2K4BA

Copr repressor structure
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
FNVSNAELIVMRVIWSLGEARVDEIYAQIPQELEWSLATVKTLLGRLVKKEMLSTEKEGRKFVYRPLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title The copper-responsive repressor CopR of Lactococcus lactis is a 'winged helix' protein.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Dna binding protein
total genus 16
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k4bA00
2ZCWA 4LK1F 2AXLA 1ONVA 4YFXF 3TKYA 2VE8A 3T5XA 2RDPA 4RB1A 2OZUA 4IHSA 1XGOA 3F72A 3F8NA 1FX7A 3I64A 2ISZA 3HSEA 5LRRA 1ODDA 3IWZA 2HQRA 5ILUA 2Q8KA 3J7AO 4HOBA 5LHGA 2F5FA 3BJ6A 1RI7A 1R1TA 2PMUA 4HLYA 4EGZA 1K79A 4LG0B 2IW5A 3ZP5A 1GHCA 1F9NA 1LDJA 1TTYA 3V8JA 4CO8A 1RZ4A 1K78B 2MBFA 3EETA 1CF7A 3MFKA 3QRFF 2FNPA 2ZNZA 3QAHA 3MCZA 2DI3A 3GUDA 3CJNA 1KU2A 2K7LA 1ZAOA 2JPBA 5FLXK 1DP7P 2KJBA 1IZ1A 1O57A 3I0TA 1MD0A 1O3QA 2TDXA 4Y15A 4M6XA 1FPQA 2CFXA 4KT5C 1BI2A 1G3YA 2RV8A 5D6EA 3DPLC 2O0YA 5FFZA 1F4KA 3L2CA 2A69F 1QPMA 4AIKA 2VBYA 3G73A 3ML6A 4Q4ZF 4I01A 4I98B 2XV4S 2M30A 1G4DA 4YFNF 2Y75A 1CF7B 1FNNA 1ZHFA 4KMUX 2P4WA 2HS5A 4MQ9F 1HKTA 1XGSA 3RDIA 2VONA 3LFKA 2W85A 5E8GA 3GFMA 4P9FA 2V1DA 5D5VB 3WGIA 1D8JA 2HWVA 2XKPA 5JI6A 3BDDA 1I27A 2D2WA 5H20A 4IPAA 5HLHA 1IXSB 2HZTA 3I53A 1XD7A 4GO1A 1O7LA 4OIQF 3QP6A 1FOKA 5LLQA 2PJPA 5F6FA 5CVIA 5ICGA 1K7AA 1XSDA 1JE8A 4A0ZA 2E7WA 4L0ZB 2EA2A 1DDNA 3IHUA 4PGGA 3JSOA 2OZ6A 4OINF 4GCVA 1HKQA 2LF7A 3SZTA 1IRGA 3KZYA 5LGUA 3JAMK 1ZGJA 2MLGA 3ZMDA 1OPCA 4A12A 1TNTA 2M45A 5L3GA 2VBWA 3RTRA 1HXDA 5DCMA 4TV7A 2STWA 2IA0A 1ZRDA 4BHBA 2IRFG 2BYVE 2JZYA 1B9NA 4O3MA 4IRHA 3FMRA 5A2QZ 1KA8A 3EYIA 2HKOA 4UHTA 4L9NA 1LDDA 2FOKA 4HV5A 1R5GA 2IA1A 2LDUA 3MZHA 4L0YB 3GVAA 5J8FA 2LF8A 1HQCA 5FO5A 1YYVA 3BROA 1LDKB 4KA4A 3V7SA 4Y17A 3R60A 2QWWA 3KP3A 3C1DA 1I6XA 3L09A 4UVAA 1T6SA 1W7PD 4G7HF 2Z3YA 1YS7A 4Q47A 2A3SA 2K02A 4UV9A 3E6DA 3GLXA 1Z7UA 2HQNA 4L5IA 4HQEA 1HW5A 1IN4A 2XROA 2DFIA 1IN5A 4M6YA 2ISYA 5DCMB 2EFQA 4LGWA 3KZZA 4LJZF 2D1HA 4A0YA 1TQIA 2P5VA 1Q1HA 3HSFA 2EK5A 1B4AA 2OD5A 3P9KA 3H92A 5BQTA 3HUGA 3FWEA 5HLGA 1S3JA 2BGCA 4PZJA 1W5TA 1YIOA 2W84A 5E1WA 3E6MA 3WTWC 2ZXJA 2PLYA 1USTA 4HF0A 2GA1A 5IT9K 3B73A 5BOXA 4RAZA 1FWZA 3M8FA 5HS8A 2DU9A 1ZH5A 1ZREA 4U88A 4UNOA 4U7DA 3RKYA 2QZ8A 3SHFA 3BP8A 3IKTA 2A68F 4RB3C 4OMZA 3RI4A 2HYFA 1H9GA 2E1CA 4CXFA 2GA2A 3KLOA 4G8XA 4LB6B 4XBFA 3ZQ7A 2GXBA 4EVIA 3LQQA 4NHJA 3JTGA 2ETHA 3O6BB 3U1DA 1J5YA 4G7ZF 5LHIA 5EEGA 1JHHA 3HRSA 5F64A 3R61A 3G3ZA 4HF1A 3SXYA 2Z33A 5E18F 2BV6A 3N97A 2L54A 2V9VA 2B0LA 3CTAA 1Z6TA 1ZRFA 1XN7A 1YW9A 1BI1A 5J8CA 4MEXF 4I7HA 3E6BA 2K27A 2OQRA 4EM1A 4CZZA 2ZBKA 3BPVA 2YSRA 2M87A 5E1XA 5D4RA 2W25A 4HW0A 1HW1A 4A2UA 2XAGA 5K5RA 3GXOA 3COAC 1IN8A 4WF2A 3GFLA 1KQ8A 4ZZDA 2O3FA 3E5XA 1EH6A 4M9SA 2A61A 5L3BA 3EYYA 1JXSA 3ULQB 3ZPLA 3GZ5A 3H3ZA 3WE3A 3FF5A 2VOPA 4AD9A 1XB4A 3I54A 3GZ6A 1U5TC 4RGSA 3EQLF 3CDHA 5LGTA 3BY6A 2PN6A 2KIUA 5D8LB 1PP8F 1FP2A 3K2ZA 3D5LA 1ZG3A 1YG2A 3CUQA 4M9ZA 3K1MA 2QM3A 2DBBA 3HIFA 1XGNA 5K5QA 2JTVA 4L18B 4MNUA 3D0SA 1ZG1A 3DFGA 3F21A 5HDGA 1HBXG 4HDVA 3Q9SA 4OOIA 4NB5A 1FT9A 5J6XA 3K0LA 4IXAA 4U0WA 3V7RA 2UWMA 5CVVA 2YX4A 3LSTA 1E2XA 1TQPA 2IJLA 1XCBA 1T38A 3M1EA 3RIRA 2CGPA 1P92A 2YX7A 4D0PA 1ULYA 4BYYA 4HX8A 3CUQC 3HOTA 2LKPA 2RNJA 1RNLA 1P4AA 1OMIA 1RUNA 2XASA 2P6TA 3CUQB 3DP7A 1SFUA 2M1BA 3T8RA 2QLZA 4KDPA 1LQ1A 1FBQA 1UHMA 1RUOA 1QNTA 2A6HF 4WXDA 4A5MA 4ZH4F 1T0FA 1B9MA 4JQFA 1FBSA 4XRFA 2IA2A 3BJOA 2P6SA 2VT2A 6PAXA 3DQVC 2GQQA 3M9AA 3BWGA 1MZBA 5FGMA 1J9IA 3P9CA 5A2QK 4G9YA 5HOOA 1REPC 2IT0A 2VN2A 5DDGA 4UXNA 2EFOA 1FLIA 1OYYA 1B1BA 2ZNYA 4DNCA 2IP2A 2M5WA 2F5CA 4JBAA 4YFKF 3HTSB 3E6CC 5FB2A 1J0RA 3ISPA 1SMYF 2X4HA 2HOEA 4LB5A 3J80Z 5KVRA 2OBPA 2NRAC 1T2KA 1BM9A 2R3SA 2OA4A 4EM0B 4KIBA 4OIRF 2HTJA 1OR7A 2JT1A 3F8MA 2HR3A 4GXOA 1YS6A 1KQ0A 3L9FA 3KEQA 4Q5SF 4GYIA 2PI0A 1J7KA 2EV5A 1XMAA 3KEOA 3ROUA 2JPCA 5TJJA 1LEAA 2YR2A 3LA3A 1VTNC 4LFUA 2K4JA 1KQ9A 5D5XB 4UVCA 1O3SA 1BI0A 1YO5C 3WTVC 3J81Z 5HLIA 3PFIA 4I09A 1J2XA 4Y13A 3JSPA 5FD6A 1KGSA 2H6BA 4EJOA 2XRNA 3KP2A 5H6QA 1SFXA 4EMSA 2HDCA 2J5PA 1AOYA 3KCCA 1HKSA 3NQOA 2QQ9A 1S8NA 4EQQA 4P96A 4WX9A 1DUXC 1FP1D 4WK8F 3VB2A 2ZO4A 1FZPB 5EEHA 4HF2A 5HS7A 2FNAA 3WU0A 4LMYA 5DUIA 1QO0D 4N9HA 2L3DA 5JR3A 1FBUA 1J75A 5LRSA 1P2FA 2IVMA 2Q0OA 3I58A 1R7JA 2XAQA 3FXRA 4HA8A 1XSXA 3F6VA 2D1VA 2K4BA 1TNSA 2H27A 2XKOA 4CDGA 1G6NA 1W5SA 2GWRA 1TBXA 1BN5A 1XSVA 2H09A 4PGHA 1KU3A 1O7FA 2D45A 1R5HA 5DUKA 2X0LA 2Y0MA 5L3CA 2OU2A 1XGMA 3O3KA 3GFIA 3F8CA 4BH9A 3V8KA 2UXNA 1STZA 4IVNA 2FBKA 3ZMUA 2GIVA 4XSXF 1ON2A 3V7CA 4KIGA 3SZPA 1ZG5A 2G9WA 2NYXA 4EM2A 4UV8A 2JSCA 2HTSA 5IT3A 5TRDA 5JFRA 4LLNA 2J5OA 1R36A 5ILVA 3RYRA 1R00A 3CLOA 1ZLKA 3REOA 2PFBA 3SFZA 4MQVA 5CJ9A 3GFJA 5HVQC 3HTUA 1YQAA 3CO6C 2KRFA 2ESNA 3M7GA 1KU7A 2E1NA 1DPUA 3HSRA 2V1UA 2QUFA 2MH9A 1P6RA 2EFPA 4KMFA 2PEXA 3C7JA 2QENA 5D6FA 4BAYA 1XDSA 2DK5A 4EGYA 5E1ZB 4ESJA 2EJRA 3MWMA 4MHGA 3EUHA 3GX4X 1S6LA 2Z9OA 1S29A 2MLKA 1V3FA 2F5EA 2C6YA 2F2EA 4IRGA 5D8KB 3HHHA 2VC0A 4MGRA 3F23A 3IL2A 2G7UA 2P7VB 2OQGA 2XVCA 1EV7A 3ERED 3FM3A 4N9IA 2XUBA 2L02A 4A6DA 1BI3A 1UHWA 3R4KA 1U8RA 1I1GA 2ZMEA 3HOSA 3WTZA 4G6DA 1X3UA 1G3TA 1WI9A 4EJVA 4QLCU 3TO9A 3NRVA 1I5ZA 3W6KB 3R0JA 3E5QA 1SD4A 1LEBA 4WWCA 1BC7C 4HYEA 4BHPA 3WTTC 3KP7A 1TLHB 2RKHA 2WTEA 4I0AA 3B02A 2XAFA 1FSEA 4RGXA 1PDNC 2VODA 3QU3A 2FU4A 4O6JA 4R1HA 3DXJF 1OYWA 3PQKA 3HRMA 2ZFWA 1WQ2A 1R58A 3R0AA 2MA3A 5K5OA 2DTRA 1R1VA 4H0EA 1SMTA 4HDUA 3K1NA 1NHAA 2NNNA 5DCFA 3MAJA 2JRTA 1KYZA 2V6CA 3HRUA 2CSOA 2KJCA 1P4XA 2ZMEB 3RPQA 1T98A 4BXUA 3FMSA 3FHZA 2L01A 1U6GA 3PQJA 3FXQA 1FY7A 3KLNA 2FMLA 3ZMZA 5LEJA 3CUOA 4NQWA 5F1RA 1JGSA 5HDNA 4P55A 1FSHA 3GF2A 1J59A 3J80K 1D8KA 3WODF 3EDPA 2EV0A 1AWCA 1MJAA 4HBLA 5E8IA 5KK1A 3WG9A 3BPXA 4E70A 5CLSA 4HZFA 1PP7U 1YLFA 4I02A 5ERIA 3H3UA 5HS9A 4IRIA 4G7OF 1YW8A 2MH2A 5AIPA 3F6OA 2DAOA 1UCRA 4U0YA 2QYOA 1FYKA 5BS6A 2Y48A 4OMYA 3TQNA 4K2EA 3KP6A 2ADUA 4LD5A 5JVTA 4EJTA 4PCQA 3Q9VA 3J81K 2DW4A 2VBZA 3MZYA 2A07F 4CICA 4RGUA 3RKWA 4FT8A 3T1BA 2P5KA 4U0VA 2GZWA 4CHUA 2LSOA 1R1UA 3E5UA 3GEZA 3WGHA 2YPRA 3I5UA 4ON0A 5DEQA 4O5VA 2P8TA 4ENMA 3QP5A 1MDMA 3OV8A 5LHHA 2DPUA 4HQMA 4ZZLA 2VE9A 4FX4A 3W6JB 3DPTA 4CYDA 3F3XA 4ESBA 5ICFA 3BOQA 3TOBA 2FF4A 4UVBA 1GVJA 5ICCA 1CGPA 3K1PA 2XGXA 1XMKA 4G94A 4RB2C 4RS8A 2HGCA 1SD7A 1TW2A 4M72A 2PQ8A 1BBYA 3KP5A 5AONA 1HW2A 1UB9A 4Q48A 2VOOA 2ELHA 3F8FA 1R22A 2QQAA 2MC3A 2DT5A 2L4AA 3HHGA 2FMYA 4IHTA 3MQ0A 3ZMVA 3BJAA 2W57A 1MDMB 2XIGA 2F5DA 2DLLA 2ESHA 4BHCA 3P7NA 3K9TA 2G7HA 2HEOA 3VEPA 3DV8A 1LB2A 2WC2A 2FEZA 3QOPA 2CO5A 1WWXA 1D5VA 3V8LA 5CVRA 3QPHA 5AIQA 3IRQA 2EB7A 1G3SA 3N4MA 1HSJA 3WTUC 4BQAA 5LGNA 1EH7A 2CQKA 4ESFA 4MTEA 4R79A 4RAYA 1R23A 4ZYGA 3RPUA 2EA4A 2YU3A 3M8EA 5ILSA 1ZGAA 4R8HA 1YTYA 1IF1A 3I4PA 3JW4A 4P9UA 4L9VA 1IW7F 1P4WA 4IJAA 1EH8A 2DK8A 2IPQX 3ABUA 1ZN2A 2R7FA 4ENJA 5CVUA 1QBJA 4KIFA 1MGTA 2HKXA 2K86A 1L3LA 4ENNA 4ENKA 2QVOA 4XSZF 2BE5F 2EV6A 3C18A 1XCVA 1HSTA 4KFCA 2KIMA 2FBHA 2RN7A 2VXZA 2E7XA 2FXAA 1Y0UA 2CG4A 1TW3A 2ZJ2A 2O61A 3DEUA 5ICEA 3GW2A 2COMA 2FE3A 3LAPA 2WV0A 3VODA 3FX3A 3ELKA 4XLPF 4GYGA 2H6CA 2RGVA 2PBIA 5FFXA 3C3WA 1MJBA 4FX0A 1Z05A 3WU1B 1ZYRF 5HDKA 3WTXC 4YG2F 1YW7A 3ZN1A 4HAMA 1XDUA 3GO5A 1BC8C 4FHTA 1IXCA 1BIAA 3WTYC 3TO7A 5DD8A 2QBYA 5E17F 3LQRA 3TO6A 3SQNA 4Z2YA 2BEOA 2P7CB 4F7ZA 2FQ3A 4RGRA 1GXQA 5D5UB 3GWZA 4KUMA 1BOAA 4KICA 4AIHA 1QGPA 3WE2A 4LLGF 3ECHA 5L3EA 2HFHA 2BBYA 1O3TA 2PG4A 3WTSC 2W24A 4ZYEA 1ON1A 2NNYA 3QPTA 2FSWA 5CYVA 5JHUA 1D3YA 1Z6RA 2DO7A 3FXUA 1U2WA 3E97A 2FBIA 4OIOF 4ASNA 1C0WA 1IN6A 5DD4A 4YIIA 4UUVA 1IN7A 3LAJA 2QBYB 2R7DA 4M9XA 4WXCA 3MEXA 4RB0A 5LEKA 4U7BA 1IUYA 1QZYA 3Q5FA 3K69A 4MEYF 1SAXA 2LNBA 2VT3A 3KE2A 4HX7A 2NAZA 3QU6A 4EJUA 4S05A 2RVCA 3KFWX 2DPDA 1QQIA 4B8XA 4G6QA 1A04A 2CWEA 4P5OA 1SFEA 2M8EA 3FM5A 3L00A 4AVPA 4XLNF 2RC4A 1SD5A 3TOAA 3AAFA 2WWYA 2ZKZA 1LJ9A 1L0OC 3HRTA 1FC3A 4HV6A 1GXPA 4BNCA 5L3FA 3RYPA 4KN4X 3U9GA 4DQ2A 3IRRA 2HYGD 1H0MA 5BPIA 3FZVA 5FLXZ 4JK1X 5BPDA 3LWFA 4L5JA 1WRJA 4M73A 1IXRC 2UXXA 2GAUA 1WKMA 3LA2A 1W7PA 5DYMA 4A0XA 2UZKA 1ZRCA 2MD5A 3NEUA 4EV0A 4M71A 3S2WA 1KU9A 2XAHA 5ED4A 1I1SA 3RKXA 4B09A 1FYLA 2EFNA 1ZARA 3P9IA 4OU0A 4WCGA 4PDKA 1LVAA 3L7WA 2A5YB 4KYWA 1U78A 2DQLA 1USSA 1S7AA 4KN7X 4N0BA 5FD5A 2A6EF 4WXHA 2OAZA 3ZMSA 4A5NA 3I59A 1JHFA 2EWNA 2CW0F 4AIJA 4L9TA 2QQBA 1Z9CA 1W7PB 3TDUC 4HX4A 1BJAA 1SD6A 1LNWA 4CGZA 1KYWA 3F8BA 2AS5F 3VFZA 1MJ9A 4KNYA 2PMHA 1Z91A 3JAMZ 2RQPA 3DKWA 4M74A 1U5TA 5DV5A 3WGGA 4GGGA 1TQMA 1O3RA 1DPRA 1W4MA 4HLXA 3E3VA 5D5WB 5E20A 4QWQA 1BIBA 4I0BA 1V4RA 3IC7A 1T39A 5D4SA 5LBQA 4I2OA 3FMQA 3T0YA 2KIFA 5K1YA 2Q2EA 1QZZA 3I59B 3DF8A 4LLLA 2VC1A 3O2PE 2STTA 3ZMTA 2DQRA 2H94A 2XHKA 2Z5UA 5H6RA 1IRFA 1Z1DA 2GXGA 3TDZC 4AWXB 2P5LC 1S7OA 5L3DA 1B6AA 2O6GE 3ECOA 2XAJA 3F22A 1IAWA 3LA7A 1B59A 2O03A 3T8TA 4S04A 1U5TB 3KP4A 1PUEE 2KKOA 2O8XA 1F1ZA 3IWFA 2L4MA 3I71A 4YIFA 1ZLJA 2V79A 3VOEA 5BMZA 2EFWA 4LK0F 1OYIA 2ACJA 4A6EA 3V4GA 2V1XA 1G3WA 1FYMA 4L9JA 1K6OA 1H9TA 1E17A 1YFHA 5IT9Z 2VBXA 4ZYDA 4MTDA 2CYYA 3JTHA 1RIOH 2Z99A 2FRHA 3ZN0A 3R6SA 3U2RA 1OKRA 4EJWA 2FA5A 3KETA 4IF4A 3TGNA 1WSUA 3BZ6A 1MKMA 5CVJA 3IKVA 1F5TA 3OOPA 1UFMA 3CO7C 4ETSA 3HYIA 4ZYHA 3ABTA 1U3EM 4LG0A 3GYHX 2NS0A 3RJPA 4OIPF 1K78A
chains in the Genus database with same CATH superfamily
3I9V2 2X6YA 3TW7A 2ZCWA 4LK1F 2NVQJ 2AXLA 1ONVA 2LOOA 4YFXF 3TKYA 2DYRH 2QSFX 2VE8A 3T5XA 1KONA 4ABZA 2RDPA 4RB1A 2OZUA 4D7NA 4DOZA 4IHSA 1XGOA 5EYRA 3F72A 3F8NA 2VQCA 4RDUA 5M5YJ 2PMZA 3BG3A 3E7LA 2E2HJ 2WAQN 3FHNA 1FX7A 3I64A 2CW7A 1HDDC 1MBJA 2ISZA 2CV0A 3HSEA 5LRRA 2EILH 2KISA 2WY8Q 4HNTA 1ODDA 3DBRB 1LUJB 4BXFA 4C3HJ 1BW6A 3IWZA 2HQRA 4M6VA 5ILUA 1Y1VJ 2Q8KA 1YJWI 3BG7A 3J7AO 3CC7I 4HOBA 1W36C 5LHGA 2F5FA 2QQ8A 2DA1A 3BJ6A 1RI7A 1X1DA 1K4TA 2GM4A 1KZHA 3OSGA 1R1TA 2PMUA 3N05A 2CH0A 1NH3A 2B63J 3S8PA 9ANTA 1OCOH 4HLYA 4FISA 4QIWN 5DS9A 2M8GX 3OYDA 4EGZA 1TL8A 1K79A 4LG0B 2E5ZA 4E7SA 2IW5A 3FISA 2DOEA 2XGCA 2R7RA 3ZP5A 3C2BA 1GHCA 1F9NA 1MMAA 1QZEA 4N4NB 4BE1A 1LDJA 1TTYA 3V8JA 2O7OA 4CO8A 5B1AH 3BG6A 1RZ4A 2JA8J 1K78B 2MBFA 3EETA 1CF7A 3CMMA 3EUKL 5EGOA 3MFKA 3QRFF 2IBDA 2FNPA 2IEKA 2ZNZA 1VQNI 2JA5J 3QAHA 3MCZA 1R9TJ 4C9YA 5FKOA 2DI3A 3GUDA 3CJNA 1KU2A 2GOXB 3LSHA 4BUPA 3I55I 2R5YA 2RNGA 1U8BA 2K7LA 1ZAOA 2EIKH 2JPBA 1JT6A 5FLXK 4DIQA 1DP7P 2KJBA 1IZ1A 3SYTA 4MLOA 1O57A 3I0TA 1MD0A 1GV2A 2HQ5A 2Y0SN 4F3QA 1O3QA 2VQHA 1ERDA 2TDXA 4BE0A 4Y15A 3LOCA 4M6XA 1FPQA 2CFXA 4KT5C 4AU7A 1BI2A 4XKCA 1LFUP 4BL0B 3L2RA 1G3YA 2RV8A 5D6EA 3DPLC 3DU6A 3K4LA 2O0YA 5FFZA 1MMDA 1F4KA 3L2CA 2X1CA 1N75A 2A69F 1QPMA 2LK2A 4AIKA 3GTLJ 1JKQC 4M3DA 2VBYA 3ZQHA 2LLKA 3G73A 5IY5H 2W82A 3ML6A 4Q4ZF 2LY1A 4I01A 4I98B 5IYCJ 2XV4S 3RKQA 2MYSA 2M30A 1Y56A 3MKZA 1G4DA 4X0GA 4XKWA 1WI3A 4YFNF 2Y75A 1CF7B 1FNNA 5EGOB 1ZHFA 1GV5A 3NWSA 4KMUX 2DJIA 2P4WA 3GTOJ 4F52A 2HS5A 4MQ9F 3AKZA 1T8IA 1HKTA 1XGSA 3G71I 1RPWA 4JX4A 2K5CA 3RDIA 2V4JC 2VONA 2R5YB 3LFKA 2W85A 5E8GA 1YRNB 3GFMA 3JRIA 4P9FA 2V1DA 5FKLA 5D5VB 3WGIA 1D8JA 2HWVA 2XKPA 5JI6A 3UR3C 2HOAA 3BDDA 1I27A 2D2WA 4XLAA 5H20A 2EZHA 4IPAA 3H1CA 