2K4BA

Copr repressor structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
FNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title The copper-responsive repressor CopR of Lactococcus lactis is a 'winged helix' protein.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Dna binding protein
total genus 16
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k4bA00
1NHAA 4EJTA 1LEBA 3WTYC 2OQGA 3MQ0A 3LSTA 1G3YA 4WK8F 4HF0A 2QWWA 4P55A 3KP3A 2XASA 4IXAA 3RDIA 3WTVC 1OMIA 3V7SA 4E70A 3LA2A 1USTA 4KNYA 3ECOA 3I59B 2V79A 4A6EA 4WXCA 2O0YA 1O7FA 2LNBA 5HLHA 2M30A 3I0TA 2MLKA 2GA1A 4LLGF 1O3SA 2PQ8A 4L5IA 1Z9CA 3LA3A 2DK8A 4Q47A 5K5RA 1XGNA 4G6QA 1CGPA 4CHUA 4AIKA 1XMKA 1H0MA 4RAYA 2RN7A 5IT3A 5D6FA 4IJAA 5D8LB 3D5LA 4N0BA 1W7PB 3LAPA 2G9WA 1D8KA 1SMYF 4ESJA 4IRHA 2FE3A 5L3FA 3L00A 4RB2C 1ZRFA 3DQVC 4RGSA 5L3CA 2RDPA 1IXSB 5D5XB 4M9ZA 2IA1A 1FWZA 4KDPA 4HYEA 1G6NA 4G9YA 2MD5A 2Q8KA 2JT1A 5IT9K 3KP4A 2K7LA 1KGSA 3IRQA 5F64A 1HXDA 1TNSA 2CQKA 4LG0A 3VFZA 4HDUA 1IN5A 3J81K 5BS6A 1PP7U 4U7BA 3F8BA 2P4WA 2PMUA 1QQIA 5TRDA 1G3SA 2EFNA 3SHFA 5AONA 2L02A 3DV8A 1SAXA 4HLYA 1AOYA 1TQMA 2VBYA 4ZYHA 3MZYA 4HF2A 2RKHA 1ZLKA 3KP7A 2FXAA 1R5HA 2W57A 4NB5A 3GFLA 1BI3A 2BEOA 2DBBA 2OA4A 4S05A 3ROUA 4PDKA 3CLOA 2DFIA 3KP2A 3V7CA 1U2WA 4YIFA 1XD7A 3HYIA 1E2XA 3IWFA 1GXPA 4P9FA 2VBWA 1B9NA 1IW7F 2NAZA 5ILSA 4KMFA 4BNCA 3KCCA 3WGGA 2Z5UA 3BROA 2E1NA 2CYYA 1QGPA 1FSHA 3HIFA 2VBZA 4JK1X 5K5OA 4LLNA 3QPTA 1YTYA 1ZRDA 5FLXK 4CO8A 5E1XA 2HKOA 4B8XA 4A5NA 4XLPF 4OU0A 3GWZA 1YW8A 4MQVA 1LDDA 2Z9OA 3KETA 4EM2A 3DF8A 4UXNA 3DEUA 5LEKA 2BBYA 1MJ9A 2DPDA 3K2ZA 5DCMA 2FU4A 3T5XA 4AD9A 1HQCA 1SMTA 4LGWA 4CXFA 5DUKA 2M8EA 2K4JA 2PLYA 1R5GA 5HS8A 4MHGA 1O3QA 1IXCA 1DUXC 2B0LA 2LF7A 3BJAA 3CUQC 3BPXA 4L9VA 4P9UA 4MGRA 3E5QA 1U78A 1ZRCA 3MZHA 4I2OA 1ZG3A 3F6VA 2UXNA 4BYYA 1XN7A 4EVIA 3ULQB 1YIOA 3TOBA 3VOEA 5LHHA 4G6DA 1HKTA 2O8XA 2VT3A 3IKVA 3P9KA 3ZMTA 3O2PE 5D4RA 5E8GA 1B59A 1I27A 4OIOF 2LSOA 4U0YA 5LGNA 5BMZA 4OMYA 2BGCA 2VOPA 4LG0B 1ON2A 2IVMA 2FF4A 2ZJ2A 4P96A 3HRMA 2Y75A 4KIGA 1HW2A 2OAZA 5CYVA 4RB3C 1LEAA 1XSVA 4PGGA 4ENJA 1YQAA 1XSXA 4HOBA 2IT0A 1T2KA 3U2RA 2L3DA 2YX7A 2BYVE 1FNNA 3BOQA 4MEXF 1U5TC 2OD5A 4L18B 5LRRA 4EJOA 1REPC 1FYLA 5L3DA 1KQ9A 3F23A 3SQNA 3O3KA 4JQFA 4RGRA 3IRRA 2QYOA 2VC0A 1FC3A 4RB0A 1WKMA 2HGCA 3E6DA 2A61A 4BH9A 4U0VA 2OZ6A 3BDDA 2IJLA 1IXRC 4EGZA 5CVRA 5DDGA 5IT9Z 3F6OA 3HRTA 2W85A 5LLQA 1HSJA 2J5OA 3DFGA 5HLIA 2EA2A 3WTZA 5FFXA 1MKMA 2W84A 1OPCA 3C7JA 1FZPB 3Q9VA 2MBFA 2FMLA 3ZMVA 2YPRA 4HW0A 4XLNF 1J9IA 4WXHA 2RV8A 2Q2EA 1J75A 5AIQA 3M9AA 2P8TA 5ICCA 1SFXA 3L09A 3JW4A 1J59A 1CF7A 1LNWA 3FM3A 3VEPA 3FXQA 2IA2A 2IA0A 2CFXA 2R7FA 4HAMA 3REOA 1MDMA 2FRHA 2XHKA 2H6CA 5DEQA 2QM3A 3ZMZA 2KIMA 4EJWA 1SFUA 3K69A 4L9JA 4UV9A 5FFZA 3CTAA 5TJJA 3FXRA 1Z91A 3RJPA 3FMSA 2A68F 1UCRA 1BC8C 4OIQF 5F6FA 2Z3YA 1KQ0A 3TO6A 1XMAA 2EV6A 1KU3A 2P7VB 3HSEA 3HUGA 2H6BA 4HX4A 2DTRA 2VONA 3P9IA 5JR3A 4ZZDA 1RIOH 1UB9A 3ELKA 2ACJA 1T0FA 1U5TA 4YFNF 2VE9A 1QPMA 5FLXZ 3ZPLA 3F72A 1R58A 1V4RA 1FSEA 4ZYDA 4UNOA 2PMHA 1MJAA 5LHIA 1BC7C 3RPQA 3QP5A 2M1BA 5D8KB 4GYIA 1K78A 3HHHA 2EFQA 5E18F 3H3ZA 5CLSA 4M9XA 1TLHB 3DPTA 2BE5F 5D4SA 2M45A 1G3TA 1XCBA 4UVCA 2ZCWA 5FD6A 4LJZF 2M5WA 3JTHA 2D1VA 2O03A 1FT9A 1S7AA 1P4AA 5JVTA 1W4MA 1WSUA 4QLCU 3K1MA 2D45A 1KQ8A 3VB2A 5EEGA 4YG2F 2XRNA 4M74A 4LLLA 5ICFA 1KU9A 1ODDA 4RGXA 4NHJA 4L0YB 1YS6A 2QBYA 1RZ4A 1K6OA 1IF1A 3V8JA 1IUYA 2MC3A 4I09A 3WE2A 4HV6A 2K27A 4ZH4F 4EM1A 2FNAA 2C6YA 1ZARA 4UUVA 2X4HA 2NNNA 3GEZA 3KP5A 4M6YA 5FD5A 2FEZA 1HW5A 4A0ZA 5BPIA 2MH2A 1R1TA 3AAFA 2FBIA 2MLGA 4A0XA 2MH9A 3K0LA 2STWA 3IKTA 3LQRA 4IVNA 1CF7B 3I64A 4G7HF 1ZN2A 1EH7A 1KYZA 1X3UA 2IPQX 5CVUA 1IRGA 3DPLC 2XKOA 2L4MA 2P7CB 1FYKA 2PBIA 2HTSA 4ZYGA 2GIVA 1U6GA 1E17A 5ILVA 2ZNYA 1D5VA 4I02A 2H09A 2QQAA 4A6DA 2XAGA 3KLNA 3R61A 4CDGA 4IRGA 4DQ2A 1HW1A 2NRAC 1WRJA 3FF5A 3QAHA 3BY6A 4CGZA 3B02A 2UWMA 1KA8A 4UVAA 1I1GA 3GUDA 4HBLA 1C0WA 5J8CA 1EV7A 4MEYF 2CGPA 5CVJA 1PUEE 3VODA 4PZJA 3QP6A 3CUQB 3SXYA 4BXUA 1B9MA 2XAQA 3CO6C 4GYGA 1KU2A 2QVOA 3DXJF 2ETHA 1P92A 1K78B 2FA5A 5AIPA 2XAFA 3TDUC 3BJOA 1FP1D 5FGMA 3M1EA 4KICA 1ZREA 1QZZA 3FWEA 4GO1A 4CYDA 3MEXA 2OU2A 1HSTA 2KJBA 1KU7A 1W5SA 5LRSA 1SD6A 4N9IA 1O57A 3WTTC 2DAOA 2DLLA 4Q48A 2QENA 4G7OF 2E7XA 1LB2A 3F8MA 5LBQA 4UVBA 4BHPA 3KZZA 3N97A 3GF2A 1U5TB 4BHCA 5D6EA 3SFZA 1J0RA 2HR3A 1G3WA 2AS5F 1FPQA 2D1HA 4OIPF 4I01A 3JAMK 1P4XA 1BIAA 2P5VA 4KUMA 3HRUA 1LDKB 2LKPA 2HWVA 3RKXA 4F7ZA 4FX4A 4Q4ZF 5BPDA 3IWZA 4OINF 1HKQA 4BQAA 3BZ6A 4OOIA 2F5FA 2A5YB 2TDXA 5DD4A 1FBSA 4ENNA 1IN4A 3RTRA 1FBUA 1Z6TA 5ILUA 5FO5A 4EJUA 3ZMDA 1SD5A 4ESBA 2NS0A 4EMSA 1TTYA 4KYWA 4P5OA 5KK1A 1Z05A 2EWNA 3E97A 4M72A 3CO7C 2CO5A 4IRIA 3V8KA 1FBQA 2A07F 3C18A 2RGVA 3ABTA 3WU0A 3F21A 1SD4A 1F4KA 2XGXA 4ENKA 1HKSA 3MCZA 3I53A 4GCVA 1J7KA 4M9SA 5E8IA 2IP2A 1P2FA 2HTJA 3WTSC 5E17F 2OQRA 2ZNZA 1T39A 5CVVA 2VODA 3ZMUA 3KFWX 4LFUA 2JSCA 4AWXB 1IN7A 1TQIA 5HDKA 2ZBKA 4U88A 5DV5A 3B73A 4KMUX 2KIUA 3T1BA 2EA4A 1ZLJA 1I5ZA 2W24A 2GXBA 5H6QA 4LK1F 1XCVA 2JPBA 3RYPA 2R7DA 5KVRA 3TO9A 4A12A 2WWYA 2HQRA 3NRVA 4WXDA 2ZMEA 4L9TA 2EFPA 3E6CC 2CG4A 2YR2A 5D5UB 1FLIA 3HTUA 3EETA 1TQPA 3W6JB 2WC2A 1ONVA 5L3EA 3HOTA 1R36A 3ISPA 3N4MA 3LAJA 1BI0A 5JI6A 2A6HF 4OIRF 2HZTA 2K02A 4WCGA 4G7ZF 4D0PA 3TGNA 2ADUA 3I5UA 3HHGA 3E6BA 3FM5A 1SFEA 1D3YA 1I6XA 2VXZA 3CUOA 2HYFA 1FX7A 1OYWA 2QUFA 2BV6A 4BAYA 1FOKA 2GWRA 3BWGA 4IHSA 1EH8A 1O3RA 2RC4A 3T8RA 3FMQA 5DCMB 3FXUA 3GFIA 3EDPA 4AIHA 5J8FA 1XDUA 3EYIA 4KN7X 2NYXA 1B6AA 3M7GA 3LQQA 4HX7A 2KIFA 4XBFA 2EFOA 1STZA 4O6JA 2EFWA 3JAMZ 5ERIA 2DI3A 5L3BA 1BN5A 3CJNA 1ZAOA 2F2EA 4Y17A 1YW9A 4M6XA 3HOSA 1QZYA 2XAJA 3IHUA 3GW2A 4ESFA 2M87A 3KLOA 3WTUC 3COAC 3E3VA 3RPUA 4I98B 1IN6A 1WQ2A 3WODF 1W7PA 3D0SA 3SZTA 2UXXA 5H20A 1IZ1A 5BQTA 4XSZF 2F5EA 1S7OA 5FB2A 2YU3A 2X0LA 4GGGA 5K1YA 2MA3A 2RQPA 3DKWA 3GXOA 1S8NA 3E5UA 3KP6A 1RNLA 3IL2A 2Z33A 2IW5A 3F8CA 3WGHA 2GA2A 2ZMEB 5ED4A 1ZG5A 3HSRA 2DU9A 4S04A 5HLGA 1JHFA 1D8JA 4O3MA 1S6LA 2XKPA 3R6SA 4HA8A 4A2UA 5E1WA 2ZXJA 1F9NA 2P5LC 4A0YA 2V1DA 2XUBA 4G8XA 3ML6A 5D5WB 4OMZA 2DT5A 2RNJA 2HKXA 5HS9A 2G7UA 3WGIA 2XV4S 2PEXA 2HDCA 2CSOA 4KA4A 1U8RA 1DP7P 1JGSA 6PAXA 1OYIA 3FMRA 3U1DA 3BPVA 1BI1A 1L0OC 4KT5C 1DPUA 5LGTA 2DK5A 4NQWA 4DNCA 3EQLF 1ZHFA 2JPCA 2PI0A 5HOOA 3V4GA 1JHHA 5J6XA 3R0JA 4N9HA 3HTSB 2HYGD 4ZYEA 3F8NA 2XAHA 1OYYA 5DUIA 4YIIA 3DP7A 3HRSA 4HQMA 4HQEA 3JTGA 1BI2A 1XGSA 3QPHA 1ON1A 1MDMB 2EK5A 3G3ZA 3TKYA 4Q5SF 3L7WA 5ICGA 1A04A 1O3TA 3RYRA 2Y0MA 2K86A 4HLXA 3KEOA 2AXLA 2RVCA 2ISZA 4L9NA 1YFHA 1BOAA 1T38A 2ZKZA 3IC7A 3J80K 1S3JA 2VBXA 2DPUA 2QZ8A 3WU1B 1G4DA 3H3UA 4WF2A 4PCQA 3WTXC 4XSXF 2FQ3A 3FZVA 5DCFA 1QO0D 3CDHA 5EEHA 4H0EA 3M8EA 3RKYA 2GQQA 2FOKA 2A6EF 4GXOA 4R8HA 2H27A 2E1CA 3F22A 2L01A 3GO5A 1OR7A 2FNPA 5E20A 2O3FA 5DYMA 3GX4X 2PG4A 3MFKA 1J5YA 3GFMA 3KZYA 2VN2A 4HZFA 2QLZA 4EJVA 2ZO4A 3PQKA 3GZ6A 5HS7A 5A2QK 4Y13A 1Z1DA 1MZBA 1K7AA 4ENMA 1SD7A 1V3FA 2LDUA 2VT2A 1XDSA 5JFRA 1ZH5A 1O7LA 2P6TA 3KEQA 3C3WA 1GVJA 4HX8A 1F1ZA 3TDZC 1PP8F 1VTNC 2V1UA 3ABUA 2KRFA 1R00A 4RGUA 1H9GA 4LD5A 2QBYB 2ZFWA 2DQLA 4WWCA 3GFJA 3KE2A 3S2WA 1LQ1A 1Z6RA 3U9GA 4IPAA 4KIFA 4K2EA 1GHCA 3RKWA 3F3XA 2P5KA 1BBYA 1EH6A 3MWMA 5CJ9A 2EJRA 2HEOA 2G7HA 4UHTA 3I58A 2PFBA 1YO5C 1WI9A 2JRTA 2O61A 1PDNC 1UHWA 3P9CA 2F5CA 3QRFF 2GAUA 4RAZA 3OV8A 4I0BA 1OKRA 1DDNA 1LVAA 2HOEA 2R3SA 4MNUA 4A5MA 1H9TA 3JSPA 3K9TA 3RI4A 1XB4A 2A3SA 1YS7A 5ICEA 4YFKF 3L9FA 1XGOA 3HSFA 4IHTA 4MTDA 2DW4A 2L54A 2D2WA 1IRFA 2W25A 1R23A 4FHTA 5BOXA 1U3EM 3G73A 2EV5A 4I7HA 2VC1A 5CVIA 2GXGA 5F1RA 4RB1A 4AIJA 4ON0A 4U0WA 3R4KA 2Q0OA 4TV7A 1B4AA 2Z99A 3LFKA 2CW0F 3GLXA 2YSRA 3QU3A 3QU6A 3WE3A 4XRFA 3P7NA 2WV0A 1XSDA 1R1VA 4Z2YA 3PQJA 2ELHA 1I1SA 3ZP5A 2V6CA 2FBHA 4JBAA 1IN8A 2FMYA 3H92A 1AWCA 4MQ9F 4G94A 2QQBA 3BP8A 1Y0UA 3LWFA 1BM9A 3T8TA 4AVPA 3GYHX 1P4WA 3F8FA 5LHGA 2V9VA 1YYVA 4L0ZB 3J80Z 1TNTA 4MTEA 3I4PA 2UZKA 1YLFA 1R22A 4BHBA 4EM0B 2HFHA 3ZQ7A 1TBXA 4U7DA 3GVAA 2HQNA 1R7JA 2V1XA 2E7WA 2FBKA 2O6GE 3QOPA 1XGMA 2P6SA 2J5PA 5HVQC 4M73A 2ESNA 3E6MA 1IAWA 3ZN0A 4ASNA 3R0AA 5D5VB 1L3LA 3PFIA 2FSWA 5E1ZB 2GZWA 4Y15A 3NQOA 1T6SA 4EGYA 3ERED 5A2QZ 1FY7A 3ECHA 2JTVA 1QBJA 2L4AA 1LDJA 4O5VA 1F5TA 1Q1HA 4LMYA 3I54A 3OOPA 1USSA 3ZMSA 2PJPA 2STTA 4LK0F 1GXQA 3E5XA 3J81Z 1T98A 1ZYRF 2KJCA 3W6KB 4HF1A 2CWEA 5LGUA 2DQRA 3RIRA 5H6RA 3K1PA 2WTEA 2PN6A 1KYWA 5HDNA 3EUHA 2XROA 3J7AO 3I59A 1RI7A 2DO7A 2OZUA 1FP2A 3FX3A 1P6RA 3K1NA 3GZ5A 1MGTA 1BJAA 2ESHA 1TW3A 1ZG1A 3FHZA 3T0YA 1WWXA 4KFCA 1J2XA 3Q9SA 1W7PD 4WX9A 2IRFG 4R1HA 4UV8A 5L3GA 1ULYA 5HDGA 2VOOA 1K79A 3SZPA 4M71A 2Y48A 5DD8A 1RUNA 4RS8A 1B1BA 4HV5A 1QNTA 4B09A 3I71A 3MAJA 3M8FA 2VE8A 4KIBA 1YG2A 2EV0A 3V8LA 3LA7A 4QWQA 2F5DA 3C1DA 3O6BB 4FX0A 4EQQA 1FYMA 4IF4A 3EYYA 2KKOA 3L2CA 3TO7A 1ZGAA 2HS5A 4EV0A 2A69F 1HBXG 4LB6B 4PGHA 3WTWC 1R1UA 1ZGJA 3NEUA 2NNYA 4CICA 4LB5A 3CUQA 2OBPA 4ZZLA 5JHUA 2K4BA 1DPRA 1LJ9A 2ISYA 3ZN1A 4FT8A 1BIBA 2XVCA 4R79A 1Z7UA 2COMA 1JE8A 4YFXF 4CZZA 2LF8A 4I0AA 1JXSA 4HDVA 3V7RA 1UFMA 3WG9A 1MJBA 4L5JA 1RUOA 3BJ6A 4ETSA 3JSOA 2JZYA 3R60A 3TQNA 2YX4A 3TOAA 2XIGA 5LEJA 2EB7A 1S29A 1W5TA 3Q5FA 5K5QA 1MD0A 1TW2A 1YW7A 2QQ9A 2H94A 4KN4X 1UHMA
chains in the Genus database with same CATH superfamily
1NHAA 1A36A 4HSRA 1QPIA 4EJTA 2KZVA 4ZDLA 1LEBA 3WTYC 2OQGA 3MQ0A 4DJAA 4JOMA 3LSTA 3JRGA 1X1CA 1G3YA 2PJRA 2M3AA 4WK8F 5FRMA 4XLEA 4HF0A 2BW3A 2QWWA 5JLWA 4P55A 3KP3A 2XASA 4IXAA 1ETWA 3RDIA 3WTVC 1LE8A 1OMIA 2JVHA 4M3FA 3V7SA 4E70A 3HGGA 3LA2A 3DWLE 4F55A 4A3EJ 1USTA 1X58A 4KNYA 3ECOA 3I59B 5J1YA 5EZGA 2V79A 4A6EA 4I6ZA 3J7YJ 4WXCA 1DU0A 2MC4A 4PUSA 2O0YA 3HKZA 3HOZJ 1O7FA 2LNBA 3LSPA 5HLHA 2M30A 3I0TA 2MLKA 1T95A 3A01B 5K7HA 2GA1A 4LLGF 3CCRI 1O3SA 1OISA 4E7KA 2PQ8A 4L5IA 1Z9CA 2WY8Q 3LA3A 2COBA 3QOEA 2DT7B 2DK8A 4Q47A 2HU9A 5K5RA 2Z16A 4ANJA 2JA7J 2LLKA 1XGNA 2LKSA 5GPCA 2CU7A 4G6QA 2K3PA 2V7FA 3BR1A 1CGPA 2F4IA 4CHUA 4AIKA 1XMKA 4A3CJ 1H0MA 1DQUA 1PJRA 4RAYA 2MSYA 2RN7A 5IT3A 5D6FA 1B72B 1B8IA 4IJAA 1LUJB 3H9QA 1JJ6C 2DCEA 5D8LB 3D5LA 4N0BA 1W7PB 3LNQA 4UUTA 2H8RA 3LAPA 2G9WA 1TWGJ 3HBLA 1D8KA 3L2WA 1SMYF 4ESJA 1XS9A 5IOYA 4A3MJ 4IRHA 2FE3A 3BCAA 5B66C 5L3FA 1MMNA 3L00A 4XORA 4RB2C 1ZRFA 3DQVC 3BTCA 4RGSA 2Y2ZA 5L3CA 3RKQA 3J7ZI 4RLQA 2K9NA 3DKYA 3ZQQA 5K7ZA 2RDPA 3HKZN 3IV5A 1HOMA 1BW6A 1U9NA 5JHFA 1IXSB 1MSFC 1P9QC 5D5XB 4M9ZA 2IA1A 1FWZA 4KDPA 4HYEA 3CZ6A 1G6NA 4G9YA 3LSRA 1JTYA 2LBFA 3ZQFA 1Y0NA 1D1AA 2A5WA 2MD5A 2A6TA 2Q8KA 5IPAA 4RAFA 3CP2A 2JT1A 4DBQA 2V6EA 5IT9K 3KP4A 3KYLA 4QSHA 1MMSA 1ZKGA 2HPIA 2K7LA 4C3IJ 1KGSA 3IRQA 5F64A 2IGOA 3IUOA 4N4NB 5FKMA 1HXDA 1WJCA 1TNSA 3OY9A 4MFDA 3H9GA 2CQKA 3HEFA 3CF2A 4LG0A 1S7EA 3VFZA 4HDUA 1IN5A 3J81K 5BS6A 1PP7U 3DEEA 1OFCX 4U7BA 3F8BA 2G0EA 2HI3A 5IP7J 5F04A 2P4WA 2NVXJ 3G1MA 3Q0UA 2PMUA 1QQIA 2CS3A 5J47A 5TRDA 1G3SA 2EFNA 1GVDA 1Y6IA 5AONA 3SHFA 1X2MA 1NK3P 2EIJH 2L02A 3DV8A 2OCCH 3FBNB 1SAXA 4HLYA 1AOYA 1TQMA 2B7EA 2VBYA 4ZYHA 4EATA 3MZYA 4HF2A 2RKHA 1ZLKA 3KP7A 2FXAA 3IH2A 1R5HA 2W57A 4NB5A 1D0ZA 3GFLA 2IGKA 3RSNA 1BI3A 3OS0A 3OIOA 2BEOA 3HG9A 2DBBA 2OA4A 2VJIA 4S05A 2JRMA 5DTDA 3ROUA 1RC9A 2LOOA 2WAEA 4PDKA 3CLOA 3OYMA 2DFIA 3KP2A 3GTKJ 3V7CA 2BVMA 4RM3A 1U2WA 1RR7A 4XQFA 2GBYA 4YIFA 3ZQGA 2BW3B 1XD7A 1F36A 3HYIA 1E2XA 3IWFA 3JRHA 3MKWB 3L1PA 4J01A 1V5EA 1GXPA 4P9FA 1VQ4I 2XC7A 2VBWA 3HOXJ 2XAUA 3I4MJ 1B9NA 3B6AA 1IW7F 2NAZA 5ILSA 4KMFA 2LH9A 4BNCA 3KCCA 3OYGA 3WGGA 3HPHA 3AFHA 1TP4A 3GBGA 3BROA 2Z5UA 2E1NA 2CYYA 1QGPA 3LOCA 3RZOJ 1FSHA 3HIFA 3D5RC 2VBZA 