U2W A;  3P7N A;  5LRR A;  4YFX F;  5D5X B;  2CYY A;  4M71 A;  3MZY A;  1RNL A;  4KT5 C;  4I0B A;  4ON0 A;  1QBJ A;  2FXA A;  4LB5 A;  5K5Q A;  4IRG A;  4A0Z A;  4P5O A;  3R61 A;  3ZQ7 A;  4HX7 A;  2DK5 A;  1T39 A;  4EV0 A;  2DW4 A;  2XV4 S;  1SFU A;  4WXC A;  2VXZ A;  2PN6 A;  3ISP A;  3RPQ A;  3ZPL A;  4XLN F;  3GZ6 A;  5D4R A;  2XIG A;  2L02 A;  5HLI A;  1CF7 A;  3NQO A;  1RI7 A;  1IZ1 A;  1TQP A;  2E1C A;  5H20 A;  2ZNY A;  2RQP A;  2NNY A;  1D8K A;  3IRQ A;  2M5W A;  2GZW A;  4HAM A;  3ECH A;  4IRH A;  4O5V A;  3TKY A;  5JFR A;  4QWQ A;  2UZK A;  2W25 A;  3R60 A;  1J5Y A;  3F21 A;  1W5T A;  3RTR A;  5L3F A;  1IRF A;  2F5E A;  4OIP F;  2UXX A;  4YG2 F;  1ZRC A;  3FF5 A;  3TO9 A;  3DKW A;  1LDK B;  4UV8 A;  5L3C A;  5DYM A;  3E3V A;  5E8I A;  2DLL A;  3F8C A;  3WU0 A;  3F8M A;  3C7J A;  4K2E A;  1B9M A;  3L09 A;  1EH8 A;  1LDD A;  2HFH A;  2QEN A;  3V7R A;  4ENK A;  2QVO A;  4EM0 B;  2RDP A;  3BPX A;  1KU7 A;  4LMY A;  1TQI A;  4M9Z A;  2VT2 A;  2YX4 A;  5BMZ A;  4UV9 A;  2JZY A;  1QZY A;  2GWR A;  3HTU A;  3QU3 A;  3WGI A;  2K7L A;  3C3W A;  2EA4 A;  3COA C;  2VBY A;  4HDU A;  4L0Y B;  4L18 B;  1ZGA A;  1P2F A;  5ILV A;  1J59 A;  4EJW A;  3ELK A;  1XGN A;  3C1D A;  4GCV A;  3DXJ F;  4EJO A;  3IRR A;  3F6O A;  5KVR A;  4I2O A;  2ISY A;  3IL2 A;  3F3X A;  2EV5 A;  1TNS A;  5DUI A;  3QP6 A;  2CQK A;  4I01 A;  3FXU A;  4L0Z B;  5BPI A;  4HF1 A;  3LAP A;  4LB6 B;  3Q5F A;  2HKO A;  4KMF A;  3CTA A;  3QOP A;  1IW7 F;  2CO5 A;  4HBL A;  4U0V A;  4IJA A;  5FFZ A;  4WXD A;  2AS5 F;  1YIO A;  4BHB A;  1Z91 A;  4E70 A;  4CGZ A;  3GW2 A;  1T98 A;  1VTN C;  2JSC A;  3JAM K;  1MGT A;  1SD7 A;  2FQ3 A;  5J8F A;  2FMY A;  1D5V A;  1LEB A;  2P5K A;  2D1H A;  1R58 A;  3WE3 A;  3GFM A;  3MWM A;  4M9X A;  1AOY A;  3HHG A;  1LB2 A;  1Z6T A;  2XAJ A;  3EET A;  4PGH A;  4DQ2 A;  3ZMU A;  2PEX A;  4WCG A;  2LKP A;  3SQN A;  1Q1H A;  5LEJ A;  2ZME A;  4L9J A;  4LD5 A;  3ULQ B;  2NYX A;  3ABU A;  2EK5 A;  3OOP