1WH5A 5KNLA 5TISC 5HLHA 1IXSB 2HZTA 3K70D 4A3GJ 3I53A 1XD7A 4GO1A 4XM3A 2DA3A 1O7LA 4OIQF 3QP6A 1FOKA 4YEJA 5LLQA 2PJPA 5EZHA 1TT0A 5F6FA 5CVIA 5ICGA 1X3ZB 1D0XA 1K7AA 5EEAA 1XSDA 4M3EA 2DMQA 1JE8A 4A0ZA 1PYVA 5GP9A 4BU2A 2VKVA 2E7WA 4L0ZB 2EA2A 1DDNA 3IHUA 4PGGA 3D1NI 2ZJPF 1IDYA 1Q1VA 1V5GA 1FMVA 3JSOA 3DKYA 3ZQCA 1OCTC 3ZCOA 2OZ6A 4OINF 4Y33A 2XGEA 1LVKA 4GCVA 1HKQA 3P5JA 2LF7A 2DN0A 1X4OA 3SZTA 1IRGA 3KZYA 2A05A 5LGUA 3JAMK 1U9NA 1ZGJA 2MLGA 2VXDA 3OOUA 4IQJA 4X1EA 2MW8A 3ZMDA 1OPCA 4A12A 1TNTA 3PO2J 2M45A 5L3GA 2VBWA 2NVYJ 3RTRA 5EG0A 3VYRB 1SVLA 1HXDA 5DCMA 4TV7A 1TWGJ 2ECBA 2V9PA 2F5VA 2STWA 2IA0A 1ZRDA 4BHBA 2IRFG 2YU9J 2E5NA 2BYVE 2JZYA 1B9NA 4D1QA 2BXYA 4O3MA 4IRHA 3FMRA 1Y39A 2L9NA 1BJZA 2VKEA 2M4KA 2E19A 5A2QZ 1KA8A 3OL4A 3EYIA 4XL9A 2HKOA 1W1WE 4UHTA 4L9NA 4MO7A 1LDDA 2FOKA 4HV5A 1U0JA 3JRGA 3MKWB 1R5GA 3DTIA 2IA1A 2LDUA 3V42A 3MZHA 4L0YB 3GVAA 1DU0A 5J8FA 5J1RA 2VKHA 2LF8A 1HQCA 4EEFG 5FO5A 1FJLA 3E1SA 1YYVA 2W00A 2DT7B 1LDKB 3BROA 4KA4A 3V7SA 4Y17A 3R60A 3BTJA 2QWWA 3KP3A 2VJJA 3C1DA 4ZC3A 1I6XA 4A3DJ 2MD0A 5IOYA 3L09A 4UVAA 1T6SA 1W7PD 4HNVA 4G7HF 2KHMA 2Z3YA 2DFFA 1YS7A 2O5RA 1X4PA 3OMYA 4Q47A 1K6YA 1K78A 2A3SA 2K02A 2JN6A 4XOTA 4UV9A 3E6DA 2KP6A 3GLXA 4FCYA 1Z7UA 2HQNA 4L5IA 2X85A 3S3MA 3HJEA 4HQEA 1HW5A 1IN4A 5DTDA 4A3BJ 2XROA 5EG0B 2K9SA 2DFIA 1IN5A 1X58A 4M6YA 1BR4A 4CCMA 2ISYA 5DCMB 2EFQA 5CQEA 3Q3SA 2V9KA 3KZZA 4LGWA 4XMYA 3PNVA 3CJRB 4LJZF 2D1HA 4RM2A 4A0YA 1TQIA 3IH3A 2P5VA 1Q1HA 4NC7A 2KFDA 5EJCA 1TWHJ 4AVZA 2F6CA 3HSFA 2EK5A 1B4AA 3HOYJ 2OD5A 3P9KA 3ABMH 3H92A 3LSKA 5BQTA 2IS1A 3HUGA 1X1PA 1S9HA 3FWEA 1JUSA 3AL0B 5HLGA 2XRLA 1S3JA 2BGCA 4PZJA 1W5TA 1YIOA 5FKNA 5J3LA 4BDZA 2W84A 5E1WA 3E6MA 3WTWC 3LMMA 2E71A 2ZXJA 2PLYA 1USTA 4HF0A 2GA1A 4V2FA 3B73A 5FKKA 2LBFA 4RAZA 5BOXA 5IT9K 1FWZA 3M8FA 1FOXA 5HS8A 1X1CA 1V55H 2DU9A 1ZH5A 3FKJA 3ZXSA 1MNEA 2JA6J 4NC8A 4JYKA 1ZREA 1WCMJ 4BY1J 2CJJA 1TWAJ 4U88A 2CQNA 3OYHA 2CUEA 4UNOA 2E1OA 2E60A 4U7DA 2Y30A 3RKYA 2QZ8A 1ZR2A 3SHFA 3BP8A 3IKTA 4RMNA 2KZGA 2A68F 4BEHA 4RB3C 4OMZA 4IOCF 4CCKA 3VYUB 3RI4A 2HYFA 1H9GA 1W0UA 4L5EA 2E1CA 4CXFA 2GA2A 3KLOA 4G8XA 4LB6B 4XBFA 4ANJA 3MKYB 3ZQ7A 2GXBA 1HC8A 4EVIA 2CRGA 2K9LA 3LQQA 4NHJA 5M3MJ 3M07A 3HKZN 3JTGA 2ETHA 2VIXA 3O6BB 3U1DA 3OY9A 1YX3A 2K9NA 4BQQA 1J5YA 4XORA 2R7WA 5F0HA 1UZCA 1W0TA 3HUGB 3CCJI 4CSWA 1XMXA 2XPWA 4G7ZF 5LHIA 5FJ8J 5EEGA 1JHHA 2Y31A 3HRSA 2IS2A 3WHBA 1IO2A 4JX6A 5F64A 3R61A 3G3ZA 3K4KA 4HF1A 2HXIA 2LBFB 2ZSIB 3SXYA 2Z33A 4A3JJ 2ZB9A 2ICWG 3OS0A 5E18F 2BV6A 3QWLA 1R4NB 1VQ7I 3J7ZI 3CCEI 3N97A 3RCOA 1ETXA 3H36A 2L54A 2V9VA 3CCVI 2B0LA 3CTAA 1BR2A 3PO3J 1IUFA 1Z6TA 4U87A 1VQ6I 3CDIA 2OCEA 3I56I 1XN7A 1ZRFA 1YW9A 2BY1A 2JVGA 2UUZA 1BI1A 5J8CA 4MEXF 4BEHB 3S2DJ 2BW3A 2MG4A 2HXOA 5C4JJ 4GDFA 3HL2A 4I7HA 1MBEA 3E6BA 2K27A 2OQRA 1WJCA 4EM1A 4CZZA 2ZBKA 3BPVA 2VQLA 2YSRA 2CMPA 2M87A 5E1XA 2DOFA 5D4RA 1VF9A 3J7YJ 2M4GA 1NG7A 2W25A 2FQ4A 3BTLA 4HW0A 1HW1A 3A0HC 2AHQA 4A2UA 4YIRX 2WA0A 1ETVA 2HVSA 2XAGA 5K5RA 3GXOA 2NVUB 3COAC 5F08A 4G12A 1IN8A 4WF2A 4FETA 2KRCA 2KIQA 4BY7J 2DODA 5FKMA 4Y4RA 3GFLA 1KQ8A 4ZZDA 2O3FA 3E5XA 2R7UA 1EH6A 2ID3A 2JVHA 2W4SA 1H8AC 4M9SA 2A61A 1IDZA 2A6TA 2K85A 5L3BA 3EYYA 1JXSA 4MFEA 3ULQB 3ZPLA 2R7VA 3GZ5A 3H3ZA 2B7EA 1S72I 1QU3A 3WE3A 3FF5A 4C3JJ 2VOPA 2GOMA 3S32A 3OYNA 3HM5A 3H9JA 4C30A 4AD9A 3DPUA 4D5FA 1XB4A 3I54A 4PK4A 3GZ6A 3DTEA 3A03A 1U5TC 4RGSA 3K4NA 4DYQA 3EQLF 5E3OA 3CDHA 5LGTA 3BY6A 2PN6A 1NK3P 3CF2A 5IYDJ 2KIUA 5D8LB 2BW3B 3A1YA 1PP8F 3DKXA 1FP2A 2DYSH 1MNMC 3QYFA 2L7FP 3K2ZA 3S2HJ 1RKTA 1ZG3A 3D5LA 1YG2A 4C2TA 5E3NA 2XF7A 3CUQA 4M9ZA 3NAUA 3K1MA 2QM3A 2DBBA 2CQXA 3HIFA 1XGNA 5K5QA 2JTVA 3HG9A 4ZTFA 4L18B 4MNUA 3D0SA 2NVXJ 2W48A 1ZG1A 3SJMA 5CPRB 3DFGA 1F36A 4B4CA 3L2QA 3F21A 5HDGA 3TP0A 3OIPA 1HBXG 4M3BA 4HDVA 3Q9SA 4OOIA 4NB5A 1FT9A 5J6XA 3K0LA 4IXAA 4U0WA 2P0WA 3V7RA 2UWMA 3LSGA 5CVVA 2DA7A 1VQLI 4DGWB 2YX4A 3G1LA 3LSTA 2HZDA 3LSMA 1DGRM 1VZ0A 1E2XA 3G2BA 4AYBN 3TL4X 5GTIC 1WPKA 1ORKA 1TQPA 2IJLA 2OTJI 5FRNA 1WHUA 2DA2A 4XLCA 5E3MA 1XCBA 1T38A 1J09A 2HQAA 3S16J 3M1EA 5IP7J 3RIRA 2CGPA 1P92A 3OR1C 2YX7A 1R71A 1FOWA 2EZLA 4D0PA 1ULYA 3HOZJ 1BW5A 3A02A 1FTZA 1OLTA 2EH3A 3MD2A 1MBHA 1OFCX 4BYYA 1A6QA 3CUQC 4HX8A 4AUXA 3HOTA 2LKPA 2RNJA 3OIQA 1RNLA 3W3CA 1P4AA 3B6AA 1OMIA 1RUNA 2FOWA 4F91B 2XASA 3CZ6A 2P6TA 3CUQB 4C2UA 5F0CA 1JUMA 3DP7A 1SFUA 2M0MA 2M1BA 3T8RA 3QQAA 2QLZA 4KDPA 1PUFA 3OS1A 3H5AA 3OYEA 1LQ1A 1FBQA 3LL7A 1UHMA 2IGOA 1APLC 1RUOA 1TC3C 1QNTA 2A6HF 3CMEI 2OUMA 3KZIC 1JKOC 3HZJA 4WXDA 4A5MA 4ZH4F 1T0FA 1B9MA 4JQFA 1FBSA 3RSNA 1HA8A 1IRZA 4IHYA 3HOUJ 3FBIB 4XRFA 3ESWB 2FUG2 1O4XA 4OAYA 2IA2A 2CS3A 4XK4A 3S14J 3BJOA 2P6SA 1ETKA 2VT2A 3BQYA 2LD5A 2Y0SA 6PAXA 3DQVC 4I76A 2GQQA 3M9AA 4UUTA 2QCOA 4B3XA 3BWGA 1MZBA 5FGMA 1IV6A 2FD5A 2GIZA 1J9IA 2NOJB 1R49A 3BZCA 3K6GA 3P9CA 2EIJH 4G9YA 5HOOA 1OQYA 5A2QK 1REPC 2IT0A 2VN2A 3CESA 5DDGA 4UXNA 2L7MP 4RM3A 2EFOA 3UNGC 1FLIA 4XN0A 1OYYA 3AG1H 2JUGA 1B1BA 2YS9A 2ZNYA 4DNCA 3Q0WA 2IP2A 2EINH 3BC8A 2M5WA 3IH2A 3H3VK 2F5CA 4JBAA 4YFKF 3HTSB 3E6CC 5FB2A 1J0RA 3ISPA 2XC7A 1K61A 1SMYF 3M1CA 2X4HA 2HOEA 1MMGA 5E79C 2R0QC 1B8IA 4LB5A 3J80Z 3HDDA 5KVRA 5EZGA 2OBPA 3BG5A 2NRAC 4IOAF 3SDGA 4XRMA 1WJBA 2LTPA 1BM9A 1T2KA 1T0FC 2R3SA 1PUFB 3FBNB 2OA4A 4EM0B 5DM7F 4KIBA 5C4XJ 2XF6A 4OIRF 2HTJA 4DZJA 2CU7A 4FE7A 1ITYA 3ASNH 3BQZA 1OR7A 2HNHA 3PNTA 1WJEA 2G0EA 4ZYAA 2QEXI 2A5WA 2JT1A 1Y1WJ 1W5CC 3PFYA 3F8MA 1JKRC 4IHWA 2KDOA 1ENHA 3HB9A 2HR3A 4GXOA 1YS6A 1KQ0A 4CZCA 2X9DA 3KEQA 3L9FA 1BOBA 4Q5SF 4GYIA 2PI0A 1J7KA 2ME0A 2BY3A 2EV5A 1LFBA 1XMAA 2F4IA 2N8GA 3KEOA 2TRTA 1YRNA 1IGNA 3ROUA 5J1UA 2JPCA 4BJ6C 5TJJA 1XC5A 4ZDLA 1LEAA 2YR2A 3LA3A 1VTNC 5M5WJ 4KITB 3S3OA 4LFUA 3MMYB 2DCEA 1MMNA 2LG4A 2VJ5A 2R7QA 2KPMA 1CQTA 2K4JA 2MGQA 3G1MA 1KQ9A 5D5XB 3A2KA 2QF7A 3JRBA 4UVCA 1O3SA 1BI0A 1YO5C 2JUCA 3ABKH 1POGA 3WTVC 3J81Z 1Z0XA 5HLIA 1B8IB 1I3AA 2AO9A 2DMNA 3PFIA 2W1OA 2K40A 1OR7C 4I09A 2X51A 1J2XA 1ETOA 2ZFUA 4Y13A 3JSPA 5FD6A 1Y6IA 1KGSA 4PJLA 3W2WA 2H6BA 2PMZN 5M5XJ 4EJOA 2CW8A 4LIVA 2XRNA 3KP2A 3SDBA 3D5SC 5H6QA 1SFXA 4EMSA 3NARA 1MIJA 2HDCA 4BJ5C 2AQFA 1Z3XA 2J5PA 1LE8A 4CYCA 4DJAA 4V19K 1AOYA 3KCCA 1HKSA 3NQOA 4HPQA 3QOEA 4NDLA 2QQ9A 1S8NA 1DU6A 4EQQA 3M4OJ 2H8WA 4P96A 4WX9A 1DUXC 1EKEA 1FP1D 4WK8F 3VB2A 4GFBA 2ZO4A 1FZPB 2HPIA 2OCCH 5EEHA 3CMAI 5HS7A 4HF2A 2FNAA 3PIOF 3D5RC 4IQ4A 3WU0A 3A0BC 3K4MA 3H0GJ 4LMYA 5DUIA 4PJMA 1QO0D 4OAZA 4N9HA 2V6EA 2L3DA 5JR3A 1WJFA 1FBUA 2DA5A 5LRSA 1J75A 1P2FA 2VKDA 3S17J 3VSLA 3GTGJ 2IVMA 1D5YA 3HXLA 2Q0OA 3I58A 1R7JA 2XAQA 3FXRA 5C3EJ 2WB1A 4HA8A 1PJRA 1XSXA 3F6VA 3B6CA 2D1VA 1JJ8C 2K4BA 2VJIA 3IH4A 4CUGA 1TNSA 4A3KJ 4XR6A 3OYMA 2H27A 1U9OA 2XKOA 4CDGA 4HEA2 1G6NA 4BGDA 1W5SA 5GAHJ 2GWRA 1TBXA 1BN5A 3S15J 1XSVA 5B66C 1YX5A 2Y9YA 2H09A 2LY2A 3GMEA 4PGHA 1KU3A 4UY8I 1O7FA 4DW6A 2JMWA 2D45A 1R5HA 3BR1A 4CYCB 1LE8B 4J19A 4IO9F 3PL8A 5DUKA 2X0LA 2XSJC 2Y0MA 4KJZA 3TEDA 5L3CA 2K9MA 2M7BA 2OU2A 1XGMA 3O3KA 2E35A 4UB8C 5IOZA 3GFIA 5HNHA 3F8CA 4D7MA 1QHGA 4BH9A 3V8KA 2UXNA 1TT5B 1STZA 1XTAA 2FBKA 3NWTA 4IVNA 3ZMUA 3KEYA 2RQQA 3G1OA 2GIVA 4XSXF 1MH4A 1ON2A 3V7CA 3Q0VA 4KIGA 4BS9A 3SZPA 1JJ6C 1ZG5A 4EATA 2G9WA 2NYXA 4MIMA 3WU2C 4UV8A 2JSCA 4EM2A 3L2WA 3BR5A 2HTSA 4XN3A 5IT3A 4FASD 5TRDA 3DTKA 5J1YA 5JFRA 4LLNA 2NVTJ 2J5OA 4PJ0C 1R36A 5ILVA 3BR6A 3K4JA 3RYRA 1R00A 2BY0A 3CLOA 1ZLKA 1T33A 4XRSA 3LSPA 3REOA 2PFBA 3SFZA 4MQVA 5FLMJ 3RZOJ 1JKPC 4G6TB 5CJ9A 3GFJA 5HVQC 3GBGA 3HTUA 1G2HA 1YQAA 3CO6C 1GDTA 2KRFA 2ESNA 2UV1A 3M7GA 1KU7A 2E1NA 1DPUA 3KYCB 3HSRA 4IX7A 2V1UA 2QUFA 1ACIA 3H5NA 2FX0A 2MH9A 1P6RA 4A93J 2EFPA 4KMFA 2PEXA 3C7JA 2QENA 1VQ4I 5F1JA 3HKZA 5D6FA 4BAYA 1XDSA 3KYLA 2DK5A 4EGYA 4ZJZA 5E1ZB 4ESJA 2EJRA 3MWMA 4MHGA 3EUHA 3GX4X 1VQ9I 1S6LA 3AL0C 1HCRA 2Z9OA 4XQFA 4XKBA 1K83J 4B47A 1S29A 3IUOA 2MLKA 2VPLA 2TCTA 2F5EA 1V3FA 1NTCA 4RA2A 1JTXA 2C6YA 3CJQB 4M3FA 3BLYA 2KZVA 2F2EA 4IRGA 5D8KB 3HHHA 2VC0A 4MGRA 3TMOA 3F23A 3IL2A 4HNUA 1YJNI 2G7UA 2P7VB 2OQGA 2XVCA 3HOWJ 4RBOA 1EV7A 2EZIA 3ERED 3C2HA 2DMUA 3FM3A 4XLFA 4N9IA 4Y52J 2XUBA 2L02A 4A6DA 1X2NA 3CCLI 1BI3A 1UHWA 3R4KA 1U8RA 1I1GA 2ZMEA 4CCLA 1RETA 2XB0X 3WTZA 3JRCA 4JP0A 3BTCA 3HOSA 4G6DA 3OL3A 1FMWA 1X3UA 1YE9A 2XSDC 1G3TA 4UB6C 2XAUA 4BACA 1WI9A 4XRSG 4EJVA 4QLCU 3C2GA 3TO9A 3NRVA 1I5ZA 2DFEA 3W6KB 3R0JA 3E5QA 3EUHC 1SD4A 1OCRH 3GZNB 4DBRA 3CD6I 1LEBA 1TWCJ 3O8HA 2ZXIA 3OYJA 4WWCA 3KX2A 3IP4B 1BC7C 4HYEA 3ZQIA 4BHPA 1XX5A 3WTTC 1LPQA 4I6ZA 3ERMA 3KP7A 1TLHB 2RKHA 2WTEA 4W97A 3VWBA 4I0AA 3B02A 2XAFA 2JK3A 3JRHA 1FSEA 3BTIA 4XLHA 1A6IA 5IP9J 2BVLA 4RGXA 1PDNC 3EPZA 4IZZA 5GAEJ 2VODA 1X2MA 3QU3A 2FU4A 4O6JA 4QSHA 3ZQGA 3CP8A 4R1HA 3DXJF 2F4MB 1OYWA 3PQKA 3HRMA 2ZFWA 1WQ2A 1K4SA 2BY2A 2E34A 1R58A 3R0AA 4BJTA 2MA3A 5K5OA 2DTRA 3ZQLA 4S0HB 1R1VA 1I50J 4H0EA 1N25A 2RAEA 4FQGA 2VASA 2ZMEC 5IP6A 3OSFA 1XS9A 1SMTA 2BOLA 4HDUA 1OCCH 2VI6A 2CUJA 3K1NA 2MC4A 2FJ1A 1NHAA 2NNNA 5DCFA 3MAJA 2JRTA 1SVOA 2QSHX 1KYZA 3AFHA 2LRDA 2V6CA 3HRUA 2CSOA 2KJCA 1P4XA 2ZMEB 4N4OB 3RPQA 1T98A 3FXJA 4BXUA 3CCSI 1VQ8I 3GTKJ 3FMSA 3FHZA 3OYGA 2L01A 2R7ZJ 1SC7A 1U6GA 5CQGA 3CC2I 3JRDA 3O8GA 1QHHD 3PQJA 3FXQA 1FY7A 3KLNA 2FMLA 4OWRB 4A3MJ 3ZMZA 1FIAA 1MBGA 3CUOA 5LEJA 3HPGA 3OR2C 4NQWA 2L5QA 1OJLA 1UELB 5F1RA 1JGSA 5LFAA 5HDNA 4P55A 2VJ4A 4CCNA 1FSHA 3GF2A 2R5ZA 1J59A 3J80K 5H2FC 1D8KA 4A3LJ 2ELKA 1M1EB 2DMPA 1YJ9I 4H4KC 3WODF 3EDPA 2EV0A 3OWTA 2KMUA 1Z7LA 1BL0A 2E2IJ 2JA7J 1Y0NA 1AWCA 1X1AA 1MJAA 4HBLA 4BBSJ 5E8IA 5KK1A 3WG9A 3BPXA 4E70A 5CLSA 4HZFA 5J4VA 3PSIA 4AYBA 3BR2A 1PP7U 3HPHA 5GADJ 1YLFA 3CP2A 4I02A 2VL8A 1FTTA 3FXOA 5ERIA 3I3LA 3H3UA 5HS9A 4IRIA 1E0EA 4G7OF 3JR9A 1YW8A 2CQQA 1UHSA 2MH2A 3DCFA 2GLOA 5AIPA 3F6OA 1NG6A 2DAOA 1UCRA 2DT6A 1D1AA 3S1MJ 3MKLA 3HC7A 4U0YA 2QYOA 4LG3A 3GTQJ 3VDXA 1FYKA 5BS6A 2EQRA 3FK6A 2Y48A 4OMYA 2VPRA 3M3YJ 3CMYA 4DZPA 1BR1A 3TQNA 4K2EA 3FDYA 3PUFA 2OPTA 3KP6A 2ADUA 4LD5A 5JVTA 5LD2C 2HU9A 4EJTA 3CJTB 4PCQA 3Q9VA 4NQWB 3J81K 3FIWA 3GLLA 2DW4A 3G6EI 2R5ZB 5DM6F 2VBZA 4KISA 3MZYA 2A07F 1LKXA 2JJ7A 4RGUA 4XOPA 3RKWA 4CICA 2DMTA 4FT8A 3T1BA 1ZELA 4CCJA 2MABA 2P5KA 3KPHA 4U0VA 3GTPJ 1IV8A 2QGUA 4XIDA 1S5LC 1E3PA 1JUPA 2GZWA 4CHUA 4ITVA 2LSOA 5F27A 4BDYA 1I6HJ 1WJAA 1R1UA 2KL4A 3E5UA 3GEZA 5C44J 3WGHA 2DXIA 2YPRA 3I5UA 4I99C 2JSPA 4ON0A 5DEQA 4O5VA 2NOGA 2P8TA 3G4SI 4HRIA 4ENMA 2WAQA 3MN2A 4II3A 3QP5A 1MDMA 3OV8A 3UKGA 3JCUC 5LHHA 2DPUA 3LSJA 3FKIJ 4HQMA 4ZZLA 2WADA 5K7FA 2VE9A 4FX4A 2HVQA 4C2MJ 3W6JB 2L2OA 2OV7A 3DPTA 2NS8A 4CYDA 3F3XA 4ESBA 4J01A 5ICFA 3BOQA 2XPVA 4DYCA 4B1RA 3TOBA 2FF4A 4UVBA 1GVJA 5ICCA 1CGPA 2H8RA 1Z67A 3OYAA 3K1PA 4LIUA 1F43A 3WHCA 2XGXA 1XMKA 4D5CA 4G94A 4RB2C 4RS8A 2ZSHB 2HGCA 1SD7A 1TW2A 4M72A 1ZGWA 3CC4I 2WAEA 3RQIA 1TZLA 1WJ5A 4HSRA 3DEWA 2PQ8A 3GTJJ 1BBYA 3KP5A 5AONA 1HW2A 4FTHA 1VQ5I 3TP3A 1UB9A 1SFOJ 4Q48A 1ZR4A 2VOOA 2ELHA 3F8FA 2KDZA 1R22A 1A36A 2QQAA 2MC3A 2DT5A 2L4AA 1DQUA 3HHGA 1MH3A 2MFZA 1AKHA 1RESA 2FMYA 2LKSA 3MQ0A 3ZMVA 1VFCA 1YI2I 4IHTA 3L2VA 1WH7A 3BJAA 2W57A 1MDMB 3S1NJ 2XIGA 2F5DA 1R4MB 2DLLA 2ESHA 4V2GA 4BHCA 2BVMA 3P7NA 3K9TA 2G7HA 2HEOA 3VEPA 3DV8A 1LB2A 4A3FJ 1UAAA 1LFPA 4PUSA 3S1RJ 