4JK1X 2NS8A 2X9DA 5K5OA 1OQYA 1AU7A 2DFFA 4LLNA 2RAEA 3VSKA 2HZDA 2K85A 1VFCA 1XG1A 3GCMA 3QPTA 1YTYA 5K7FA 1ZRDA 4E7SA 2Y31A 5FLXK 4CO8A 2L7FP 5E1XA 2HKOA 4B8XA 4A5NA 1LKXA 2Y0SA 4XLPF 4OU0A 3NWSA 2LY2A 3GWZA 1YW8A 2ZC2A 4B4CA 1BR1A 4MQVA 3H0DA 4ZTFA 4IHWA 1LDDA 2DODA 2Z9OA 4C2TA 3KETA 4EM2A 3MKZA 3L2VA 1X3ZB 2R7SA 5FKOA 5HLTA 2TRTA 3DF8A 4UXNA 3DEUA 2JA6J 1WH7A 3S2HJ 1Z77A 2BY3A 5LEKA 3AKZA 1WZ2A 1MBHA 3K4LA 4E7JA 1R4MB 3A0HC 2BBYA 2OCEA 1FIPA 1MJ9A 2DPDA 1T0FC 3K2ZA 1MMDA 3GTOJ 5M3FJ 5F0FA 5DCMA 2FU4A 1U9OA 1UHSA 3T5XA 4AD9A 1HQCA 4V19K 1SMTA 4CA0A 5FRNA 4LGWA 1YJNI 4CXFA 2HOSA 5DUKA 1IDZA 2EBIA 2M8EA 1X1DA 2K4JA 2PLYA 1R5GA 5HS8A 4MHGA 1O3QA 5IOZA 3NARA 1WPKA 1IXCA 3FXJA 1N78A 1DUXC 1JTXA 2B0LA 1IRXA 2LF7A 3LSMA 3BJAA 3CUQC 2MW8A 3BPXA 1UZCA 1WJEA 4L9VA 4P9UA 3CCJI 3LMMA 4MGRA 1UAAA 3E5QA 1R5ID 4UB8C 1U78A 2Q1ZB 1ZRCA 4IOCF 3MZHA 4I2OA 1ZG3A 3F6VA 2LBFB 2UXNA 4BYYA 2LC2A 1LPQA 3HPGA 1XN7A 2L5QA 2W82A 2EIKH 4EVIA 1F43A 2Y0SN 3ULQB 1YIOA 4A3LJ 4C3HJ 3TOBA 2R7QA 3VOEA 5LHHA 4G6DA 2VJJA 1HKTA 2O8XA 2VT3A 3IKVA 3P9KA 3ZMTA 3O2PE 3U21A 5D4RA 1T8IA 5E8GA 1B59A 1I27A 4OIOF 2LSOA 1R71A 4U0YA 4W1UA 5LGNA 5BMZA 4KISA 4KT6A 4OMYA 2BGCA 3S15J 2VOPA 4LG0B 2HOAA 1MSEC 1ON2A 5IP6A 2IVMA 5IY5H 2M4GA 2IEKA 2FF4A 2ZJ2A 4P96A 3HRMA 2Y75A 4KIGA 1DP3A 1HW2A 2M4KA 3G71I 5LD2C 2OAZA 4XL9A 5CYVA 4RB3C 1LEAA 1XSVA 4YEJA 2AQFA 1CQTA 4FISA 4DGWB 4PGGA 2IS1A 1YQAA 3SZGA 4ENJA 1WJ5A 1XSXA 1QVTA 4HOBA 4F93B 2IT0A 1T2KA 3U2RA 3IAS2 2L0KA 2L3DA 4XKVA 5F27A 2YX7A 2BYVE 1FNNA 3BOQA 4N4OB 4MEXF 1U5TC 3OYCA 1FMWA 2WV1A 5E3NA 2OD5A 2RNGA 4L18B 2R7UA 5LRRA 4XK4A 4EJOA 3QODA 1REPC 1FYLA 2K9SA 3M07A 4FE4A 5L3DA 2M9HA 1KQ9A 2KLOA 3F23A 3SQNA 2BHZA 1NG7A 3O3KA 4JQFA 2B63J 3MVPA 2XF7A 3HOVJ 4RGRA 3IRRA 2QYOA 1LFPA 2VC0A 2N8GA 1FC3A 3H9JA 4RB0A 1VI0A 1WKMA 2KHMA 2HGCA 3OYNA 1TWHJ 4XONA 3MD2A 3E6DA 2A61A 4BH9A 3BDDA 2OZ6A 4U0VA 2IJLA 4BJTA 1ERDA 2L7KA 1IXRC 4EGZA 1ZTRA 5CVRA 2DMQA 2NVYJ 5DDGA 1DGWY 1SFKA 3F0CA 5IT9Z 2KRHA 3F6OA 1E3PA 5JLXA 2BY1A 3HRTA 3B6CA 2W85A 4HNUA 5FKKA 3CP8A 5LLQA 1HSJA 2J5OA 3DFGA 5HLIA 2EA2A 3WTZA 2FD5A 5FFXA 1MKMA 4LOCA 4FASD 3JRAA 3OWTA 2W84A 2V1NA 1OPCA 4M3GA 3C7JA 2RREA 1FZPB 3Q9VA 3BG7A 1YX3A 1Y8QB 2FMLA 2MBFA 3ZMVA 2YPRA 4HW0A 4XLNF 1J9IA 2CFOA 5DM7F 4WXHA 2RV8A 2Q2EA 1J75A 1VQ7I 2OJED 5AIQA 3M9AA 3S2DJ 2P8TA 3ASNH 2CW8A 1ZQ3P 5ICCA 1SFXA 3L09A 3JW4A 2VQLA 1J59A 2VXDA 1CF7A 1LNWA 1TWCJ 2UV1A 3FM3A 1LFUP 3VEPA 1PYVA 3FXQA 2IA2A 2IA0A 2CFXA 2R7FA 4HAMA 3REOA 1MDMA 1MNEA 1S72I 3TW6A 2FRHA 2XHKA 2H6CA 5DEQA 2QM3A 3K6GA 3ZMZA 2KIMA 4IOAF 1QU3A 4EJWA 4BL0B 1SFUA 3K69A 4L9JA 5FLMJ 3CDLA 3CCEI 2NOJB 3GZNB 4UV9A 3BT9A 4C30A 5FFZA 4XKCA 1VQNI 4MLOA 3CTAA 5TJJA 4EEFG 3FXRA 5M5XJ 1Z91A 4LIVA 3VYRB 3RJPA 3PIPF 3FMSA 2A68F 1UCRA 4A69C 3S3MA 1BC8C 2GOXB 4OIQF 2V4JC 2AQEA 3BC8A 5F6FA 3SEZA 3WHCA 2Z3YA 2DA7A 1KQ0A 2DMNA 2HYJA 4D9JA 1P7JA 3TO6A 1XMAA 2EV6A 3CJRB 1KU3A 2P7VB 3BLYA 1RKTA 1U8BA 2CW7A 3HSEA 3HUGA 4V2FA 2H6BA 4HX4A 2ZXHA 3I56I 2DTRA 2W00A 1JUMA 2LKXA 3JRIA 2WAQA 1EJ9A 3P9IA 4XLCA 2VONA 1TC3C 4IX7A 3IH4A 5JR3A 4ZZDA 1RIOH 1UB9A 3ELKA 2ACJA 2QSGX 1JGGA 1T0FA 1POGA 2JA5J 1U5TA 4YFNF 2VE9A 2WB1A 1JKQC 1QPMA 2DFHA 4RAGA 4BBSJ 5FKNA 5FLXZ 1YHQI 3F72A 3ZPLA 1R58A 1BL0A 1KONA 1V4RA 3HJEA 1FSEA 2MG4A 2JA2A 4ZYDA 2CMPA 2PMHA 4UNOA 2XGCA 3LFUA 2Y9ZA 1MJAA 1TWFJ 5LHIA 1BC7C 3RPQA 2HDDA 4CCJA 2JUGA 4XKWA 3QP5A 3CCLI 2M1BA 5D8KB 4GYIA 1K78A 4A3BJ 4DZPA 5CPRB 1IV8A 2Y9YA 3HHHA 2EFQA 4IQJA 5E18F 3H3ZA 4BDZA 5CLSA 3KYCB 4NNJA 2XPWA 1HF0A 4M9XA 4ZC3A 1TLHB 3DPTA 2BE5F 4AUXA 4MFEA 1VZ0A 5D4SA 4AM3A 3PIOF 2NVUB 2M45A 4QPOA 1G3TA 1XCBA 4UVCA 2ZCWA 5FD6A 4LJZF 2M5WA 3JTHA 2D1VA 2O03A 2R7VA 5GAHJ 1FT9A 1D0YA 1S7AA 1P4AA 5JVTA 1W4MA 3TBIA 1WSUA 1R49A 2WAQN 4I76A 4QLCU 3LSJA 5B1AH 3K1MA 2D45A 2W7NA 1KQ8A 3VB2A 2HVQA 5EEGA 5B5EC 4YG2F 1PUFA 2WB1N 2XRNA 4M74A 3VSLA 4GFBA 3DBRB 2KDZA 4LLLA 2XB5A 5ICFA 2YU9J 1KU9A 3DU5A 1ODDA 4RGXA 1BJZA 3MN2A 3JRDA 3C2HA 4L0YB 4NHJA 1YS6A 4LITA 2QBYA 1RZ4A 1K6OA 1A5JA 2BVLA 2K9QA 1IF1A 4XNFA 3QWLA 3V8JA 4CYCA 3KYDB 4CH7A 4FQGA 2MC3A 4I09A 3KX2A 1ITYA 1IUYA 4CSWA 3FXMA 5TGTA 3WE2A 2E5NA 1Z21A 3W2WA 4HV6A 1X2NA 1Y56A 2K27A 4ZH4F 4Y33A 1VQ6I 4H4KC 3BQZA 4RM2A 4EM1A 3H0GJ 3CC4I 2FNAA 4HEA2 2AO9A 2C6YA 2DMPA 1ZARA 4UUVA 2X4HA 1VNDA 2NNNA 2IGNA 3GEZA 3KP5A 4M6YA 5FD5A 4BBRJ 2FEZA 1HW5A 4A0ZA 2E2HJ 1XMXA 3BQYA 5BPIA 2MH2A 3ZQCA 1R1TA 4E4HA 1RPWA 1BR2A 3AAFA 1UG2A 3A4CA 2FBIA 2CUJA 2MLGA 3TP3A 2Q2EB 2Z1DA 2LY9A 4A0XA 2AHQA 3QPSA 2MH9A 4HPQA 4BUPA 3K0LA 4ZJZA 4UUSA 2STWA 3IKTA 2DTZA 3LQRA 4IVNA 3OYIA 1CF7B 3DCFA 1D5YA 1R4NB 3I64A 4NDLA 3D1NI 4G7HF 3OYKA 2VPRA 1ZN2A 1EH7A 1FJLA 3OYJA 1KYZA 1X3UA 1Z67A 1YX5A 2IPQX 5CVUA 1IRGA 4YIRX 3DPLC 5C4XJ 3FHNA 2XKOA 2DN0A 1EKEA 2L4MA 3HXLA 2P7CB 3CD6I 5IYCJ 3OIQA 3DU6A 1FYKA 2PBIA 2HTSA 4F3QA 1HDPA 3TP0A 3BG9A 2K3FA 4X1EA 4ZYGA 3DKXA 2GIVA 1K61A 1U6GA 1E17A 5ILVA 2ZNYA 1D5VA 2VQHA 4I02A 2H09A 2LP0A 5KAFC 2FOWA 2QQAA 4A6DA 2XAGA 3KLNA 3OYBA 2E1OA 3R61A 4XKBA 3HUGB 4CDGA 4IRGA 4BQOA 3A02A 4D5CA 2X1CA 4PFPA 3ESWB 4DQ2A 1HW1A 5E3MA 2NRAC 3CESA 2R7OA 4A3GJ 1WRJA 1R6RA 3FF5A 3OR1C 3QAHA 3BG6A 3BY6A 4CGZA 2E35A 3B02A 2UWMA 1XPXA 4NC8A 1D1BA 1KA8A 3OSFA 4UVAA 1I1GA 3GUDA 4HBLA 2Y69H 1ZK8A 2DJIA 1C0WA 1N77A 5J8CA 1EV7A 1X1BA 4MEYF 2CGPA 3FISA 5CVJA 1PUEE 3VODA 4GRIA 5M3MJ 4PZJA 1RETA 3QP6A 3CUQB 3SXYA 4D7MA 4BXUA 1EA3A 1B9MA 2XAQA 4XN0A 3CO6C 4GYGA 1KU2A 2QVOA 3DXJF 1X19A 2QQ8A 2ETHA 1P92A 1K78B 2FA5A 3H5RA 4PK4A 2E71A 5AIPA 2XAFA 3WU2C 2AXTC 1P7IA 3TDUC 1VQ9I 1Z0XA 2LG4A 1V54H 3PNTA 2ZMEC 1J09A 2KDOA 3BJOA 1FP1D 2IXSA 5FGMA 4XN3A 3BTLA 1VQMI 3LSGA 3M1EA 1Y1VJ 4KICA 3LSIA 3SFIA 1ZREA 1QZZA 5GADJ 3FWEA 2Y30A 4GO1A 4CYDA 3MEXA 4LIUA 2OU2A 1HSTA 2R93J 2JJ7A 2KJBA 3BTJA 1KU7A 4BXFA 1W5SA 4B3AA 5LRSA 3OYDA 2JN6A 1SD6A 4N9IA 2CV2A 1O57A 2E1MC 5DS9A 3WTTC 4OWRB 2LRDA 1SAUA 1PUFB 2CQQA 2DAOA 2DLLA 2XGEA 2R7TA 5EYRA 4Q48A 1OCOH 2QENA 3RQIA 4G7OF 2E7XA 2MABA 1LB2A 3N05A 3S3NA 3F8MA 5LBQA 2K9MA 4UVBA 1IC8A 2VKDA 4CYCB 4BHPA 1TZLA 2D5VA 1GV2A 3KZZA 3N97A 3GF2A 3DBHB 1U5TB 4BHCA 2QA4I 5J3LA 1I50J 5D6EA 3SFZA 1J0RA 4F52A 4XIDA 2VI6A 5HNFA 4XMYA 3OL3A 2HR3A 2PJRB 1G3WA 2AS5F 2CRGA 1FPQA 2QKMB 2D1HA 4OIPF 2CUEA 2VQGA 5GTIC 4NBQA 3GTPJ 2NXNB 4I01A 1Z3YA 3JAMK 1P4XA 3BZCA 1LE8B 3MMYB 2O8KA 1FEXA 1BIAA 2P5VA 4KUMA 1X3WB 3HRUA 1LDKB 2LKPA 4UUSB 2HWVA 3RKXA 2BOLA 2VJ5A 3WHBA 3PFYA 4F7ZA 4ABZA 3E1SA 4FX4A 4Q4ZF 5BPDA 1T33A 2WADA 3IWZA 4BU2A 2ECBA 4OINF 1HKQA 4BQAA 3BZ6A 4OOIA 2F5FA 3I55I 1D1CA 2A5YB 3DBLB 2TDXA 3CMAI 5DD4A 1QVUA 1FBSA 4ENNA 2LD5A 3K4KA 4C9YA 1IN4A 2BXYA 4Y4RA 3RTRA 1FBUA 3I9V2 1Z6TA 3HGYA 5FO5A 5ILUA 2ELJA 2E34A 4EJUA 3QPLA 2QGUA 3FK6A 3ZMDA 1SD5A 4ESBA 4HRIA 3K70C 1A35A 3TMOA 4PJLA 3W2AA 2PMZA 2NS0A 1TL8A 4A3DJ 4BACA 4EMSA 1TTYA 4XOTA 3AG2H 4KYWA 4P5OA 5KK1A 1Z05A 3CCVI 2EWNA 3E97A 4HNTA 5FJ8J 4M72A 3CO7C 4M6VA 2CO5A 2JSPA 3UKGA 1B8IB 3ZCOA 1WVRA 3OS2A 3GMEA 4IRIA 4GDFA 3V8KA 1SEUA 1GT0C 3H1CA 3IP4B 1FBQA 4OAYA 4A3JJ 2MGQA 2A07F 4MO7A 3C18A 2RGVA 4G6TB 2ZSHB 2X6XA 3ABTA 4IL6C 3WU0A 3WG7H 1K4SA 2JK3A 3F21A 2R7RA 2L9VA 1SD4A 1V55H 3I3LA 3PJRA 1F4KA 2X6WA 3ABLH 2DMTA 4NC6A 4E7LA 1QRYA 2XGXA 1BR4A 1W36C 2V9KA 2Z2SB 4ENKA 3DPUA 1HKSA 2DFEA 3MCZA 3I53A 4GCVA 3H3VK 2DA4A 2L9SA 2R5ZA 1YJWI 1D0XA 2M0MA 1J7KA 2FX0A 2ZJRF 4M9SA 1SVLA 3D5SC 5E8IA 1AHDP 1FOWA 2IP2A 1YIJI 1P2FA 1WJDA 3S93A 1MH4A 4PSXA 2VUMJ 2HTJA 2OF7A 3WTSC 5E17F 3RCOA 3OYLA 2OQRA 3BR6A 3DTEA 2ZNZA 3DEWA 1T39A 4II2A 5CVVA 3OYAA 4X6AJ 2VODA 2EH3A 2PMZN 3ZMUA 3KFWX 3CMMA 3KPHA 4LFUA 5B3SH 1H88C 2GOMA 2DA5A 2JSCA 2L2OA 4AWXB 1IN7A 2X51A 1TQIA 1G8XA 5HDKA 2OV7A 2ZBKA 4U88A 4E7IA 5DV5A 3BR2A 1X4PA 4IHXA 2HDWA 1ETVA 2HQ5A 4MIMA 3B73A 4KMUX 2KIUA 2L9RA 3S32A 3T1BA 2EA4A 3S17J 1ZLJA 1I5ZA 4RA2A 1MNMC 2W24A 2GXBA 5H6QA 2NVQJ 3OMYA 3DLAA 2QF7A 4LK1F 1XCVA 2JPBA 2QCOA 2R7DA 3RYPA 3ZGKA 4C3JJ 5KVRA 3TO9A 3C2BA 4M3BA 4Y3OA 4A93J 4XR6A 3K2AA 4B3XA 4A12A 2WWYA 1MIJA 1MBKA 2HQRA 3NRVA 3Q3SA 1OCCH 4WXDA 2ZMEA 4J19A 4L9TA 2EFPA 2E36A 3E6CC 1GUUA 2CG4A 2CH0A 2YR2A 5D5UB 3MZ8A 1AA7A 1UG0A 1KZHA 3FKIJ 1FLIA 4B47A 3HTUA 3EETA 4NC7A 1WJBA 4JYKA 3A0BC 4J00A 3W6VA 2CUFA 1TQPA 4D7NA 3W6JB 2WC2A 1ONVA 3GTGJ 5L3EA 3HOTA 4A3FJ 1R36A 3ISPA 4ITVA 3OOUA 3S8PA 3S1NJ 5J1RA 2DA6A 1S9HA 3KIOA 3N4MA 3LAJA 4FETA 1BI0A 2LREA 3PM1A 5JI6A 2A6HF 2DOEA 4OIRF 3A03A 2HZTA 2CQXA 2ID3A 2LY1A 2K02A 4WCGA 4G7ZF 4D0PA 1NH3A 4RLFA 3TGNA 3CJTB 4CCKA 2EQRA 3A1YA 2ZFUA 2ADUA 2IAIA 4E7ZA 3I5UA 5J1UA 3HHGA 1MMAA 3E6BA 3FM5A 3PO2J 2WY7Q 2I8DA 5EJCA 1SFEA 1D3YA 4IO9F 1I6XA 1NK2P 2VXZA 1TT5B 1WJAA 3CUOA 3MKYB 2HVSA 2HYFA 5F08A 3L2UA 1FX7A 1OYWA 2QUFA 2BV6A 4BAYA 1APLC 1FOKA 3HOUJ 1NTCA 4CCLA 1YJ9I 2GWRA 3BWGA 5E3LA 4IHSA 1I39A 3JCUC 3RQ4A 3ZR8X 1G2HA 1EH8A 1O3RA 1SC7A 2JVGA 2KQRA 1WHUA 2IGMA 2K9LA 2E2IJ 1FTTA 2RC4A 3OIPA 3K70D 2CV0A 3T8RA 3FMQA 2L7MP 5DCMB 3FXUA 3GFIA 3EDPA 2CQNA 4AIHA 4FCYA 5J8FA 1XDUA 3ZQHA 5EEAA 5KAIC 2HXOA 3EYIA 1WH5A 2X85A 1FOYA 2NYXA 1B6AA 4KN7X 5GAEJ 3G6EI 3M7GA 2YS9A 3Q0WA 2GLOA 3LQQA 4HX7A 2KIFA 4XBFA 2EFOA 4L5EA 1IGNA 1STZA 4O6JA 1IJWC 1Y39A 3CCUI 2EFWA 3JAMZ 5ERIA 2DI3A 5L3BA 1BN5A 1LVKA 2ICWG 3CJNA 3A01A 2XF5A 1ZAOA 4YELA 2F2EA 4Y17A 4XOPA 2DXIA 3JREA 1OCTC 1WFXA 3F9KA 2IS6A 1YW9A 4M6XA 3HOSA 1QZYA 1U0JA 2XAJA 3IHUA 5J40A 3GW2A 5GAGJ 2OPTA 1Y1WJ 2DOAA 3BR3A 4ESFA 2M87A 2HQAA 3K4CA 4AU7A 3KLOA 2EZKA 3CJQB 3WTUC 3COAC 1JI8A 3E3VA 4DBRA 2F4MB 2VB6A 2IS4A 1ETYA 2EIMH 3PSFA 3RPUA 1QHHD 2O9LA 4PSWA 2DMUA 1UELB 4I98B 1IN6A 3W2VA 4PFOA 2WA0A 1WQ2A 1Z3XA 3WODF 1W7PA 3D0SA 3SZTA 2UXXA 4BE1A 5H20A 1HC8A 3PO3J 3ABKH 1OLTA 1IZ1A 5BQTA 3JR9A 2K5CA 4XSZF 2F5EA 1S7OA 5FB2A 1G59A 1Y8RB 3I4NJ 2DA3A 2YU3A 2X0LA 1I6HJ 4BY7J 1WGXA 1YI2I 4GGGA 5K1YA 2MA3A 2RQPA 3DKWA 3FBIB 3FIWA 3GXOA 1S8NA 3E5UA 3OYFA 3KP6A 1RNLA 3IL2A 2Z33A 2EINH 2IW5A 3F8CA 3K4MA 4F91B 2BHYA 2OUMA 3WGHA 2GA2A 2VQCA 2ZMEB 2DA1A 5ED4A 1ZG5A 3HSRA 2DU9A 4S04A 5M5WJ 2VKHA 2BY2A 3CMYA 5HLGA 2R7WA 1JHFA 3PL8A 1D8JA 4O3MA 3JRBA 1TWAJ 1S6LA 4I99C 1R9TJ 2XKPA 3R6SA 4HA8A 4A2UA 5E1WA 4PJJA 4S0HB 2ZXJA 2L7ZA 1F9NA 2P5LC 3H5AA 4A0YA 2B9SA 2V1DA 2XUBA 4G8XA 3ML6A 2XF6A 4XLAA 2XPUA 2UUZA 5D5WB 4OMZA 2DT5A 2RNJA 4AYBA 2E1MB 2LMDA 2HKXA 5HS9A 2G7UA 4PJMA 4QTRA 4U87A 4CCOA 2KP6A 2E60A 3WGIA 2BY0A 3EUAA 5GP9A 2XV4S 2PEXA 1YITI 2X1EA 2HDCA 2QKLB 2CSOA 1I3QJ 3C2GA 3FDYA 4KA4A 1U8RA 4RMNA 2IS2A 2H1LA 2M0CA 4BKXA 1DP7P 3BCBA 5E79C 1JGSA 3AG1H 3SJMA 4A3IJ 2XSJC 6PAXA 1OYIA 4BGDA 3JRCA 3FMRA 1GDTA 3U1DA 3S1RJ 3BPVA 1HA8A 1BI1A 4BEHA 3P5JA 1L0OC 4XM3A 3S3OA 4KT5C 1DPUA 3K4JA 5LGTA 2DK5A 4FE7A 2XDVA 2V26A 1Z7LA 3BZKA 4NQWA 2GXAA 4QIWN 3ZRGA 4DNCA 3EQLF 3G2BA 1ZHFA 2JPCA 2VASA 2ZXIA 4BS9A 2PI0A 4PJNA 1JT0A 5HOOA 3PNVA 1JHHA 3V4GA 5EZHA 3R0JA 4B1RA 3PSIA 4N9HA 5J6XA 3HTSB 2X6OA 2HYGD 1OJLA 4ZYEA 3F8NA 2EILH 4ZYAA 2XAHA 1E3OC 1OYYA 1M1EB 5DUIA 4YIIA 5GTHC 1K6YA 3DP7A 2A05A 1O4XA 1FTZA 3HRSA 4HQMA 3GTQJ 4HQEA 3JTGA 1BI2A 5HNHA 2NVTJ 1QHGA 1XGSA 2FUG2 3QPHA 1ON1A 3JRFA 9ANTA 4DYCA 2ME6A 1MDMB 2EK5A 3G3ZA 3TKYA 4Q5SF 4ZDPA 4UY8I 3L7WA 1YRNA 3QYFA 1ZR4A 4NUBA 5ICGA 4AYBN 3M8JA 2JA8J 1T08B 2LVSA 2CJJA 3VYSB 2R4GA 1A31A 1A04A 5DM6F 2DYRH 1O3TA 2X1DA 3SEQA 1A6IA 2KMUA 2YUSA 3RYRA 1AKHA 3PNYA 2W48A 2Y0MA 2K86A 4HLXA 3KEOA 1SVOA 2AXLA 2RVCA 3M4OJ 2ISZA 4L9NA 1YFHA 1BOAA 1T38A 2ZKZA 3IC7A 3J80K 1S3JA 3CMEI 2ZJPF 1FIAA 2L9NA 1W1WE 2VBXA 2DPUA 3HM5A 3SDGA 3VWBA 2QZ8A 3L2QA 1IO2A 3WU1B 2H1KA 1Q1VA 1G4DA 3H3UA 1IRZA 4WF2A 4A3KJ 1JJ8C 4PCQA 3WTXC 1K4TA 4XSXF 2FQ3A 1W0UA 1VQKI 3FZVA 5DCFA 1QO0D 4KJZA 3CDHA 2LK2A 5EEHA 4RDUA 4H0EA 