A;  4TV7 A;  5LRS A;  5FGM A;  2MH2 A;  4UXN A;  3CO6 C;  3LQR A;  5E1W A;  3FHZ A;  3EYY A;  2GQQ A;  1V3F A;  3FMR A;  1S29 A;  2VOP A;  2ESH A;  3I4P A;  3RDI A;  2E7W A;  3GZ5 A;  3GEZ A;  2IA1 A;  1I1S A;  2YX7 A;  1W7P B;  3M8F A;  4YFK F;  2P6T A;  1YO5 C;  5BPD A;  5TRD A;  1XGM A;  2YPR A;  3KLN A;  1T2K A;  2M87 A;  1HW2 A;  4MTD A;  5J8C A;  4IHT A;  5LHH A;  5E17 F;  5HVQ C;  5HLH A;  3E6B A;  1KU2 A;  1WRJ A;  3U2R A;  1Z7U A;  4I09 A;  4YII A;  3QRF F;  2DT5 A;  1RUN A;  1W5S A;  3K69 A;  4MGR A;  4R79 A;  4KDP A;  2DPU A;  5E1Z B;  5HDK A;  4HF0 A;  2O6G E;  2ZME B;  4N9I A;  2E1N A;  3E5U A;  4ENJ A;  3I5U A;  2QQB A;  1YQA A;  4LG0 B;  4YFN F;  4LLN A;  5D5U B;  2FA5 A;  4JK1 X;  4Q48 A;  3WGH A;  4D0P A;  2ZFW A;  3FM5 A;  1K6O A;  5CVI A;  1T38 A;  2KIM A;  2K27 A;  1IXR C;  2DPD A;  2FBK A;  5BOX A;  1XMA A;  2UXN A;  2IA2 A;  1IUY A;  3M8E A;  2OZ6 A;  3KFW X;  5E1X A;  3SXY A;  1UCR A;  1OYW A;  1EH7 A;  4PCQ A;  4AD9 A;  1Z1D A;  2RN7 A;  1S8N A;  1ZG1 A;  4Y17 A;  2HTS A;  1YS7 A;  3N4M A;  3P9I A;  2Q0O A;  1P4X A;  1MJB A;  2VBW A;  3GO5 A;  3I0T A;  1IN8 A;  3R4K A;  3KE2 A;  1IXS B;  1REP C;  5ICE A;  2HQR A;  3IHU A;  4IVN A;  2NAZ A;  4Y15 A;  4UUV A;  3ZMT A;  3NEU A;  2Q8K A;  2DFI A;  1I6X A;  1XGO A;  4PZJ A;  1U5T A;  3TDU C;  5H6R A;  2X0L A;  2X4H A;  1G6N A;  1IN5 A;  4WK8 F;  2LF7 A;  4L5J A;  4KN4 X;  4CO8 A;  4U0Y A;  4LGW A;  5FD5 A;  1EV7 A;  1ZYR F;  2JTV A;  1QGP A;  2XHK A;  5H6Q A;  2FU4 A;  3VOE A;  1LEA A;  3Q9V A;  3FX3 A;  1YW7 A;  3GUD A;  2A61 A;  4KNY A;  1YG2 A;  1BN5 A;  2EJR A;  4MHG A;  1B6A A;  3PQK A;  3MFK A;  2EB7 A;  3R6S A;  2L3D A;  4HLY A;  4AVP A;  4G7O F;  4IXA A;  2M30 A;  2ZKZ A;  5F6F A;  2L4A A;  4A0Y A;  2R7D A;  3J7A O;  3ERE D;  4G7Z F;  1MKM A;  1HKS A;  4U0W A;  1J9I A;  3D5L A;  2FML A;  4UNO A;  4OOI A;  2FEZ A;  2P4W A;  2P7V B;  4ZZL A;  3PFI A;  5E18 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...