2WC2A 2FEZA 3QOPA 2CO5A 1WWXA 1MBFA 3QODA 2L0KA 1D5VA 3SEZA 5B5EC 2Z2SB 5E3LA 3V8LA 1QPIA 5CVRA 3QPHA 1Z21A 5AIQA 3IRQA 2ZJRF 3QPSA 5JVGF 5M3FJ 3S3NA 2EB7A 2X1EA 1G3SA 3VYSB 3N4MA 1HSJA 2I5UA 3WTUC 2CV1A 4BQAA 5LGNA 1EH7A 2LVSA 4QTRA 2CQKA 5KCMA 2QA4I 3VYTB 2KT0A 1N78A 4ESFA 4II2A 1ETWA 1ETQA 4MTEA 3HBLA 2E2JJ 4R79A 4E6KG 2DTZA 1YOVB 4RAYA 1R23A 4ZYGA 3FK7A 3QYBA 2EA4A 3RPUA 2YU3A 3M8EA 4F93B 4YELA 5KHDA 1ETYA 5ILSA 3S93A 1ZGAA 1T95A 4R8HA 1YTYA 1IF1A 1G59A 5KAIC 3CLQA 3IAS2 4PSXA 2X6XA 3OYFA 2O9LA 2PJRA 1AKHB 3I4PA 4A3EJ 3JW4A 4P9UA 2KRHA 5EDNA 2PX9A 4L9VA 2VUMJ 1IW7F 1QRYA 2WBMA 1P4WA 4IJAA 1EH8A 2Y69H 2DK8A 3GCMA 5KAFC 3X2QH 2V1NA 2IPQX 3ABUA 2Z1DA 1ZN2A 2K3FA 2R7FA 4ENJA 1I3QJ 5CVUA 3IV5A 2JRMA 1QBJA 2DA4A 1MMSA 5F0FA 4KIFA 3OYIA 1MGTA 3U21A 1X1BA 2HKXA 3ZGKA 3A01A 2K86A 5GPCA 1L3LA 1A31A 4ENNA 4ENKA 2WAFA 2QVOA 1WVRA 4XSZF 2BE5F 5B1BH 2EV6A 3C18A 2M0CA 5JHFA 2AXTC 1XCVA 1HSTA 3KIOA 4KFCA 3FXLA 2KIMA 2FBHA 2RN7A 2VXZA 3W2VA 3PSFA 1JT0A 2QSGX 2E7XA 3CCMI 1P9QC 2FXAA 2GXAA 1Y0UA 1OCPA 2VB6A 2L7ZA 2CG4A 3DLLF 2IAIA 1TW3A 2ZJ2A 3OYBA 2O61A 3EUAA 2HDWA 2I10A 4F55A 2K9QA 3DEUA 5ICEA 3GW2A 2COMA 4E4HA 2KLOA 2XB5A 3LFUA 2FE3A 3LAPA 3VPRA 3I4MJ 3OIOA 2HOSA 2IS6A 2HI3A 4E7KA 2WV0A 2ZXHA 3DEEA 4HG2A 2Q1ZB 5K7HA 3VODA 1JGGA 1IRXA 3FX3A 2RREA 2PJRB 3ELKA 4XLPF 3K4CA 4GYGA 2KQRA 2H6CA 2RGVA 3L1PA 4JX5A 3LSIA 1EA3A 1Y8QB 2PBIA 5FFXA 4IEJA 5IYBJ 3C3WA 2XGDA 1MJBA 4IL6C 2EBIA 4FX0A 1Z05A 2IS4A 5BNGA 3WU1B 3ONQA 4Y7NJ 4PJNA 1ZYRF 4XNFA 3A01B 2XF5A 1MBKA 5J47A 5HDKA 2HOTA 2JWTA 4YRVA 3WTXC 4YG2F 1YW7A 3ZN1A 5HODA 4QPOA 4HAMA 2D5VA 1XDUA 2XDVA 3GO5A 1BC8C 2JQ7A 4FHTA 4M3GA 1IXCA 1BIAA 3CQZJ 5B3SH 1MSFC 5FRMA 3WTYC 3TO7A 5DD8A 5EF6A 1B72A 2DOAA 2QBYA 5E17F 4Z6YA 3LQRA 3TO6A 3SQNA 1IC8A 3F9KA 4Z2YA 3WG7H 4BQNA 2BEOA 2P7CB 4F7ZA 2FQ3A 2HDDA 4NBQA 1YIJI 4RGRA 2CUZA 2M34A 5GTHC 1GXQA 3H9QA 4RLFA 1XPXA 5D5UB 1H89C 3GWZA 2NXNB 5JLWA 3FXMA 4KUMA 2WV1A 1WGXA 4BE2A 2R7SA 1BOAA 2ZJQF 4KICA 3BZKA 4AIHA 3JRFA 2L9SA 4XKVA 4A3IJ 1QGPA 3WE2A 2OF7A 2JA2A 4ZDOA 4LLGF 1X3WB 3ECHA 5L3EA 2HFHA 2BBYA 1ZK8A 2K3PA 2PG4A 1O3TA 3WTSC 2W24A 4ZYEA 1ON1A 2NNYA 3QPTA 4CA0A 2FSWA 3ZOBA 1D1BA 5CYVA 5JHUA 2H1KA 2O8KA 1D3YA 1Z6RA 1D1CA 2DO7A 1U2WA 3E97A 2FBIA 3FXUA 4LOCA 1GVDA 4OIOF 1AA7A 4ASNA 4B43A 1C0WA 1IN6A 5DD4A 4YIIA 3ZQFA 1WZ2A 3HGGA 4IKFA 4RLQA 2BHYA 4UUVA 3DWLE 3PIPF 1IN7A 3LAJA 4J00A 3QYEA 1E3HA 1B72B 2QBYB 2ELJA 2R7DA 3K7AJ 4M9XA 3MVPA 4WXCA 3MEXA 4QPQA 2LP0A 1OISA 4RB0A 1SFKA 5LEKA 4U7BA 2R7OA 4PFOA 3JREA 1RR8C 3VSKA 1IUYA 1QZYA 3Q5FA 5TGTA 3K69A 3DBLB 4MEYF 3BT9A 1SAXA 2LNBA 2V26A 4PJJA 3BR0A 4FE4A 2VT3A 1H88C 3KE2A 1V5EA 1TP4A 2E36A 4E7IA 2CQ7A 5IPAA 4KT6A 1HOMA 2L9VA 4HX7A 2NAZA 1SEUA 3QU6A 4EJUA 4S05A 1AHDP 2WB1N 2RVCA 4PSWA 3KFWX 2DPDA 1P7IA 1QQIA 3BG9A 4NNJA 4B8XA 4G6QA 1A04A 2CWEA 4P5OA 2ZXWH 1SFEA 3H5RA 3I4NJ 2M8EA 2R4GA 3FM5A 4B44A 3L00A 4AVPA 4XLNF 2NS7A 2X6OA 2R7TA 4JOMA 2RC4A 1SD5A 3TOAA 5FLVA 3AAFA 3SFIA 4W1UA 1VQOI 2VLAA 4UUSA 2WWYA 1YHQI 2ZC2A 3K70C 2ZKZA 1SANA 2M3AA 3MZ8A 3SEQA 2I8DA 1LJ9A 3CCUI 4D9JA 5CKTA 1L0OC 3H35A 1FC3A 3HRTA 4HV6A 1A5JA 2X48A 1VNDA 1VI0A 1GXPA 2M9HA 4BNCA 3RQ4A 5L3FA 4RAFA 3RYPA 4KN4X 3U9GA 4DQ2A 4DBQA 3IRRA 2HYGD 4C3IJ 1IJWC 1H0MA 5BPIA 3FZVA 3DBHB 4JK1X 1RR7A 3LWFA 5FLXZ 5BPDA 1UG0A 1RC9A 1UJ8A 2BHZA 4L5JA 1WRJA 2AQEA 4RAGA 3TBIA 4M73A 5FROA 4F92B 5HNFA 1IXRC 1YITI 2LYCA 3ABLH 3HGYA 2DA6A 1GT0C 4NUBA 2UXXA 4NC6A 2GAUA 5F04A 1WKMA 3LA2A 1W7PA 5DYMA 2COBA 4A0XA 2IGNA 2UZKA 1ZRCA 4BQOA 1VQKI 1ZKGA 2MD5A 1MW7A 3NEUA 1RKWA 4CCOA 4EV0A 1EF4A 1GUUA 4M71A 3S2WA 1KU9A 2MSYA 2XAHA 3LNQA 5ED4A 1I1SA 3RKXA 4B09A 3J7AY 1FYLA 2IGKA 4Y3OA 4E7ZA 2EFNA 1ZARA 3TW6A 1IG7A 3P9IA 3S1QJ 4OU0A 4WCGA 4PDKA 4UUSB 1LVAA 2M7AA 2X6WA 4MFDA 1FEXA 3L7WA 2A5YB 4XLEA 1HF0A 4KYWA 4BBRJ 1U78A 2DQLA 3DU5A 2OJED 4A69C 2LFBA 1USSA 3W6VA 1S7AA 4KN7X 4N0BA 3F0CA 1DP3A 1DGWY 2WY7Q 3BCBA 3CCYA 5GPAA 2HYJA 5FD5A 1WJDA 2A6EF 2LREA 3BCAA 4WXHA 2OAZA 3ZMSA 4A5NA 3KYDB 3Q0UA 3K2AA 3I59A 1JHFA 2EWNA 2CW0F 4AIJA 3CF5F 4L9TA 1TWFJ 2QQBA 2CFOA 1Z9CA 2V7FA 1W7PB 3TDUC 2W7NA 2F4OB 4HX4A 1BJAA 4E7LA 1T56A 1SD6A 1LNWA 4XICA 5J4YA 1D0ZA 1SVMA 4BKXA 4CGZA 1KYWA 3F8BA 4GRIA 2X1DA 2AS5F 1EJ9A 1N77A 2QKLB 2BXZA 2P81A 3IAM2 3AG3H 4B3AA 3CCQI 4IHVA 4AM3A 3HOVJ 2ID6A 1VQMI 3AG2H 5JLXA 1R5ID 1X19A 3ZR8X 2DDBA 4BXXJ 3VFZA 1MJ9A 4KNYA 4E7HA 5K7ZA 2ECCA 2PMHA 1Z91A 2DFHA 1FOYA 2RQPA 3DKWA 3JAMZ 1ZQ3P 4M74A 1U5TA 2EZKA 5DV5A 2LH9A 3WGGA 4GGGA 1TQMA 2Y2ZA 3PUBA 1O3RA 1DPRA 1W4MA 4HLXA 2Z16A 3E3VA 5D5WB 1NK2P 5E20A 1V5FA 4ZTJA 4QWQA 1BIBA 4I0BA 3CDLA 1V4RA 3IC7A 2H1LA 3U1KA 1D0YA 1T39A 1Y8RB 5D4SA 5LBQA 4I2OA 1A35A 2CUFA 1V54H 3FMQA 3T0YA 2KIFA 5K1YA 2M2EA 2Q2EA 1Z77A 4HSTA 1QZZA 1T08B 3I59B 3DF8A 2CV2A 4LLLA 1JI8A 2LKXA 2VC1A 2HVRA 3O2PE 4X6AJ 3L2UA 1MSEC 2LC2A 1ZTRA 2ME6A 3ZMTA 1GLNA 2DQRA 2H94A 2LY9A 2XHKA 2STTA 2Z5UA 1SAUA 5H6RA 1IRFA 1Z1DA 4ZDPA 2GXGA 1UMQA 2OC6A 1HLVA 1PVEA 3AG4H 3TDZC 2LMDA 1QVTA 4AWXB 2P5LC 2IXSA 3OYKA 1S7OA 4IHXA 5L3DA 1B6AA 1FIPA 2O6GE 3ECOA 3JRAA 2XAJA 3F22A 1IAWA 3ZQQA 3LA7A 1RRJA 3W2AA 5GAGJ 1B59A 2O03A 3T8TA 4S04A 3HEFA 3PJRA 2R7XA 1U5TB 3SZGA 1JTYA 3KP4A 3PNYA 1PUEE 2KKOA 1UG2A 4E7JA 2O8XA 2R92J 1F1ZA 3BR3A 1XG1A 3IWFA 1HDPA 1P7JA 2L4MA 4PFPA 3LSRA 2HPMA 3GTMJ 3ZRGA 3I71A 2R93J 1BA5A 4YIFA 1ZLJA 4XONA 2V79A 3VOEA 1W36D 2F48A 1QVUA 3OYCA 5BMZA 2EFWA 4LK0F 1OYIA 4AC0A 1Z3YA 2Q2EB 2ACJA 2E1MC 4CH7A 1AU7A 4A6EA 1G8XA 2OTLI 3V4GA 2L7KA 2V1XA 3K4BA 2Y9ZA 3PM1A 1G3WA 3E0JB 1FYMA 1OCZH 4L9JA 1K6OA 4LITA 2EIMH 1H9TA 1E17A 1YFHA 5IT9Z 2VBXA 2E1MB 1QA6A 1I39A 4ZYDA 3FXKA 4B48A 2EPFA 2LR8A 4MTDA 2CYYA 3JTHA 1RIOH 2Z99A 2FRHA 3ZN0A 3R6SA 3U2RA 3ASOH 3M8JA 1OKRA 1MNDA 2VQGA 4EJWA 2FA5A 3KETA 4IF4A 2L9RA 2DDAA 2YUSA 1VQPI 3TGNA 2DJNA 2XPUA 3K10A 3H9GA 5HLTA 1WSUA 3BZ6A 1MKMA 5CVJA 3RPUD 1S7EA 5J40A 3OS2A 3OYLA 3IKVA 1E3OC 1R6RA 1F5TA 3DLAA 3OOPA 1UFMA 2QKMB 3CO7C 3CCRI 4AIDA 4P1WA 3HYIA 4ETSA 4ZYHA 3RZDJ 2B9SA 3QPLA 3ABTA 1U3EM 4LG0A 4A3CJ 2IGMA 1WFXA 3H0DA 3GYHX 2NS0A 2GBYA 2BZTA 3RJPA 3HOXJ 4DYRA 4OIPF 3A4CA
chains in the Genus database with same CATH topology
2ZCWA 4LK1F 2AXLA 1ONVA 4YFXF 3TKYA 2VE8A 3T5XA 2RDPA 4RB1A 2OZUA 4IHSA 1XGOA 3F72A 3F8NA 1FX7A 3I64A 2ISZA 3HSEA 5LRRA 1ODDA 3IWZA 2HQRA 5ILUA 2Q8KA 3J7AO 4HOBA 5LHGA 2F5FA 3BJ6A 1RI7A 1R1TA 2PMUA 4HLYA 4EGZA 1K79A 4LG0B 2IW5A 3ZP5A 1GHCA 1F9NA 1LDJA 1TTYA 3V8JA 4CO8A 1RZ4A 1K78B 2MBFA 3EETA 1CF7A 3MFKA 3QRFF 2FNPA 2ZNZA 3QAHA 3MCZA 2DI3A 3GUDA 3CJNA 1KU2A 2K7LA 1ZAOA 2JPBA 5FLXK 1DP7P 2KJBA 1IZ1A 1O57A 3I0TA 1MD0A 1O3QA 2TDXA 4Y15A 4M6XA 1FPQA 2CFXA 4KT5C 1BI2A 1G3YA 2RV8A 5D6EA 3DPLC 2O0YA 5FFZA 1F4KA 3L2CA 2A69F 1QPMA 4AIKA 2VBYA 3G73A 3ML6A 4Q4ZF 4I01A 4I98B 2XV4S 2M30A 1G4DA 4YFNF 2Y75A 1CF7B 1FNNA 1ZHFA 4KMUX 2P4WA 2HS5A 4MQ9F 1HKTA 1XGSA 3RDIA 2VONA 3LFKA 2W85A 5E8GA 3GFMA 4P9FA 2V1DA 5D5VB 3WGIA 1D8JA 2HWVA 2XKPA 5JI6A 3BDDA 1I27A 2D2WA 5H20A 4IPAA 5HLHA 1IXSB 2HZTA 3I53A 1XD7A 4GO1A 1O7LA 4OIQF 3QP6A 1FOKA 5LLQA 2PJPA 5F6FA 5CVIA 5ICGA 1K7AA 1XSDA 1JE8A 4A0ZA 2E7WA 4L0ZB 2EA2A 1DDNA 3IHUA 4PGGA 3JSOA 2OZ6A 4OINF 4GCVA 1HKQA 2LF7A 3SZTA 1IRGA 3KZYA 5LGUA 3JAMK 1ZGJA 2MLGA 3ZMDA 1OPCA 4A12A 1TNTA 2M45A 5L3GA 2VBWA 3RTRA 1HXDA 5DCMA 4TV7A 2STWA 2IA0A 1ZRDA 4BHBA 2IRFG 2BYVE 2JZYA 1B9NA 4O3MA 4IRHA 3FMRA 5A2QZ 1KA8A 3EYIA 2HKOA 4UHTA 4L9NA 1LDDA 2FOKA 4HV5A 1R5GA 2IA1A 2LDUA 3MZHA 4L0YB 3GVAA 5J8FA 2LF8A 1HQCA 5FO5A 1YYVA 3BROA 1LDKB 4KA4A 3V7SA 4Y17A 3R60A 2QWWA 3KP3A 3C1DA 1I6XA 3L09A 4UVAA 1T6SA 1W7PD 4G7HF 2Z3YA 1YS7A 4Q47A 2A3SA 2K02A 4UV9A 3E6DA 3GLXA 1Z7UA 2HQNA 4L5IA 4HQEA 1HW5A 1IN4A 2XROA 2DFIA 1IN5A 4M6YA 2ISYA 5DCMB 2EFQA 4LGWA 3KZZA 4LJZF 2D1HA 4A0YA 1TQIA 2P5VA 1Q1HA 3HSFA 2EK5A 1B4AA 2OD5A 3P9KA 3H92A 5BQTA 3HUGA 3FWEA 5HLGA 1S3JA 2BGCA 4PZJA 1W5TA 1YIOA 2W84A 5E1WA 3E6MA 3WTWC 2ZXJA 2PLYA 1USTA 4HF0A 2GA1A 5IT9K 3B73A 5BOXA 4RAZA 1FWZA 3M8FA 5HS8A 2DU9A 1ZH5A 1ZREA 4U88A 4UNOA 4U7DA 3RKYA 2QZ8A 3SHFA 3BP8A 3IKTA 2A68F 4RB3C 4OMZA 3RI4A 2HYFA 1H9GA 2E1CA 4CXFA 2GA2A 3KLOA 4G8XA 4LB6B 4XBFA 3ZQ7A 2GXBA 4EVIA 3LQQA 4NHJA 3JTGA 2ETHA 3O6BB 3U1DA 1J5YA 4G7ZF 5LHIA 5EEGA 1JHHA 3HRSA 5F64A 3R61A 3G3ZA 4HF1A 3SXYA 2Z33A 5E18F 2BV6A 3N97A 2L54A 2V9VA 2B0LA 3CTAA 1Z6TA 1ZRFA 1XN7A 1YW9A 1BI1A 5J8CA 4MEXF 4I7HA 3E6BA 2K27A 2OQRA 4EM1A 4CZZA 2ZBKA 3BPVA 2YSRA 2M87A 5E1XA 5D4RA 2W25A 4HW0A 1HW1A 4A2UA 2XAGA 5K5RA 3GXOA 3COAC 1IN8A 4WF2A 3GFLA 1KQ8A 4ZZDA 2O3FA 3E5XA 1EH6A 4M9SA 2A61A 5L3BA 3EYYA 1JXSA 3ULQB 3ZPLA 3GZ5A 3H3ZA 3WE3A 3FF5A 2VOPA 4AD9A 1XB4A 3I54A 3GZ6A 1U5TC 4RGSA 3EQLF 3CDHA 5LGTA 3BY6A 2PN6A 2KIUA 5D8LB 1PP8F 1FP2A 3K2ZA 3D5LA 1ZG3A 1YG2A 3CUQA 4M9ZA 3K1MA 2QM3A 2DBBA 3HIFA 1XGNA 5K5QA 2JTVA 4L18B 4MNUA 3D0SA 1ZG1A 3DFGA 3F21A 5HDGA 1HBXG 4HDVA 3Q9SA 4OOIA 4NB5A 1FT9A 5J6XA 3K0LA 4IXAA 4U0WA 3V7RA 2UWMA 5CVVA 2YX4A 3LSTA 1E2XA 1TQPA 2IJLA 1XCBA 1T38A 3M1EA 3RIRA 2CGPA 1P92A 2YX7A 4D0PA 1ULYA 4BYYA 4HX8A 3CUQC 3HOTA 2LKPA 2RNJA 1RNLA 1P4AA 1OMIA 1RUNA 2XASA 2P6TA 3CUQB 3DP7A 1SFUA 2M1BA 3T8RA 2QLZA 4KDPA 1LQ1A 1FBQA 1UHMA 1RUOA 1QNTA 2A6HF 4WXDA 4A5MA 4ZH4F 1T0FA 1B9MA 4JQFA 1FBSA 4XRFA 2IA2A 3BJOA 2P6SA 2VT2A 6PAXA 3DQVC 2GQQA 3M9AA 3BWGA 1MZBA 5FGMA 1J9IA 3P9CA 5A2QK 4G9YA 5HOOA 1REPC 2IT0A 2VN2A 5DDGA 4UXNA 2EFOA 1FLIA 1OYYA 1B1BA 2ZNYA 4DNCA 2IP2A 2M5WA 2F5CA 4JBAA 4YFKF 3HTSB 3E6CC 5FB2A 1J0RA 3ISPA 1SMYF 2X4HA 2HOEA 4LB5A 3J80Z 5KVRA 2OBPA 2NRAC 1T2KA 1BM9A 2R3SA 2OA4A 4EM0B 4KIBA 4OIRF 2HTJA 1OR7A 2JT1A 3F8MA 2HR3A 4GXOA 1YS6A 1KQ0A 3L9FA 3KEQA 4Q5SF 4GYIA 2PI0A 1J7KA 2EV5A 1XMAA 3KEOA 3ROUA 2JPCA 5TJJA 1LEAA 2YR2A 3LA3A 1VTNC 4LFUA 2K4JA 1KQ9A 5D5XB 4UVCA 1O3SA 1BI0A 1YO5C 3WTVC 3J81Z 5HLIA 3PFIA 4I09A 1J2XA 4Y13A 3JSPA 5FD6A 1KGSA 2H6BA 4EJOA 2XRNA 3KP2A 5H6QA 1SFXA 4EMSA 2HDCA 2J5PA 1AOYA 3KCCA 1HKSA 3NQOA 2QQ9A 1S8NA 4EQQA 4P96A 4WX9A 1DUXC 1FP1D 4WK8F 3VB2A 2ZO4A 1FZPB 5EEHA 4HF2A 5HS7A 2FNAA 3WU0A 4LMYA 5DUIA 1QO0D 4N9HA 2L3DA 5JR3A 1FBUA 1J75A 5LRSA 1P2FA 2IVMA 2Q0OA 3I58A 1R7JA 2XAQA 3FXRA 4HA8A 1XSXA 3F6VA 2D1VA 2K4BA 1TNSA 2H27A 2XKOA 4CDGA 1G6NA 1W5SA 2GWRA 1TBXA 1BN5A 1XSVA 2H09A 4PGHA 1KU3A 1O7FA 2D45A 1R5HA 5DUKA 2X0LA 2Y0MA 5L3CA 2OU2A 1XGMA 3O3KA 3GFIA 3F8CA 4BH9A 3V8KA 2UXNA 1STZA 4IVNA 2FBKA 3ZMUA 2GIVA 4XSXF 1ON2A 3V7CA 4KIGA 3SZPA 1ZG5A 2G9WA 2NYXA 4EM2A 4UV8A 2JSCA 2HTSA 5IT3A 5TRDA 5JFRA 4LLNA 2J5OA 1R36A 5ILVA 3RYRA 1R00A 3CLOA 1ZLKA 3REOA 2PFBA 3SFZA 4MQVA 5CJ9A 3GFJA 5HVQC 3HTUA 1YQAA 3CO6C 2KRFA 2ESNA 3M7GA 1KU7A 2E1NA 1DPUA 3HSRA 2V1UA 2QUFA 2MH9A 1P6RA 2EFPA 4KMFA 2PEXA 3C7JA 2QENA 5D6FA 4BAYA 1XDSA 2DK5A 4EGYA 5E1ZB 4ESJA 2EJRA 3MWMA 4MHGA 3EUHA 3GX4X 1S6LA 2Z9OA 1S29A 2MLKA 1V3FA 2F5EA 2C6YA 2F2EA 4IRGA 5D8KB 3HHHA 2VC0A 4MGRA 3F23A 3IL2A 2G7UA 2P7VB 2OQGA 2XVCA 1EV7A 3ERED 3FM3A 4N9IA 2XUBA 2L02A 4A6DA 1BI3A 1UHWA 3R4KA 1U8RA 1I1GA 2ZMEA 3HOSA 3WTZA 4G6DA 1X3UA 1G3TA 1WI9A 4EJVA 4QLCU 3TO9A 3NRVA 1I5ZA 3W6KB 3R0JA 3E5QA 1SD4A 1LEBA 4WWCA 1BC7C 4HYEA 4BHPA 3WTTC 3KP7A 1TLHB 2RKHA 2WTEA 4I0AA 3B02A 2XAFA 1FSEA 4RGXA 1PDNC 2VODA 3QU3A 2FU4A 4O6JA 4R1HA 3DXJF 1OYWA 3PQKA 3HRMA 2ZFWA 1WQ2A 1R58A 3R0AA 2MA3A 5K5OA 2DTRA 