1PVEA 2NOGA 3M8EA 1ZGWA 1W5CC 3RKYA 2DOFA 2GQQA 2XRLA 1QZEA 2FOKA 4Y52J 2A6EF 4GXOA 4R8HA 2H27A 2E1CA 3ERMA 3F22A 4M3EA 1T56A 2M7AA 3LL7A 2L01A 1ENHA 3GO5A 1OR7A 2FNPA 2LTPA 4CUGA 3NAUA 5IYDJ 5E20A 3CF5F 2O3FA 5DYMA 3GX4X 4IQ4A 2R5YA 1JT6A 3AL0C 1ETOA 2PG4A 2E19A 3MFKA 1J5YA 3CQZJ 3BG5A 3ABMH 3GFMA 3K4BA 2VN2A 3KZYA 4HZFA 1ETQA 2QLZA 4EJVA 3KEYA 3IH3A 2ID6A 2ZO4A 1JKPC 3PQKA 3GZ6A 1IUFA 5CQEA 5HS7A 4HSTA 5A2QK 4Y13A 1Z1DA 1MZBA 4JX5A 1VQ8I 2X6YA 5LFAA 3DTIA 1K7AA 4ENMA 1SD7A 1V3FA 2F5VA 3HOWJ 1MBFA 2LDUA 4IKFA 2VT2A 2DJNA 1XDSA 3ZOBA 5JFRA 1H8AC 1ZH5A 1O7LA 2P6TA 3KEQA 5EGOA 2DYSH 3C3WA 3GTJJ 3OS1A 1GVJA 2KRCA 1OCZH 3OSGA 2HNHA 4HX8A 2KZGA 2HXIA 1F1ZA 3HL2A 1GV5A 3TDZC 1PP8F 1VTNC 2V1UA 3ABUA 3A2KA 2KRFA 2EZIA 1R00A 4RGUA 1H9GA 4LD5A 2QBYB 2ZFWA 3HOYJ 4XRSG 2DQLA 4WWCA 3GFJA 3KE2A 3S2WA 1LQ1A 1JKRC 2DDBA 1Z6RA 2GIZA 3U9GA 4IPAA 1ACIA 4KIFA 4BY1J 4K2EA 1GHCA 3RKWA 4BEHB 4BXXJ 3F3XA 2P5KA 1BBYA 1EH6A 3MWMA 5CJ9A 2EJRA 2MD0A 2HEOA 4NQWB 3S1QJ 1UMQA 2G7HA 2K40A 4UHTA 1MNDA 3I58A 2DDAA 2JWTA 2VL8A 3E0JB 1X4OA 2PFBA 1A6QA 1YO5C 2CQ7A 2KT0A 3OL4A 1MW7A 1WI9A 2JRTA 2DA2A 2O61A 1PDNC 1IG7A 2GM4A 5FLVA 3GTMJ 1UHWA 2F4OB 3P9CA 2F5CA 3FXOA 4C2MJ 3QRFF 2GAUA 4RAZA 2JMWA 3OV8A 2XPVA 4I0BA 4BDYA 1W0TA 1OKRA 1DDNA 1LVAA 1UJ8A 3PUBA 2HOEA 3VYTB 1BW5A 4IZZA 1N75A 2VKEA 2R3SA 4MNUA 4XLFA 1YRNB 2E5ZA 4A5MA 1H9TA 3JSPA 3EUHC 3NWTA 4OAZA 4UB6C 3K9TA 4E7HA 3RI4A 3X2QH 2M34A 1XB4A 2A3SA 1YS7A 4G12A 2HVRA 4JP0A 4HG2A 5ICEA 4YFKF 2EPFA 3L2RA 2X48A 3E7LA 5H2FC 4ZDOA 3L9FA 1XGOA 2OTJI 3HSFA 1AKHB 2ZJQF 4IHTA 3CC2I 2R7ZJ 5F0CA 4MTDA 1MMGA 2DW4A 2L54A 1IRFA 2D2WA 5FROA 3QYEA 1RKWA 2W25A 1R23A 1SVMA 4BE2A 4IHVA 1RESA 4FHTA 1HLVA 5BOXA 1U3EM 3G73A 2EV5A 2R7XA 4I7HA 2JQ7A 3HB9A 5KCMA 2VC1A 5CVIA 1ZELA 5J4YA 4CZCA 2GXGA 5F1RA 4RB1A 4Y7NJ 4AIJA 4ON0A 4U0WA 3TW7A 3BG3A 5TISC 2MYSA 4JX4A 3R4KA 2DT6A 2Q0OA 5CQGA 4TV7A 1HCRA 2ECCA 1B4AA 2Z99A 1YOVB 5F1JA 3LFKA 3W3CA 2CW0F 5EG0A 1WJFA 4BQQA 2R5YB 3GLXA 1YE9A 2YSRA 3QU3A 1MBEA 3HZJA 3QU6A 3WE3A 3OYEA 1IV6A 4XRFA 3P7NA 2ZSIB 2WV0A 1XSDA 3ZQIA 1R1VA 2VIXA 2R0QC 4XRSA 3S14J 3ZQLA 4Z2YA 3PQJA 2ELHA 1I1SA 3CCYA 1V5FA 2RQQA 1X1PA 3CCSI 3ZP5A 5GPAA 2V6CA 4X0GA 1X1AA 3HC7A 3DLLF 2FBHA 4JBAA 3QYBA 5C44J 5KHDA 3UR3C 1IN8A 1ZR2A 2FMYA 4BJ6C 3H92A 1AWCA 4MQ9F 3CDIA 4D5FA 3SYTA 4G94A 2QQBA 3BP8A 1Y0UA 3LWFA 1BM9A 1VQPI 3M1CA 5EGOB 3S1MJ 1DGRM 3Q0VA 3T8TA 4P1WA 4AVPA 3GYHX 1P4WA 3F8FA 1ORKA 2KISA 2KPMA 3RZDJ 2LFBA 3AG4H 5LHGA 2V9VA 1YYVA 4L0ZB 5C3EJ 1BA5A 3SDBA 3J80Z 1ETXA 1TNTA 4MTEA 3I4PA 1QA6A 2UZKA 3OYHA 1YLFA 1R22A 2E2JJ 2OTLI 4BHBA 2EZHA 3ZXSA 4HNVA 4EM0B 2HFHA 5IYBJ 5IP9J 2V9PA 1FOXA 3ZQ7A 1TBXA 1IDYA 4U7DA 3GVAA 2HQNA 4ZTJA 1R7JA 3QQAA 3O8HA 2V1XA 5C4JJ 1HDDC 2E7WA 1BOBA 2FBKA 4KITB 2O6GE 3QOPA 1XGMA 2P6SA 3PUFA 2ELKA 5FKLA 2BZTA 2J5PA 5HVQC 2HPMA 5E3OA 4M73A 2ESNA 3E6MA 3K10A 2I5UA 1IAWA 3FXKA 2NS7A 3ZN0A 4ASNA 1V5GA 5HODA 3ONQA 3R0AA 4XRMA 5D5VB 3H35A 3PFIA 1L3LA 3M3YJ 2FSWA 5E1ZB 2HOTA 1VF9A 2O5RA 2WAFA 2ZB9A 2GZWA 4Y15A 3NQOA 4AIDA 4JX6A 1T6SA 4EGYA 3ERED 5A2QZ 1FY7A 2LYCA 2JTVA 1SANA 3ECHA 1JKOC 4M3DA 1QBJA 4V2GA 4XICA 2L4AA 4D1QA 1LDJA 4DZJA 4O5VA 3G1OA 1F5TA 1Q1HA 4LMYA 3I54A 2IBDA 2LR8A 3OOPA 3H36A 1USSA 2KIQA 1XC5A 3ZMSA 1WI3A 2PJPA 1JUSA 2FJ1A 1JUPA 4QPQA 2STTA 3FKJA 1SFOJ 4LK0F 1VQOI 1GXQA 3E5XA 4W97A 3J81Z 1T98A 1ZYRF 3BTIA 2KJCA 1MBGA 3W6KB 4HF1A 1I3AA 5JVGF 2CWEA 5LGUA 2DQRA 4XLHA 3RIRA 2VJ4A 5H6RA 2OC6A 3GLLA 3FK7A 4AC0A 3K1PA 1S5LC 2WTEA 2PN6A 4B44A 1FMVA 1EF4A 5KNLA 1KYWA 5HDNA 3DTKA 2H8WA 3EUHA 2VKVA 5F0HA 2XB0X 2XROA 3J7AO 3I59A 1RI7A 2M2EA 2DO7A 2R5ZB 2OZUA 1FP2A 1OR7C 3BR0A 4IHYA 3EUKL 4AVZA 3FX3A 1P6RA 3K1NA 3GZ5A 1MGTA 3LSKA 1BJAA 2ESHA 2ZXWH 1OCRH 3CLQA 3BR5A 1TW3A 5EG0B 3V42A 1ZG1A 3K4NA 3FHZA 4FTHA 3RPUD 3GTLJ 3T0YA 3U1KA 4IEJA 1WWXA 3CCQI 4KFCA 1J2XA 3Q9SA 1W36D 1W7PD 4WX9A 2IRFG 4R1HA 1E3HA 4UV8A 2QSFX 5L3GA 4YRVA 1ULYA 5HDGA 2VOOA 1K79A 3VPRA 4E6KG 3SZPA 2ME0A 5B1BH 4M71A 2KL4A 1OCPA 2Y48A 5DD8A 1RUNA 4RS8A 2O7OA 1B1BA 4HV5A 4DW6A 2EZLA 1QNTA 1B72A 5J4VA 4B09A 4Z6YA 3TL4X 3I71A 3MAJA 1DU6A 3M8FA 2KFDA 2VE8A 3G4SI 2M7BA 1YG2A 4KIBA 2VPLA 2EV0A 1VQLI 3V8LA 3LA7A 1XTAA 3VDXA 4DYRA 2F48A 2XSDC 1K83J 2W4SA 4LG3A 4QWQA 2F5DA 3C1DA 3O6BB 4FX0A 4EQQA 4PJ0C 2FQ4A 1FYMA 4IF4A 3EYYA 2WBMA 2P0WA 4II3A 2KKOA 2P81A 3TO7A 3L2CA 1ZGAA 2HS5A 4BE0A 3K7AJ 4EV0A 2A69F 2W1OA 3CCMI 1HBXG 3AL0B 4LB6B 4PGHA 4RBOA 1ETKA 3WTWC 1R1UA 1ZGJA 3LSHA 3IAM2 3NEUA 1H89C 2I10A 2NNYA 4CICA 4LB5A 3CUQA 2OBPA 1TT0A 4ZZLA 5JHUA 3UNGC 3KZIC 2F6CA 2K4BA 2TCTA 3OR2C 1DPRA 1LJ9A 2ISYA 4FT8A 3ZN1A 1BIBA 3EPZA 4CCMA 2XVCA 5CKTA 4R79A 2M8GX 1Z7UA 4DIQA 2COMA 4DOZA 4YFXF 4CZZA 1JE8A 2XGDA 3H5NA 1GLNA 3HDDA 2LF8A 3AG3H 5BNGA 4I0AA 1JXSA 4HDVA 3V7RA 2PX9A 1MH3A 1XX5A 4B48A 1UFMA 3TEDA 3WG9A 1N25A 3O8GA 3ASOH 2VLAA 1MJBA 2BXZA 4DYQA 4L5JA 2JUCA 4CCNA 1RUOA 4BQNA 1VQ5I 4F92B 2CV1A 3BJ6A 2MFZA 4ETSA 1RRJA 3JSOA 2JZYA 3R60A 3TQNA 4BJ5C 2YX4A 3TOAA 2XIGA 3VYUB 3FXLA 5M5YJ 5EDNA 5LEJA 1MBJA 2EB7A 1S29A 1WCMJ 1W5TA 1E0EA 1LFBA 3G1LA 1NG6A 3S16J 2QEXI 2QSHX 4C2UA 3Q5FA 2R92J 1RR8C 2CUZA 3CC7I 4B43A 3J7AY 5K5QA 3MKLA 1MD0A 1TW2A 1YW7A 2QQ9A 2H94A 5EF6A 4KN4X 1UHMA
chains in the Genus database with same CATH topology
1NHAA 4EJTA 1LEBA 3WTYC 2OQGA 3MQ0A 3LSTA 1G3YA 4WK8F 4HF0A 2QWWA 4P55A 3KP3A 2XASA 4IXAA 3RDIA 3WTVC 1OMIA 3V7SA 4E70A 3LA2A 1USTA 4KNYA 3ECOA 3I59B 2V79A 4A6EA 4WXCA 2O0YA 1O7FA 2LNBA 5HLHA 2M30A 3I0TA 2MLKA 2GA1A 4LLGF 1O3SA 2PQ8A 4L5IA 1Z9CA 3LA3A 2DK8A 4Q47A 5K5RA 1XGNA 4G6QA 1CGPA 4CHUA 4AIKA 1XMKA 1H0MA 4RAYA 2RN7A 5IT3A 5D6FA 4IJAA 5D8LB 3D5LA 4N0BA 1W7PB 3LAPA 2G9WA 1D8KA 1SMYF 4ESJA 4IRHA 2FE3A 5L3FA 3L00A 4RB2C 1ZRFA 3DQVC 4RGSA 5L3CA 2RDPA 1IXSB 5D5XB 4M9ZA 2IA1A 1FWZA 4KDPA 4HYEA 1G6NA 4G9YA 2MD5A 2Q8KA 2JT1A 5IT9K 3KP4A 2K7LA 1KGSA 3IRQA 5F64A 1HXDA 1TNSA 2CQKA 4LG0A 3VFZA 4HDUA 1IN5A 3J81K 5BS6A 1PP7U 4U7BA 3F8BA 2P4WA 2PMUA 1QQIA 5TRDA 1G3SA 2EFNA 3SHFA 5AONA 2L02A 3DV8A 1SAXA 4HLYA 1AOYA 1TQMA 2VBYA 4ZYHA 3MZYA 4HF2A 2RKHA 1ZLKA 3KP7A 2FXAA 1R5HA 2W57A 4NB5A 3GFLA 1BI3A 2BEOA 2DBBA 2OA4A 4S05A 3ROUA 4PDKA 3CLOA 2DFIA 3KP2A 3V7CA 1U2WA 4YIFA 1XD7A 3HYIA 1E2XA 3IWFA 1GXPA 4P9FA 2VBWA 1B9NA 1IW7F 2NAZA 5ILSA 4KMFA 4BNCA 3KCCA 3WGGA 2Z5UA 3BROA 2E1NA 2CYYA 1QGPA 1FSHA 3HIFA 2VBZA 4JK1X 5K5OA 4LLNA 3QPTA 1YTYA 1ZRDA 5FLXK 4CO8A 5E1XA 2HKOA 4B8XA 4A5NA 4XLPF 4OU0A 3GWZA 1YW8A 4MQVA 1LDDA 2Z9OA 3KETA 4EM2A 3DF8A 4UXNA 3DEUA 5LEKA 2BBYA 1MJ9A 2DPDA 3K2ZA 5DCMA 2FU4A 3T5XA 4AD9A 1HQCA 1SMTA 4LGWA 4CXFA 5DUKA 2M8EA 2K4JA 2PLYA 1R5GA 5HS8A 4MHGA 1O3QA 1IXCA 1DUXC 2B0LA 2LF7A 3BJAA 3CUQC 3BPXA 4L9VA 4P9UA 4MGRA 3E5QA 1U78A 1ZRCA 3MZHA 4I2OA 1ZG3A 3F6VA 2UXNA 4BYYA 1XN7A 4EVIA 3ULQB 1YIOA 3TOBA 3VOEA 5LHHA 4G6DA 1HKTA 2O8XA 2VT3A 3IKVA 3P9KA 3ZMTA 3O2PE 5D4RA 5E8GA 1B59A 1I27A 4OIOF 2LSOA 4U0YA 5LGNA 5BMZA 4OMYA 2BGCA 2VOPA 4LG0B 1ON2A 2IVMA 2FF4A 2ZJ2A 4P96A 3HRMA 2Y75A 4KIGA 1HW2A 2OAZA 5CYVA 4RB3C 1LEAA 1XSVA 4PGGA 4ENJA 1YQAA 1XSXA 4HOBA 2IT0A 1T2KA 3U2RA 2L3DA 2YX7A 2BYVE 1FNNA 3BOQA 4MEXF 1U5TC 2OD5A 4L18B 5LRRA 4EJOA 1REPC 1FYLA 5L3DA 1KQ9A 3F23A 3SQNA 3O3KA 4JQFA 4RGRA 3IRRA 2QYOA 2VC0A 1FC3A 4RB0A 1WKMA 2HGCA 3E6DA 2A61A 4BH9A 4U0VA 2OZ6A 3BDDA 2IJLA 1IXRC 4EGZA 5CVRA 5DDGA 5IT9Z 3F6OA 3HRTA 2W85A 5LLQA 1HSJA 2J5OA 3DFGA 5HLIA 2EA2A 3WTZA 5FFXA 1MKMA 2W84A 1OPCA 3C7JA 1FZPB 3Q9VA 2MBFA 2FMLA 3ZMVA 2YPRA 4HW0A 4XLNF 1J9IA 4WXHA 2RV8A 2Q2EA 1J75A 5AIQA 3M9AA 2P8TA 5ICCA 1SFXA 3L09A 3JW4A 1J59A 1CF7A 1LNWA 3FM3A 3VEPA 3FXQA 2IA2A 2IA0A 2CFXA 2R7FA 4HAMA 3REOA 1MDMA 2FRHA 2XHKA 2H6CA 5DEQA 2QM3A 3ZMZA 2KIMA 4EJWA 1SFUA 3K69A 4L9JA 4UV9A 5FFZA 3CTAA 5TJJA 3FXRA 1Z91A 3RJPA 3FMSA 2A68F 1UCRA 1BC8C 4OIQF 5F6FA 2Z3YA 1KQ0A 3TO6A 1XMAA 2EV6A 1KU3A 2P7VB 3HSEA 3HUGA 2H6BA 4HX4A 2DTRA 2VONA 3P9IA 5JR3A 4ZZDA 1RIOH 1UB9A 3ELKA 2ACJA 1T0FA 1U5TA 4YFNF 2VE9A 1QPMA 5FLXZ 3ZPLA 3F72A 1R58A 1V4RA 1FSEA 4ZYDA 4UNOA 2PMHA 1MJAA 5LHIA 1BC7C 3RPQA 3QP5A 2M1BA 5D8KB 4GYIA 1K78A 3HHHA 2EFQA 5E18F 3H3ZA 5CLSA 4M9XA 1TLHB 3DPTA 2BE5F 5D4SA 2M45A 1G3TA 1XCBA 4UVCA 2ZCWA 5FD6A 4LJZF 2M5WA 3JTHA 2D1VA 2O03A 1FT9A 1S7AA 1P4AA 5JVTA 1W4MA 1WSUA 4QLCU 3K1MA 2D45A 1KQ8A 3VB2A 5EEGA 4YG2F 2XRNA 4M74A 4LLLA 5ICFA 1KU9A 1ODDA 4RGXA 4NHJA 4L0YB 1YS6A 2QBYA 1RZ4A 1K6OA 1IF1A 3V8JA 1IUYA 2MC3A 4I09A 3WE2A 4HV6A 2K27A 4ZH4F 4EM1A 2FNAA 2C6YA 1ZARA 4UUVA 2X4HA 2NNNA 3GEZA 3KP5A 4M6YA 5FD5A 2FEZA 1HW5A 4A0ZA 5BPIA 2MH2A 1R1TA 3AAFA 2FBIA 2MLGA 4A0XA 2MH9A 3K0LA 2STWA 3IKTA 3LQRA 4IVNA 1CF7B 3I64A 4G7HF 1ZN2A 1EH7A 1KYZA 1X3UA 2IPQX 5CVUA 1IRGA 3DPLC 2XKOA 2L4MA 2P7CB 1FYKA 2PBIA 2HTSA 4ZYGA 2GIVA 1U6GA 1E17A 5ILVA 2ZNYA 1D5VA 4I02A 2H09A 2QQAA 4A6DA 2XAGA 3KLNA 3R61A 4CDGA 4IRGA 4DQ2A 1HW1A 2NRAC 1WRJA 3FF5A 3QAHA 3BY6A 4CGZA 3B02A 2UWMA 1KA8A 4UVAA 1I1GA 3GUDA 4HBLA 1C0WA 5J8CA 1EV7A 4MEYF 2CGPA 5CVJA 1PUEE 3VODA 4PZJA 3QP6A 3CUQB 3SXYA 4BXUA 1B9MA 2XAQA 3CO6C 4GYGA 1KU2A 2QVOA 3DXJF 2ETHA 1P92A 1K78B 2FA5A 5AIPA 2XAFA 3TDUC 3BJOA 1FP1D 5FGMA 3M1EA 4KICA 1ZREA 1QZZA 3FWEA 4GO1A 4CYDA 3MEXA 2OU2A 1HSTA 2KJBA 1KU7A 1W5SA 5LRSA 1SD6A 4N9IA 1O57A 3WTTC 2DAOA 2DLLA 4Q48A 2QENA 4G7OF 2E7XA 1LB2A 3F8MA 5LBQA 4UVBA 4BHPA 3KZZA 3N97A 3GF2A 1U5TB 4BHCA 5D6EA 3SFZA 1J0RA 2HR3A 1G3WA 2AS5F 1FPQA 2D1HA 4OIPF 4I01A 3JAMK 1P4XA 1BIAA 2P5VA 4KUMA 3HRUA 1LDKB 2LKPA 2HWVA 3RKXA 4F7ZA 4FX4A 4Q4ZF 5BPDA 3IWZA 4OINF 1HKQA 4BQAA 3BZ6A 4OOIA 2F5FA 2A5YB 2TDXA 5DD4A 1FBSA 4ENNA 1IN4A 3RTRA 1FBUA 1Z6TA 5ILUA 5FO5A 4EJUA 3ZMDA 1SD5A 4ESBA 2NS0A 4EMSA 1TTYA 4KYWA 4P5OA 5KK1A 1Z05A 2EWNA 3E97A 4M72A 3CO7C 2CO5A 4IRIA 3V8KA 1FBQA 2A07F 3C18A 2RGVA 3ABTA 3WU0A 3F21A 1SD4A 1F4KA 2XGXA 4ENKA 1HKSA 3MCZA 3I53A 4GCVA 1J7KA 4M9SA 5E8IA 2IP2A 1P2FA 2HTJA 3WTSC 5E17F 2OQRA 2ZNZA 1T39A 5CVVA 2VODA 3ZMUA 3KFWX 4LFUA 2JSCA 4AWXB 1IN7A 1TQIA 5HDKA 2ZBKA 4U88A 5DV5A 3B73A 4KMUX 2KIUA 3T1BA 2EA4A 1ZLJA 1I5ZA 2W24A 2GXBA 5H6QA 4LK1F 1XCVA 2JPBA 3RYPA 2R7DA 5KVRA 3TO9A 4A12A 2WWYA 2HQRA 3NRVA 4WXDA 2ZMEA 4L9TA 2EFPA 3E6CC 2CG4A 2YR2A 5D5UB 1FLIA 3HTUA 3EETA 1TQPA 3W6JB 2WC2A 1ONVA 5L3EA 3HOTA 1R36A 3ISPA 3N4MA 3LAJA 1BI0A 5JI6A 2A6HF 4OIRF 2HZTA 2K02A 4WCGA 4G7ZF 4D0PA 3TGNA 2ADUA 3I5UA 3HHGA 3E6BA 3FM5A 1SFEA 1D3YA 1I6XA 2VXZA 3CUOA 2HYFA 1FX7A 1OYWA 2QUFA 2BV6A 4BAYA 1FOKA 2GWRA 3BWGA 4IHSA 1EH8A 1O3RA 2RC4A 3T8RA 3FMQA 5DCMB 3FXUA 3GFIA 3EDPA 4AIHA 5J8FA 1XDUA 3EYIA 4KN7X 2NYXA 1B6AA 3M7GA 3LQQA 4HX7A 2KIFA 4XBFA 2EFOA 1STZA 4O6JA 2EFWA 3JAMZ 5ERIA 2DI3A 5L3BA 1BN5A 3CJNA 1ZAOA 2F2EA 4Y17A 1YW9A 4M6XA 3HOSA 1QZYA 2XAJA 3IHUA 3GW2A 4ESFA 2M87A 3KLOA 3WTUC 3COAC 3E3VA 3RPUA 4I98B 1IN6A 1WQ2A 3WODF 1W7PA 3D0SA 3SZTA 2UXXA 5H20A 1IZ1A 5BQTA 4XSZF 2F5EA 1S7OA 5FB2A 2YU3A 2X0LA 4GGGA 5K1YA 2MA3A 2RQPA 3DKWA 3GXOA 1S8NA 3E5UA 3KP6A 1RNLA 3IL2A 2Z33A 2IW5A 3F8CA 3WGHA 2GA2A 2ZMEB 5ED4A 1ZG5A 3HSRA 2DU9A 4S04A 5HLGA 1JHFA 1D8JA 4O3MA 1S6LA 2XKPA 3R6SA 4HA8A 4A2UA 5E1WA 2ZXJA 1F9NA 2P5LC 4A0YA 2V1DA 2XUBA 4G8XA 3ML6A 5D5WB 4OMZA 2DT5A 2RNJA 2HKXA 5HS9A 2G7UA 3WGIA 2XV4S 2PEXA 2HDCA 2CSOA 4KA4A 1U8RA 1DP7P 1JGSA 6PAXA 1OYIA 3FMRA 3U1DA 3BPVA 1BI1A 1L0OC 4KT5C 1DPUA 5LGTA 2DK5A 4NQWA 4DNCA 3EQLF 1ZHFA 2JPCA 2PI0A 5HOOA 3V4GA 1JHHA 5J6XA 3R0JA 4N9HA 3HTSB 2HYGD 4ZYEA 3F8NA 2XAHA 1OYYA 5DUIA 4YIIA 3DP7A 3HRSA 4HQMA 4HQEA 3JTGA 1BI2A 1XGSA 3QPHA 1ON1A 1MDMB 2EK5A 3G3ZA 3TKYA 4Q5SF 3L7WA 5ICGA 1A04A 1O3TA 3RYRA 2Y0MA 2K86A 4HLXA 3KEOA 2AXLA 2RVCA 2ISZA 4L9NA 1YFHA 1BOAA 1T38A 2ZKZA 3IC7A 3J80K 1S3JA 2VBXA 2DPUA 2QZ8A 3WU1B 1G4DA 3H3UA 4WF2A 4PCQA 3WTXC 4XSXF 2FQ3A 3FZVA 5DCFA 1QO0D 3CDHA 5EEHA 4H0EA 3M8EA 3RKYA 2GQQA 2FOKA 2A6EF 4GXOA 4R8HA 2H27A 2E1CA 3F22A 2L01A 3GO5A 1OR7A 2FNPA 5E20A 2O3FA 5DYMA 3GX4X 2PG4A 3MFKA 1J5YA 3GFMA 3KZYA 2VN2A 4HZFA 2QLZA 4EJVA 2ZO4A 3PQKA 3GZ6A 5HS7A 5A2QK 4Y13A 1Z1DA 1MZBA 1K7AA 4ENMA 1SD7A 1V3FA 2LDUA 2VT2A 1XDSA 5JFRA 1ZH5A 1O7LA 2P6TA 3KEQA 3C3WA 1GVJA 4HX8A 1F1ZA 3TDZC 1PP8F 1VTNC 2V1UA 3ABUA 2KRFA 1R00A 4RGUA 1H9GA 4LD5A 2QBYB 2ZFWA 2DQLA 4WWCA 3GFJA 3KE2A 3S2WA 1LQ1A 1Z6RA 3U9GA 4IPAA 4KIFA 4K2EA 1GHCA 3RKWA 3F3XA 2P5KA 1BBYA 1EH6A 3MWMA 5CJ9A 2EJRA 2HEOA 2G7HA 4UHTA 3I58A 2PFBA 1YO5C 1WI9A 2JRTA 2O61A 1PDNC 1UHWA 3P9CA 2F5CA 3QRFF 2GAUA 4RAZA 3OV8A 4I0BA 1OKRA 1DDNA 1LVAA 2HOEA 2R3SA 4MNUA 4A5MA 1H9TA 3JSPA 3K9TA 3RI4A 1XB4A 2A3SA 1YS7A 5ICEA 4YFKF 3L9FA 1XGOA 3HSFA 4IHTA 4MTDA 2DW4A 2L54A 2D2WA 1IRFA 2W25A 1R23A 4FHTA 5BOXA 1U3EM 3G73A 2EV5A 4I7HA 2VC1A 5CVIA 2GXGA 5F1RA 4RB1A 4AIJA 4ON0A 4U0WA 3R4KA 2Q0OA 4TV7A 1B4AA 2Z99A 3LFKA 2CW0F 3GLXA 2YSRA 3QU3A 3QU6A 3WE3A 4XRFA 3P7NA 2WV0A 1XSDA 1R1VA 4Z2YA 3PQJA 2ELHA 1I1SA 3ZP5A 2V6CA 2FBHA 4JBAA 1IN8A 2FMYA 3H92A 1AWCA 4MQ9F 4G94A 2QQBA 3BP8A 1Y0UA 3LWFA 1BM9A 3T8TA 4AVPA 3GYHX 1P4WA 3F8FA 5LHGA 2V9VA 1YYVA 4L0ZB 3J80Z 1TNTA 4MTEA 3I4PA 2UZKA 1YLFA 1R22A 4BHBA 4EM0B 2HFHA 3ZQ7A 1TBXA 4U7DA 3GVAA 2HQNA 1R7JA 2V1XA 2E7WA 2FBKA 2O6GE 3QOPA 1XGMA 2P6SA 2J5PA 5HVQC 4M73A 2ESNA 3E6MA 1IAWA 3ZN0A 4ASNA 3R0AA 5D5VB 1L3LA 3PFIA 2FSWA 5E1ZB 2GZWA 4Y15A 3NQOA 1T6SA 4EGYA 3ERED 5A2QZ 1FY7A 3ECHA 2JTVA 1QBJA 2L4AA 1LDJA 4O5VA 1F5TA 1Q1HA 4LMYA 3I54A 3OOPA 1USSA 3ZMSA 2PJPA 2STTA 4LK0F 1GXQA 3E5XA 3J81Z 1T98A 1ZYRF 2KJCA 3W6KB 4HF1A 2CWEA 5LGUA 2DQRA 3RIRA 5H6RA 3K1PA 2WTEA 2PN6A 1KYWA 5HDNA 3EUHA 2XROA 3J7AO 3I59A 1RI7A 2DO7A 2OZUA 1FP2A 3FX3A 1P6RA 3K1NA 3GZ5A 1MGTA 1BJAA 2ESHA 1TW3A 1ZG1A 3FHZA 3T0YA 1WWXA 4KFCA 1J2XA 3Q9SA 1W7PD 4WX9A 2IRFG 4R1HA 4UV8A 5L3GA 1ULYA 5HDGA 2VOOA 1K79A 3SZPA 4M71A 2Y48A 5DD8A 1RUNA 4RS8A 1B1BA 4HV5A 1QNTA 4B09A 3I71A 3MAJA 3M8FA 2VE8A 4KIBA 1YG2A 2EV0A 3V8LA 3LA7A 4QWQA 2F5DA 3C1DA 3O6BB 4FX0A 4EQQA 1FYMA 4IF4A 3EYYA 2KKOA 3L2CA 3TO7A 1ZGAA 2HS5A 4EV0A 2A69F 1HBXG 4LB6B 4PGHA 3WTWC 1R1UA 1ZGJA 3NEUA 2NNYA 4CICA 4LB5A 3CUQA 2OBPA 4ZZLA 5JHUA 2K4BA 1DPRA 1LJ9A 2ISYA 3ZN1A 4FT8A 1BIBA 2XVCA 4R79A 1Z7UA 2COMA 1JE8A 4YFXF 4CZZA 2LF8A 4I0AA 1JXSA 4HDVA 3V7RA 1UFMA 3WG9A 1MJBA 4L5JA 1RUOA 3BJ6A 4ETSA 3JSOA 2JZYA 3R60A 3TQNA 2YX4A 3TOAA 2XIGA 5LEJA 2EB7A 1S29A 1W5TA 3Q5FA 5K5QA 1MD0A 1TW2A 1YW7A 2QQ9A 2H94A 4KN4X 1UHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHA A;  4EJT A;  1LEB A;  3WTY C;  2OQG A;  3MQ0 A;  3LST A;  1G3Y A;  4WK8 F;  4HF0 A;  2QWW A;  4P55 A;  3KP3 A;  2XAS A;  4IXA A;  3RDI A;  3WTV C;  1OMI A;  3V7S A;  4E70 A;  3LA2 A;  1UST A;  4KNY A;  3ECO A;  3I59 B;  2V79 A;  4A6E A;  4WXC A;  2O0Y A;  1O7F A;  2LNB A;  5HLH A;  2M30 A;  3I0T A;  2MLK A;  2GA1 A;  4LLG F;  1O3S A;  2PQ8 A;  4L5I A;  1Z9C A;  3LA3 A;  2DK8 A;  4Q47 A;  5K5R A;  1XGN A;  4G6Q A;  1CGP A;  4CHU A;  4AIK A;  1XMK A;  1H0M A;  4RAY A;  2RN7 A;  5IT3 A;  5D6F A;  4IJA A;  5D8L B;  3D5L A;  4N0B A;  1W7P B;  3LAP A;  2G9W A;  1D8K A;  1SMY F;  4ESJ A;  4IRH A;  2FE3 A;  5L3F A;  3L00 A;  4RB2 C;  1ZRF A;  3DQV C;  4RGS A;  5L3C A;  2RDP A;  1IXS B;  5D5X B;  4M9Z A;  2IA1 A;  1FWZ A;  4KDP A;  4HYE A;  1G6N A;  4G9Y A;  2MD5 A;  2Q8K A;  2JT1 A;  5IT9 K;  3KP4 A;  2K7L A;  1KGS A;  3IRQ A;  5F64 A;  1HXD A;  1TNS A;  2CQK A;  4LG0 A;  3VFZ A;  4HDU A;  1IN5 A;  3J81 K;  5BS6 A;  1PP7 U;  4U7B A;  3F8B A;  2P4W A;  2PMU A;  1QQI A;  5TRD A;  1G3S A;  2EFN A;  3SHF A;  5AON A;  2L02 A;  3DV8 A;  1SAX A;  4HLY A;  1AOY A;  1TQM A;  2VBY A;  4ZYH A;  3MZY A;  4HF2 A;  2RKH A;  1ZLK A;  3KP7 A;  2FXA A;  1R5H A;  2W57 A;  4NB5 A;  3GFL A;  1BI3 A;  2BEO A;  2DBB A;  2OA4 A;  4S05 A;  3ROU A;  4PDK A;  3CLO A;  2DFI A;  3KP2 A;  3V7C A;  1U2W A;  4YIF A;  1XD7 A;  3HYI A;  1E2X A;  3IWF A;  1GXP A;  4P9F A;  2VBW A;  1B9N A;  1IW7 F;  2NAZ A;  5ILS A;  4KMF A;  4BNC A;  3KCC A;  3WGG A;  2Z5U A;  3BRO A;  2E1N A;  2CYY A;  1QGP A;  1FSH A;  3HIF A;  2VBZ A;  4JK1 X;  5K5O A;  4LLN A;  3QPT A;  1YTY A;  1ZRD A;  5FLX K;  4CO8 A;  5E1X A;  2HKO A;  4B8X A;  4A5N A;  4XLP F;  4OU0 A;  3GWZ A;  1YW8 A;  4MQV A;  1LDD A;  2Z9O A;  3KET A;  4EM2 A;  3DF8 A;  4UXN A;  3DEU A;  5LEK A;  2BBY A;  1MJ9 A;  2DPD A;  3K2Z A;  5DCM A;  2FU4 A;  3T5X A;  4AD9 A;  1HQC A;  1SMT A;  4LGW A;  4CXF A;  5DUK A;  2M8E A;  2K4J A;  2PLY A;  1R5G A;  5HS8 A;  4MHG A;  1O3Q A;  1IXC A;  1DUX C;  2B0L A;  2LF7 A;  3BJA A;  3CUQ C;  3BPX A;  4L9V A;  4P9U A;  4MGR A;  3E5Q A;  1U78 A;  1ZRC A;  3MZH A;  4I2O A;  1ZG3 A;  3F6V A;  2UXN A;  4BYY A;  1XN7 A;  4EVI A;  3ULQ B;  1YIO A;  3TOB A;  3VOE A;  5LHH A;  4G6D A;  1HKT A;  2O8X A;  2VT3 A;  3IKV A;  3P9K A;  3ZMT A;  3O2P E;  5D4R A;  5E8G A;  1B59 A;  1I27 A;  4OIO F;  2LSO A;  4U0Y A;  5LGN A;  5BMZ A;  4OMY A;  2BGC A;  2VOP A;  4LG0 B;  1ON2 A;  2IVM A;  2FF4 A;  2ZJ2 A;  4P96 A;  3HRM A;  2Y75 A;  4KIG A;  1HW2 A;  2OAZ A;  5CYV A;  4RB3 C;  1LEA A;  1XSV A;  4PGG A;  4ENJ A;  1YQA A;  1XSX A;  4HOB A;  2IT0 A;  1T2K A;  3U2R A;  2L3D A;  2YX7 A;  2BYV E;  1FNN A;  3BOQ A;  4MEX F;  1U5T C;  2OD5 A;  4L18 B;  5LRR A;  4EJO A;  1REP C;  1FYL A;  5L3D A;  1KQ9 A;  3F23 A;  3SQN A;  3O3K A;  4JQF A;  4RGR A;  3IRR A;  2QYO A;  2VC0 A;  1FC3 A;  4RB0 A;  1WKM A;  2HGC A;  3E6D A;  2A61 A;  4BH9 A;  4U0V A;  2OZ6 A;  3BDD A;  2IJL A;  1IXR C;  4EGZ A;  5CVR A;  5DDG A;  5IT9 Z;  3F6O A;  3HRT A;  2W85 A;  5LLQ A;  1HSJ A;  2J5O A;  3DFG A;  5HLI A;  2EA2 A;  3WTZ A;  5FFX A;  1MKM A;  2W84 A;  1OPC A;  3C7J A;  1FZP B;  3Q9V A;  2MBF A;  2FML A;  3ZMV A;  2YPR A;  4HW0 A;  4XLN F;  1J9I A;  4WXH A;  2RV8 A;  2Q2E A;  1J75 A;  5AIQ A;  3M9A A;  2P8T A;  5ICC A;  1SFX A;  3L09 A;  3JW4 A;  1J59 A;  1CF7 A;  1LNW A;  3FM3 A;  3VEP A;  3FXQ A;  2IA2 A;  2IA0 A;  2CFX A;  2R7F A;  4HAM A;  3REO A;  1MDM A;  2FRH A;  2XHK A;  2H6C A;  5DEQ A;  2QM3 A;  3ZMZ A;  2KIM A;  4EJW A;  1SFU A;  3K69 A;  4L9J A;  4UV9 A;  5FFZ A;  3CTA A;  5TJJ A;  3FXR A;  1Z91 A;  3RJP A;  3FMS A;  2A68 F;  1UCR A;  1BC8 C;  4OIQ F;  5F6F A;  2Z3Y A;  1KQ0 A;  3TO6 A;  1XMA A;  2EV6 A;  1KU3 A;  2P7V B;  3HSE A;  3HUG A;  2H6B A;  4HX4 A;  2DTR A;  2VON A;  3P9I A;  5JR3 A;  4ZZD A;  1RIO H;  1UB9 A;  3ELK A;  2ACJ A;  1T0F A;  1U5T A;  4YFN F;  2VE9 A;  1QPM A;  5FLX Z;  3ZPL A;  3F72 A;  1R58 A;  1V4R A;  1FSE A;  4ZYD A;  4UNO A;  2PMH A;  1MJA A;  5LHI A;  1BC7 C;  3RPQ A;  3QP5 A;  2M1B A;  5D8K B;  4GYI A;  1K78 A;  3HHH A;  2EFQ A;  5E18 F;  3H3Z A;  5CLS A;  4M9X A;  1TLH B;  3DPT A;  2BE5 F;  5D4S A;  2M45 A;  1G3T A;  1XCB A;  4UVC A;  2ZCW A;  5FD6 A;  4LJZ F;  2M5W A;  3JTH A;  2D1V A;  2O03 A;  1FT9 A;  1S7A A;  1P4A A;  5JVT A;  1W4M A;  1WSU A;  4QLC U;  3K1M A;  2D45 A;  1KQ8 A;  3VB2 A;  5EEG A;  4YG2 F;  2XRN A;  4M74 A;  4LLL A;  5ICF A;  1KU9 A;  1ODD A;  4RGX A;  4NHJ A;  4L0Y B;  1YS6 A;  2QBY A;  1RZ4 A;  1K6O A;  1IF1 A;  3V8J A;  1IUY A;  2MC3 A;  4I09 A;  3WE2 A;  4HV6 A;  2K27 A;  4ZH4 F;  4EM1 A;  2FNA A;  2C6Y A;  1ZAR A;  4UUV A;  2X4H A;  2NNN A;  3GEZ A;  3KP5 A;  4M6Y A;  5FD5 A;  2FEZ A;  1HW5 A;  4A0Z A;  5BPI A;  2MH2 A;  1R1T A;  3AAF A;  2FBI A;  2MLG A;  4A0X A;  2MH9 A;  3K0L A;  2STW A;  3IKT A;  3LQR A;  4IVN A;  1CF7 B;  3I64 A;  4G7H F;  1ZN2 A;  1EH7 A;  1KYZ A;  1X3U A;  2IPQ X;  5CVU A;  1IRG A;  3DPL C;  2XKO A;  2L4M A;  2P7C B;  1FYK A;  2PBI A;  2HTS A;  4ZYG A;  2GIV A;  1U6G A;  1E17 A;  5ILV A;  2ZNY A;  1D5V A;  4I02 A;  2H09 A;  2QQA A;  4A6D A;  2XAG A;  3KLN A;  3R61 A;  4CDG A;  4IRG A;  4DQ2 A;  1HW1 A;  2NRA C;  1WRJ A;  3FF5 A;  3QAH A;  3BY6 A;  4CGZ A;  3B02 A;  2UWM A;  1KA8 A;  4UVA A;  1I1G A;  3GUD A;  4HBL A;  1C0W A;  5J8C A;  1EV7 A;  4MEY F;  2CGP A;  5CVJ A;  1PUE E;  3VOD A;  4PZJ A;  3QP6 A;  3CUQ B;  3SXY A;  4BXU A;  1B9M A;  2XAQ A;  3CO6 C;  4GYG A;  1KU2 A;  2QVO A;  3DXJ F;  2ETH A;  1P92 A;  1K78 B;  2FA5 A;  5AIP A;  2XAF A;  3TDU C;  3BJO A;  1FP1 D;  5FGM A;  3M1E A;  4KIC A;  1ZRE A;  1QZZ A;  3FWE A;  4GO1 A;  4CYD A;  3MEX A;  2OU2 A;  1HST A;  2KJB A;  1KU7 A;  1W5S A;  5LRS A;  1SD6 A;  4N9I A;  1O57 A;  3WTT C;  2DAO A;  2DLL A;  4Q48 A;  2QEN A;  4G7O F;  2E7X A;  1LB2 A;  3F8M A;  5LBQ A;  4UVB A;  4BHP A;  3KZZ A;  3N97 A;  3GF2 A;  1U5T B;  4BHC A;  5D6E A;  3SFZ A;  1J0R A;  2HR3 A;  1G3W A;  2AS5 F;  1FPQ A;  2D1H A;  4OIP F;  4I01 A;  3JAM K;  1P4X A;  1BIA A;  2P5V A;  4KUM A;  3HRU A;  1LDK B;  2LKP A;  2HWV A;  3RKX A;  4F7Z A;  4FX4 A;  4Q4Z F;  5BPD A;  3IWZ A;  4OIN F;  1HKQ A;  4BQA A;  3BZ6 A;  4OOI A;  2F5F A;  2A5Y B;  2TDX A;  5DD4 A;  1FBS A;  4ENN A;  1IN4 A;  3RTR A;  1FBU A;  1Z6T A;  5ILU A;  5FO5 A;  4EJU A;  3ZMD A;  1SD5 A;  4ESB A;  2NS0 A;  4EMS A;  1TTY A;  4KYW A;  4P5O A;  5KK1 A;  1Z05 A;  2EWN A;  3E97 A;  4M72 A;  3CO7 C;  2CO5 A;  4IRI A;  3V8K A;  1FBQ A;  2A07 F;  3C18 A;  2RGV A;  3ABT A;  3WU0 A;  3F21 A;  1SD4 A;  1F4K A;  2XGX A;  4ENK A;  1HKS A;  3MCZ A;  3I53 A;  4GCV A;  1J7K A;  4M9S A;  5E8I A;  2IP2 A;  1P2F A;  2HTJ A;  3WTS C;  5E17 F;  2OQR A;  2ZNZ A;  1T39 A;  5CVV A;  2VOD A;  3ZMU A;  3KFW X;  4LFU A;  2JSC A;  4AWX B;  1IN7 A;  1TQI A;  5HDK A;  2ZBK A;  4U88 A;  5DV5 A;  3B73 A;  4KMU X;  2KIU A;  3T1B A;  2EA4 A;  1ZLJ A;  1I5Z A;  2W24 A;  2GXB A;  5H6Q A;  4LK1 F;  1XCV A;  2JPB A;  3RYP A;  2R7D A;  5KVR A;  3TO9 A;  4A12 A;  2WWY A;  2HQR A;  3NRV A;  4WXD A;  2ZME A;  4L9T A;  2EFP A;  3E6C C;  2CG4 A;  2YR2 A;  5D5U B;  1FLI A;  3HTU A;  3EET A;  1TQP A;  3W6J B;  2WC2 A;  1ONV A;  5L3E A;  3HOT A;  1R36 A;  3ISP A;  3N4M A;  3LAJ A;  1BI0 A;  5JI6 A;  2A6H F;  4OIR F;  2HZT A;  2K02 A;  4WCG A;  4G7Z F;  4D0P A;  3TGN A;  2ADU A;  3I5U A;  3HHG A;  3E6B A;  3FM5 A;  1SFE A;  1D3Y A;  1I6X A;  2VXZ A;  3CUO A;  2HYF A;  1FX7 A;  1OYW A;  2QUF A;  2BV6 A;  4BAY A;  1FOK A;  2GWR A;  3BWG A;  4IHS A;  1EH8 A;  1O3R A;  2RC4 A;  3T8R A;  3FMQ A;  5DCM B;  3FXU A;  3GFI A;  3EDP A;  4AIH A;  5J8F A;  1XDU A;  3EYI A;  4KN7 X;  2NYX A;  1B6A A;  3M7G A;  3LQQ A;  4HX7 A;  2KIF A;  4XBF A;  2EFO A;  1STZ A;  4O6J A;  2EFW A;  3JAM Z;  5ERI A;  2DI3 A;  5L3B A;  1BN5 A;  3CJN A;  1ZAO A;  2F2E A;  4Y17 A;  1YW9 A;  4M6X A;  3HOS A;  1QZY A;  2XAJ A;  3IHU A;  3GW2 A;  4ESF A;  2M87 A;  3KLO A;  3WTU C;  3COA C;  3E3V A;  3RPU A;  4I98 B;  1IN6 A;  1WQ2 A;  3WOD F;  1W7P A;  3D0S A;  3SZT A;  2UXX A;  5H20 A;  1IZ1 A;  5BQT A;  4XSZ F;  2F5E A;  1S7O A;  5FB2 A;  2YU3 A;  2X0L A;  4GGG A;  5K1Y A;  2MA3 A;  2RQP A;  3DKW A;  3GXO A;  1S8N A;  3E5U A;  3KP6 A;  1RNL A;  3IL2 A;  2Z33 A;  2IW5 A;  3F8C A;  3WGH A;  2GA2 A;  2ZME B;  5ED4 A;  1ZG5 A;  3HSR A;  2DU9 A;  4S04 A;  5HLG A;  1JHF A;  1D8J A;  4O3M A;  1S6L A;  2XKP A;  3R6S A;  4HA8 A;  4A2U A;  5E1W A;  2ZXJ A;  1F9N A;  2P5L C;  4A0Y A;  2V1D A;  2XUB A;  4G8X A;  3ML6 A;  5D5W B;  4OMZ A;  2DT5 A;  2RNJ A;  2HKX A;  5HS9 A;  2G7U A;  3WGI A;  2XV4 S;  2PEX A;  2HDC A;  2CSO A;  4KA4 A;  1U8R A;  1DP7 P;  1JGS A;  6PAX A;  1OYI A;  3FMR A;  3U1D A;  3BPV A;  1BI1 A;  1L0O C;  4KT5 C;  1DPU A;  5LGT A;  2DK5 A;  4NQW A;  4DNC A;  3EQL F;  1ZHF A;  2JPC A;  2PI0 A;  5HOO A;  3V4G A;  1JHH A;  5J6X A;  3R0J A;  4N9H A;  3HTS B;  