1R1VA 4H0EA 1SMTA 4HDUA 3K1NA 1NHAA 2NNNA 5DCFA 3MAJA 2JRTA 1KYZA 2V6CA 3HRUA 2CSOA 2KJCA 1P4XA 2ZMEB 3RPQA 1T98A 4BXUA 3FMSA 3FHZA 2L01A 1U6GA 3PQJA 3FXQA 1FY7A 3KLNA 2FMLA 3ZMZA 5LEJA 3CUOA 4NQWA 5F1RA 1JGSA 5HDNA 4P55A 1FSHA 3GF2A 1J59A 3J80K 1D8KA 3WODF 3EDPA 2EV0A 1AWCA 1MJAA 4HBLA 5E8IA 5KK1A 3WG9A 3BPXA 4E70A 5CLSA 4HZFA 1PP7U 1YLFA 4I02A 5ERIA 3H3UA 5HS9A 4IRIA 4G7OF 1YW8A 2MH2A 5AIPA 3F6OA 2DAOA 1UCRA 4U0YA 2QYOA 1FYKA 5BS6A 2Y48A 4OMYA 3TQNA 4K2EA 3KP6A 2ADUA 4LD5A 5JVTA 4EJTA 4PCQA 3Q9VA 3J81K 2DW4A 2VBZA 3MZYA 2A07F 4CICA 4RGUA 3RKWA 4FT8A 3T1BA 2P5KA 4U0VA 2GZWA 4CHUA 2LSOA 1R1UA 3E5UA 3GEZA 3WGHA 2YPRA 3I5UA 4ON0A 5DEQA 4O5VA 2P8TA 4ENMA 3QP5A 1MDMA 3OV8A 5LHHA 2DPUA 4HQMA 4ZZLA 2VE9A 4FX4A 3W6JB 3DPTA 4CYDA 3F3XA 4ESBA 5ICFA 3BOQA 3TOBA 2FF4A 4UVBA 1GVJA 5ICCA 1CGPA 3K1PA 2XGXA 1XMKA 4G94A 4RB2C 4RS8A 2HGCA 1SD7A 1TW2A 4M72A 2PQ8A 1BBYA 3KP5A 5AONA 1HW2A 1UB9A 4Q48A 2VOOA 2ELHA 3F8FA 1R22A 2QQAA 2MC3A 2DT5A 2L4AA 3HHGA 2FMYA 4IHTA 3MQ0A 3ZMVA 3BJAA 2W57A 1MDMB 2XIGA 2F5DA 2DLLA 2ESHA 4BHCA 3P7NA 3K9TA 2G7HA 2HEOA 3VEPA 3DV8A 1LB2A 2WC2A 2FEZA 3QOPA 2CO5A 1WWXA 1D5VA 3V8LA 5CVRA 3QPHA 5AIQA 3IRQA 2EB7A 1G3SA 3N4MA 1HSJA 3WTUC 4BQAA 5LGNA 1EH7A 2CQKA 4ESFA 4MTEA 4R79A 4RAYA 1R23A 4ZYGA 3RPUA 2EA4A 2YU3A 3M8EA 5ILSA 1ZGAA 4R8HA 1YTYA 1IF1A 3I4PA 3JW4A 4P9UA 4L9VA 1IW7F 1P4WA 4IJAA 1EH8A 2DK8A 2IPQX 3ABUA 1ZN2A 2R7FA 4ENJA 5CVUA 1QBJA 4KIFA 1MGTA 2HKXA 2K86A 1L3LA 4ENNA 4ENKA 2QVOA 4XSZF 2BE5F 2EV6A 3C18A 1XCVA 1HSTA 4KFCA 2KIMA 2FBHA 2RN7A 2VXZA 2E7XA 2FXAA 1Y0UA 2CG4A 1TW3A 2ZJ2A 2O61A 3DEUA 5ICEA 3GW2A 2COMA 2FE3A 3LAPA 2WV0A 3VODA 3FX3A 3ELKA 4XLPF 4GYGA 2H6CA 2RGVA 2PBIA 5FFXA 3C3WA 1MJBA 4FX0A 1Z05A 3WU1B 1ZYRF 5HDKA 3WTXC 4YG2F 1YW7A 3ZN1A 4HAMA 1XDUA 3GO5A 1BC8C 4FHTA 1IXCA 1BIAA 3WTYC 3TO7A 5DD8A 2QBYA 5E17F 3LQRA 3TO6A 3SQNA 4Z2YA 2BEOA 2P7CB 4F7ZA 2FQ3A 4RGRA 1GXQA 5D5UB 3GWZA 4KUMA 1BOAA 4KICA 4AIHA 1QGPA 3WE2A 4LLGF 3ECHA 5L3EA 2HFHA 2BBYA 1O3TA 2PG4A 3WTSC 2W24A 4ZYEA 1ON1A 2NNYA 3QPTA 2FSWA 5CYVA 5JHUA 1D3YA 1Z6RA 2DO7A 3FXUA 1U2WA 3E97A 2FBIA 4OIOF 4ASNA 1C0WA 1IN6A 5DD4A 4YIIA 4UUVA 1IN7A 3LAJA 2QBYB 2R7DA 4M9XA 4WXCA 3MEXA 4RB0A 5LEKA 4U7BA 1IUYA 1QZYA 3Q5FA 3K69A 4MEYF 1SAXA 2LNBA 2VT3A 3KE2A 4HX7A 2NAZA 3QU6A 4EJUA 4S05A 2RVCA 3KFWX 2DPDA 1QQIA 4B8XA 4G6QA 1A04A 2CWEA 4P5OA 1SFEA 2M8EA 3FM5A 3L00A 4AVPA 4XLNF 2RC4A 1SD5A 3TOAA 3AAFA 2WWYA 2ZKZA 1LJ9A 1L0OC 3HRTA 1FC3A 4HV6A 1GXPA 4BNCA 5L3FA 3RYPA 4KN4X 3U9GA 4DQ2A 3IRRA 2HYGD 1H0MA 5BPIA 3FZVA 5FLXZ 4JK1X 5BPDA 3LWFA 4L5JA 1WRJA 4M73A 1IXRC 2UXXA 2GAUA 1WKMA 3LA2A 1W7PA 5DYMA 4A0XA 2UZKA 1ZRCA 2MD5A 3NEUA 4EV0A 4M71A 3S2WA 1KU9A 2XAHA 5ED4A 1I1SA 3RKXA 4B09A 1FYLA 2EFNA 1ZARA 3P9IA 4OU0A 4WCGA 4PDKA 1LVAA 3L7WA 2A5YB 4KYWA 1U78A 2DQLA 1USSA 1S7AA 4KN7X 4N0BA 5FD5A 2A6EF 4WXHA 2OAZA 3ZMSA 4A5NA 3I59A 1JHFA 2EWNA 2CW0F 4AIJA 4L9TA 2QQBA 1Z9CA 1W7PB 3TDUC 4HX4A 1BJAA 1SD6A 1LNWA 4CGZA 1KYWA 3F8BA 2AS5F 3VFZA 1MJ9A 4KNYA 2PMHA 1Z91A 3JAMZ 2RQPA 3DKWA 4M74A 1U5TA 5DV5A 3WGGA 4GGGA 1TQMA 1O3RA 1DPRA 1W4MA 4HLXA 3E3VA 5D5WB 5E20A 4QWQA 1BIBA 4I0BA 1V4RA 3IC7A 1T39A 5D4SA 5LBQA 4I2OA 3FMQA 3T0YA 2KIFA 5K1YA 2Q2EA 1QZZA 3I59B 3DF8A 4LLLA 2VC1A 3O2PE 2STTA 3ZMTA 2DQRA 2H94A 2XHKA 2Z5UA 5H6RA 1IRFA 1Z1DA 2GXGA 3TDZC 4AWXB 2P5LC 1S7OA 5L3DA 1B6AA 2O6GE 3ECOA 2XAJA 3F22A 1IAWA 3LA7A 1B59A 2O03A 3T8TA 4S04A 1U5TB 3KP4A 1PUEE 2KKOA 2O8XA 1F1ZA 3IWFA 2L4MA 3I71A 4YIFA 1ZLJA 2V79A 3VOEA 5BMZA 2EFWA 4LK0F 1OYIA 2ACJA 4A6EA 3V4GA 2V1XA 1G3WA 1FYMA 4L9JA 1K6OA 1H9TA 1E17A 1YFHA 5IT9Z 2VBXA 4ZYDA 4MTDA 2CYYA 3JTHA 1RIOH 2Z99A 2FRHA 3ZN0A 3R6SA 3U2RA 1OKRA 4EJWA 2FA5A 3KETA 4IF4A 3TGNA 1WSUA 3BZ6A 1MKMA 5CVJA 3IKVA 1F5TA 3OOPA 1UFMA 3CO7C 4ETSA 3HYIA 4ZYHA 3ABTA 1U3EM 4LG0A 3GYHX 2NS0A 3RJPA 4OIPF 1K78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCW A;  4LK1 F;  2AXL A;  1ONV A;  4YFX F;  3TKY A;  2VE8 A;  3T5X A;  2RDP A;  4RB1 A;  2OZU A;  4IHS A;  1XGO A;  3F72 A;  3F8N A;  1FX7 A;  3I64 A;  2ISZ A;  3HSE A;  5LRR A;  1ODD A;  3IWZ A;  2HQR A;  5ILU A;  2Q8K A;  3J7A O;  4HOB A;  5LHG A;  2F5F A;  3BJ6 A;  1RI7 A;  1R1T A;  2PMU A;  4HLY A;  4EGZ A;  1K79 A;  4LG0 B;  2IW5 A;  3ZP5 A;  1GHC A;  1F9N A;  1LDJ A;  1TTY A;  3V8J A;  4CO8 A;  1RZ4 A;  1K78 B;  2MBF A;  3EET A;  1CF7 A;  3MFK A;  3QRF F;  2FNP A;  2ZNZ A;  3QAH A;  3MCZ A;  2DI3 A;  3GUD A;  3CJN A;  1KU2 A;  2K7L A;  1ZAO A;  2JPB A;  5FLX K;  1DP7 P;  2KJB A;  1IZ1 A;  1O57 A;  3I0T A;  1MD0 A;  1O3Q A;  2TDX A;  4Y15 A;  4M6X A;  1FPQ A;  2CFX A;  4KT5 C;  1BI2 A;  1G3Y A;  2RV8 A;  5D6E A;  3DPL C;  2O0Y A;  5FFZ A;  1F4K A;  3L2C A;  2A69 F;  1QPM A;  4AIK A;  2VBY A;  3G73 A;  3ML6 A;  4Q4Z F;  4I01 A;  4I98 B;  2XV4 S;  2M30 A;  1G4D A;  4YFN F;  2Y75 A;  1CF7 B;  1FNN A;  1ZHF A;  4KMU X;  2P4W A;  2HS5 A;  4MQ9 F;  1HKT A;  1XGS A;  3RDI A;  2VON A;  3LFK A;  2W85 A;  5E8G A;  3GFM A;  4P9F A;  2V1D A;  5D5V B;  3WGI A;  1D8J A;  2HWV A;  2XKP A;  5JI6 A;  3BDD A;  1I27 A;  2D2W A;  5H20 A;  4IPA A;  5HLH A;  1IXS B;  2HZT A;  3I53 A;  1XD7 A;  4GO1 A;  1O7L A;  4OIQ F;  3QP6 A;  1FOK A;  5LLQ A;  2PJP A;  5F6F A;  5CVI A;  5ICG A;  1K7A A;  1XSD A;  1JE8 A;  4A0Z A;  2E7W A;  4L0Z B;  2EA2 A;  1DDN A;  3IHU A;  4PGG A;  3JSO A;  2OZ6 A;  4OIN F;  4GCV A;  1HKQ A;  2LF7 A;  3SZT A;  1IRG A;  3KZY A;  5LGU A;  3JAM K;  1ZGJ A;  2MLG A;  3ZMD A;  1OPC A;  4A12 A;  1TNT A;  2M45 A;  5L3G A;  2VBW A;  3RTR A;  1HXD A;  5DCM A;  4TV7 A;  2STW A;  2IA0 A;  1ZRD A;  4BHB A;  2IRF G;  2BYV E;  2JZY A;  1B9N A;  4O3M A;  4IRH A;  3FMR A;  5A2Q Z;  1KA8 A;  3EYI A;  2HKO A;  4UHT A;  4L9N A;  1LDD A;  2FOK A;  4HV5 A;  1R5G A;  2IA1 A;  2LDU A;  3MZH A;  4L0Y B;  3GVA A;  5J8F A;  2LF8 A;  1HQC A;  5FO5 A;  1YYV A;  3BRO A;  1LDK B;  4KA4 A;  3V7S A;  4Y17 A;  3R60 A;  2QWW A;  3KP3 A;  3C1D A;  1I6X A;  3L09 A;  4UVA A;  1T6S A;  1W7P D;  4G7H F;  2Z3Y A;  1YS7 A;  4Q47 A;  2A3S A;  2K02 A;  4UV9 A;  3E6D A;  3GLX A;  1Z7U A;  2HQN A;  4L5I A;  4HQE A;  1HW5 A;  1IN4 A;  2XRO A;  2DFI A;  1IN5 A;  4M6Y A;  2ISY A;  5DCM B;  2EFQ A;  4LGW A;  3KZZ A;  4LJZ F;  2D1H A;  4A0Y A;  1TQI A;  2P5V A;  1Q1H A;  3HSF A;  2EK5 A;  1B4A A;  2OD5 A;  3P9K A;  3H92 A;  5BQT A;  3HUG A;  3FWE A;  5HLG A;  1S3J A;  2BGC A;  4PZJ A;  1W5T A;  1YIO A;  2W84 A;  5E1W A;  3E6M A;  3WTW C;  2ZXJ A;  2PLY A;  1UST A;  4HF0 A;  2GA1 A;  5IT9 K;  3B73 A;  5BOX A;  4RAZ A;  1FWZ A;  3M8F A;  5HS8 A;  2DU9 A;  1ZH5 A;  1ZRE A;  4U88 A;  4UNO A;  4U7D A;  3RKY A;  2QZ8 A;  3SHF A;  3BP8 A;  3IKT A;  2A68 F;  4RB3 C;  4OMZ A;  3RI4 A;  2HYF A;  1H9G A;  2E1C A;  4CXF A;  2GA2 A;  3KLO A;  4G8X A;  4LB6 B;  4XBF A;  3ZQ7 A;  2GXB A;  4EVI A;  3LQQ A;  4NHJ A;  3JTG A;  2ETH A;  3O6B B;  3U1D A;  1J5Y A;  4G7Z F;  5LHI A;  5EEG A;  1JHH A;  3HRS A;  5F64 A;  3R61 A;  3G3Z A;  4HF1 A;  3SXY A;  2Z33 A;  5E18 F;  2BV6 A;  3N97 A;  2L54 A;  2V9V A;  2B0L A;  3CTA A;  1Z6T A;  1ZRF A;  1XN7 A;  1YW9 A;  1BI1 A;  5J8C A;  4MEX F;  4I7H A;  3E6B A;  2K27 A;  2OQR A;  4EM1 A;  4CZZ A;  2ZBK A;  3BPV A;  2YSR A;  2M87 A;  5E1X A;  5D4R A;  2W25 A;  4HW0 A;  1HW1 A;  4A2U A;  2XAG A;  5K5R A;  3GXO A;  3COA C;  1IN8 A;  4WF2 A;  3GFL A;  1KQ8 A;  4ZZD A;  2O3F A;  3E5X A;  1EH6 A;  4M9S A;  2A61 A;  5L3B A;  3EYY A;  1JXS A;  3ULQ B;  3ZPL A;  3GZ5 A;  3H3Z A;  3WE3 A;  3FF5 A;  2VOP A;  4AD9 A;  1XB4 A;  3I54 A;  3GZ6 A;  1U5T C;  4RGS A;  3EQL F;  3CDH A;  5LGT A;  3BY6 A;  2PN6 A;  2KIU A;  5D8L B;  1PP8 F;  1FP2 A;  3K2Z A;  3D5L A;  1ZG3 A;  1YG2 A;  3CUQ A;  4M9Z A;  3K1M A;  2QM3 A;  2DBB A;  3HIF A;  1XGN A;  5K5Q A;  2JTV A;  4L18 B;  4MNU A;  3D0S A;  1ZG1 A;  3DFG A;  3F21 A;  5HDG A;  1HBX G;  4HDV A;  3Q9S A;  4OOI A;  4NB5 A;  1FT9 A;  5J6X A;  3K0L A;  4IXA A;  4U0W A;  3V7R A;  2UWM A;  5CVV A;  2YX4 A;  3LST A;  1E2X A;  1TQP A;  2IJL A;  1XCB A;  1T38 A;  3M1E A;  3RIR A;  2CGP A;  1P92 A;  2YX7 A;  4D0P A;  1ULY A;  4BYY A;  4HX8 A;  3CUQ C;  3HOT A;  2LKP A;  2RNJ A;  1RNL A;  1P4A A;  1OMI A;  1RUN A;  2XAS A;  2P6T A;  3CUQ B;  3DP7 A;  1SFU A;  2M1B A;  3T8R A;  2QLZ A;  4KDP A;  1LQ1 A;  1FBQ A;  1UHM A;  1RUO A;  1QNT A;  2A6H F;  4WXD A;  4A5M A;  4ZH4 F;  1T0F A;  1B9M A;  4JQF A;  1FBS A;  4XRF A;  2IA2 A;  3BJO A;  2P6S A;  2VT2 A;  6PAX A;  3DQV C;  2GQQ A;  3M9A A;  3BWG A;  1MZB A;  5FGM A;  1J9I A;  3P9C A;  5A2Q K;  4G9Y A;  5HOO A;  1REP C;  2IT0 A;  2VN2 A;  5DDG A;  4UXN A;  2EFO A;  1FLI A;  1OYY A;  1B1B A;  2ZNY A;  4DNC A;  2IP2 A;  2M5W A;  2F5C A;  4JBA A;  4YFK F;  3HTS B;  3E6C C;  5FB2 A;  1J0R A;  3ISP A;  1SMY F;  2X4H A;  2HOE A;  4LB5 A;  3J80 Z;  5KVR A;  2OBP A;  2NRA C;  1T2K A;  1BM9 A;  2R3S A;  2OA4 A;  4EM0 B;  4KIB A;  4OIR F;  2HTJ A;  1OR7 A;  2JT1 A;  3F8M A;  2HR3 A;  4GXO A;  1YS6 A;  1KQ0 A;  3L9F A;  3KEQ A;  4Q5S F;  4GYI A;  2PI0 A;  1J7K A;  2EV5 A;  1XMA A;  3KEO A;  3ROU A;  2JPC A;  5TJJ A;  1LEA A;  2YR2 A;  3LA3 A;  1VTN C;  4LFU A;  2K4J A;  1KQ9 A;  5D5X B;  4UVC A;  1O3S A;  1BI0 A;  1YO5 C;  3WTV C;  3J81 Z;  5HLI A;  3PFI A;  4I09 A;  1J2X A;  4Y13 A;  3JSP A;  5FD6 A;  1KGS A;  2H6B A;  4EJO A;  2XRN A;  3KP2 A;  5H6Q A;  1SFX A;  4EMS A;  2HDC A;  2J5P A;  1AOY A;  3KCC A;  1HKS A;  3NQO A;  2QQ9 A;  1S8N A;  4EQQ A;  4P96 A;  4WX9 A;  1DUX C;  1FP1 D;  4WK8 F;  3VB2 A;  2ZO4 A;  1FZP B;  5EEH A;  4HF2 A;  5HS7 A;  2FNA A;  3WU0 A;  4LMY A;  5DUI A;  1QO0 D;  4N9H A;  2L3D A;  5JR3 A;  1FBU A;  1J75 A;  5LRS A;  1P2F A;  2IVM A;  2Q0O A;  3I58 A;  1R7J A;  2XAQ A;  3FXR A;  4HA8 A;  1XSX A;  3F6V A;  2D1V A;  2K4B A;  1TNS A;  2H27 A;  2XKO A;  4CDG A;  1G6N A;  1W5S A;  2GWR A;  1TBX A;  1BN5 A;  1XSV A;  2H09 A;  4PGH A;  1KU3 A;  1O7F A;  2D45 A;  1R5H A;  5DUK A;  2X0L A;  2Y0M A;  5L3C A;  2OU2 A;  1XGM A;  3O3K A;  3GFI A;  3F8C A;  4BH9 A;  3V8K A;  2UXN A;  1STZ A;  4IVN A;  2FBK A;  3ZMU A;  2GIV A;  4XSX F;  1ON2 A;  3V7C A;  4KIG A;  3SZP A;  1ZG5 A;  2G9W A;  2NYX A;  4EM2 A;  4UV8 A;  2JSC A;  2HTS A;  5IT3 A;  5TRD A;  5JFR A;  4LLN A;  2J5O A;  1R36 A;  5ILV A;  3RYR A;  1R00 A;  3CLO A;  1ZLK A;  3REO A;  2PFB A;  3SFZ A;  4MQV A;  5CJ9 A;  3GFJ A;  5HVQ C;  3HTU A;  1YQA A;  3CO6 C;  2KRF A;  2ESN A;  3M7G A;  1KU7 A;  2E1N A;  1DPU A;  3HSR A;  2V1U A;  2QUF A;  2MH9 A;  1P6R A;  2EFP A;  4KMF A;  2PEX A;  3C7J A;  2QEN A;  5D6F A;  4BAY A;  1XDS A;  2DK5 A;  4EGY A;  5E1Z B;  4ESJ A;  2EJR A;  3MWM A;  4MHG A;  3EUH A;  3GX4 X;  1S6L A;  2Z9O A;  1S29 A;  2MLK A;  1V3F A;  2F5E A;  2C6Y A;  2F2E A;  4IRG A;  5D8K B;  3HHH A;  2VC0 A;  4MGR A;  3F23 A;  3IL2 A;  2G7U A;  2P7V B;  2OQG A;  2XVC A;  1EV7 A;  3ERE D;  3FM3 A;  4N9I A;  2XUB A;  2L02 A;  4A6D A;  1BI3 A;  1UHW A;  3R4K A;  1U8R A;  1I1G A;  2ZME A;  3HOS A;  3WTZ A;  4G6D A;  1X3U A;  1G3T A;  1WI9 A;  4EJV A;  4QLC U;  3TO9 A;  3NRV A;  1I5Z A;  3W6K B;  3R0J A;  3E5Q A;  1SD4 A;  1LEB A;  4WWC A;  1BC7 C;  4HYE A;  4BHP A;  3WTT