2HYG D;  4ZYE A;  3F8N A;  2XAH A;  1OYY A;  5DUI A;  4YII A;  3DP7 A;  3HRS A;  4HQM A;  4HQE A;  3JTG A;  1BI2 A;  1XGS A;  3QPH A;  1ON1 A;  1MDM B;  2EK5 A;  3G3Z A;  3TKY A;  4Q5S F;  3L7W A;  5ICG A;  1A04 A;  1O3T A;  3RYR A;  2Y0M A;  2K86 A;  4HLX A;  3KEO A;  2AXL A;  2RVC A;  2ISZ A;  4L9N A;  1YFH A;  1BOA A;  1T38 A;  2ZKZ A;  3IC7 A;  3J80 K;  1S3J A;  2VBX A;  2DPU A;  2QZ8 A;  3WU1 B;  1G4D A;  3H3U A;  4WF2 A;  4PCQ A;  3WTX C;  4XSX F;  2FQ3 A;  3FZV A;  5DCF A;  1QO0 D;  3CDH A;  5EEH A;  4H0E A;  3M8E A;  3RKY A;  2GQQ A;  2FOK A;  2A6E F;  4GXO A;  4R8H A;  2H27 A;  2E1C A;  3F22 A;  2L01 A;  3GO5 A;  1OR7 A;  2FNP A;  5E20 A;  2O3F A;  5DYM A;  3GX4 X;  2PG4 A;  3MFK A;  1J5Y A;  3GFM A;  3KZY A;  2VN2 A;  4HZF A;  2QLZ A;  4EJV A;  2ZO4 A;  3PQK A;  3GZ6 A;  5HS7 A;  5A2Q K;  4Y13 A;  1Z1D A;  1MZB A;  1K7A A;  4ENM A;  1SD7 A;  1V3F A;  2LDU A;  2VT2 A;  1XDS A;  5JFR A;  1ZH5 A;  1O7L A;  2P6T A;  3KEQ A;  3C3W A;  1GVJ A;  4HX8 A;  1F1Z A;  3TDZ C;  1PP8 F;  1VTN C;  2V1U A;  3ABU A;  2KRF A;  1R00 A;  4RGU A;  1H9G A;  4LD5 A;  2QBY B;  2ZFW A;  2DQL A;  4WWC A;  3GFJ A;  3KE2 A;  3S2W A;  1LQ1 A;  1Z6R A;  3U9G A;  4IPA A;  4KIF A;  4K2E A;  1GHC A;  3RKW A;  3F3X A;  2P5K A;  1BBY A;  1EH6 A;  3MWM A;  5CJ9 A;  2EJR A;  2HEO A;  2G7H A;  4UHT A;  3I58 A;  2PFB A;  1YO5 C;  1WI9 A;  2JRT A;  2O61 A;  1PDN C;  1UHW A;  3P9C A;  2F5C A;  3QRF F;  2GAU A;  4RAZ A;  3OV8 A;  4I0B A;  1OKR A;  1DDN A;  1LVA A;  2HOE A;  2R3S A;  4MNU A;  4A5M A;  1H9T A;  3JSP A;  3K9T A;  3RI4 A;  1XB4 A;  2A3S A;  1YS7 A;  5ICE A;  4YFK F;  3L9F A;  1XGO A;  3HSF A;  4IHT A;  4MTD A;  2DW4 A;  2L54 A;  2D2W A;  1IRF A;  2W25 A;  1R23 A;  4FHT A;  5BOX A;  1U3E M;  3G73 A;  2EV5 A;  4I7H A;  2VC1 A;  5CVI A;  2GXG A;  5F1R A;  4RB1 A;  4AIJ A;  4ON0 A;  4U0W A;  3R4K A;  2Q0O A;  4TV7 A;  1B4A A;  2Z99 A;  3LFK A;  2CW0 F;  3GLX A;  2YSR A;  3QU3 A;  3QU6 A;  3WE3 A;  4XRF A;  3P7N A;  2WV0 A;  1XSD A;  1R1V A;  4Z2Y A;  3PQJ A;  2ELH A;  1I1S A;  3ZP5 A;  2V6C A;  2FBH A;  4JBA A;  1IN8 A;  2FMY A;  3H92 A;  1AWC A;  4MQ9 F;  4G94 A;  2QQB A;  3BP8 A;  1Y0U A;  3LWF A;  1BM9 A;  3T8T A;  4AVP A;  3GYH X;  1P4W A;  3F8F A;  5LHG A;  2V9V A;  1YYV A;  4L0Z B;  3J80 Z;  1TNT A;  4MTE A;  3I4P A;  2UZK A;  1YLF A;  1R22 A;  4BHB A;  4EM0 B;  2HFH A;  3ZQ7 A;  1TBX A;  4U7D A;  3GVA A;  2HQN A;  1R7J A;  2V1X A;  2E7W A;  2FBK A;  2O6G E;  3QOP A;  1XGM A;  2P6S A;  2J5P A;  5HVQ C;  4M73 A;  2ESN A;  3E6M A;  1IAW A;  3ZN0 A;  4ASN A;  3R0A A;  5D5V B;  1L3L A;  3PFI A;  2FSW A;  5E1Z B;  2GZW A;  4Y15 A;  3NQO A;  1T6S A;  4EGY A;  3ERE D;  5A2Q Z;  1FY7 A;  3ECH A;  2JTV A;  1QBJ A;  2L4A A;  1LDJ A;  4O5V A;  1F5T A;  1Q1H A;  4LMY A;  3I54 A;  3OOP A;  1USS A;  3ZMS A;  2PJP A;  2STT A;  4LK0 F;  1GXQ A;  3E5X A;  3J81 Z;  1T98 A;  1ZYR F;  2KJC A;  3W6K B;  4HF1 A;  2CWE A;  5LGU A;  2DQR A;  3RIR A;  5H6R A;  3K1P A;  2WTE A;  2PN6 A;  1KYW A;  5HDN A;  3EUH A;  2XRO A;  3J7A O;  3I59 A;  1RI7 A;  2DO7 A;  2OZU A;  1FP2 A;  3FX3 A;  1P6R A;  3K1N A;  3GZ5 A;  1MGT A;  1BJA A;  2ESH A;  1TW3 A;  1ZG1 A;  3FHZ A;  3T0Y A;  1WWX A;  4KFC A;  1J2X A;  3Q9S A;  1W7P D;  4WX9 A;  2IRF G;  4R1H A;  4UV8 A;  5L3G A;  1ULY A;  5HDG A;  2VOO A;  1K79 A;  3SZP A;  4M71 A;  2Y48 A;  5DD8 A;  1RUN A;  4RS8 A;  1B1B A;  4HV5 A;  1QNT A;  4B09 A;  3I71 A;  3MAJ A;  3M8F A;  2VE8 A;  4KIB A;  1YG2 A;  2EV0 A;  3V8L A;  3LA7 A;  4QWQ A;  2F5D A;  3C1D A;  3O6B B;  4FX0 A;  4EQQ A;  1FYM A;  4IF4 A;  3EYY A;  2KKO A;  3L2C A;  3TO7 A;  1ZGA A;  2HS5 A;  4EV0 A;  2A69 F;  1HBX G;  4LB6 B;  4PGH A;  3WTW C;  1R1U A;  1ZGJ A;  3NEU A;  2NNY A;  4CIC A;  4LB5 A;  3CUQ A;  2OBP A;  4ZZL A;  5JHU A;  2K4B A;  1DPR A;  1LJ9 A;  2ISY A;  3ZN1 A;  4FT8 A;  1BIB A;  2XVC A;  4R79 A;  1Z7U A;  2COM A;  1JE8 A;  4YFX F;  4CZZ A;  2LF8 A;  4I0A A;  1JXS A;  4HDV A;  3V7R A;  1UFM A;  3WG9 A;  1MJB A;  4L5J A;  1RUO A;  3BJ6 A;  4ETS A;  3JSO A;  2JZY A;  3R60 A;  3TQN A;  2YX4 A;  3TOA A;  2XIG A;  5LEJ A;  2EB7 A;  1S29 A;  1W5T A;  3Q5F A;  5K5Q A;  1MD0 A;  1TW2 A;  1YW7 A;  2QQ9 A;  2H94 A;  4KN4 X;  1UHM A; 
#chains in the Genus database with same CATH topology
 1NHA A;  1A36 A;  4HSR A;  1QPI A;  4EJT A;  2KZV A;  4ZDL A;  1LEB A;  3WTY C;  2OQG A;  3MQ0 A;  4DJA A;  4JOM A;  3LST A;  3JRG A;  1X1C A;  1G3Y A;  2PJR A;  2M3A A;  4WK8 F;  5FRM A;  4XLE A;  4HF0 A;  2BW3 A;  2QWW A;  5JLW A;  4P55 A;  3KP3 A;  2XAS A;  4IXA A;  1ETW A;  3RDI A;  3WTV C;  1LE8 A;  1OMI A;  2JVH A;  4M3F A;  3V7S A;  4E70 A;  3HGG A;  3LA2 A;  3DWL E;  4F55 A;  4A3E J;  1UST A;  1X58 A;  4KNY A;  3ECO A;  3I59 B;  5J1Y A;  5EZG A;  2V79 A;  4A6E A;  4I6Z A;  3J7Y J;  4WXC A;  1DU0 A;  2MC4 A;  4PUS A;  2O0Y A;  3HKZ A;  3HOZ J;  1O7F A;  2LNB A;  3LSP A;  5HLH A;  2M30 A;  3I0T A;  2MLK A;  1T95 A;  3A01 B;  5K7H A;  2GA1 A;  4LLG F;  3CCR I;  1O3S A;  1OIS A;  4E7K A;  2PQ8 A;  4L5I A;  1Z9C A;  2WY8 Q;  3LA3 A;  2COB A;  3QOE A;  2DT7 B;  2DK8 A;  4Q47 A;  2HU9 A;  5K5R A;  2Z16 A;  4ANJ A;  2JA7 J;  2LLK A;  1XGN A;  2LKS A;  5GPC A;  2CU7 A;  4G6Q A;  2K3P A;  2V7F A;  3BR1 A;  1CGP A;  2F4I A;  4CHU A;  4AIK A;  1XMK A;  4A3C J;  1H0M A;  1DQU A;  1PJR A;  4RAY A;  2MSY A;  2RN7 A;  5IT3 A;  5D6F A;  1B72 B;  1B8I A;  4IJA A;  1LUJ B;  3H9Q A;  1JJ6 C;  2DCE A;  5D8L B;  3D5L A;  4N0B A;  1W7P B;  3LNQ A;  4UUT A;  2H8R A;  3LAP A;  2G9W A;  1TWG J;  3HBL A;  1D8K A;  3L2W A;  1SMY F;  4ESJ A;  1XS9 A;  5IOY A;  4A3M J;  4IRH A;  2FE3 A;  3BCA A;  5B66 C;  5L3F A;  1MMN A;  3L00 A;  4XOR A;  4RB2 C;  1ZRF A;  3DQV C;  3BTC A;  4RGS A;  2Y2Z A;  5L3C A;  3RKQ A;  3J7Z I;  4RLQ A;  2K9N A;  3DKY A;  3ZQQ A;  5K7Z A;  2RDP A;  3HKZ N;  3IV5 A;  1HOM A;  1BW6 A;  1U9N A;  5JHF A;  1IXS B;  1MSF C;  1P9Q C;  5D5X B;  4M9Z A;  2IA1 A;  1FWZ A;  4KDP A;  4HYE A;  3CZ6 A;  1G6N A;  4G9Y A;  3LSR A;  1JTY A;  2LBF A;  3ZQF A;  1Y0N A;  1D1A A;  2A5W A;  2MD5 A;  2A6T A;  2Q8K A;  5IPA A;  4RAF A;  3CP2 A;  2JT1 A;  4DBQ A;  2V6E A;  5IT9 K;  3KP4 A;  3KYL A;  4QSH A;  1MMS A;  1ZKG A;  2HPI A;  2K7L A;  4C3I J;  1KGS A;  3IRQ A;  5F64 A;  2IGO A;  3IUO A;  4N4N B;  5FKM A;  1HXD A;  1WJC A;  1TNS A;  3OY9 A;  4MFD A;  3H9G A;  2CQK A;  3HEF A;  3CF2 A;  4LG0 A;  1S7E A;  3VFZ A;  4HDU A;  1IN5 A;  3J81 K;  5BS6 A;  1PP7 U;  3DEE A;  1OFC X;  4U7B A;  3F8B A;  2G0E A;  2HI3 A;  5IP7 J;  5F04 A;  2P4W A;  2NVX J;  3G1M A;  3Q0U A;  2PMU A;  1QQI A;  2CS3 A;  5J47 A;  5TRD A;  1G3S A;  2EFN A;  1GVD A;  1Y6I A;  5AON A;  3SHF A;  1X2M A;  1NK3 P;  2EIJ H;  2L02 A;  3DV8 A;  2OCC H;  3FBN B;  1SAX A;  4HLY A;  1AOY A;  1TQM A;  2B7E A;  2VBY A;  4ZYH A;  4EAT A;  3MZY A;  4HF2 A;  2RKH A;  1ZLK A;  3KP7 A;  2FXA A;  3IH2 A;  1R5H A;  2W57 A;  4NB5 A;  1D0Z A;  3GFL A;  2IGK A;  3RSN A;  1BI3 A;  3OS0 A;  3OIO A;  2BEO A;  3HG9 A;  2DBB A;  2OA4 A;  2VJI A;  4S05 A;  2JRM A;  5DTD A;  3ROU A;  1RC9 A;  2LOO A;  2WAE A;  4PDK A;  3CLO A;  3OYM A;  2DFI A;  3KP2 A;  3GTK J;  3V7C A;  2BVM A;  4RM3 A;  1U2W A;  1RR7 A;  4XQF A;  2GBY A;  4YIF A;  3ZQG A;  2BW3 B;  1XD7 A;  1F36 A;  3HYI A;  1E2X A;  3IWF A;  3JRH A;  3MKW B;  3L1P A;  4J01 A;  1V5E A;  1GXP A;  4P9F A;  1VQ4 I;  2XC7 A;  2VBW A;  3HOX J;  2XAU A;  3I4M J;  1B9N A;  3B6A A;  1IW7 F;  2NAZ A;  5ILS A;  4KMF A;  2LH9 A;  4BNC A;  3KCC A;  3OYG A;  3WGG A;  3HPH A;  3AFH A;  1TP4 A;  3GBG A;  3BRO A;  2Z5U A;  2E1N A;  2CYY A;  1QGP A;  3LOC A;  3RZO J;  1FSH A;  3HIF A;  3D5R C;  2VBZ A;  4JK1 X;  2NS8 A;  2X9D A;  5K5O A;  1OQY A;  1AU7 A;  2DFF A;  4LLN A;  2RAE A;  3VSK A;  2HZD A;  2K85 A;  1VFC A;  1XG1 A;  3GCM A;  3QPT A;  1YTY A;  5K7F A;  1ZRD A;  4E7S A;  2Y31 A;  5FLX K;  4CO8 A;  2L7F P;  5E1X A;  2HKO A;  4B8X A;  4A5N A;  1LKX A;  2Y0S A;  4XLP F;  4OU0 A;  3NWS A;  2LY2 A;  3GWZ A;  1YW8 A;  2ZC2 A;  4B4C A;  1BR1 A;  4MQV A;  3H0D A;  4ZTF A;  4IHW A;  1LDD A;  2DOD A;  2Z9O A;  4C2T A;  3KET A;  4EM2 A;  3MKZ A;  3L2V A;  1X3Z B;  2R7S A;  5FKO A;  5HLT A;  2TRT A;  3DF8 A;  4UXN A;  3DEU A;  2JA6 J;  1WH7 A;  3S2H J;  1Z77 A;  2BY3 A;  5LEK A;  3AKZ A;  1WZ2 A;  1MBH A;  3K4L A;  4E7J A;  1R4M B;  3A0H C;  2BBY A;  2OCE A;  1FIP A;  1MJ9 A;  2DPD A;  1T0F C;  3K2Z A;  1MMD A;  3GTO J;  5M3F J;  5F0F A;  5DCM A;  2FU4 A;  1U9O A;  1UHS A;  3T5X A;  4AD9 A;  1HQC A;  4V19 K;  1SMT A;  4CA0 A;  5FRN A;  4LGW A;  1YJN I;  4CXF A;  2HOS A;  5DUK A;  1IDZ A;  2EBI A;  2M8E A;  1X1D A;  2K4J A;  2PLY A;  1R5G A;  5HS8 A;  4MHG A;  1O3Q A;  5IOZ A;  3NAR A;  1WPK A;  1IXC A;  3FXJ A;  1N78 A;  1DUX C;  1JTX A;  2B0L A;  1IRX A;  2LF7 A;  3LSM A;  3BJA A;  3CUQ C;  2MW8 A;  3BPX A;  1UZC A;  1WJE A;  4L9V A;  4P9U A;  3CCJ I;  3LMM A;  4MGR A;  1UAA A;  3E5Q A;  1R5I D;  4UB8 C;  1U78 A;  2Q1Z B;  1ZRC A;  4IOC F;  3MZH A;  4I2O A;  1ZG3 A;  3F6V A;  2LBF B;  2UXN A;  4BYY A;  2LC2 A;  1LPQ A;  3HPG A;  1XN7 A;  2L5Q A;  2W82 A;  2EIK H;  4EVI A;  1F43 A;  2Y0S N;  3ULQ B;  1YIO A;  4A3L J;  4C3H J;  3TOB A;  2R7Q A;  3VOE A;  5LHH A;  4G6D A;  2VJJ A;  1HKT A;  2O8X A;  2VT3 A;  3IKV A;  3P9K A;  3ZMT A;  3O2P E;  3U21 A;  5D4R A;  1T8I A;  5E8G A;  1B59 A;  1I27 A;  4OIO F;  2LSO A;  1R71 A;  4U0Y A;  4W1U A;  5LGN A;  5BMZ A;  4KIS A;  4KT6 A;  4OMY A;  2BGC A;  3S15 J;  2VOP A;  4LG0 B;  2HOA A;  1MSE C;  1ON2 A;  5IP6 A;  2IVM A;  5IY5 H;  2M4G A;  2IEK A;  2FF4 A;  2ZJ2 A;  4P96 A;  3HRM A;  2Y75 A;  4KIG A;  1DP3 A;  1HW2 A;  2M4K A;  3G71 I;  5LD2 C;  2OAZ A;  4XL9 A;  5CYV A;  4RB3 C;  1LEA A;  1XSV A;  4YEJ A;  2AQF A;  1CQT A;  4FIS A;  4DGW B;  4PGG A;  2IS1 A;  1YQA A;  3SZG A;  4ENJ A;  1WJ5 A;  1XSX A;  1QVT A;  4HOB A;  4F93 B;  2IT0 A;  1T2K A;  3U2R A;  3IAS 2;  2L0K A;  2L3D A;  4XKV A;  5F27 A;  2YX7 A;  2BYV E;  1FNN A;  3BOQ A;  4N4O B;  4MEX F;  1U5T C;  3OYC A;  1FMW A;  2WV1 A;  5E3N A;  2OD5 A;  2RNG A;  4L18 B;  2R7U A;  5LRR A;  4XK4 A;  4EJO A;  3QOD A;  1REP C;  1FYL A;  2K9S A;  3M07 A;  4FE4 A;  5L3D A;  2M9H A;  1KQ9 A;  2KLO A;  3F23 A;  3SQN A;  2BHZ A;  1NG7 A;  3O3K A;  4JQF A;  2B63 J;  3MVP A;  2XF7 A;  3HOV J;  4RGR A;  3IRR A;  2QYO A;  1LFP A;  2VC0 A;  2N8G A;  1FC3 A;  3H9J A;  4RB0 A;  1VI0 A;  1WKM A;  2KHM A;  2HGC A;  3OYN A;  1TWH J;  4XON A;  3MD2 A;  3E6D A;  2A61 A;  4BH9 A;  3BDD A;  2OZ6 A;  4U0V A;  2IJL A;  4BJT A;  1ERD A;  2L7K A;  1IXR C;  4EGZ A;  1ZTR A;  5CVR A;  2DMQ A;  2NVY J;  5DDG A;  1DGW Y;  1SFK A;  3F0C A;  5IT9 Z;  2KRH A;  3F6O A;  1E3P A;  5JLX A;  2BY1 A;  3HRT A;  3B6C A;  2W85 A;  4HNU A;  5FKK A;  3CP8 A;  5LLQ A;  1HSJ A;  2J5O A;  3DFG A;  5HLI A;  2EA2 A;  3WTZ A;  2FD5 A;  5FFX A;  1MKM A;  4LOC A;  4FAS D;  3JRA A;  3OWT A;  2W84 A;  2V1N A;  1OPC A;  4M3G A;  3C7J A;  2RRE A;  1FZP B;  3Q9V A;  3BG7 A;  1YX3 A;  1Y8Q B;  2FML A;  2MBF A;  3ZMV A;  2YPR A;  4HW0 A;  4XLN F;  1J9I A;  2CFO A;  5DM7 F;  4WXH A;  2RV8 A;  2Q2E A;  1J75 A;  1VQ7 I;  2OJE D;  5AIQ A;  3M9A A;  3S2D J;  2P8T A;  3ASN H;  2CW8 A;  1ZQ3 P;  5ICC A;  1SFX A;  3L09 A;  3JW4 A;  2VQL A;  1J59 A;  2VXD A;  1CF7 A;  1LNW A;  1TWC J;  2UV1 A;  3FM3 A;  1LFU P;  3VEP A;  1PYV A;  3FXQ A;  2IA2 A;  2IA0 A;  2CFX A;  2R7F A;  4HAM A;  3REO A;  1MDM A;  1MNE A;  1S72 I;  3TW6 A;  2FRH A;  2XHK