C;  3KP7 A;  1TLH B;  2RKH A;  2WTE A;  4I0A A;  3B02 A;  2XAF A;  1FSE A;  4RGX A;  1PDN C;  2VOD A;  3QU3 A;  2FU4 A;  4O6J A;  4R1H A;  3DXJ F;  1OYW A;  3PQK A;  3HRM A;  2ZFW A;  1WQ2 A;  1R58 A;  3R0A A;  2MA3 A;  5K5O A;  2DTR A;  1R1V A;  4H0E A;  1SMT A;  4HDU A;  3K1N A;  1NHA A;  2NNN A;  5DCF A;  3MAJ A;  2JRT A;  1KYZ A;  2V6C A;  3HRU A;  2CSO A;  2KJC A;  1P4X A;  2ZME B;  3RPQ A;  1T98 A;  4BXU A;  3FMS A;  3FHZ A;  2L01 A;  1U6G A;  3PQJ A;  3FXQ A;  1FY7 A;  3KLN A;  2FML A;  3ZMZ A;  5LEJ A;  3CUO A;  4NQW A;  5F1R A;  1JGS A;  5HDN A;  4P55 A;  1FSH A;  3GF2 A;  1J59 A;  3J80 K;  1D8K A;  3WOD F;  3EDP A;  2EV0 A;  1AWC A;  1MJA A;  4HBL A;  5E8I A;  5KK1 A;  3WG9 A;  3BPX A;  4E70 A;  5CLS A;  4HZF A;  1PP7 U;  1YLF A;  4I02 A;  5ERI A;  3H3U A;  5HS9 A;  4IRI A;  4G7O F;  1YW8 A;  2MH2 A;  5AIP A;  3F6O A;  2DAO A;  1UCR A;  4U0Y A;  2QYO A;  1FYK A;  5BS6 A;  2Y48 A;  4OMY A;  3TQN A;  4K2E A;  3KP6 A;  2ADU A;  4LD5 A;  5JVT A;  4EJT A;  4PCQ A;  3Q9V A;  3J81 K;  2DW4 A;  2VBZ A;  3MZY A;  2A07 F;  4CIC A;  4RGU A;  3RKW A;  4FT8 A;  3T1B A;  2P5K A;  4U0V A;  2GZW A;  4CHU A;  2LSO A;  1R1U A;  3E5U A;  3GEZ A;  3WGH A;  2YPR A;  3I5U A;  4ON0 A;  5DEQ A;  4O5V A;  2P8T A;  4ENM A;  3QP5 A;  1MDM A;  3OV8 A;  5LHH A;  2DPU A;  4HQM A;  4ZZL A;  2VE9 A;  4FX4 A;  3W6J B;  3DPT A;  4CYD A;  3F3X A;  4ESB A;  5ICF A;  3BOQ A;  3TOB A;  2FF4 A;  4UVB A;  1GVJ A;  5ICC A;  1CGP A;  3K1P A;  2XGX A;  1XMK A;  4G94 A;  4RB2 C;  4RS8 A;  2HGC A;  1SD7 A;  1TW2 A;  4M72 A;  2PQ8 A;  1BBY A;  3KP5 A;  5AON A;  1HW2 A;  1UB9 A;  4Q48 A;  2VOO A;  2ELH A;  3F8F A;  1R22 A;  2QQA A;  2MC3 A;  2DT5 A;  2L4A A;  3HHG A;  2FMY A;  4IHT A;  3MQ0 A;  3ZMV A;  3BJA A;  2W57 A;  1MDM B;  2XIG A;  2F5D A;  2DLL A;  2ESH A;  4BHC A;  3P7N A;  3K9T A;  2G7H A;  2HEO A;  3VEP A;  3DV8 A;  1LB2 A;  2WC2 A;  2FEZ A;  3QOP A;  2CO5 A;  1WWX A;  1D5V A;  3V8L A;  5CVR A;  3QPH A;  5AIQ A;  3IRQ A;  2EB7 A;  1G3S A;  3N4M A;  1HSJ A;  3WTU C;  4BQA A;  5LGN A;  1EH7 A;  2CQK A;  4ESF A;  4MTE A;  4R79 A;  4RAY A;  1R23 A;  4ZYG A;  3RPU A;  2EA4 A;  2YU3 A;  3M8E A;  5ILS A;  1ZGA A;  4R8H A;  1YTY A;  1IF1 A;  3I4P A;  3JW4 A;  4P9U A;  4L9V A;  1IW7 F;  1P4W A;  4IJA A;  1EH8 A;  2DK8 A;  2IPQ X;  3ABU A;  1ZN2 A;  2R7F A;  4ENJ A;  5CVU A;  1QBJ A;  4KIF A;  1MGT A;  2HKX A;  2K86 A;  1L3L A;  4ENN A;  4ENK A;  2QVO A;  4XSZ F;  2BE5 F;  2EV6 A;  3C18 A;  1XCV A;  1HST A;  4KFC A;  2KIM A;  2FBH A;  2RN7 A;  2VXZ A;  2E7X A;  2FXA A;  1Y0U A;  2CG4 A;  1TW3 A;  2ZJ2 A;  2O61 A;  3DEU A;  5ICE A;  3GW2 A;  2COM A;  2FE3 A;  3LAP A;  2WV0 A;  3VOD A;  3FX3 A;  3ELK A;  4XLP F;  4GYG A;  2H6C A;  2RGV A;  2PBI A;  5FFX A;  3C3W A;  1MJB A;  4FX0 A;  1Z05 A;  3WU1 B;  1ZYR F;  5HDK A;  3WTX C;  4YG2 F;  1YW7 A;  3ZN1 A;  4HAM A;  1XDU A;  3GO5 A;  1BC8 C;  4FHT A;  1IXC A;  1BIA A;  3WTY C;  3TO7 A;  5DD8 A;  2QBY A;  5E17 F;  3LQR A;  3TO6 A;  3SQN A;  4Z2Y A;  2BEO A;  2P7C B;  4F7Z A;  2FQ3 A;  4RGR A;  1GXQ A;  5D5U B;  3GWZ A;  4KUM A;  1BOA A;  4KIC A;  4AIH A;  1QGP A;  3WE2 A;  4LLG F;  3ECH A;  5L3E A;  2HFH A;  2BBY A;  1O3T A;  2PG4 A;  3WTS C;  2W24 A;  4ZYE A;  1ON1 A;  2NNY A;  3QPT A;  2FSW A;  5CYV A;  5JHU A;  1D3Y A;  1Z6R A;  2DO7 A;  3FXU A;  1U2W A;  3E97 A;  2FBI A;  4OIO F;  4ASN A;  1C0W A;  1IN6 A;  5DD4 A;  4YII A;  4UUV A;  1IN7 A;  3LAJ A;  2QBY B;  2R7D A;  4M9X A;  4WXC A;  3MEX A;  4RB0 A;  5LEK A;  4U7B A;  1IUY A;  1QZY A;  3Q5F A;  3K69 A;  4MEY F;  1SAX A;  2LNB A;  2VT3 A;  3KE2 A;  4HX7 A;  2NAZ A;  3QU6 A;  4EJU A;  4S05 A;  2RVC A;  3KFW X;  2DPD A;  1QQI A;  4B8X A;  4G6Q A;  1A04 A;  2CWE A;  4P5O A;  1SFE A;  2M8E A;  3FM5 A;  3L00 A;  4AVP A;  4XLN F;  2RC4 A;  1SD5 A;  3TOA A;  3AAF A;  2WWY A;  2ZKZ A;  1LJ9 A;  1L0O C;  3HRT A;  1FC3 A;  4HV6 A;  1GXP A;  4BNC A;  5L3F A;  3RYP A;  4KN4 X;  3U9G A;  4DQ2 A;  3IRR A;  2HYG D;  1H0M A;  5BPI A;  3FZV A;  5FLX Z;  4JK1 X;  5BPD A;  3LWF A;  4L5J A;  1WRJ A;  4M73 A;  1IXR C;  2UXX A;  2GAU A;  1WKM A;  3LA2 A;  1W7P A;  5DYM A;  4A0X A;  2UZK A;  1ZRC A;  2MD5 A;  3NEU A;  4EV0 A;  4M71 A;  3S2W A;  1KU9 A;  2XAH A;  5ED4 A;  1I1S A;  3RKX A;  4B09 A;  1FYL A;  2EFN A;  1ZAR A;  3P9I A;  4OU0 A;  4WCG A;  4PDK A;  1LVA A;  3L7W A;  2A5Y B;  4KYW A;  1U78 A;  2DQL A;  1USS A;  1S7A A;  4KN7 X;  4N0B A;  5FD5 A;  2A6E F;  4WXH A;  2OAZ A;  3ZMS A;  4A5N A;  3I59 A;  1JHF A;  2EWN A;  2CW0 F;  4AIJ A;  4L9T A;  2QQB A;  1Z9C A;  1W7P B;  3TDU C;  4HX4 A;  1BJA A;  1SD6 A;  1LNW A;  4CGZ A;  1KYW A;  3F8B A;  2AS5 F;  3VFZ A;  1MJ9 A;  4KNY A;  2PMH A;  1Z91 A;  3JAM Z;  2RQP A;  3DKW A;  4M74 A;  1U5T A;  5DV5 A;  3WGG A;  4GGG A;  1TQM A;  1O3R A;  1DPR A;  1W4M A;  4HLX A;  3E3V A;  5D5W B;  5E20 A;  4QWQ A;  1BIB A;  4I0B A;  1V4R A;  3IC7 A;  1T39 A;  5D4S A;  5LBQ A;  4I2O A;  3FMQ A;  3T0Y A;  2KIF A;  5K1Y A;  2Q2E A;  1QZZ A;  3I59 B;  3DF8 A;  4LLL A;  2VC1 A;  3O2P E;  2STT A;  3ZMT A;  2DQR A;  2H94 A;  2XHK A;  2Z5U A;  5H6R A;  1IRF A;  1Z1D A;  2GXG A;  3TDZ C;  4AWX B;  2P5L C;  1S7O A;  5L3D A;  1B6A A;  2O6G E;  3ECO A;  2XAJ A;  3F22 A;  1IAW A;  3LA7 A;  1B59 A;  2O03 A;  3T8T A;  4S04 A;  1U5T B;  3KP4 A;  1PUE E;  2KKO A;  2O8X A;  1F1Z A;  3IWF A;  2L4M A;  3I71 A;  4YIF A;  1ZLJ A;  2V79 A;  3VOE A;  5BMZ A;  2EFW A;  4LK0 F;  1OYI A;  2ACJ A;  4A6E A;  3V4G A;  2V1X A;  1G3W A;  1FYM A;  4L9J A;  1K6O A;  1H9T A;  1E17 A;  1YFH A;  5IT9 Z;  2VBX A;  4ZYD A;  4MTD A;  2CYY A;  3JTH A;  1RIO H;  2Z99 A;  2FRH A;  3ZN0 A;  3R6S A;  3U2R A;  1OKR A;  4EJW A;  2FA5 A;  3KET A;  4IF4 A;  3TGN A;  1WSU A;  3BZ6 A;  1MKM A;  5CVJ A;  3IKV A;  1F5T A;  3OOP A;  1UFM A;  3CO7 C;  4ETS A;  3HYI A;  4ZYH A;  3ABT A;  1U3E M;  4LG0 A;  3GYH X;  2NS0 A;  3RJP A;  4OIP F;  1K78 A; 
#chains in the Genus database with same CATH topology
 3I9V 2;  2X6Y A;  3TW7 A;  2ZCW A;  4LK1 F;  2NVQ J;  2AXL A;  1ONV A;  2LOO A;  4YFX F;  3TKY A;  2DYR H;  2QSF X;  2VE8 A;  3T5X A;  1KON A;  4ABZ A;  2RDP A;  4RB1 A;  2OZU A;  4D7N A;  4DOZ A;  4IHS A;  1XGO A;  5EYR A;  3F72 A;  3F8N A;  2VQC A;  4RDU A;  5M5Y J;  2PMZ A;  3BG3 A;  3E7L A;  2E2H J;  2WAQ N;  3FHN A;  1FX7 A;  3I64 A;  2CW7 A;  1HDD C;  1MBJ A;  2ISZ A;  2CV0 A;  3HSE A;  5LRR A;  2EIL H;  2KIS A;  2WY8 Q;  4HNT A;  1ODD A;  3DBR B;  1LUJ B;  4BXF A;  4C3H J;  1BW6 A;  3IWZ A;  2HQR A;  4M6V A;  5ILU A;  1Y1V J;  2Q8K A;  1YJW I;  3BG7 A;  3J7A O;  3CC7 I;  4HOB A;  1W36 C;  5LHG A;  2F5F A;  2QQ8 A;  2DA1 A;  3BJ6 A;  1RI7 A;  1X1D A;  1K4T A;  2GM4 A;  1KZH A;  3OSG A;  1R1T A;  2PMU A;  3N05 A;  2CH0 A;  1NH3 A;  2B63 J;  3S8P A;  9ANT A;  1OCO H;  4HLY A;  4FIS A;  4QIW N;  5DS9 A;  2M8G X;  3OYD A;  4EGZ A;  1TL8 A;  1K79 A;  4LG0 B;  2E5Z A;  4E7S A;  2IW5 A;  3FIS A;  2DOE A;  2XGC A;  2R7R A;  3ZP5 A;  3C2B A;  1GHC A;  1F9N A;  1MMA A;  1QZE A;  4N4N B;  4BE1 A;  1LDJ A;  1TTY A;  3V8J A;  2O7O A;  4CO8 A;  5B1A H;  3BG6 A;  1RZ4 A;  2JA8 J;  1K78 B;  2MBF A;  3EET A;  1CF7 A;  3CMM A;  3EUK L;  5EGO A;  3MFK A;  3QRF F;  2IBD A;  2FNP A;  2IEK A;  2ZNZ A;  1VQN I;  2JA5 J;  3QAH A;  3MCZ A;  1R9T J;  4C9Y A;  5FKO A;  2DI3 A;  3GUD A;  3CJN A;  1KU2 A;  2GOX B;  3LSH A;  4BUP A;  3I55 I;  2R5Y A;  2RNG A;  1U8B A;  2K7L A;  1ZAO A;  2EIK H;  2JPB A;  1JT6 A;  5FLX K;  4DIQ A;  1DP7 P;  2KJB A;  1IZ1 A;  3SYT A;  4MLO A;  1O57 A;  3I0T A;  1MD0 A;  1GV2 A;  2HQ5 A;  2Y0S N;  4F3Q A;  1O3Q A;  2VQH A;  1ERD A;  2TDX A;  4BE0 A;  4Y15 A;  3LOC A;  4M6X A;  1FPQ A;  2CFX A;  4KT5 C;  4AU7 A;  1BI2 A;  4XKC A;  1LFU P;  4BL0 B;  3L2R A;  1G3Y A;  2RV8 A;  5D6E A;  3DPL C;  3DU6 A;  3K4L A;  2O0Y A;  5FFZ A;  1MMD A;  1F4K A;  3L2C A;  2X1C A;  1N75 A;  2A69 F;  1QPM A;  2LK2 A;  4AIK A;  3GTL J;  1JKQ C;  4M3D A;  2VBY A;  3ZQH A;  2LLK A;  3G73 A;  5IY5 H;  2W82 A;  3ML6 A;  4Q4Z F;  2LY1 A;  4I01 A;  4I98 B;  5IYC J;  2XV4 S;  3RKQ A;  2MYS A;  2M30 A;  1Y56 A;  3MKZ A;  1G4D A;  4X0G A;  4XKW A;  1WI3 A;  4YFN F;  2Y75 A;  1CF7 B;  1FNN A;  5EGO B;  1ZHF A;  1GV5 A;  3NWS A;  4KMU X;  2DJI A;  2P4W A;  3GTO J;  4F52 A;  2HS5 A;  4MQ9 F;  3AKZ A;  1T8I A;  1HKT A;  1XGS A;  3G71 I;  1RPW A;  4JX4 A;  2K5C A;  3RDI A;  2V4J C;  2VON A;  2R5Y B;  3LFK A;  2W85 A;  5E8G A;  1YRN B;  3GFM A;  3JRI A;  4P9F A;  2V1D A;  5FKL A;  5D5V B;  3WGI A;  1D8J A;  2HWV A;  2XKP A;  5JI6 A;  3UR3 C;  2HOA A;  3BDD A;  1I27 A;  2D2W A;  4XLA A;  5H20 A;  2EZH A;  4IPA A;  3H1C A;  1WH5 A;  5KNL A;  5TIS C;  5HLH A;  1IXS B;  2HZT A;  3K70 D;  4A3G J;  3I53 A;  1XD7 A;  4GO1 A;  4XM3 A;  2DA3 A;  1O7L A;  4OIQ F;  3QP6 A;  1FOK A;  4YEJ A;  5LLQ A;  2PJP A;  5EZH A;  1TT0 A;  5F6F A;  5CVI A;  5ICG A;  1X3Z B;  1D0X A;  1K7A A;  5EEA A;  1XSD A;  4M3E A;  2DMQ A;  1JE8 A;  4A0Z A;  1PYV A;  5GP9 A;  4BU2 A;  2VKV A;  2E7W A;  4L0Z B;  2EA2 A;  1DDN A;  3IHU A;  4PGG A;  3D1N I;  2ZJP F;  1IDY A;  1Q1V A;  1V5G A;  1FMV A;  3JSO A;  3DKY A;  3ZQC A;  1OCT C;  3ZCO A;  2OZ6 A;  4OIN F;  4Y33 A;  2XGE A;  1LVK A;  4GCV A;  1HKQ A;  3P5J A;  2LF7 A;  2DN0 A;  1X4O A;  3SZT A;  1IRG A;  3KZY A;  2A05 A;  5LGU A;  3JAM K;  1U9N A;  1ZGJ A;  2MLG A;  2VXD A;  3OOU A;  4IQJ A;  4X1E A;  2MW8 A;  3ZMD A;  1OPC A;  4A12 A;  1TNT A;  3PO2 J;  2M45 A;  5L3G A;  2VBW A;  2NVY J;  3RTR A;  5EG0 A;  3VYR B;  1SVL A;  1HXD A;  5DCM A;  4TV7 A;  1TWG J;  2ECB A;  2V9P A;  2F5V A;  2STW A;  2IA0 A;  1ZRD A;  4BHB A;  2IRF G;  2YU9 J;  2E5N A;  2BYV E;  2JZY A;  1B9N A;  4D1Q A;  2BXY A;  4O3M A;  4IRH A;  3FMR A;  1Y39 A;  2L9N A;  1BJZ A;  2VKE A;  2M4K A;  2E19 A;  5A2Q Z;  1KA8 A;  3OL4 A;  3EYI A;  4XL9 A;  2HKO A;  1W1W E;  4UHT A;  4L9N A;  4MO7 A;  1LDD A;  2FOK A;  4HV5 A;  1U0J A;  3JRG A;  3MKW B;  1R5G A;  3DTI A;  2IA1 A;  2LDU A;  3V42 A;  3MZH A;  4L0Y B;  3GVA A;  1DU0 A;  5J8F A;  5J1R A;  2VKH A;  2LF8 A;  1HQC A;  4EEF G;  5FO5 A;  1FJL A;  3E1S A;  1YYV A;  2W00 A;  2DT7 B;  1LDK B;  3BRO A;  4KA4 A;  3V7S A;  4Y17 A;  3R60 A;  3BTJ A;  2QWW A;  3KP3 A;  2VJJ A;  3C1D A;  4ZC3 A;  1I6X A;  4A3D J;  2MD0 A;  5IOY A;  3L09 A;  4UVA A;  1T6S A;  1W7P D;  4HNV A;  4G7H F;  2KHM A;  2Z3Y A;  2DFF A;  1YS7 A;  2O5R A;  1X4P A;  3OMY A;  4Q47 A;  1K6Y A;  1K78 A;  2A3S A;  2K02 A;  2JN6 A;  4XOT A;  4UV9 A;  3E6D A;  2KP6 A;  3GLX A;  4FCY A;  1Z7U A;  2HQN A;  4L5I A;  2X85 A;  3S3M A;  3HJE A;  4HQE A;  1HW5 A;  1IN4 A;  5DTD A;  4A3B J;  2XRO A;  5EG0 B;  2K9S A;  2DFI A;  1IN5 A;  1X58 A;  4M6Y A;  1BR4 A;  4CCM A;  2ISY A;  5DCM B;  2EFQ A;  5CQE A;  3Q3S A;  2V9K A;  3KZZ A;  4LGW A;  4XMY A;  3PNV A;  3CJR B;  4LJZ F;  2D1H A;  4RM2 A;  4A0Y A;  1TQI A;  3IH3 A;  2P5V A;  1Q1H A;  4NC7 A;  2KFD A;  5EJC A;  1TWH J;  4AVZ A;  2F6C A;  3HSF A;  2EK5 A;  1B4A A;  3HOY J;  2OD5 A;  3P9K A;  3ABM H;  3H92 A;  3LSK A;  5BQT A;  2IS1 A;  3HUG A;  1X1P A;  1S9H A;  3FWE A;  1JUS A;  3AL0 B;  5HLG A;  2XRL A;  1S3J A;  2BGC A;  4PZJ A;  1W5T A;  1YIO A;  5FKN A;  5J3L A;  4BDZ A;  2W84 A;  5E1W A;  3E6M A;  3WTW C;  3LMM A;  2E71 A;  2ZXJ A;  2PLY A;  1UST A;  4HF0 A;  2GA1 A;  4V2F A;  3B73 A;  5FKK A;  2LBF A;  4RAZ A;  5BOX A;  5IT9 K;  1FWZ A;  3M8F A;  1FOX A;  5HS8 A;  1X1C A;  1V55 H;  2DU9 A;  1ZH5 A;  3FKJ A;  3ZXS A;  1MNE A;  2JA6 J;  4NC8 A;  4JYK A;  1ZRE A;  1WCM J;  4BY1 J;  2CJJ A;  1TWA J;  4U88 A;  2CQN A;  3OYH A;  2CUE A;  4UNO A;  2E1O A;  2E60 A;  4U7D A;  2Y30 A;  3RKY A;  2QZ8 A;  1ZR2 A;  3SHF A;  3BP8 A;  3IKT A;  4RMN A;  2KZG A;  2A68 F;  4BEH A;  4RB3 C;  4OMZ A;  4IOC F;  4CCK A;  3VYU B;  3RI4 A;  2HYF A;  1H9G A;  1W0U A;  4L5E A;  2E1C A;  4CXF A;  2GA2 A;  3KLO A;  4G8X A;  4LB6 B;  4XBF A;  4ANJ A;  3MKY B;  3ZQ7 A;  2GXB A;  1HC8 A;  4EVI A;  2CRG A;  2K9L A;  3LQQ A;  4NHJ A;  5M3M J;  3M07 A;  3HKZ N;  3JTG A;  2ETH A;  2VIX A;  3O6B B;  3U1D A;  3OY9 A;  1YX3 A;  2K9N A;  4BQQ A;  1J5Y A;  4XOR A;  2R7W A;  5F0H A;  1UZC A;  1W0T A;  3HUG B;  3CCJ I;  4CSW A;  1XMX A;  2XPW A;  4G7Z F;  5LHI A;  5FJ8 J;  5EEG A;  1JHH A;  2Y31 A;  3HRS A;  2IS2 A;  3WHB A;  1IO2 A;  4JX6 A;  5F64 A;  3R61 A;  3G3Z A;  3K4K A;  4HF1 A;  2HXI A;  2LBF B;  2ZSI B;  3SXY A;  2Z33 A;  4A3J J;  2ZB9 A;  2ICW G;  3OS0 A;  5E18 F;  2BV6 A;  3QWL A;  1R4N B;  1VQ7 I;  3J7Z I;  3CCE I;  3N97 A;  3RCO A;  1ETX A;  3H36 A;  2L54 A;  2V9V A;  3CCV I;  2B0L A;  3CTA A;  1BR2 A;  3PO3 J;  1IUF A;  1Z6T A;  4U87 A;  1VQ6 I;  3CDI A;  2OCE A;  3I56 I;  1XN7 A;  1ZRF A;  1YW9 A;  2BY1 A;  2JVG A;  2UUZ A;  1BI1 A;  5J8C A;  4MEX F;  4BEH B;  3S2D J;  2BW3 A;  2MG4 A;  2HXO A;  5C4J J;  4GDF A;  3HL2 A;  4I7H A;  1MBE A;  3E6B A;  2K27 A;  2OQR A;  1WJC A;  4EM1 A;  4CZZ A;  2ZBK A;  3BPV A;  2VQL A;  2YSR A;  2CMP A;  2M87 A;  5E1X A;  2DOF A;  5D4R A;  1VF9 A;  3J7Y J;  2M4G A;  1NG7 A;  2W25 A;  2FQ4 A;  3BTL A;  4HW0 A;  1HW1 A;  3A0H C;  2AHQ A;  4A2U A;  4YIR X;  2WA0 A;  1ETV A;  2HVS A;  2XAG A;  5K5R A;  3GXO A;  2NVU B;  3COA C;  5F08 A;  4G12 A;  1IN8 A;  4WF2 A;  4FET A;  2KRC A;  2KIQ A;  4BY7 J;  2DOD A;  5FKM A;  4Y4R A;  3GFL A;  1KQ8 A;  4ZZD A;  2O3F A;  3E5X A;  2R7U A;  1EH6 A;  2ID3 A;  2JVH A;  2W4S A;  1H8A C;  4M9S A;  2A61 A;  1IDZ A;  2A6T A;  2K85 A;  5L3B A;  3EYY A;  1JXS A;  4MFE A;  3ULQ B;  3ZPL A;  2R7V A;  3GZ5 A;  3H3Z A;  2B7E A;  1S72 I;  1QU3 A;  3WE3 A;  3FF5 A;  4C3J J;  2VOP A;  2GOM A;  3S32 A;  3OYN A;  3HM5 A;  3H9J A;  4C30 A;  4AD9 A;  3DPU A;  4D5F A;  1XB4 A;  3I54 A;  4PK4 A;  3GZ6 A;  3DTE A;  3A03 A;  1U5T C;  4RGS A;  3K4N A;  4DYQ A;  3EQL F;  5E3O A;  3CDH A;  5LGT A;  3BY6 A;  2PN6 A;  1NK3 P;  3CF2 A;  5IYD J;  2KIU A;  5D8L B;  2BW3 B;  3A1Y A;  1PP8 F;  3DKX A;  1FP2 A;  2DYS H;  1MNM C;  3QYF A;  2L7F P;  3K2Z A;  3S2H J;  1RKT A;  1ZG3 A;  3D5L A;  1YG2 A;  4C2T A;  5E3N A;  2XF7 A;  3CUQ A;  4M9Z A;  3NAU A;  3K1M A;  2QM3 A;  2DBB A;  2CQX A;  3HIF A;  1XGN A;  5K5Q A;  2JTV A;  3HG9 A;  4ZTF A;  4L18 B;  4MNU A;  3D0S A;  2NVX J;  2W48 A;  1ZG1 A;  3SJM A;  5CPR B;  3DFG A;  1F36 A;  4B4C A;  3L2Q A;  3F21 A;  5HDG A;  3TP0 A;  3OIP A;  1HBX G;  4M3B A;  4HDV A;  3Q9S A;  4OOI A;  4NB5 A;  1FT9 A;  5J6X A;  3K0L A;  4IXA A;  4U0W A;  2P0W A;  3V7R A;  2UWM A;  3LSG A;  5CVV A;  2DA7 A;  1VQL I;  4DGW B;  2YX4 A;  3G1L A;  3LST A;  2HZD A;  3LSM A;  1DGR M;  1VZ0 A;  1E2X A;  3G2B A;  4AYB N;  3TL4 X;  5GTI C;  1WPK A;  1ORK A;  1TQP A;  2IJL A;  2OTJ I;  5FRN A;  1WHU A;  2DA2 A;  4XLC A;  5E3M A;  1XCB A;  1T38 A;  1J09 A;  2HQA A;  3S16 J;  3M1E A;  5IP7 J;  3RIR A;  2CGP A;  1P92 A;  3OR1 C;  2YX7 A;  1R71 A;  1FOW A;  2EZL A;  4D0P A;  1ULY A;  3HOZ J;  1BW5 A;  3A02 A;  1FTZ A;  1OLT A;  2EH3 A;  3MD2 A;  1MBH A;  1OFC X;  4BYY A;  1A6Q A;  3CUQ C;  4HX8 A;  4AUX A;  3HOT A;  2LKP A;  2RNJ A;  3OIQ A;  1RNL A;  3W3C A;  1P4A A;  3B6A A;  1OMI A;  1RUN A;  2FOW A;  4F91 B;  2XAS A;  3CZ6 A;  2P6T A;  3CUQ B;  4C2U A;  5F0C A;  1JUM A;  3DP7 A;  1SFU A;  2M0M A;  2M1B A;  3T8R A;  3QQA A;  2QLZ A;  4KDP A;  1PUF A;  3OS1 A;  3H5A A;  3OYE A;  1LQ1 A;  1FBQ A;  3LL7 A;  1UHM A;  2IGO A;  1APL C;  1RUO A;  1TC3 C;  1QNT A;  2A6H F;  3CME I;  2OUM A;  3KZI C;  1JKO C;  3HZJ A;  4WXD A;  4A5M A;  4ZH4 F;  1T0F A;  1B9M A;  4JQF A;  1FBS A;  3RSN A;  1HA8 A;  1IRZ A;  4IHY A;  3HOU J;  3FBI B;  4XRF A;  3ESW B;  2FUG 2;  1O4X A;  4OAY A;  2IA2 A;  2CS3 A;  4XK4 A;  3S14 J;  3BJO A;  2P6S A;  1ETK A;  2VT2 A;  3BQY A;  2LD5 A;  2Y0S A;  6PAX A;  3DQV C;  4I76 A;  2GQQ A;  3M9A A;  4UUT A;  2QCO A;  4B3X A;  3BWG A;  1MZB A;  5FGM A;  1IV6 A;  2FD5 A;  2GIZ A;  1J9I A;  2NOJ B;  1R49 A;  3BZC A;  3K6G A;  3P9C A;  2EIJ H;  4G9Y A;  5HOO A;  1OQY A;  5A2Q K;  1REP C;  2IT0 A;  2VN2 A;  3CES A;  5DDG A;  4UXN A;  2L7M P;  4RM3 A;  2EFO A;  3UNG C;  1FLI A;  4XN0 A;  1OYY A;  3AG1 H;  2JUG A;  1B1B A;  2YS9 A;  2ZNY A;  4DNC A;  3Q0W A;  2IP2 A;  2EIN H;  3BC8 A;  2M5W A;  3IH2 A;  3H3V K;  2F5C A;  4JBA A;  4YFK F;  3HTS B;  3E6C C;  5FB2 A;  1J0R A;  3ISP A;  2XC7 A;  1K61 A;  1SMY F;  3M1C A;  2X4H A;  2HOE A;  1MMG A;  5E79 C;  2R0Q C;  1B8I A;  4LB5 A;  3J80 Z;  3HDD A;  5KVR A;  5EZG A;  2OBP A;  3BG5 A;  2NRA C;  4IOA F;  3SDG A;  4XRM A;  1WJB A;  2LTP A;  1BM9 A;  1T2K A;  1T0F C;  2R3S A;  1PUF B;  3FBN B;  2OA4 A;  4EM0 B;  5DM7 F;  4KIB A;  5C4X J;  2XF6 A;  4OIR F;  2HTJ A;  4DZJ A;  2CU7 A;  4FE7 A;  1ITY A;  3ASN H;  3BQZ A;  1OR7 A;  2HNH A;  3PNT A;  1WJE A;  2G0E A;  4ZYA A;  2QEX I;  2A5W A;  2JT1 A;  1Y1W J;  1W5C C;  3PFY A;  3F8M A;  1JKR C;  4IHW A;  2KDO A;  1ENH A;  3HB9 A;  2HR3 A;  4GXO A;  1YS6 A;  1KQ0 A;  4CZC A;  2X9D A;  3KEQ A;  3L9F A;  1BOB A;  4Q5S F;  4GYI A;  2PI0 A;  1J7K A;  2ME0 A;  2BY3 A;  2EV5 A;  1LFB A;  1XMA A;  2F4I A;  2N8G A;  3KEO A;  2TRT A;  1YRN A;  1IGN A;  3ROU A;  5J1U A;  2JPC A;  4BJ6 C;  5TJJ A;  1XC5 A;  4ZDL A;  1LEA A;  2YR2 A;  3LA3 A;  1VTN C;  5M5W J;  4KIT B;  3S3O A;  4LFU A;  3MMY B;  2DCE A;  1MMN A;  2LG4 A;  2VJ5 A;  2R7Q A;  2KPM A;  1CQT A;  2K4J A;  2MGQ A;  3G1M A;  1KQ9 A;  5D5X B;  3A2K A;  2QF7 A;  3JRB A;  4UVC A;  1O3S A;  1BI0 A;  1YO5 C;  2JUC A;  3ABK H;  1POG A;  3WTV C;  3J81 Z;  1Z0X A;  5HLI A;  1B8I B;  1I3A A;  2AO9 A;  2DMN A;  3PFI A;  2W1O A;  2K40 A;  1OR7 C;  4I09 A;  2X51 A;  1J2X A;  1ETO A;  2ZFU A;  4Y13 A;  3JSP A;  5FD6 A;  1Y6I A;  1KGS A;  4PJL A;  3W2W A;  2H6B A;  2PMZ N;  5M5X J;  4EJO A;  2CW8 A;  4LIV A;  2XRN A;  3KP2 A;  3SDB A;  3D5S C;  5H6Q A;  1SFX A;  4EMS A;  3NAR A;  1MIJ A;  2HDC A;  4BJ5 C;  2AQF A;  1Z3X A;  2J5P A;  1LE8 A;  4CYC A;  4DJA A;  4V19 K;  1AOY A;  3KCC A;  1HKS A;  3NQO A;  4HPQ A;  3QOE A;  4NDL A;  2QQ9 A;  1S8N A;  1DU6 A;  4EQQ A;  3M4O J;  2H8W A;  4P96 A;  4WX9 A;  1DUX C;  1EKE A;  1FP1 D;  4WK8 F;  3VB2 A;  4GFB A;  2ZO4 A;  1FZP B;  2HPI A;  2OCC H;  5EEH A;  3CMA I;  5HS7 A;  4HF2 A;  2FNA A;  3PIO F;  3D5R C;  4IQ4 A;  3WU0 A;  3A0B C;  3K4M A;  3H0G J;  4LMY A;  5DUI A;  4PJM A;  1QO0 D;  4OAZ A;  4N9H A;  2V6E A;  2L3D A;  5JR3 A;  1WJF A;  1FBU A;  2DA5 A;  5LRS A;  1J75 A;  1P2F A;  2VKD A;  3S17 J;  3VSL A;  3GTG J;  2IVM A;  1D5Y A;  3HXL A;  2Q0O A;  3I58 A;  1R7J A;  2XAQ A;  3FXR A;  5C3E J;  2WB1 A;  4HA8 A;  1PJR A;  1XSX A;  3F6V A;  3B6C A;  2D1V A;  1JJ8 C;  2K4B A;  2VJI A;  3IH4 A;  4CUG A;  1TNS A;  4A3K J;  4XR6 A;  3OYM A;  2H27 A;  1U9O A;  2XKO A;  4CDG A;  4HEA 2;  1G6N A;  4BGD A;  1W5S A;  5GAH J;  2GWR A;  1TBX A;  1BN5 A;  3S15 J;  1XSV A;  5B66 C;  1YX5 A;  2Y9Y A;  2H09 A;  2LY2 A;  3GME A;  4PGH A;  1KU3 A;  4UY8 I;  1O7F A;  4DW6 A;  2JMW A;  2D45 A;  1R5H A;  3BR1 A;  4CYC B;  1LE8 B;  4J19 A;  4IO9 F;  3PL8 A;  5DUK A;  2X0L A;  2XSJ C;  2Y0M A;  4KJZ A;  3TED A;  5L3C A;  2K9M A;  2M7B A;  2OU2 A;  1XGM A;  3O3K A;  2E35 A;  4UB8 C;  5IOZ A;  3GFI A;  5HNH A;  3F8C A;  4D7M A;  1QHG A;  4BH9 A;  3V8K A;  2UXN A;  1TT5 B;  1STZ A;  1XTA A;  2FBK A;  3NWT A;  4IVN A;  3ZMU A;  3KEY A;  2RQQ A;  3G1O A;  2GIV A;  4XSX F;  1MH4 A;  1ON2 A;  3V7C A;  3Q0V A;  4KIG A;  4BS9 A;  3SZP A;  1JJ6 C;  1ZG5 A;  4EAT A;  2G9W A;  2NYX A;  4MIM A;  3WU2 C;  4UV8 A;  2JSC A;  4EM2 A;  3L2W A;  3BR5 A;  2HTS A;  4XN3 A;  5IT3 A;  4FAS D;  5TRD A;  3DTK A;  5J1Y A;  5JFR A;  4LLN A;  2NVT J;  2J5O A;  4PJ0 C;  1R36 A;  5ILV A;  3BR6 A;  3K4J A;  3RYR A;  1R00 A;  2BY0 A;  3CLO A;  1ZLK A;  1T33 A;  4XRS A;  3LSP A;  3REO A;  2PFB A;  3SFZ A;  4MQV A;  5FLM J;  3RZO J;  1JKP C;  4G6T B;  5CJ9 A;  3GFJ A;  5HVQ C;  3GBG A;  3HTU A;  1G2H A;  1YQA A;  3CO6 C;  1GDT A;  2KRF A;  2ESN A;  2UV1 A;  3M7G A;  1KU7 A;  2E1N A;  1DPU A;  3KYC B;  3HSR A;  4IX7 A;  2V1U A;  2QUF A;  1ACI A;  3H5N A;  2FX0 A;  2MH9 A;  1P6R A;  4A93 J;  2EFP A;  4KMF A;  2PEX A;  3C7J A;  2QEN A;  1VQ4 I;  5F1J A;  3HKZ A;  5D6F A;  4BAY A;  1XDS A;  3KYL A;  2DK5 A;  4EGY A;  4ZJZ A;  5E1Z B;  4ESJ A;  2EJR A;  3MWM A;  4MHG A;  3EUH A;  3GX4 X;  1VQ9 I;  1S6L A;  3AL0 C;  1HCR A;  2Z9O A;  4XQF A;  4XKB A;  1K83 J;  4B47 A;  1S29 A;  3IUO A;  2MLK A;  2VPL A;  2TCT A;  2F5E A;  1V3F A;  1NTC A;  4RA2 A;  1JTX A;  2C6Y A;  3CJQ B;  4M3F A;  3BLY A;  2KZV A;  2F2E A;  4IRG A;  5D8K B;  3HHH A;  2VC0 A;  4MGR A;  3TMO A;  3F23 A;  3IL2 A;  4HNU A;  1YJN I;  2G7U A;  2P7V B;  2OQG A;  2XVC A;  3HOW J;  4RBO A;  1EV7 A;  2EZI A;  3ERE D;  3C2H A;  2DMU A;  3FM3 A;  4XLF A;  4N9I A;  4Y52 J;  2XUB A;  2L02 A;  4A6D A;  1X2N A;  3CCL I;  1BI3 A;  1UHW A;  3R4K A;  1U8R A;  1I1G A;  2ZME A;  4CCL A;  1RET A;  2XB0 X;  3WTZ A;  3JRC A;  4JP0 A;  3BTC A;  3HOS A;  4G6D A;  3OL3 A;  1FMW A;  1X3U A;  1YE9 A;  2XSD C;  1G3T A;  4UB6 C;  2XAU A;  4BAC A;  1WI9 A;  4XRS G;  4EJV A;  4QLC U;  3C2G A;  3TO9 A;  3NRV A;  1I5Z A;  2DFE A;  3W6K B;  3R0J A;  3E5Q A;  3EUH C;  1SD4 A;  1OCR H;  3GZN B;  4DBR A;  3CD6 I;  1LEB A;  1TWC J;  3O8H A;  2ZXI A;  3OYJ A;  4WWC A;  3KX2 A;  3IP4 B;  1BC7 C;  4HYE A;  3ZQI A;  4BHP A;  1XX5 A;  3WTT C;  1LPQ A;  4I6Z A;  3ERM A;  3KP7 A;  1TLH B;  2RKH A;  2WTE A;  4W97 A;  3VWB A;  4I0A A;  3B02 A;  2XAF A;  2JK3 A;  3JRH A;  1FSE A;  3BTI A;  4XLH A;  1A6I A;  5IP9 J;  2BVL A;  4RGX A;  1PDN C;  3EPZ A;  4IZZ A;  5GAE J;  2VOD A;  1X2M A;  3QU3 A;  2FU4 A;  4O6J A;  4QSH A;  3ZQG A;  3CP8 A;  4R1H A;  3DXJ F;  2F4M B;  1OYW A;  3PQK A;  3HRM A;  2ZFW A;  1WQ2 A;  1K4S A;  2BY2 A;  2E34 A;  1R58 A;  3R0A A;  4BJT A;  2MA3 A;  5K5O A;  2DTR A;  3ZQL A;  4S0H B;  1R1V A;  1I50 J;  4H0E A;  1N25 A;  2RAE A;  4FQG A;  2VAS A;  2ZME C;  5IP6 A;  3OSF A;  1XS9 A;  1SMT A;  2BOL A;  4HDU A;  1OCC H;  2VI6 A;  2CUJ A;  3K1N A;  2MC4 A;  2FJ1 A;  1NHA A;  2NNN A;  5DCF A;  3MAJ A;  2JRT A;  1SVO A;  2QSH X;  1KYZ A;  3AFH A;  2LRD A;  2V6C A;  3HRU A;  2CSO A;  2KJC A;  1P4X A;  2ZME B;  4N4O B;  3RPQ A;  1T98 A;  3FXJ A;  4BXU A;  3CCS