A;  2H6C A;  5DEQ A;  2QM3 A;  3K6G A;  3ZMZ A;  2KIM A;  4IOA F;  1QU3 A;  4EJW A;  4BL0 B;  1SFU A;  3K69 A;  4L9J A;  5FLM J;  3CDL A;  3CCE I;  2NOJ B;  3GZN B;  4UV9 A;  3BT9 A;  4C30 A;  5FFZ A;  4XKC A;  1VQN I;  4MLO A;  3CTA A;  5TJJ A;  4EEF G;  3FXR A;  5M5X J;  1Z91 A;  4LIV A;  3VYR B;  3RJP A;  3PIP F;  3FMS A;  2A68 F;  1UCR A;  4A69 C;  3S3M A;  1BC8 C;  2GOX B;  4OIQ F;  2V4J C;  2AQE A;  3BC8 A;  5F6F A;  3SEZ A;  3WHC A;  2Z3Y A;  2DA7 A;  1KQ0 A;  2DMN A;  2HYJ A;  4D9J A;  1P7J A;  3TO6 A;  1XMA A;  2EV6 A;  3CJR B;  1KU3 A;  2P7V B;  3BLY A;  1RKT A;  1U8B A;  2CW7 A;  3HSE A;  3HUG A;  4V2F A;  2H6B A;  4HX4 A;  2ZXH A;  3I56 I;  2DTR A;  2W00 A;  1JUM A;  2LKX A;  3JRI A;  2WAQ A;  1EJ9 A;  3P9I A;  4XLC A;  2VON A;  1TC3 C;  4IX7 A;  3IH4 A;  5JR3 A;  4ZZD A;  1RIO H;  1UB9 A;  3ELK A;  2ACJ A;  2QSG X;  1JGG A;  1T0F A;  1POG A;  2JA5 J;  1U5T A;  4YFN F;  2VE9 A;  2WB1 A;  1JKQ C;  1QPM A;  2DFH A;  4RAG A;  4BBS J;  5FKN A;  5FLX Z;  1YHQ I;  3F72 A;  3ZPL A;  1R58 A;  1BL0 A;  1KON A;  1V4R A;  3HJE A;  1FSE A;  2MG4 A;  2JA2 A;  4ZYD A;  2CMP A;  2PMH A;  4UNO A;  2XGC A;  3LFU A;  2Y9Z A;  1MJA A;  1TWF J;  5LHI A;  1BC7 C;  3RPQ A;  2HDD A;  4CCJ A;  2JUG A;  4XKW A;  3QP5 A;  3CCL I;  2M1B A;  5D8K B;  4GYI A;  1K78 A;  4A3B J;  4DZP A;  5CPR B;  1IV8 A;  2Y9Y A;  3HHH A;  2EFQ A;  4IQJ A;  5E18 F;  3H3Z A;  4BDZ A;  5CLS A;  3KYC B;  4NNJ A;  2XPW A;  1HF0 A;  4M9X A;  4ZC3 A;  1TLH B;  3DPT A;  2BE5 F;  4AUX A;  4MFE A;  1VZ0 A;  5D4S A;  4AM3 A;  3PIO F;  2NVU B;  2M45 A;  4QPO A;  1G3T A;  1XCB A;  4UVC A;  2ZCW A;  5FD6 A;  4LJZ F;  2M5W A;  3JTH A;  2D1V A;  2O03 A;  2R7V A;  5GAH J;  1FT9 A;  1D0Y A;  1S7A A;  1P4A A;  5JVT A;  1W4M A;  3TBI A;  1WSU A;  1R49 A;  2WAQ N;  4I76 A;  4QLC U;  3LSJ A;  5B1A H;  3K1M A;  2D45 A;  2W7N A;  1KQ8 A;  3VB2 A;  2HVQ A;  5EEG A;  5B5E C;  4YG2 F;  1PUF A;  2WB1 N;  2XRN A;  4M74 A;  3VSL A;  4GFB A;  3DBR B;  2KDZ A;  4LLL A;  2XB5 A;  5ICF A;  2YU9 J;  1KU9 A;  3DU5 A;  1ODD A;  4RGX A;  1BJZ A;  3MN2 A;  3JRD A;  3C2H A;  4L0Y B;  4NHJ A;  1YS6 A;  4LIT A;  2QBY A;  1RZ4 A;  1K6O A;  1A5J A;  2BVL A;  2K9Q A;  1IF1 A;  4XNF A;  3QWL A;  3V8J A;  4CYC A;  3KYD B;  4CH7 A;  4FQG A;  2MC3 A;  4I09 A;  3KX2 A;  1ITY A;  1IUY A;  4CSW A;  3FXM A;  5TGT A;  3WE2 A;  2E5N A;  1Z21 A;  3W2W A;  4HV6 A;  1X2N A;  1Y56 A;  2K27 A;  4ZH4 F;  4Y33 A;  1VQ6 I;  4H4K C;  3BQZ A;  4RM2 A;  4EM1 A;  3H0G J;  3CC4 I;  2FNA A;  4HEA 2;  2AO9 A;  2C6Y A;  2DMP A;  1ZAR A;  4UUV A;  2X4H A;  1VND A;  2NNN A;  2IGN A;  3GEZ A;  3KP5 A;  4M6Y A;  5FD5 A;  4BBR J;  2FEZ A;  1HW5 A;  4A0Z A;  2E2H J;  1XMX A;  3BQY A;  5BPI A;  2MH2 A;  3ZQC A;  1R1T A;  4E4H A;  1RPW A;  1BR2 A;  3AAF A;  1UG2 A;  3A4C A;  2FBI A;  2CUJ A;  2MLG A;  3TP3 A;  2Q2E B;  2Z1D A;  2LY9 A;  4A0X A;  2AHQ A;  3QPS A;  2MH9 A;  4HPQ A;  4BUP A;  3K0L A;  4ZJZ A;  4UUS A;  2STW A;  3IKT A;  2DTZ A;  3LQR A;  4IVN A;  3OYI A;  1CF7 B;  3DCF A;  1D5Y A;  1R4N B;  3I64 A;  4NDL A;  3D1N I;  4G7H F;  3OYK A;  2VPR A;  1ZN2 A;  1EH7 A;  1FJL A;  3OYJ A;  1KYZ A;  1X3U A;  1Z67 A;  1YX5 A;  2IPQ X;  5CVU A;  1IRG A;  4YIR X;  3DPL C;  5C4X J;  3FHN A;  2XKO A;  2DN0 A;  1EKE A;  2L4M A;  3HXL A;  2P7C B;  3CD6 I;  5IYC J;  3OIQ A;  3DU6 A;  1FYK A;  2PBI A;  2HTS A;  4F3Q A;  1HDP A;  3TP0 A;  3BG9 A;  2K3F A;  4X1E A;  4ZYG A;  3DKX A;  2GIV A;  1K61 A;  1U6G A;  1E17 A;  5ILV A;  2ZNY A;  1D5V A;  2VQH A;  4I02 A;  2H09 A;  2LP0 A;  5KAF C;  2FOW A;  2QQA A;  4A6D A;  2XAG A;  3KLN A;  3OYB A;  2E1O A;  3R61 A;  4XKB A;  3HUG B;  4CDG A;  4IRG A;  4BQO A;  3A02 A;  4D5C A;  2X1C A;  4PFP A;  3ESW B;  4DQ2 A;  1HW1 A;  5E3M A;  2NRA C;  3CES A;  2R7O A;  4A3G J;  1WRJ A;  1R6R A;  3FF5 A;  3OR1 C;  3QAH A;  3BG6 A;  3BY6 A;  4CGZ A;  2E35 A;  3B02 A;  2UWM A;  1XPX A;  4NC8 A;  1D1B A;  1KA8 A;  3OSF A;  4UVA A;  1I1G A;  3GUD A;  4HBL A;  2Y69 H;  1ZK8 A;  2DJI A;  1C0W A;  1N77 A;  5J8C A;  1EV7 A;  1X1B A;  4MEY F;  2CGP A;  3FIS A;  5CVJ A;  1PUE E;  3VOD A;  4GRI A;  5M3M J;  4PZJ A;  1RET A;  3QP6 A;  3CUQ B;  3SXY A;  4D7M A;  4BXU A;  1EA3 A;  1B9M A;  2XAQ A;  4XN0 A;  3CO6 C;  4GYG A;  1KU2 A;  2QVO A;  3DXJ F;  1X19 A;  2QQ8 A;  2ETH A;  1P92 A;  1K78 B;  2FA5 A;  3H5R A;  4PK4 A;  2E71 A;  5AIP A;  2XAF A;  3WU2 C;  2AXT C;  1P7I A;  3TDU C;  1VQ9 I;  1Z0X A;  2LG4 A;  1V54 H;  3PNT A;  2ZME C;  1J09 A;  2KDO A;  3BJO A;  1FP1 D;  2IXS A;  5FGM A;  4XN3 A;  3BTL A;  1VQM I;  3LSG A;  3M1E A;  1Y1V J;  4KIC A;  3LSI A;  3SFI A;  1ZRE A;  1QZZ A;  5GAD J;  3FWE A;  2Y30 A;  4GO1 A;  4CYD A;  3MEX A;  4LIU A;  2OU2 A;  1HST A;  2R93 J;  2JJ7 A;  2KJB A;  3BTJ A;  1KU7 A;  4BXF A;  1W5S A;  4B3A A;  5LRS A;  3OYD A;  2JN6 A;  1SD6 A;  4N9I A;  2CV2 A;  1O57 A;  2E1M C;  5DS9 A;  3WTT C;  4OWR B;  2LRD A;  1SAU A;  1PUF B;  2CQQ A;  2DAO A;  2DLL A;  2XGE A;  2R7T A;  5EYR A;  4Q48 A;  1OCO H;  2QEN A;  3RQI A;  4G7O F;  2E7X A;  2MAB A;  1LB2 A;  3N05 A;  3S3N A;  3F8M A;  5LBQ A;  2K9M A;  4UVB A;  1IC8 A;  2VKD A;  4CYC B;  4BHP A;  1TZL A;  2D5V A;  1GV2 A;  3KZZ A;  3N97 A;  3GF2 A;  3DBH B;  1U5T B;  4BHC A;  2QA4 I;  5J3L A;  1I50 J;  5D6E A;  3SFZ A;  1J0R A;  4F52 A;  4XID A;  2VI6 A;  5HNF A;  4XMY A;  3OL3 A;  2HR3 A;  2PJR B;  1G3W A;  2AS5 F;  2CRG A;  1FPQ A;  2QKM B;  2D1H A;  4OIP F;  2CUE A;  2VQG A;  5GTI C;  4NBQ A;  3GTP J;  2NXN B;  4I01 A;  1Z3Y A;  3JAM K;  1P4X A;  3BZC A;  1LE8 B;  3MMY B;  2O8K A;  1FEX A;  1BIA A;  2P5V A;  4KUM A;  1X3W B;  3HRU A;  1LDK B;  2LKP A;  4UUS B;  2HWV A;  3RKX A;  2BOL A;  2VJ5 A;  3WHB A;  3PFY A;  4F7Z A;  4ABZ A;  3E1S A;  4FX4 A;  4Q4Z F;  5BPD A;  1T33 A;  2WAD A;  3IWZ A;  4BU2 A;  2ECB A;  4OIN F;  1HKQ A;  4BQA A;  3BZ6 A;  4OOI A;  2F5F A;  3I55 I;  1D1C A;  2A5Y B;  3DBL B;  2TDX A;  3CMA I;  5DD4 A;  1QVU A;  1FBS A;  4ENN A;  2LD5 A;  3K4K A;  4C9Y A;  1IN4 A;  2BXY A;  4Y4R A;  3RTR A;  1FBU A;  3I9V 2;  1Z6T A;  3HGY A;  5FO5 A;  5ILU A;  2ELJ A;  2E34 A;  4EJU A;  3QPL A;  2QGU A;  3FK6 A;  3ZMD A;  1SD5 A;  4ESB A;  4HRI A;  3K70 C;  1A35 A;  3TMO A;  4PJL A;  3W2A A;  2PMZ A;  2NS0 A;  1TL8 A;  4A3D J;  4BAC A;  4EMS A;  1TTY A;  4XOT A;  3AG2 H;  4KYW A;  4P5O A;  5KK1 A;  1Z05 A;  3CCV I;  2EWN A;  3E97 A;  4HNT A;  5FJ8 J;  4M72 A;  3CO7 C;  4M6V A;  2CO5 A;  2JSP A;  3UKG A;  1B8I B;  3ZCO A;  1WVR A;  3OS2 A;  3GME A;  4IRI A;  4GDF A;  3V8K A;  1SEU A;  1GT0 C;  3H1C A;  3IP4 B;  1FBQ A;  4OAY A;  4A3J J;  2MGQ A;  2A07 F;  4MO7 A;  3C18 A;  2RGV A;  4G6T B;  2ZSH B;  2X6X A;  3ABT A;  4IL6 C;  3WU0 A;  3WG7 H;  1K4S A;  2JK3 A;  3F21 A;  2R7R A;  2L9V A;  1SD4 A;  1V55 H;  3I3L A;  3PJR A;  1F4K A;  2X6W A;  3ABL H;  2DMT A;  4NC6 A;  4E7L A;  1QRY A;  2XGX A;  1BR4 A;  1W36 C;  2V9K A;  2Z2S B;  4ENK A;  3DPU A;  1HKS A;  2DFE A;  3MCZ A;  3I53 A;  4GCV A;  3H3V K;  2DA4 A;  2L9S A;  2R5Z A;  1YJW I;  1D0X A;  2M0M A;  1J7K A;  2FX0 A;  2ZJR F;  4M9S A;  1SVL A;  3D5S C;  5E8I A;  1AHD P;  1FOW A;  2IP2 A;  1YIJ I;  1P2F A;  1WJD A;  3S93 A;  1MH4 A;  4PSX A;  2VUM J;  2HTJ A;  2OF7 A;  3WTS C;  5E17 F;  3RCO A;  3OYL A;  2OQR A;  3BR6 A;  3DTE A;  2ZNZ A;  3DEW A;  1T39 A;  4II2 A;  5CVV A;  3OYA A;  4X6A J;  2VOD A;  2EH3 A;  2PMZ N;  3ZMU A;  3KFW X;  3CMM A;  3KPH A;  4LFU A;  5B3S H;  1H88 C;  2GOM A;  2DA5 A;  2JSC A;  2L2O A;  4AWX B;  1IN7 A;  2X51 A;  1TQI A;  1G8X A;  5HDK A;  2OV7 A;  2ZBK A;  4U88 A;  4E7I A;  5DV5 A;  3BR2 A;  1X4P A;  4IHX A;  2HDW A;  1ETV A;  2HQ5 A;  4MIM A;  3B73 A;  4KMU X;  2KIU A;  2L9R A;  3S32 A;  3T1B A;  2EA4 A;  3S17 J;  1ZLJ A;  1I5Z A;  4RA2 A;  1MNM C;  2W24 A;  2GXB A;  5H6Q A;  2NVQ J;  3OMY A;  3DLA A;  2QF7 A;  4LK1 F;  1XCV A;  2JPB A;  2QCO A;  2R7D A;  3RYP A;  3ZGK A;  4C3J J;  5KVR A;  3TO9 A;  3C2B A;  4M3B A;  4Y3O A;  4A93 J;  4XR6 A;  3K2A A;  4B3X A;  4A12 A;  2WWY A;  1MIJ A;  1MBK A;  2HQR A;  3NRV A;  3Q3S A;  1OCC H;  4WXD A;  2ZME A;  4J19 A;  4L9T A;  2EFP A;  2E36 A;  3E6C C;  1GUU A;  2CG4 A;  2CH0 A;  2YR2 A;  5D5U B;  3MZ8 A;  1AA7 A;  1UG0 A;  1KZH A;  3FKI J;  1FLI A;  4B47 A;  3HTU A;  3EET A;  4NC7 A;  1WJB A;  4JYK A;  3A0B C;  4J00 A;  3W6V A;  2CUF A;  1TQP A;  4D7N A;  3W6J B;  2WC2 A;  1ONV A;  3GTG J;  5L3E A;  3HOT A;  4A3F J;  1R36 A;  3ISP A;  4ITV A;  3OOU A;  3S8P A;  3S1N J;  5J1R A;  2DA6 A;  1S9H A;  3KIO A;  3N4M A;  3LAJ A;  4FET A;  1BI0 A;  2LRE A;  3PM1 A;  5JI6 A;  2A6H F;  2DOE A;  4OIR F;  3A03 A;  2HZT A;  2CQX A;  2ID3 A;  2LY1 A;  2K02 A;  4WCG A;  4G7Z F;  4D0P A;  1NH3 A;  4RLF A;  3TGN A;  3CJT B;  4CCK A;  2EQR A;  3A1Y A;  2ZFU A;  2ADU A;  2IAI A;  4E7Z A;  3I5U A;  5J1U A;  3HHG A;  1MMA A;  3E6B A;  3FM5 A;  3PO2 J;  2WY7 Q;  2I8D A;  5EJC A;  1SFE A;  1D3Y A;  4IO9 F;  1I6X A;  1NK2 P;  2VXZ A;  1TT5 B;  1WJA A;  3CUO A;  3MKY B;  2HVS A;  2HYF A;  5F08 A;  3L2U A;  1FX7 A;  1OYW A;  2QUF A;  2BV6 A;  4BAY A;  1APL C;  1FOK A;  3HOU J;  1NTC A;  4CCL A;  1YJ9 I;  2GWR A;  3BWG A;  5E3L A;  4IHS A;  1I39 A;  3JCU C;  3RQ4 A;  3ZR8 X;  1G2H A;  1EH8 A;  1O3R A;  1SC7 A;  2JVG A;  2KQR A;  1WHU A;  2IGM A;  2K9L A;  2E2I J;  1FTT A;  2RC4 A;  3OIP A;  3K70 D;  2CV0 A;  3T8R A;  3FMQ A;  2L7M P;  5DCM B;  3FXU A;  3GFI A;  3EDP A;  2CQN A;  4AIH A;  4FCY A;  5J8F A;  1XDU A;  3ZQH A;  5EEA A;  5KAI C;  2HXO A;  3EYI A;  1WH5 A;  2X85 A;  1FOY A;  2NYX A;  1B6A A;  4KN7 X;  5GAE J;  3G6E I;  3M7G A;  2YS9 A;  3Q0W A;  2GLO A;  3LQQ A;  4HX7 A;  2KIF A;  4XBF A;  2EFO A;  4L5E A;  1IGN A;  1STZ A;  4O6J A;  1IJW C;  1Y39 A;  3CCU I;  2EFW A;  3JAM Z;  5ERI A;  2DI3 A;  5L3B A;  1BN5 A;  1LVK A;  2ICW G;  3CJN A;  3A01 A;  2XF5 A;  1ZAO A;  4YEL A;  2F2E A;  4Y17 A;  4XOP A;  2DXI A;  3JRE A;  1OCT C;  1WFX A;  3F9K A;  2IS6 A;  1YW9 A;  4M6X A;  3HOS A;  1QZY A;  1U0J A;  2XAJ A;  3IHU A;  5J40 A;  3GW2 A;  5GAG J;  2OPT A;  1Y1W J;  2DOA A;  3BR3 A;  4ESF A;  2M87 A;  2HQA A;  3K4C A;  4AU7 A;  3KLO A;  2EZK A;  3CJQ B;  3WTU C;  3COA C;  1JI8 A;  3E3V A;  4DBR A;  2F4M B;  2VB6 A;  2IS4 A;  1ETY A;  2EIM H;  3PSF A;  3RPU A;  1QHH D;  2O9L A;  4PSW A;  2DMU A;  1UEL B;  4I98 B;  1IN6 A;  3W2V A;  4PFO A;  2WA0 A;  1WQ2 A;  1Z3X A;  3WOD F;  1W7P A;  3D0S A;  3SZT A;  2UXX A;  4BE1 A;  5H20 A;  1HC8 A;  3PO3 J;  3ABK H;  1OLT A;  1IZ1 A;  5BQT A;  3JR9 A;  2K5C A;  4XSZ F;  2F5E A;  1S7O A;  5FB2 A;  1G59 A;  1Y8R B;  3I4N J;  2DA3 A;  2YU3 A;  2X0L A;  1I6H J;  4BY7 J;  1WGX A;  1YI2 I;  4GGG A;  5K1Y A;  2MA3 A;  2RQP A;  3DKW A;  3FBI B;  3FIW A;  3GXO A;  1S8N A;  3E5U A;  3OYF A;  3KP6 A;  1RNL A;  3IL2 A;  2Z33 A;  2EIN H;  2IW5 A;  3F8C A;  3K4M A;  4F91 B;  2BHY A;  2OUM A;  3WGH A;  2GA2 A;  2VQC A;  2ZME B;  2DA1 A;  5ED4 A;  1ZG5 A;  3HSR A;  2DU9 A;  4S04 A;  5M5W J;  2VKH A;  2BY2 A;  3CMY A;  5HLG A;  2R7W A;  1JHF A;  3PL8 A;  1D8J A;  4O3M A;  3JRB A;  1TWA J;  1S6L A;  4I99 C;  1R9T J;  2XKP A;  3R6S A;  4HA8 A;  4A2U A;  5E1W A;  4PJJ A;  4S0H B;  2ZXJ A;  2L7Z A;  1F9N A;  2P5L C;  3H5A A;  4A0Y A;  2B9S A;  2V1D A;  2XUB A;  4G8X A;  3ML6 A;  2XF6 A;  4XLA A;  2XPU A;  2UUZ A;  5D5W B;  4OMZ A;  2DT5 A;  2RNJ A;  4AYB A;  2E1M B;  2LMD A;  2HKX A;  5HS9 A;  2G7U A;  4PJM A;  4QTR A;  4U87 A;  4CCO A;  2KP6 A;  2E60 A;  3WGI