I;  1VQ8 I;  3GTK J;  3FMS A;  3FHZ A;  3OYG A;  2L01 A;  2R7Z J;  1SC7 A;  1U6G A;  5CQG A;  3CC2 I;  3JRD A;  3O8G A;  1QHH D;  3PQJ A;  3FXQ A;  1FY7 A;  3KLN A;  2FML A;  4OWR B;  4A3M J;  3ZMZ A;  1FIA A;  1MBG A;  3CUO A;  5LEJ A;  3HPG A;  3OR2 C;  4NQW A;  2L5Q A;  1OJL A;  1UEL B;  5F1R A;  1JGS A;  5LFA A;  5HDN A;  4P55 A;  2VJ4 A;  4CCN A;  1FSH A;  3GF2 A;  2R5Z A;  1J59 A;  3J80 K;  5H2F C;  1D8K A;  4A3L J;  2ELK A;  1M1E B;  2DMP A;  1YJ9 I;  4H4K C;  3WOD F;  3EDP A;  2EV0 A;  3OWT A;  2KMU A;  1Z7L A;  1BL0 A;  2E2I J;  2JA7 J;  1Y0N A;  1AWC A;  1X1A A;  1MJA A;  4HBL A;  4BBS J;  5E8I A;  5KK1 A;  3WG9 A;  3BPX A;  4E70 A;  5CLS A;  4HZF A;  5J4V A;  3PSI A;  4AYB A;  3BR2 A;  1PP7 U;  3HPH A;  5GAD J;  1YLF A;  3CP2 A;  4I02 A;  2VL8 A;  1FTT A;  3FXO A;  5ERI A;  3I3L A;  3H3U A;  5HS9 A;  4IRI A;  1E0E A;  4G7O F;  3JR9 A;  1YW8 A;  2CQQ A;  1UHS A;  2MH2 A;  3DCF A;  2GLO A;  5AIP A;  3F6O A;  1NG6 A;  2DAO A;  1UCR A;  2DT6 A;  1D1A A;  3S1M J;  3MKL A;  3HC7 A;  4U0Y A;  2QYO A;  4LG3 A;  3GTQ J;  3VDX A;  1FYK A;  5BS6 A;  2EQR A;  3FK6 A;  2Y48 A;  4OMY A;  2VPR A;  3M3Y J;  3CMY A;  4DZP A;  1BR1 A;  3TQN A;  4K2E A;  3FDY A;  3PUF A;  2OPT A;  3KP6 A;  2ADU A;  4LD5 A;  5JVT A;  5LD2 C;  2HU9 A;  4EJT A;  3CJT B;  4PCQ A;  3Q9V A;  4NQW B;  3J81 K;  3FIW A;  3GLL A;  2DW4 A;  3G6E I;  2R5Z B;  5DM6 F;  2VBZ A;  4KIS A;  3MZY A;  2A07 F;  1LKX A;  2JJ7 A;  4RGU A;  4XOP A;  3RKW A;  4CIC A;  2DMT A;  4FT8 A;  3T1B A;  1ZEL A;  4CCJ A;  2MAB A;  2P5K A;  3KPH A;  4U0V A;  3GTP J;  1IV8 A;  2QGU A;  4XID A;  1S5L C;  1E3P A;  1JUP A;  2GZW A;  4CHU A;  4ITV A;  2LSO A;  5F27 A;  4BDY A;  1I6H J;  1WJA A;  1R1U A;  2KL4 A;  3E5U A;  3GEZ A;  5C44 J;  3WGH A;  2DXI A;  2YPR A;  3I5U A;  4I99 C;  2JSP A;  4ON0 A;  5DEQ A;  4O5V A;  2NOG A;  2P8T A;  3G4S I;  4HRI A;  4ENM A;  2WAQ A;  3MN2 A;  4II3 A;  3QP5 A;  1MDM A;  3OV8 A;  3UKG A;  3JCU C;  5LHH A;  2DPU A;  3LSJ A;  3FKI J;  4HQM A;  4ZZL A;  2WAD A;  5K7F A;  2VE9 A;  4FX4 A;  2HVQ A;  4C2M J;  3W6J B;  2L2O A;  2OV7 A;  3DPT A;  2NS8 A;  4CYD A;  3F3X A;  4ESB A;  4J01 A;  5ICF A;  3BOQ A;  2XPV A;  4DYC A;  4B1R A;  3TOB A;  2FF4 A;  4UVB A;  1GVJ A;  5ICC A;  1CGP A;  2H8R A;  1Z67 A;  3OYA A;  3K1P A;  4LIU A;  1F43 A;  3WHC A;  2XGX A;  1XMK A;  4D5C A;  4G94 A;  4RB2 C;  4RS8 A;  2ZSH B;  2HGC A;  1SD7 A;  1TW2 A;  4M72 A;  1ZGW A;  3CC4 I;  2WAE A;  3RQI A;  1TZL A;  1WJ5 A;  4HSR A;  3DEW A;  2PQ8 A;  3GTJ J;  1BBY A;  3KP5 A;  5AON A;  1HW2 A;  4FTH A;  1VQ5 I;  3TP3 A;  1UB9 A;  1SFO J;  4Q48 A;  1ZR4 A;  2VOO A;  2ELH A;  3F8F A;  2KDZ A;  1R22 A;  1A36 A;  2QQA A;  2MC3 A;  2DT5 A;  2L4A A;  1DQU A;  3HHG A;  1MH3 A;  2MFZ A;  1AKH A;  1RES A;  2FMY A;  2LKS A;  3MQ0 A;  3ZMV A;  1VFC A;  1YI2 I;  4IHT A;  3L2V A;  1WH7 A;  3BJA A;  2W57 A;  1MDM B;  3S1N J;  2XIG A;  2F5D A;  1R4M B;  2DLL A;  2ESH A;  4V2G A;  4BHC A;  2BVM A;  3P7N A;  3K9T A;  2G7H A;  2HEO A;  3VEP A;  3DV8 A;  1LB2 A;  4A3F J;  1UAA A;  1LFP A;  4PUS A;  3S1R J;  2WC2 A;  2FEZ A;  3QOP A;  2CO5 A;  1WWX A;  1MBF A;  3QOD A;  2L0K A;  1D5V A;  3SEZ A;  5B5E C;  2Z2S B;  5E3L A;  3V8L A;  1QPI A;  5CVR A;  3QPH A;  1Z21 A;  5AIQ A;  3IRQ A;  2ZJR F;  3QPS A;  5JVG F;  5M3F J;  3S3N A;  2EB7 A;  2X1E A;  1G3S A;  3VYS B;  3N4M A;  1HSJ A;  2I5U A;  3WTU C;  2CV1 A;  4BQA A;  5LGN A;  1EH7 A;  2LVS A;  4QTR A;  2CQK A;  5KCM A;  2QA4 I;  3VYT B;  2KT0 A;  1N78 A;  4ESF A;  4II2 A;  1ETW A;  1ETQ A;  4MTE A;  3HBL A;  2E2J J;  4R79 A;  4E6K G;  2DTZ A;  1YOV B;  4RAY A;  1R23 A;  4ZYG A;  3FK7 A;  3QYB A;  2EA4 A;  3RPU A;  2YU3 A;  3M8E A;  4F93 B;  4YEL A;  5KHD A;  1ETY A;  5ILS A;  3S93 A;  1ZGA A;  1T95 A;  4R8H A;  1YTY A;  1IF1 A;  1G59 A;  5KAI C;  3CLQ A;  3IAS 2;  4PSX A;  2X6X A;  3OYF A;  2O9L A;  2PJR A;  1AKH B;  3I4P A;  4A3E J;  3JW4 A;  4P9U A;  2KRH A;  5EDN A;  2PX9 A;  4L9V A;  2VUM J;  1IW7 F;  1QRY A;  2WBM A;  1P4W A;  4IJA A;  1EH8 A;  2Y69 H;  2DK8 A;  3GCM A;  5KAF C;  3X2Q H;  2V1N A;  2IPQ X;  3ABU A;  2Z1D A;  1ZN2 A;  2K3F A;  2R7F A;  4ENJ A;  1I3Q J;  5CVU A;  3IV5 A;  2JRM A;  1QBJ A;  2DA4 A;  1MMS A;  5F0F A;  4KIF A;  3OYI A;  1MGT A;  3U21 A;  1X1B A;  2HKX A;  3ZGK A;  3A01 A;  2K86 A;  5GPC A;  1L3L A;  1A31 A;  4ENN A;  4ENK A;  2WAF A;  2QVO A;  1WVR A;  4XSZ F;  2BE5 F;  5B1B H;  2EV6 A;  3C18 A;  2M0C A;  5JHF A;  2AXT C;  1XCV A;  1HST A;  3KIO A;  4KFC A;  3FXL A;  2KIM A;  2FBH A;  2RN7 A;  2VXZ A;  3W2V A;  3PSF A;  1JT0 A;  2QSG X;  2E7X A;  3CCM I;  1P9Q C;  2FXA A;  2GXA A;  1Y0U A;  1OCP A;  2VB6 A;  2L7Z A;  2CG4 A;  3DLL F;  2IAI A;  1TW3 A;  2ZJ2 A;  3OYB A;  2O61 A;  3EUA A;  2HDW A;  2I10 A;  4F55 A;  2K9Q A;  3DEU A;  5ICE A;  3GW2 A;  2COM A;  4E4H A;  2KLO A;  2XB5 A;  3LFU A;  2FE3 A;  3LAP A;  3VPR A;  3I4M J;  3OIO A;  2HOS A;  2IS6 A;  2HI3 A;  4E7K A;  2WV0 A;  2ZXH A;  3DEE A;  4HG2 A;  2Q1Z B;  5K7H A;  3VOD A;  1JGG A;  1IRX A;  3FX3 A;  2RRE A;  2PJR B;  3ELK A;  4XLP F;  3K4C A;  4GYG A;  2KQR A;  2H6C A;  2RGV A;  3L1P A;  4JX5 A;  3LSI A;  1EA3 A;  1Y8Q B;  2PBI A;  5FFX A;  4IEJ A;  5IYB J;  3C3W A;  2XGD A;  1MJB A;  4IL6 C;  2EBI A;  4FX0 A;  1Z05 A;  2IS4 A;  5BNG A;  3WU1 B;  3ONQ A;  4Y7N J;  4PJN A;  1ZYR F;  4XNF A;  3A01 B;  2XF5 A;  1MBK A;  5J47 A;  5HDK A;  2HOT A;  2JWT A;  4YRV A;  3WTX C;  4YG2 F;  1YW7 A;  3ZN1 A;  5HOD A;  4QPO A;  4HAM A;  2D5V A;  1XDU A;  2XDV A;  3GO5 A;  1BC8 C;  2JQ7 A;  4FHT A;  4M3G A;  1IXC A;  1BIA A;  3CQZ J;  5B3S H;  1MSF C;  5FRM A;  3WTY C;  3TO7 A;  5DD8 A;  5EF6 A;  1B72 A;  2DOA A;  2QBY A;  5E17 F;  4Z6Y A;  3LQR A;  3TO6 A;  3SQN A;  1IC8 A;  3F9K A;  4Z2Y A;  3WG7 H;  4BQN A;  2BEO A;  2P7C B;  4F7Z A;  2FQ3 A;  2HDD A;  4NBQ A;  1YIJ I;  4RGR A;  2CUZ A;  2M34 A;  5GTH C;  1GXQ A;  3H9Q A;  4RLF A;  1XPX A;  5D5U B;  1H89 C;  3GWZ A;  2NXN B;  5JLW A;  3FXM A;  4KUM A;  2WV1 A;  1WGX A;  4BE2 A;  2R7S A;  1BOA A;  2ZJQ F;  4KIC A;  3BZK A;  4AIH A;  3JRF A;  2L9S A;  4XKV A;  4A3I J;  1QGP A;  3WE2 A;  2OF7 A;  2JA2 A;  4ZDO A;  4LLG F;  1X3W B;  3ECH A;  5L3E A;  2HFH A;  2BBY A;  1ZK8 A;  2K3P A;  2PG4 A;  1O3T A;  3WTS C;  2W24 A;  4ZYE A;  1ON1 A;  2NNY A;  3QPT A;  4CA0 A;  2FSW A;  3ZOB A;  1D1B A;  5CYV A;  5JHU A;  2H1K A;  2O8K A;  1D3Y A;  1Z6R A;  1D1C A;  2DO7 A;  1U2W A;  3E97 A;  2FBI A;  3FXU A;  4LOC A;  1GVD A;  4OIO F;  1AA7 A;  4ASN A;  4B43 A;  1C0W A;  1IN6 A;  5DD4 A;  4YII A;  3ZQF A;  1WZ2 A;  3HGG A;  4IKF A;  4RLQ A;  2BHY A;  4UUV A;  3DWL E;  3PIP F;  1IN7 A;  3LAJ A;  4J00 A;  3QYE A;  1E3H A;  1B72 B;  2QBY B;  2ELJ A;  2R7D A;  3K7A J;  4M9X A;  3MVP A;  4WXC A;  3MEX A;  4QPQ A;  2LP0 A;  1OIS A;  4RB0 A;  1SFK A;  5LEK A;  4U7B A;  2R7O A;  4PFO A;  3JRE A;  1RR8 C;  3VSK A;  1IUY A;  1QZY A;  3Q5F A;  5TGT A;  3K69 A;  3DBL B;  4MEY F;  3BT9 A;  1SAX A;  2LNB A;  2V26 A;  4PJJ A;  3BR0 A;  4FE4 A;  2VT3 A;  1H88 C;  3KE2 A;  1V5E A;  1TP4 A;  2E36 A;  4E7I A;  2CQ7 A;  5IPA A;  4KT6 A;  1HOM A;  2L9V A;  4HX7 A;  2NAZ A;  1SEU A;  3QU6 A;  4EJU A;  4S05 A;  1AHD P;  2WB1 N;  2RVC A;  4PSW A;  3KFW X;  2DPD A;  1P7I A;  1QQI A;  3BG9 A;  4NNJ A;  4B8X A;  4G6Q A;  1A04 A;  2CWE A;  4P5O A;  2ZXW H;  1SFE A;  3H5R A;  3I4N J;  2M8E A;  2R4G A;  3FM5 A;  4B44 A;  3L00 A;  4AVP A;  4XLN F;  2NS7 A;  2X6O A;  2R7T A;  4JOM A;  2RC4 A;  1SD5 A;  3TOA A;  5FLV A;  3AAF A;  3SFI A;  4W1U A;  1VQO I;  2VLA A;  4UUS A;  2WWY A;  1YHQ I;  2ZC2 A;  3K70 C;  2ZKZ A;  1SAN A;  2M3A A;  3MZ8 A;  3SEQ A;  2I8D A;  1LJ9 A;  3CCU I;  4D9J A;  5CKT A;  1L0O C;  3H35 A;  1FC3 A;  3HRT A;  4HV6 A;  1A5J A;  2X48 A;  1VND A;  1VI0 A;  1GXP A;  2M9H A;  4BNC A;  3RQ4 A;  5L3F A;  4RAF A;  3RYP A;  4KN4 X;  3U9G A;  4DQ2 A;  4DBQ A;  3IRR A;  2HYG D;  4C3I J;  1IJW C;  1H0M A;  5BPI A;  3FZV A;  3DBH B;  4JK1 X;  1RR7 A;  3LWF A;  5FLX Z;  5BPD A;  1UG0 A;  1RC9 A;  1UJ8 A;  2BHZ A;  4L5J A;  1WRJ A;  2AQE A;  4RAG A;  3TBI A;  4M73 A;  5FRO A;  4F92 B;  5HNF A;  1IXR C;  1YIT I;  2LYC A;  3ABL H;  3HGY A;  2DA6 A;  1GT0 C;  4NUB A;  2UXX A;  4NC6 A;  2GAU A;  5F04 A;  1WKM A;  3LA2 A;  1W7P A;  5DYM A;  2COB A;  4A0X A;  2IGN A;  2UZK A;  1ZRC A;  4BQO A;  1VQK I;  1ZKG A;  2MD5 A;  1MW7 A;  3NEU A;  1RKW A;  4CCO A;  4EV0 A;  1EF4 A;  1GUU A;  4M71 A;  3S2W A;  1KU9 A;  2MSY A;  2XAH A;  3LNQ A;  5ED4 A;  1I1S A;  3RKX A;  4B09 A;  3J7A Y;  1FYL A;  2IGK A;  4Y3O A;  4E7Z A;  2EFN A;  1ZAR A;  3TW6 A;  1IG7 A;  3P9I A;  3S1Q J;  4OU0 A;  4WCG A;  4PDK A;  4UUS B;  1LVA A;  2M7A A;  2X6W A;  4MFD A;  1FEX A;  3L7W A;  2A5Y B;  4XLE A;  1HF0 A;  4KYW A;  4BBR J;  1U78 A;  2DQL A;  3DU5 A;  2OJE D;  4A69 C;  2LFB A;  1USS A;  3W6V A;  1S7A A;  4KN7 X;  4N0B A;  3F0C A;  1DP3 A;  1DGW Y;  2WY7 Q;  3BCB A;  3CCY A;  5GPA A;  2HYJ A;  5FD5 A;  1WJD A;  2A6E F;  2LRE A;  3BCA A;  4WXH A;  2OAZ A;  3ZMS A;  4A5N A;  3KYD B;  3Q0U A;  3K2A A;  3I59 A;  1JHF A;  2EWN A;  2CW0 F;  4AIJ A;  3CF5 F;  4L9T A;  1TWF J;  2QQB A;  2CFO A;  1Z9C A;  2V7F A;  1W7P B;  3TDU C;  2W7N A;  2F4O B;  4HX4 A;  1BJA A;  4E7L A;  1T56 A;  1SD6 A;  1LNW A;  4XIC A;  5J4Y A;  1D0Z A;  1SVM A;  4BKX A;  4CGZ A;  1KYW A;  3F8B A;  4GRI A;  2X1D A;  2AS5 F;  1EJ9 A;  1N77 A;  2QKL B;  2BXZ A;  2P81 A;  3IAM 2;  3AG3 H;  4B3A A;  3CCQ I;  4IHV A;  4AM3 A;  3HOV J;  2ID6 A;  1VQM I;  3AG2 H;  5JLX A;  1R5I D;  1X19 A;  3ZR8 X;  2DDB A;  4BXX J;  3VFZ A;  1MJ9 A;  4KNY A;  4E7H A;  5K7Z A;  2ECC A;  2PMH A;  1Z91 A;  2DFH A;  1FOY A;  2RQP A;  3DKW A;  3JAM Z;  1ZQ3 P;  4M74 A;  1U5T A;  2EZK A;  5DV5 A;  2LH9 A;  3WGG A;  4GGG A;  1TQM A;  2Y2Z A;  3PUB A;  1O3R A;  1DPR A;  1W4M A;  4HLX A;  2Z16 A;  3E3V A;  5D5W B;  1NK2 P;  5E20 A;  1V5F A;  4ZTJ A;  4QWQ A;  1BIB A;  4I0B A;  3CDL A;  1V4R A;  3IC7 A;  2H1L A;  3U1K A;  1D0Y A;  1T39 A;  1Y8R B;  5D4S A;  5LBQ A;  4I2O A;  1A35 A;  2CUF A;  1V54 H;  3FMQ A;  3T0Y A;  2KIF A;  5K1Y A;  2M2E A;  2Q2E A;  1Z77 A;  4HST A;  1QZZ A;  1T08 B;  3I59 B;  3DF8 A;  2CV2 A;  4LLL A;  1JI8 A;  2LKX A;  2VC1 A;  2HVR A;  3O2P E;  4X6A J;  3L2U A;  1MSE C;  2LC2 A;  1ZTR A;  2ME6 A;  3ZMT A;  1GLN A;  2DQR A;  2H94 A;  2LY9 A;  2XHK A;  2STT A;  2Z5U A;  1SAU A;  5H6R A;  1IRF A;  1Z1D A;  4ZDP A;  2GXG A;  1UMQ A;  2OC6 A;  1HLV A;  1PVE A;  3AG4 H;  3TDZ C;  2LMD A;  1QVT A;  4AWX B;  2P5L C;  2IXS A;  3OYK A;  1S7O A;  4IHX A;  5L3D A;  1B6A A;  1FIP A;  2O6G E;  3ECO A;  3JRA A;  2XAJ A;  3F22 A;  1IAW A;  3ZQQ A;  3LA7 A;  1RRJ A;  3W2A A;  5GAG J;  1B59 A;  2O03 A;  3T8T A;  4S04 A;  3HEF A;  3PJR A;  2R7X A;  1U5T B;  3SZG A;  1JTY A;  3KP4 A;  3PNY A;  1PUE E;  2KKO A;  1UG2 A;  4E7J A;  2O8X A;  2R92 J;  1F1Z A;  3BR3 A;  1XG1 A;  3IWF A;  1HDP A;  1P7J A;  2L4M A;  4PFP A;  3LSR A;  2HPM A;  3GTM J;  3ZRG A;  3I71 A;  2R93 J;  1BA5 A;  4YIF A;  1ZLJ A;  4XON A;  2V79 A;  3VOE A;  1W36 D;  2F48 A;  1QVU A;  3OYC A;  5BMZ A;  2EFW A;  4LK0 F;  1OYI A;  4AC0 A;  1Z3Y A;  2Q2E B;  2ACJ A;  2E1M C;  4CH7 A;  1AU7 A;  4A6E A;  1G8X A;  2OTL I;  3V4G A;  2L7K A;  2V1X A;  3K4B A;  2Y9Z A;  3PM1 A;  1G3W A;  3E0J B;  1FYM A;  1OCZ H;  4L9J A;  1K6O A;  4LIT A;  2EIM H;  1H9T A;  1E17 A;  1YFH A;  5IT9 Z;  2VBX A;  2E1M B;  1QA6 A;  1I39 A;  4ZYD A;  3FXK A;  4B48 A;  2EPF A;  2LR8 A;  4MTD A;  2CYY A;  3JTH A;  1RIO H;  2Z99 A;  2FRH A;  3ZN0 A;  3R6S A;  3U2R A;  3ASO H;  3M8J A;  1OKR A;  1MND A;  2VQG A;  4EJW A;  2FA5 A;  3KET A;  4IF4 A;  2L9R A;  2DDA A;  2YUS A;  1VQP I;  3TGN A;  2DJN A;  2XPU A;  3K10 A;  3H9G A;  5HLT A;  1WSU A;  3BZ6 A;  1MKM A;  5CVJ A;  3RPU D;  1S7E A;  5J40 A;  3OS2 A;  3OYL A;  3IKV A;  1E3O C;  1R6R A;  1F5T A;  3DLA A;  3OOP A;  1UFM A;  2QKM B;  3CO7 C;  3CCR I;  4AID A;  4P1W A;  3HYI A;  4ETS A;  4ZYH A;  3RZD J;  2B9S A;  3QPL A;  3ABT A;  1U3E M;  4LG0 A;  4A3C J;  2IGM A;  1WFX A;  3H0D A;  3GYH X;  2NS0 A;  2GBY A;  2BZT A;  3RJP A;  3HOX J;  4DYR A;  4OIP F;  3A4C A; 