A;  2BY0 A;  3EUA A;  5GP9 A;  2XV4 S;  2PEX A;  1YIT I;  2X1E A;  2HDC A;  2QKL B;  2CSO A;  1I3Q J;  3C2G A;  3FDY A;  4KA4 A;  1U8R A;  4RMN A;  2IS2 A;  2H1L A;  2M0C A;  4BKX A;  1DP7 P;  3BCB A;  5E79 C;  1JGS A;  3AG1 H;  3SJM A;  4A3I J;  2XSJ C;  6PAX A;  1OYI A;  4BGD A;  3JRC A;  3FMR A;  1GDT A;  3U1D A;  3S1R J;  3BPV A;  1HA8 A;  1BI1 A;  4BEH A;  3P5J A;  1L0O C;  4XM3 A;  3S3O A;  4KT5 C;  1DPU A;  3K4J A;  5LGT A;  2DK5 A;  4FE7 A;  2XDV A;  2V26 A;  1Z7L A;  3BZK A;  4NQW A;  2GXA A;  4QIW N;  3ZRG A;  4DNC A;  3EQL F;  3G2B A;  1ZHF A;  2JPC A;  2VAS A;  2ZXI A;  4BS9 A;  2PI0 A;  4PJN A;  1JT0 A;  5HOO A;  3PNV A;  1JHH A;  3V4G A;  5EZH A;  3R0J A;  4B1R A;  3PSI A;  4N9H A;  5J6X A;  3HTS B;  2X6O A;  2HYG D;  1OJL A;  4ZYE A;  3F8N A;  2EIL H;  4ZYA A;  2XAH A;  1E3O C;  1OYY A;  1M1E B;  5DUI A;  4YII A;  5GTH C;  1K6Y A;  3DP7 A;  2A05 A;  1O4X A;  1FTZ A;  3HRS A;  4HQM A;  3GTQ J;  4HQE A;  3JTG A;  1BI2 A;  5HNH A;  2NVT J;  1QHG A;  1XGS A;  2FUG 2;  3QPH A;  1ON1 A;  3JRF A;  9ANT A;  4DYC A;  2ME6 A;  1MDM B;  2EK5 A;  3G3Z A;  3TKY A;  4Q5S F;  4ZDP A;  4UY8 I;  3L7W A;  1YRN A;  3QYF A;  1ZR4 A;  4NUB A;  5ICG A;  4AYB N;  3M8J A;  2JA8 J;  1T08 B;  2LVS A;  2CJJ A;  3VYS B;  2R4G A;  1A31 A;  1A04 A;  5DM6 F;  2DYR H;  1O3T A;  2X1D A;  3SEQ A;  1A6I A;  2KMU A;  2YUS A;  3RYR A;  1AKH A;  3PNY A;  2W48 A;  2Y0M A;  2K86 A;  4HLX A;  3KEO A;  1SVO A;  2AXL A;  2RVC A;  3M4O J;  2ISZ A;  4L9N A;  1YFH A;  1BOA A;  1T38 A;  2ZKZ A;  3IC7 A;  3J80 K;  1S3J A;  3CME I;  2ZJP F;  1FIA A;  2L9N A;  1W1W E;  2VBX A;  2DPU A;  3HM5 A;  3SDG A;  3VWB A;  2QZ8 A;  3L2Q A;  1IO2 A;  3WU1 B;  2H1K A;  1Q1V A;  1G4D A;  3H3U A;  1IRZ A;  4WF2 A;  4A3K J;  1JJ8 C;  4PCQ A;  3WTX C;  1K4T A;  4XSX F;  2FQ3 A;  1W0U A;  1VQK I;  3FZV A;  5DCF A;  1QO0 D;  4KJZ A;  3CDH A;  2LK2 A;  5EEH A;  4RDU A;  4H0E A;  1PVE A;  2NOG A;  3M8E A;  1ZGW A;  1W5C C;  3RKY A;  2DOF A;  2GQQ A;  2XRL A;  1QZE A;  2FOK A;  4Y52 J;  2A6E F;  4GXO A;  4R8H A;  2H27 A;  2E1C A;  3ERM A;  3F22 A;  4M3E A;  1T56 A;  2M7A A;  3LL7 A;  2L01 A;  1ENH A;  3GO5 A;  1OR7 A;  2FNP A;  2LTP A;  4CUG A;  3NAU A;  5IYD J;  5E20 A;  3CF5 F;  2O3F A;  5DYM A;  3GX4 X;  4IQ4 A;  2R5Y A;  1JT6 A;  3AL0 C;  1ETO A;  2PG4 A;  2E19 A;  3MFK A;  1J5Y A;  3CQZ J;  3BG5 A;  3ABM H;  3GFM A;  3K4B A;  2VN2 A;  3KZY A;  4HZF A;  1ETQ A;  2QLZ A;  4EJV A;  3KEY A;  3IH3 A;  2ID6 A;  2ZO4 A;  1JKP C;  3PQK A;  3GZ6 A;  1IUF A;  5CQE A;  5HS7 A;  4HST A;  5A2Q K;  4Y13 A;  1Z1D A;  1MZB A;  4JX5 A;  1VQ8 I;  2X6Y A;  5LFA A;  3DTI A;  1K7A A;  4ENM A;  1SD7 A;  1V3F A;  2F5V A;  3HOW J;  1MBF A;  2LDU A;  4IKF A;  2VT2 A;  2DJN A;  1XDS A;  3ZOB A;  5JFR A;  1H8A C;  1ZH5 A;  1O7L A;  2P6T A;  3KEQ A;  5EGO A;  2DYS H;  3C3W A;  3GTJ J;  3OS1 A;  1GVJ A;  2KRC A;  1OCZ H;  3OSG A;  2HNH A;  4HX8 A;  2KZG A;  2HXI A;  1F1Z A;  3HL2 A;  1GV5 A;  3TDZ C;  1PP8 F;  1VTN C;  2V1U A;  3ABU A;  3A2K A;  2KRF A;  2EZI A;  1R00 A;  4RGU A;  1H9G A;  4LD5 A;  2QBY B;  2ZFW A;  3HOY J;  4XRS G;  2DQL A;  4WWC A;  3GFJ A;  3KE2 A;  3S2W A;  1LQ1 A;  1JKR C;  2DDB A;  1Z6R A;  2GIZ A;  3U9G A;  4IPA A;  1ACI A;  4KIF A;  4BY1 J;  4K2E A;  1GHC A;  3RKW A;  4BEH B;  4BXX J;  3F3X A;  2P5K A;  1BBY A;  1EH6 A;  3MWM A;  5CJ9 A;  2EJR A;  2MD0 A;  2HEO A;  4NQW B;  3S1Q J;  1UMQ A;  2G7H A;  2K40 A;  4UHT A;  1MND A;  3I58 A;  2DDA A;  2JWT A;  2VL8 A;  3E0J B;  1X4O A;  2PFB A;  1A6Q A;  1YO5 C;  2CQ7 A;  2KT0 A;  3OL4 A;  1MW7 A;  1WI9 A;  2JRT A;  2DA2 A;  2O61 A;  1PDN C;  1IG7 A;  2GM4 A;  5FLV A;  3GTM J;  1UHW A;  2F4O B;  3P9C A;  2F5C A;  3FXO A;  4C2M J;  3QRF F;  2GAU A;  4RAZ A;  2JMW A;  3OV8 A;  2XPV A;  4I0B A;  4BDY A;  1W0T A;  1OKR A;  1DDN A;  1LVA A;  1UJ8 A;  3PUB A;  2HOE A;  3VYT B;  1BW5 A;  4IZZ A;  1N75 A;  2VKE A;  2R3S A;  4MNU A;  4XLF A;  1YRN B;  2E5Z A;  4A5M A;  1H9T A;  3JSP A;  3EUH C;  3NWT A;  4OAZ A;  4UB6 C;  3K9T A;  4E7H A;  3RI4 A;  3X2Q H;  2M34 A;  1XB4 A;  2A3S A;  1YS7 A;  4G12 A;  2HVR A;  4JP0 A;  4HG2 A;  5ICE A;  4YFK F;  2EPF A;  3L2R A;  2X48 A;  3E7L A;  5H2F C;  4ZDO A;  3L9F A;  1XGO A;  2OTJ I;  3HSF A;  1AKH B;  2ZJQ F;  4IHT A;  3CC2 I;  2R7Z J;  5F0C A;  4MTD A;  1MMG A;  2DW4 A;  2L54 A;  1IRF A;  2D2W A;  5FRO A;  3QYE A;  1RKW A;  2W25 A;  1R23 A;  1SVM A;  4BE2 A;  4IHV A;  1RES A;  4FHT A;  1HLV A;  5BOX A;  1U3E M;  3G73 A;  2EV5 A;  2R7X A;  4I7H A;  2JQ7 A;  3HB9 A;  5KCM A;  2VC1 A;  5CVI A;  1ZEL A;  5J4Y A;  4CZC A;  2GXG A;  5F1R A;  4RB1 A;  4Y7N J;  4AIJ A;  4ON0 A;  4U0W A;  3TW7 A;  3BG3 A;  5TIS C;  2MYS A;  4JX4 A;  3R4K A;  2DT6 A;  2Q0O A;  5CQG A;  4TV7 A;  1HCR A;  2ECC A;  1B4A A;  2Z99 A;  1YOV B;  5F1J A;  3LFK A;  3W3C A;  2CW0 F;  5EG0 A;  1WJF A;  4BQQ A;  2R5Y B;  3GLX A;  1YE9 A;  2YSR A;  3QU3 A;  1MBE A;  3HZJ A;  3QU6 A;  3WE3 A;  3OYE A;  1IV6 A;  4XRF A;  3P7N A;  2ZSI B;  2WV0 A;  1XSD A;  3ZQI A;  1R1V A;  2VIX A;  2R0Q C;  4XRS A;  3S14 J;  3ZQL A;  4Z2Y A;  3PQJ A;  2ELH A;  1I1S A;  3CCY A;  1V5F A;  2RQQ A;  1X1P A;  3CCS I;  3ZP5 A;  5GPA A;  2V6C A;  4X0G A;  1X1A A;  3HC7 A;  3DLL F;  2FBH A;  4JBA A;  3QYB A;  5C44 J;  5KHD A;  3UR3 C;  1IN8 A;  1ZR2 A;  2FMY A;  4BJ6 C;  3H92 A;  1AWC A;  4MQ9 F;  3CDI A;  4D5F A;  3SYT A;  4G94 A;  2QQB A;  3BP8 A;  1Y0U A;  3LWF A;  1BM9 A;  1VQP I;  3M1C A;  5EGO B;  3S1M J;  1DGR M;  3Q0V A;  3T8T A;  4P1W A;  4AVP A;  3GYH X;  1P4W A;  3F8F A;  1ORK A;  2KIS A;  2KPM A;  3RZD J;  2LFB A;  3AG4 H;  5LHG A;  2V9V A;  1YYV A;  4L0Z B;  5C3E J;  1BA5 A;  3SDB A;  3J80 Z;  1ETX A;  1TNT A;  4MTE A;  3I4P A;  1QA6 A;  2UZK A;  3OYH A;  1YLF A;  1R22 A;  2E2J J;  2OTL I;  4BHB A;  2EZH A;  3ZXS A;  4HNV A;  4EM0 B;  2HFH A;  5IYB J;  5IP9 J;  2V9P A;  1FOX A;  3ZQ7 A;  1TBX A;  1IDY A;  4U7D A;  3GVA A;  2HQN A;  4ZTJ A;  1R7J A;  3QQA A;  3O8H A;  2V1X A;  5C4J J;  1HDD C;  2E7W A;  1BOB A;  2FBK A;  4KIT B;  2O6G E;  3QOP A;  1XGM A;  2P6S A;  3PUF A;  2ELK A;  5FKL A;  2BZT A;  2J5P A;  5HVQ C;  2HPM A;  5E3O A;  4M73 A;  2ESN A;  3E6M A;  3K10 A;  2I5U A;  1IAW A;  3FXK A;  2NS7 A;  3ZN0 A;  4ASN A;  1V5G A;  5HOD A;  3ONQ A;  3R0A A;  4XRM A;  5D5V B;  3H35 A;  3PFI A;  1L3L A;  3M3Y J;  2FSW A;  5E1Z B;  2HOT A;  1VF9 A;  2O5R A;  2WAF A;  2ZB9 A;  2GZW A;  4Y15 A;  3NQO A;  4AID A;  4JX6 A;  1T6S A;  4EGY A;  3ERE D;  5A2Q Z;  1FY7 A;  2LYC A;  2JTV A;  1SAN A;  3ECH A;  1JKO C;  4M3D A;  1QBJ A;  4V2G A;  4XIC A;  2L4A A;  4D1Q A;  1LDJ A;  4DZJ A;  4O5V A;  3G1O A;  1F5T A;  1Q1H A;  4LMY A;  3I54 A;  2IBD A;  2LR8 A;  3OOP A;  3H36 A;  1USS A;  2KIQ A;  1XC5 A;  3ZMS A;  1WI3 A;  2PJP A;  1JUS A;  2FJ1 A;  1JUP A;  4QPQ A;  2STT A;  3FKJ A;  1SFO J;  4LK0 F;  1VQO I;  1GXQ A;  3E5X A;  4W97 A;  3J81 Z;  1T98 A;  1ZYR F;  3BTI A;  2KJC A;  1MBG A;  3W6K B;  4HF1 A;  1I3A A;  5JVG F;  2CWE A;  5LGU A;  2DQR A;  4XLH A;  3RIR A;  2VJ4 A;  5H6R A;  2OC6 A;  3GLL A;  3FK7 A;  4AC0 A;  3K1P A;  1S5L C;  2WTE A;  2PN6 A;  4B44 A;  1FMV A;  1EF4 A;  5KNL A;  1KYW A;  5HDN A;  3DTK A;  2H8W A;  3EUH A;  2VKV A;  5F0H A;  2XB0 X;  2XRO A;  3J7A O;  3I59 A;  1RI7 A;  2M2E A;  2DO7 A;  2R5Z B;  2OZU A;  1FP2 A;  1OR7 C;  3BR0 A;  4IHY A;  3EUK L;  4AVZ A;  3FX3 A;  1P6R A;  3K1N A;  3GZ5 A;  1MGT A;  3LSK A;  1BJA A;  2ESH A;  2ZXW H;  1OCR H;  3CLQ A;  3BR5 A;  1TW3 A;  5EG0 B;  3V42 A;  1ZG1 A;  3K4N A;  3FHZ A;  4FTH A;  3RPU D;  3GTL J;  3T0Y A;  3U1K A;  4IEJ A;  1WWX A;  3CCQ I;  4KFC A;  1J2X A;  3Q9S A;  1W36 D;  1W7P D;  4WX9 A;  2IRF G;  4R1H A;  1E3H A;  4UV8 A;  2QSF X;  5L3G A;  4YRV A;  1ULY A;  5HDG A;  2VOO A;  1K79 A;  3VPR A;  4E6K G;  3SZP A;  2ME0 A;  5B1B H;  4M71 A;  2KL4 A;  1OCP A;  2Y48 A;  5DD8 A;  1RUN A;  4RS8 A;  2O7O A;  1B1B A;  4HV5 A;  4DW6 A;  2EZL A;  1QNT A;  1B72 A;  5J4V A;  4B09 A;  4Z6Y A;  3TL4 X;  3I71 A;  3MAJ A;  1DU6 A;  3M8F A;  2KFD A;  2VE8 A;  3G4S I;  2M7B A;  1YG2 A;  4KIB A;  2VPL A;  2EV0 A;  1VQL I;  3V8L A;  3LA7 A;  1XTA A;  3VDX A;  4DYR A;  2F48 A;  2XSD C;  1K83 J;  2W4S A;  4LG3 A;  4QWQ A;  2F5D A;  3C1D A;  3O6B B;  4FX0 A;  4EQQ A;  4PJ0 C;  2FQ4 A;  1FYM A;  4IF4 A;  3EYY A;  2WBM A;  2P0W A;  4II3 A;  2KKO A;  2P81 A;  3TO7 A;  3L2C A;  1ZGA A;  2HS5 A;  4BE0 A;  3K7A J;  4EV0 A;  2A69 F;  2W1O A;  3CCM I;  1HBX G;  3AL0 B;  4LB6 B;  4PGH A;  4RBO A;  1ETK A;  3WTW C;  1R1U A;  1ZGJ A;  3LSH A;  3IAM 2;  3NEU A;  1H89 C;  2I10 A;  2NNY A;  4CIC A;  4LB5 A;  3CUQ A;  2OBP A;  1TT0 A;  4ZZL A;  5JHU A;  3UNG C;  3KZI C;  2F6C A;  2K4B A;  2TCT A;  3OR2 C;  1DPR A;  1LJ9 A;  2ISY A;  4FT8 A;  3ZN1 A;  1BIB A;  3EPZ A;  4CCM A;  2XVC A;  5CKT A;  4R79 A;  2M8G X;  1Z7U A;  4DIQ A;  2COM A;  4DOZ A;  4YFX F;  4CZZ A;  1JE8 A;  2XGD A;  3H5N A;  1GLN A;  3HDD A;  2LF8 A;  3AG3 H;  5BNG A;  4I0A A;  1JXS A;  4HDV A;  3V7R A;  2PX9 A;  1MH3 A;  1XX5 A;  4B48 A;  1UFM A;  3TED A;  3WG9 A;  1N25 A;  3O8G A;  3ASO H;  2VLA A;  1MJB A;  2BXZ A;  4DYQ A;  4L5J A;  2JUC A;  4CCN A;  1RUO A;  4BQN A;  1VQ5 I;  4F92 B;  2CV1 A;  3BJ6 A;  2MFZ A;  4ETS A;  1RRJ A;  3JSO A;  2JZY A;  3R60 A;  3TQN A;  4BJ5 C;  2YX4 A;  3TOA A;  2XIG A;  3VYU B;  3FXL A;  5M5Y J;  5EDN A;  5LEJ A;  1MBJ A;  2EB7 A;  1S29 A;  1WCM J;  1W5T A;  1E0E A;  1LFB A;  3G1L A;  1NG6 A;  3S16 J;  2QEX I;  2QSH X;  4C2U A;  3Q5F A;  2R92 J;  1RR8 C;  2CUZ A;  3CC7 I;  4B43 A;  3J7A Y;  5K5Q A;  3MKL A;  1MD0 A;  1TW2 A;  1YW7 A;  2QQ9 A;  2H94 A;  5EF6 A;  4KN4 X;  1UHM A; 
#chains in the Genus database with same CATH homology
 1NHA A;  4EJT A;  1LEB A;  3WTY C;  2OQG A;  3MQ0 A;  3LST A;  1G3Y A;  4WK8 F;  4HF0 A;  2QWW A;  4P55 A;  3KP3 A;  2XAS A;  4IXA A;  3RDI A;  3WTV C;  1OMI A;  3V7S A;  4E70 A;  3LA2 A;  1UST A;  4KNY A;  3ECO A;  3I59 B;  2V79 A;  4A6E A;  4WXC A;  2O0Y A;  1O7F A;  2LNB A;  5HLH A;  2M30 A;  3I0T A;  2MLK A;  2GA1 A;  4LLG F;  1O3S A;  2PQ8 A;  4L5I A;  1Z9C A;  3LA3 A;  2DK8 A;  4Q47 A;  5K5R A;  1XGN A;  4G6Q A;  1CGP A;  4CHU A;  4AIK A;  1XMK A;  1H0M A;  4RAY A;  2RN7 A;  5IT3 A;  5D6F A;  4IJA A;  5D8L B;  3D5L A;  4N0B A;  1W7P B;  3LAP A;  2G9W A;  1D8K A;  1SMY F;  4ESJ A;  4IRH A;  2FE3 A;  5L3F A;  3L00 A;  4RB2 C;  1ZRF A;  3DQV C;  4RGS A;  5L3C A;  2RDP A;  1IXS B;  5D5X B;  4M9Z A;  2IA1 A;  1FWZ A;  4KDP A;  4HYE A;  1G6N A;  4G9Y A;  2MD5 A;  2Q8K A;  2JT1 A;  5IT9 K;  3KP4 A;  2K7L A;  1KGS A;  3IRQ A;  5F64 A;  1HXD A;  1TNS A;  2CQK A;  4LG0 A;  3VFZ A;  4HDU A;  1IN5 A;  3J81 K;  5BS6 A;  1PP7 U;  4U7B A;  3F8B A;  2P4W A;  2PMU A;  1QQI A;  5TRD A;  1G3S A;  2EFN A;  3SHF A;  5AON A;  2L02 A;  3DV8 A;  1SAX A;  4HLY A;  1AOY A;  1TQM A;  2VBY A;  4ZYH A;  3MZY A;  4HF2 A;  2RKH A;  1ZLK A;  3KP7 A;  2FXA A;  1R5H A;  2W57 A;  4NB5 A;  3GFL A;  1BI3 A;  2BEO A;  2DBB A;  2OA4 A;  4S05 A;  3ROU A;  4PDK A;  3CLO A;  2DFI A;  3KP2 A;  3V7C A;  1U2W A;  4YIF A;  1XD7 A;  3HYI A;  1E2X A;  3IWF A;  1GXP A;  4P9F A;  2VBW A;  1B9N A;  1IW7 F;  2NAZ A;  5ILS A;  4KMF A;  4BNC A;  3KCC A;  3WGG A;  2Z5U A;  3BRO A;  2E1N A;  2CYY A;  1QGP A;  1FSH A;  3HIF A;  2VBZ A;  4JK1 X;  5K5O A;  4LLN A;  3QPT A;  1YTY A;  1ZRD A;  5FLX K;  4CO8 A;  5E1X A;  2HKO A;  4B8X A;  4A5N A;  4XLP F;  4OU0 A;  3GWZ A;  1YW8 A;  4MQV A;  1LDD A;  2Z9O A;  3KET A;  4EM2 A;  3DF8 A;  4UXN A;  3DEU A;  5LEK A;  2BBY A;  1MJ9 A;  2DPD A;  3K2Z A;  5DCM A;  2FU4 A;  3T5X A;  4AD9 A;  1HQC A;  1SMT A;  4LGW A;  4CXF A;  5DUK A;  2M8E A;  2K4J A;  2PLY A;  1R5G A;  5HS8 A;  4MHG A;  1O3Q A;  1IXC A;  1DUX C;  2B0L A;  2LF7 A;  3BJA A;  3CUQ C;  3BPX A;  4L9V A;  4P9U A;  4MGR A;  3E5Q A;  1U78 A;  1ZRC A;  3MZH A;  4I2O A;  1ZG3 A;  3F6V A;  2UXN A;  4BYY A;  1XN7 A;  4EVI A;  3ULQ B;  1YIO A;  3TOB A;  3VOE A;  5LHH A;  4G6D A;  1HKT A;  2O8X A;  2VT3 A;  3IKV A;  3P9K A;  3ZMT A;  3O2P E;  5D4R A;  5E8G A;  1B59 A;  1I27 A;  4OIO F;  2LSO A;  4U0Y A;  5LGN A;  5BMZ A;  4OMY A;  2BGC A;  2VOP A;  4LG0 B;  1ON2 A;  2IVM A;  2FF4 A;  2ZJ2 A;  4P96 A;  3HRM A;  2Y75 A;  4KIG A;  1HW2 A;  2OAZ A;  5CYV A;  4RB3 C;  1LEA A;  1XSV A;  4PGG A;  4ENJ A;  1YQA A;  1XSX A;  4HOB A;  2IT0 A;  1T2K A;  3U2R A;  2L3D A;  2YX7 A;  2BYV E;  1FNN A;  3BOQ A;  4MEX F;  1U5T C;  2OD5 A;  4L18 B;  5LRR A;  4EJO A;  1REP C;  1FYL A;  5L3D A;  1KQ9 A;  3F23 A;  3SQN A;  3O3K A;  4JQF A;  4RGR A;  3IRR A;  2QYO A;  2VC0 A;  1FC3 A;  4RB0 A;  1WKM A;  2HGC A;  3E6D A;  2A61 A;  4BH9 A;  4U0V A;  2OZ6 A;  3BDD A;  2IJL A;  1IXR C;  4EGZ A;  5CVR A;  5DDG A;  5IT9 Z;  3F6O A;  3HRT A;  2W85 A;  5LLQ A;  1HSJ A;  2J5O A;  3DFG A;  5HLI A;  2EA2 A;  3WTZ A;  5FFX A;  1MKM A;  2W84 A;  1OPC A;  3C7J A;  1FZP B;  3Q9V A;  2MBF A;  2FML A;  3ZMV A;  2YPR A;  4HW0 A;  4XLN F;  1J9I A;  4WXH A;  2RV8 A;  2Q2E A;  1J75 A;  5AIQ A;  3M9A A;  2P8T A;  5ICC A;  1SFX A;  3L09 A;  3JW4 A;  1J59 A;  1CF7 A;  1LNW A;  3FM3 A;  3VEP A;  3FXQ A;  2IA2 A;  2IA0 A;  2CFX A;  2R7F A;  4HAM A;  3REO A;  1MDM A;  2FRH A;  2XHK A;  2H6C A;  5DEQ A;  2QM3 A;  3ZMZ A;  2KIM A;  4EJW A;  1SFU A;  3K69 A;  4L9J A;  4UV9 A;  5FFZ A;  3CTA A;  5TJJ A;  3FXR A;  1Z91 A;  3RJP A;  3FMS A;  2A68 F;  1UCR A;  1BC8 C;  4OIQ F;  5F6F A;  2Z3Y A;  1KQ0 A;  3TO6 A;  1XMA A;  2EV6 A;  1KU3 A;  2P7V B;  3HSE A;  3HUG A;  2H6B A;  4HX4 A;  2DTR A;  2VON A;  3P9I A;  5JR3 A;  4ZZD A;  1RIO H;  1UB9 A;  3ELK A;  2ACJ A;  1T0F A;  1U5T A;  4YFN F;  2VE9 A;  1QPM A;  5FLX Z;  3ZPL A;  3F72 A;  1R58 A;  1V4R A;  1FSE A;  4ZYD A;  4UNO A;  2PMH A;  1MJA A;  5LHI A;  1BC7 C;  3RPQ A;  3QP5 A;  2M1B A;  5D8K B;  4GYI A;  1K78 A;  3HHH A;  2EFQ A;  5E18 F;  3H3Z A;  5CLS A;  4M9X A;  1TLH B;  3DPT A;  2BE5 F;  5D4S A;  2M45 A;  1G3T A;  1XCB A;  4UVC A;  2ZCW A;  5FD6 A;  4LJZ F;  2M5W A;  3JTH A;  2D1V A;  2O03 A;  1FT9 A;  1S7A A;  1P4A A;  5JVT A;  1W4M A;  1WSU A;  4QLC U;  3K1M A;  2D45 A;  1KQ8 A;  3VB2 A;  5EEG A;  4YG2 F;  2XRN A;  4M74 A;  4LLL A;  5ICF A;  1KU9 A;  1ODD A;  4RGX A;  4NHJ A;  4L0Y B;  1YS6 A;  2QBY A;  1RZ4 A;  1K6O A;  1IF1 A;  3V8J A;  1IUY A;  2MC3 A;  4I09 A;  3WE2 A;  4HV6 A;  2K27 A;  4ZH4 F;  4EM1 A;  2FNA A;  2C6Y A;  1ZAR A;  4UUV A;  2X4H A;  2NNN A;  3GEZ A;  3KP5 A;  4M6Y A;  5FD5 A;  2FEZ A;  1HW5 A;  4A0Z A;  5BPI A;  2MH2 A;  1R1T A;  3AAF A;  2FBI A;  2MLG A;  4A0X A;  2MH9 A;  3K0L A;  2STW A;  3IKT A;  3LQR A;  4IVN A;  1CF7 B;  3I64 A;  4G7H F;  1ZN2 A;  1EH7 A;  1KYZ A;  1X3U A;  2IPQ X;  5CVU A;  1IRG A;  3DPL C;  2XKO A;  2L4M A;  2P7C B;  1FYK A;  2PBI A;  2HTS A;  4ZYG A;  2GIV A;  1U6G A;  1E17 A;  5ILV A;  2ZNY A;  1D5V A;  4I02 A;  2H09 A;  2QQA A;  4A6D A;  2XAG A;  3KLN A;  3R61 A;  4CDG A;  4IRG A;  4DQ2 A;  1HW1 A;  2NRA C;  1WRJ A;  3FF5 A;  3QAH A;  3BY6 A;  4CGZ A;  3B02 A;  2UWM A;  1KA8 A;  4UVA A;  1I1G A;  3GUD A;  4HBL A;  1C0W A;  5J8C A;  1EV7 A;  4MEY F;  2CGP A;  5CVJ A;  1PUE E;  3VOD A;  4PZJ A;  3QP6 A;  3CUQ B;  3SXY A;  4BXU A;  1B9M A;  2XAQ A;  3CO6 C;  4GYG A;  1KU2 A;  2QVO A;  3DXJ F;  2ETH A;  1P92 A;  1K78 B;  2FA5 A;  5AIP A;  2XAF A;  3TDU C;  3BJO A;  1FP1 D;  5FGM A;  3M1E A;  4KIC A;  1ZRE A;  1QZZ A;  3FWE A;  4GO1 A;  4CYD A;  3MEX A;  2OU2 A;  1HST A;  2KJB A;  1KU7 A;  1W5S A;  5LRS A;  1SD6 A;  4N9I A;  1O57 A;  3WTT C;  2DAO A;  2DLL A;  4Q48 A;  2QEN A;  4G7O F;  2E7X A;  1LB2 A;  3F8M A;  5LBQ A;  4UVB A;  4BHP A;  3KZZ A;  3N97 A;  3GF2 A;  1U5T B;  4BHC A;  5D6E A;  3SFZ A;  1J0R A;  2HR3 A;  1G3W A;  2AS5 F;  1FPQ A;  2D1H A;  4OIP F;  4I01 A;  3JAM K;  1P4X A;  1BIA A;  2P5V A;  4KUM A;  3HRU A;  1LDK B;  2LKP A;  2HWV A;  3RKX A;  4F7Z A;  4FX4 A;  4Q4Z F;  5BPD A;  3IWZ A;  4OIN F;  1HKQ A;  4BQA A;  3BZ6 A;  4OOI A;  2F5F A;  2A5Y B;  2TDX A;  5DD4 A;  1FBS A;  4ENN A;  1IN4 A;  3RTR A;  1FBU A;  1Z6T A;  5ILU A;  5FO5 A;  4EJU A;  3ZMD A;  1SD5 A;  4ESB A;  2NS0 A;  4EMS A;  1TTY A;  4KYW A;  4P5O A;  5KK1 A;  1Z05 A;  2EWN A;  3E97 A;  4M72 A;  3CO7 C;  2CO5 A;  4IRI A;  3V8K A;  1FBQ A;  2A07 F;  3C18 A;  2RGV A;  3ABT A;  3WU0 A;  3F21 A;  1SD4 A;  1F4K A;  2XGX A;  4ENK A;  1HKS A;  3MCZ A;  3I53 A;  4GCV A;  1J7K A;  4M9S A;  5E8I A;  2IP2 A;  1P2F A;  2HTJ A;  3WTS C;  5E17 F;  2OQR A;  2ZNZ A;  1T39 A;  5CVV A;  2VOD A;  3ZMU A;  3KFW X;  4LFU A;  2JSC A;  4AWX B;  1IN7 A;  1TQI A;  5HDK A;  2ZBK A;  4U88 A;  5DV5 A;  3B73 A;  4KMU X;  2KIU A;  3T1B A;  2EA4 A;  1ZLJ A;  1I5Z A;  2W24 A;  2GXB A;  5H6Q A;  4LK1 F;  1XCV A;  2JPB A;  3RYP A;  2R7D A;  5KVR A;  3TO9 A;  4A12 A;  2WWY A;  2HQR A;  3NRV A;  4WXD A;  2ZME A;  4L9T A;  2EFP A;  3E6C C;  2CG4 A;  2YR2 A;  5D5U B;  1FLI A;  3HTU A;  3EET A;  1TQP A;  3W6J B;  2WC2 A;  1ONV A;  5L3E A;  3HOT A;  1R36 A;  3ISP A;  3N4M A;  3LAJ A;  1BI0 A;  5JI6 A;  2A6H F;  4OIR F;  2HZT A;  2K02 A;  4WCG A;  4G7Z F;  4D0P A;  3TGN A;  2ADU A;  3I5U A;  3HHG A;  3E6B A;  3FM5 A;  1SFE A;  1D3Y A;  1I6X A;  2VXZ A;  3CUO A;  2HYF A;  1FX7 A;  1OYW A;  2QUF A;  2BV6 A;  4BAY A;  1FOK A;  2GWR A;  3BWG A;  4IHS A;  1EH8 A;  1O3R A;  2RC4 A;  3T8R A;  3FMQ A;  5DCM B;  3FXU A;  3GFI A;  3EDP A;  4AIH A;  5J8F A;  1XDU A;  3EYI A;  4KN7 X;  2NYX A;  1B6A A;  3M7G A;  3LQQ A;  4HX7 A;  2KIF A;  4XBF A;  2EFO A;  1STZ A;  4O6J A;  2EFW A;  3JAM Z;  5ERI A;  2DI3 A;  5L3B A;  1BN5 A;  3CJN A;  1ZAO A;  2F2E A;  4Y17 A;  1YW9 A;  4M6X A;  3HOS A;  1QZY A;  2XAJ A;  3IHU A;  3GW2 A;  4ESF A;  2M87 A;  3KLO A;  3WTU C;  3COA C;  3E3V A;  3RPU A;  4I98 B;  1IN6 A;  1WQ2 A;  3WOD F;  1W7P A;  3D0S A;  3SZT A;  2UXX A;  5H20 A;  1IZ1 A;  5BQT A;  4XSZ F;  2F5E A;  1S7O A;  5FB2 A;  2YU3 A;  2X0L A;  4GGG A;  5K1Y A;  2MA3 A;  2RQP A;  3DKW A;  3GXO A;  1S8N A;  3E5U A;  3KP6 A;  1RNL A;  3IL2 A;  2Z33 A;  2IW5 A;  3F8C A;  3WGH A;  2GA2 A;  2ZME B;  5ED4 A;  1ZG5 A;  3HSR A;  2DU9 A;  4S04 A;  5HLG A;  1JHF A;  1D8J A;  4O3M A;  1S6L A;  2XKP A;  3R6S A;  4HA8 A;  4A2U A;  5E1W A;  2ZXJ A;  1F9N A;  2P5L C;  4A0Y A;  2V1D A;  2XUB A;  4G8X A;  3ML6 A;  5D5W B;  4OMZ A;  2DT5 A;  2RNJ A;  2HKX A;  5HS9 A;  2G7U A;  3WGI A;  2XV4 S;  2PEX A;  2HDC A;  2CSO A;  4KA4 A;  1U8R A;  1DP7 P;  1JGS A;  6PAX A;  1OYI A;  3FMR A;  3U1D A;  3BPV A;  1BI1 A;  1L0O C;  4KT5 C;  1DPU A;  5LGT A;  2DK5 A;  4NQW A;  4DNC A;  3EQL F;  1ZHF A;  2JPC A;  2PI0 A;  5HOO A;  3V4G A;  1JHH A;  5J6X A;  3R0J A;  4N9H A;  3HTS B;  2HYG D;  4ZYE A;  3F8N A;  2XAH A;  1OYY A;  5DUI A;  4YII A;  3DP7 A;  3HRS A;  4HQM A;  4HQE A;  3JTG A;  1BI2 A;  1XGS A;  3QPH A;  1ON1 A;  1MDM B;  2EK5 A;  3G3Z A;  3TKY A;  4Q5S F;  3L7W A;  5ICG A;  1A04 A;  1O3T A;  3RYR A;  2Y0M A;  2K86 A;  4HLX A;  3KEO A;  2AXL A;  2RVC A;  2ISZ A;  4L9N A;  1YFH A;  1BOA A;  1T38 A;  2ZKZ A;  3IC7 A;  3J80 K;  1S3J A;  2VBX A;  2DPU A;  2QZ8 A;  3WU1 B;  1G4D A;  3H3U A;  4WF2 A;  4PCQ A;  3WTX C;  4XSX F;  2FQ3 A;  3FZV A;  5DCF A;  1QO0 D;  3CDH A;  5EEH A;  4H0E A;  3M8E A;  3RKY A;  2GQQ A;  2FOK A;  2A6E F;  4GXO A;  4R8H A;  2H27 A;  2E1C A;  3F22 A;  2L01 A;  3GO5 A;  1OR7 A;  2FNP A;  5E20 A;  2O3F A;  5DYM A;  3GX4 X;  2PG4 A;  3MFK A;  1J5Y A;  3GFM A;  3KZY A;  2VN2 A;  4HZF A;  2QLZ A;  4EJV A;  2ZO4 A;  3PQK A;  3GZ6 A;  5HS7 A;  5A2Q K;  4Y13 A;  1Z1D A;  1MZB A;  1K7A A;  4ENM A;  1SD7 A;  1V3F A;  2LDU A;  2VT2 A;  1XDS A;  5JFR A;  1ZH5 A;  1O7L A;  2P6T A;  3KEQ A;  3C3W A;  1GVJ A;  4HX8 A;  1F1Z A;  3TDZ C;  1PP8 F;  1VTN C;  2V1U A;  3ABU A;  2KRF A;  1R00 A;  4RGU A;  1H9G A;  4LD5 A;  2QBY B;  2ZFW A;  2DQL A;  4WWC A;  3GFJ A;  3KE2 A;  3S2W A;  1LQ1 A;  1Z6R A;  3U9G A;  4IPA A;  4KIF A;  4K2E A;  1GHC A;  3RKW A;  3F3X A;  2P5K A;  1BBY A;  1EH6 A;  3MWM A;  5CJ9 A;  2EJR A;  2HEO A;  2G7H A;  4UHT A;  3I58 A;  2PFB A;  1YO5 C;  1WI9 A;  2JRT A;  2O61 A;  1PDN C;  1UHW A;  3P9C A;  2F5C A;  3QRF F;  2GAU A;  4RAZ A;  3OV8 A;  4I0B A;  1OKR A;  1DDN A;  1LVA A;  2HOE A;  2R3S A;  4MNU A;  4A5M A;  1H9T A;  3JSP A;  3K9T A;  3RI4 A;  1XB4 A;  2A3S A;  1YS7 A;  5ICE A;  4YFK F;  3L9F A;  1XGO A;  3HSF A;  4IHT A;  4MTD A;  2DW4 A;  2L54 A;  2D2W A;  1IRF A;  2W25 A;  1R23 A;  4FHT A;  5BOX A;  1U3E M;  3G73 A;  2EV5 A;  4I7H A;  2VC1 A;  5CVI A;  2GXG A;  5F1R A;  4RB1 A;  4AIJ A;  4ON0 A;  4U0W A;  3R4K A;  2Q0O A;  4TV7 A;  1B4A A;  2Z99 A;  3LFK A;  2CW0 F;  3GLX A;  2YSR A;  3QU3 A;  3QU6 A;  3WE3 A;  4XRF A;  3P7N A;  2WV0 A;  1XSD A;  1R1V A;  4Z2Y A;  3PQJ A;  2ELH A;  1I1S A;  3ZP5 A;  2V6C A;  2FBH A;  4JBA A;  1IN8 A;  2FMY A;  3H92 A;  1AWC A;  4MQ9 F;  4G94 A;  2QQB A;  3BP8 A;  1Y0U A;  3LWF A;  1BM9 A;  3T8T A;  4AVP A;  3GYH X;  1P4W A;  3F8F A;  5LHG A;  2V9V A;  1YYV A;  4L0Z B;  3J80 Z;  1TNT A;  4MTE A;  3I4P A;  2UZK A;  1YLF A;  1R22 A;  4BHB A;  4EM0 B;  2HFH A;  3ZQ7 A;  1TBX A;  4U7D A;  3GVA A;  2HQN A;  1R7J A;  2V1X A;  2E7W A;  2FBK A;  2O6G E;  3QOP A;  1XGM A;  2P6S A;  2J5P A;  5HVQ C;  4M73 A;  2ESN A;  3E6M A;  1IAW A;  3ZN0 A;  4ASN A;  3R0A A;  5D5V B;  1L3L A;  3PFI A;  2FSW A;  5E1Z B;  2GZW A;  4Y15 A;  3NQO A;  1T6S A;  4EGY A;  3ERE D;  5A2Q Z;  1FY7 A;  3ECH A;  2JTV A;  1QBJ A;  2L4A A;  1LDJ A;  4O5V A;  1F5T A;  1Q1H A;  4LMY A;  3I54 A;  3OOP A;  1USS A;  3ZMS A;  2PJP A;  2STT A;  4LK0 F;  1GXQ A;  3E5X A;  3J81 Z;  1T98 A;  1ZYR F;  2KJC A;  3W6K B;  4HF1 A;  2CWE A;  5LGU A;  2DQR A;  3RIR A;  5H6R A;  3K1P A;  2WTE A;  2PN6 A;  1KYW A;  5HDN A;  3EUH A;  2XRO A;  3J7A O;  3I59 A;  1RI7 A;  2DO7 A;  2OZU A;  1FP2 A;  3FX3 A;  1P6R A;  3K1N A;  3GZ5 A;  1MGT A;  1BJA A;  2ESH A;  1TW3 A;  1ZG1 A;  3FHZ A;  3T0Y A;  1WWX A;  4KFC A;  1J2X A;  3Q9S A;  1W7P D;  4WX9 A;  2IRF G;  4R1H A;  4UV8 A;  5L3G A;  1ULY A;  5HDG A;  2VOO A;  1K79 A;  3SZP A;  4M71 A;  2Y48 A;  5DD8 A;  1RUN A;  4RS8 A;  1B1B A;  4HV5 A;  1QNT A;  4B09 A;  3I71 A;  3MAJ A;  3M8F A;  2VE8 A;  4KIB A;  1YG2 A;  2EV0 A;  3V8L A;  3LA7 A;  4QWQ A;  2F5D A;  3C1D A;  3O6B B;  4FX0 A;  4EQQ A;  1FYM A;  4IF4 A;  3EYY A;  2KKO A;  3L2C A;  3TO7 A;  1ZGA A;  2HS5 A;  4EV0 A;  2A69 F;  1HBX G;  4LB6 B;  4PGH A;  3WTW C;  1R1U A;  1ZGJ A;  3NEU A;  2NNY A;  4CIC A;  4LB5 A;  3CUQ A;  2OBP A;  4ZZL A;  5JHU A;  2K4B A;  1DPR A;  1LJ9 A;  2ISY A;  3ZN1 A;  4FT8 A;  1BIB A;  2XVC A;  4R79 A;  1Z7U A;  2COM A;  1JE8 A;  4YFX F;  4CZZ A;  2LF8 A;  4I0A A;  1JXS A;  4HDV A;  3V7R A;  1UFM A;  3WG9 A;  1MJB A;  4L5J A;  1RUO A;  3BJ6 A;  4ETS A;  3JSO A;  2JZY A;  3R60 A;  3TQN A;  2YX4 A;  3TOA A;  2XIG A;  5LEJ A;  2EB7 A;  1S29 A;  1W5T A;  3Q5F A;  5K5Q A;  1MD0 A;  1TW2 A;  1YW7 A;  2QQ9 A;  2H94 A;  4KN4 X;  1UHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...