#chains in the Genus database with same CATH homology
 2ZCW A;  4LK1 F;  2AXL A;  1ONV A;  4YFX F;  3TKY A;  2VE8 A;  3T5X A;  2RDP A;  4RB1 A;  2OZU A;  4IHS A;  1XGO A;  3F72 A;  3F8N A;  1FX7 A;  3I64 A;  2ISZ A;  3HSE A;  5LRR A;  1ODD A;  3IWZ A;  2HQR A;  5ILU A;  2Q8K A;  3J7A O;  4HOB A;  5LHG A;  2F5F A;  3BJ6 A;  1RI7 A;  1R1T A;  2PMU A;  4HLY A;  4EGZ A;  1K79 A;  4LG0 B;  2IW5 A;  3ZP5 A;  1GHC A;  1F9N A;  1LDJ A;  1TTY A;  3V8J A;  4CO8 A;  1RZ4 A;  1K78 B;  2MBF A;  3EET A;  1CF7 A;  3MFK A;  3QRF F;  2FNP A;  2ZNZ A;  3QAH A;  3MCZ A;  2DI3 A;  3GUD A;  3CJN A;  1KU2 A;  2K7L A;  1ZAO A;  2JPB A;  5FLX K;  1DP7 P;  2KJB A;  1IZ1 A;  1O57 A;  3I0T A;  1MD0 A;  1O3Q A;  2TDX A;  4Y15 A;  4M6X A;  1FPQ A;  2CFX A;  4KT5 C;  1BI2 A;  1G3Y A;  2RV8 A;  5D6E A;  3DPL C;  2O0Y A;  5FFZ A;  1F4K A;  3L2C A;  2A69 F;  1QPM A;  4AIK A;  2VBY A;  3G73 A;  3ML6 A;  4Q4Z F;  4I01 A;  4I98 B;  2XV4 S;  2M30 A;  1G4D A;  4YFN F;  2Y75 A;  1CF7 B;  1FNN A;  1ZHF A;  4KMU X;  2P4W A;  2HS5 A;  4MQ9 F;  1HKT A;  1XGS A;  3RDI A;  2VON A;  3LFK A;  2W85 A;  5E8G A;  3GFM A;  4P9F A;  2V1D A;  5D5V B;  3WGI A;  1D8J A;  2HWV A;  2XKP A;  5JI6 A;  3BDD A;  1I27 A;  2D2W A;  5H20 A;  4IPA A;  5HLH A;  1IXS B;  2HZT A;  3I53 A;  1XD7 A;  4GO1 A;  1O7L A;  4OIQ F;  3QP6 A;  1FOK A;  5LLQ A;  2PJP A;  5F6F A;  5CVI A;  5ICG A;  1K7A A;  1XSD A;  1JE8 A;  4A0Z A;  2E7W A;  4L0Z B;  2EA2 A;  1DDN A;  3IHU A;  4PGG A;  3JSO A;  2OZ6 A;  4OIN F;  4GCV A;  1HKQ A;  2LF7 A;  3SZT A;  1IRG A;  3KZY A;  5LGU A;  3JAM K;  1ZGJ A;  2MLG A;  3ZMD A;  1OPC A;  4A12 A;  1TNT A;  2M45 A;  5L3G A;  2VBW A;  3RTR A;  1HXD A;  5DCM A;  4TV7 A;  2STW A;  2IA0 A;  1ZRD A;  4BHB A;  2IRF G;  2BYV E;  2JZY A;  1B9N A;  4O3M A;  4IRH A;  3FMR A;  5A2Q Z;  1KA8 A;  3EYI A;  2HKO A;  4UHT A;  4L9N A;  1LDD A;  2FOK A;  4HV5 A;  1R5G A;  2IA1 A;  2LDU A;  3MZH A;  4L0Y B;  3GVA A;  5J8F A;  2LF8 A;  1HQC A;  5FO5 A;  1YYV A;  3BRO A;  1LDK B;  4KA4 A;  3V7S A;  4Y17 A;  3R60 A;  2QWW A;  3KP3 A;  3C1D A;  1I6X A;  3L09 A;  4UVA A;  1T6S A;  1W7P D;  4G7H F;  2Z3Y A;  1YS7 A;  4Q47 A;  2A3S A;  2K02 A;  4UV9 A;  3E6D A;  3GLX A;  1Z7U A;  2HQN A;  4L5I A;  4HQE A;  1HW5 A;  1IN4 A;  2XRO A;  2DFI A;  1IN5 A;  4M6Y A;  2ISY A;  5DCM B;  2EFQ A;  4LGW A;  3KZZ A;  4LJZ F;  2D1H A;  4A0Y A;  1TQI A;  2P5V A;  1Q1H A;  3HSF A;  2EK5 A;  1B4A A;  2OD5 A;  3P9K A;  3H92 A;  5BQT A;  3HUG A;  3FWE A;  5HLG A;  1S3J A;  2BGC A;  4PZJ A;  1W5T A;  1YIO A;  2W84 A;  5E1W A;  3E6M A;  3WTW C;  2ZXJ A;  2PLY A;  1UST A;  4HF0 A;  2GA1 A;  5IT9 K;  3B73 A;  5BOX A;  4RAZ A;  1FWZ A;  3M8F A;  5HS8 A;  2DU9 A;  1ZH5 A;  1ZRE A;  4U88 A;  4UNO A;  4U7D A;  3RKY A;  2QZ8 A;  3SHF A;  3BP8 A;  3IKT A;  2A68 F;  4RB3 C;  4OMZ A;  3RI4 A;  2HYF A;  1H9G A;  2E1C A;  4CXF A;  2GA2 A;  3KLO A;  4G8X A;  4LB6 B;  4XBF A;  3ZQ7 A;  2GXB A;  4EVI A;  3LQQ A;  4NHJ A;  3JTG A;  2ETH A;  3O6B B;  3U1D A;  1J5Y A;  4G7Z F;  5LHI A;  5EEG A;  1JHH A;  3HRS A;  5F64 A;  3R61 A;  3G3Z A;  4HF1 A;  3SXY A;  2Z33 A;  5E18 F;  2BV6 A;  3N97 A;  2L54 A;  2V9V A;  2B0L A;  3CTA A;  1Z6T A;  1ZRF A;  1XN7 A;  1YW9 A;  1BI1 A;  5J8C A;  4MEX F;  4I7H A;  3E6B A;  2K27 A;  2OQR A;  4EM1 A;  4CZZ A;  2ZBK A;  3BPV A;  2YSR A;  2M87 A;  5E1X A;  5D4R A;  2W25 A;  4HW0 A;  1HW1 A;  4A2U A;  2XAG A;  5K5R A;  3GXO A;  3COA C;  1IN8 A;  4WF2 A;  3GFL A;  1KQ8 A;  4ZZD A;  2O3F A;  3E5X A;  1EH6 A;  4M9S A;  2A61 A;  5L3B A;  3EYY A;  1JXS A;  3ULQ B;  3ZPL A;  3GZ5 A;  3H3Z A;  3WE3 A;  3FF5 A;  2VOP A;  4AD9 A;  1XB4 A;  3I54 A;  3GZ6 A;  1U5T C;  4RGS A;  3EQL F;  3CDH A;  5LGT A;  3BY6 A;  2PN6 A;  2KIU A;  5D8L B;  1PP8 F;  1FP2 A;  3K2Z A;  3D5L A;  1ZG3 A;  1YG2 A;  3CUQ A;  4M9Z A;  3K1M A;  2QM3 A;  2DBB A;  3HIF A;  1XGN A;  5K5Q A;  2JTV A;  4L18 B;  4MNU A;  3D0S A;  1ZG1 A;  3DFG A;  3F21 A;  5HDG A;  1HBX G;  4HDV A;  3Q9S A;  4OOI A;  4NB5 A;  1FT9 A;  5J6X A;  3K0L A;  4IXA A;  4U0W A;  3V7R A;  2UWM A;  5CVV A;  2YX4 A;  3LST A;  1E2X A;  1TQP A;  2IJL A;  1XCB A;  1T38 A;  3M1E A;  3RIR A;  2CGP A;  1P92 A;  2YX7 A;  4D0P A;  1ULY A;  4BYY A;  4HX8 A;  3CUQ C;  3HOT A;  2LKP A;  2RNJ A;  1RNL A;  1P4A A;  1OMI A;  1RUN A;  2XAS A;  2P6T A;  3CUQ B;  3DP7 A;  1SFU A;  2M1B A;  3T8R A;  2QLZ A;  4KDP A;  1LQ1 A;  1FBQ A;  1UHM A;  1RUO A;  1QNT A;  2A6H F;  4WXD A;  4A5M A;  4ZH4 F;  1T0F A;  1B9M A;  4JQF A;  1FBS A;  4XRF A;  2IA2 A;  3BJO A;  2P6S A;  2VT2 A;  6PAX A;  3DQV C;  2GQQ A;  3M9A A;  3BWG A;  1MZB A;  5FGM A;  1J9I A;  3P9C A;  5A2Q K;  4G9Y A;  5HOO A;  1REP C;  2IT0 A;  2VN2 A;  5DDG A;  4UXN A;  2EFO A;  1FLI A;  1OYY A;  1B1B A;  2ZNY A;  4DNC A;  2IP2 A;  2M5W A;  2F5C A;  4JBA A;  4YFK F;  3HTS B;  3E6C C;  5FB2 A;  1J0R A;  3ISP A;  1SMY F;  2X4H A;  2HOE A;  4LB5 A;  3J80 Z;  5KVR A;  2OBP A;  2NRA C;  1T2K A;  1BM9 A;  2R3S A;  2OA4 A;  4EM0 B;  4KIB A;  4OIR F;  2HTJ A;  1OR7 A;  2JT1 A;  3F8M A;  2HR3 A;  4GXO A;  1YS6 A;  1KQ0 A;  3L9F A;  3KEQ A;  4Q5S F;  4GYI A;  2PI0 A;  1J7K A;  2EV5 A;  1XMA A;  3KEO A;  3ROU A;  2JPC A;  5TJJ A;  1LEA A;  2YR2 A;  3LA3 A;  1VTN C;  4LFU A;  2K4J A;  1KQ9 A;  5D5X B;  4UVC A;  1O3S A;  1BI0 A;  1YO5 C;  3WTV C;  3J81 Z;  5HLI A;  3PFI A;  4I09 A;  1J2X A;  4Y13 A;  3JSP A;  5FD6 A;  1KGS A;  2H6B A;  4EJO A;  2XRN A;  3KP2 A;  5H6Q A;  1SFX A;  4EMS A;  2HDC A;  2J5P A;  1AOY A;  3KCC A;  1HKS A;  3NQO A;  2QQ9 A;  1S8N A;  4EQQ A;  4P96 A;  4WX9 A;  1DUX C;  1FP1 D;  4WK8 F;  3VB2 A;  2ZO4 A;  1FZP B;  5EEH A;  4HF2 A;  5HS7 A;  2FNA A;  3WU0 A;  4LMY A;  5DUI A;  1QO0 D;  4N9H A;  2L3D A;  5JR3 A;  1FBU A;  1J75 A;  5LRS A;  1P2F A;  2IVM A;  2Q0O A;  3I58 A;  1R7J A;  2XAQ A;  3FXR A;  4HA8 A;  1XSX A;  3F6V A;  2D1V A;  2K4B A;  1TNS A;  2H27 A;  2XKO A;  4CDG A;  1G6N A;  1W5S A;  2GWR A;  1TBX A;  1BN5 A;  1XSV A;  2H09 A;  4PGH A;  1KU3 A;  1O7F A;  2D45 A;  1R5H A;  5DUK A;  2X0L A;  2Y0M A;  5L3C A;  2OU2 A;  1XGM A;  3O3K A;  3GFI A;  3F8C A;  4BH9 A;  3V8K A;  2UXN A;  1STZ A;  4IVN A;  2FBK A;  3ZMU A;  2GIV A;  4XSX F;  1ON2 A;  3V7C A;  4KIG A;  3SZP A;  1ZG5 A;  2G9W A;  2NYX A;  4EM2 A;  4UV8 A;  2JSC A;  2HTS A;  5IT3 A;  5TRD A;  5JFR A;  4LLN A;  2J5O A;  1R36 A;  5ILV A;  3RYR A;  1R00 A;  3CLO A;  1ZLK A;  3REO A;  2PFB A;  3SFZ A;  4MQV A;  5CJ9 A;  3GFJ A;  5HVQ C;  3HTU A;  1YQA A;  3CO6 C;  2KRF A;  2ESN A;  3M7G A;  1KU7 A;  2E1N A;  1DPU A;  3HSR A;  2V1U A;  2QUF A;  2MH9 A;  1P6R A;  2EFP A;  4KMF A;  2PEX A;  3C7J A;  2QEN A;  5D6F A;  4BAY A;  1XDS A;  2DK5 A;  4EGY A;  5E1Z B;  4ESJ A;  2EJR A;  3MWM A;  4MHG A;  3EUH A;  3GX4 X;  1S6L A;  2Z9O A;  1S29 A;  2MLK A;  1V3F A;  2F5E A;  2C6Y A;  2F2E A;  4IRG A;  5D8K B;  3HHH A;  2VC0 A;  4MGR A;  3F23 A;  3IL2 A;  2G7U A;  2P7V B;  2OQG A;  2XVC A;  1EV7 A;  3ERE D;  3FM3 A;  4N9I A;  2XUB A;  2L02 A;  4A6D A;  1BI3 A;  1UHW A;  3R4K A;  1U8R A;  1I1G A;  2ZME A;  3HOS A;  3WTZ A;  4G6D A;  1X3U A;  1G3T A;  1WI9 A;  4EJV A;  4QLC U;  3TO9 A;  3NRV A;  1I5Z A;  3W6K B;  3R0J A;  3E5Q A;  1SD4 A;  1LEB A;  4WWC A;  1BC7 C;  4HYE A;  4BHP A;  3WTT C;  3KP7 A;  1TLH B;  2RKH A;  2WTE A;  4I0A A;  3B02 A;  2XAF A;  1FSE A;  4RGX A;  1PDN C;  2VOD A;  3QU3 A;  2FU4 A;  4O6J A;  4R1H A;  3DXJ F;  1OYW A;  3PQK A;  3HRM A;  2ZFW A;  1WQ2 A;  1R58 A;  3R0A A;  2MA3 A;  5K5O A;  2DTR A;  1R1V A;  4H0E A;  1SMT A;  4HDU A;  3K1N A;  1NHA A;  2NNN A;  5DCF A;  3MAJ A;  2JRT A;  1KYZ A;  2V6C A;  3HRU A;  2CSO A;  2KJC A;  1P4X A;  2ZME B;  3RPQ A;  1T98 A;  4BXU A;  3FMS A;  3FHZ A;  2L01 A;  1U6G A;  3PQJ A;  3FXQ A;  1FY7 A;  3KLN A;  2FML A;  3ZMZ A;  5LEJ A;  3CUO A;  4NQW A;  5F1R A;  1JGS A;  5HDN A;  4P55 A;  1FSH A;  3GF2 A;  1J59 A;  3J80 K;  1D8K A;  3WOD F;  3EDP A;  2EV0 A;  1AWC A;  1MJA A;  4HBL A;  5E8I A;  5KK1 A;  3WG9 A;  3BPX A;  4E70 A;  5CLS A;  4HZF A;  1PP7 U;  1YLF A;  4I02 A;  5ERI A;  3H3U A;  5HS9 A;  4IRI A;  4G7O F;  1YW8 A;  2MH2 A;  5AIP A;  3F6O A;  2DAO A;  1UCR A;  4U0Y A;  2QYO A;  1FYK A;  5BS6 A;  2Y48 A;  4OMY A;  3TQN A;  4K2E A;  3KP6 A;  2ADU A;  4LD5 A;  5JVT A;  4EJT A;  4PCQ A;  3Q9V A;  3J81 K;  2DW4 A;  2VBZ A;  3MZY A;  2A07 F;  4CIC A;  4RGU A;  3RKW A;  4FT8 A;  3T1B A;  2P5K A;  4U0V A;  2GZW A;  4CHU A;  2LSO A;  1R1U A;  3E5U A;  3GEZ A;  3WGH A;  2YPR A;  3I5U A;  4ON0 A;  5DEQ A;  4O5V A;  2P8T A;  4ENM A;  3QP5 A;  1MDM A;  3OV8 A;  5LHH A;  2DPU A;  4HQM A;  4ZZL A;  2VE9 A;  4FX4 A;  3W6J B;  3DPT A;  4CYD A;  3F3X A;  4ESB A;  5ICF A;  3BOQ A;  3TOB A;  2FF4 A;  4UVB A;  1GVJ A;  5ICC A;  1CGP A;  3K1P A;  2XGX A;  1XMK A;  4G94 A;  4RB2 C;  4RS8 A;  2HGC A;  1SD7 A;  1TW2 A;  4M72 A;  2PQ8 A;  1BBY A;  3KP5 A;  5AON A;  1HW2 A;  1UB9 A;  4Q48 A;  2VOO A;  2ELH A;  3F8F A;  1R22 A;  2QQA A;  2MC3 A;  2DT5 A;  2L4A A;  3HHG A;  2FMY A;  4IHT A;  3MQ0 A;  3ZMV A;  3BJA A;  2W57 A;  1MDM B;  2XIG A;  2F5D A;  2DLL A;  2ESH A;  4BHC A;  3P7N A;  3K9T A;  2G7H A;  2HEO A;  3VEP A;  3DV8 A;  1LB2 A;  2WC2 A;  2FEZ A;  3QOP A;  2CO5 A;  1WWX A;  1D5V A;  3V8L A;  5CVR A;  3QPH A;  5AIQ A;  3IRQ A;  2EB7 A;  1G3S A;  3N4M A;  1HSJ A;  3WTU C;  4BQA A;  5LGN A;  1EH7 A;  2CQK A;  4ESF A;  4MTE A;  4R79 A;  4RAY A;  1R23 A;  4ZYG A;  3RPU A;  2EA4 A;  2YU3 A;  3M8E A;  5ILS A;  1ZGA A;  4R8H A;  1YTY A;  1IF1 A;  3I4P A;  3JW4 A;  4P9U A;  4L9V A;  1IW7 F;  1P4W A;  4IJA A;  1EH8 A;  2DK8 A;  2IPQ X;  3ABU A;  1ZN2 A;  2R7F A;  4ENJ A;  5CVU A;  1QBJ A;  4KIF A;  1MGT A;  2HKX A;  2K86 A;  1L3L A;  4ENN A;  4ENK A;  2QVO A;  4XSZ F;  2BE5 F;  2EV6 A;  3C18 A;  1XCV A;  1HST A;  4KFC A;  2KIM A;  2FBH A;  2RN7 A;  2VXZ A;  2E7X A;  2FXA A;  1Y0U A;  2CG4 A;  1TW3 A;  2ZJ2 A;  2O61 A;  3DEU A;  5ICE A;  3GW2 A;  2COM A;  2FE3 A;  3LAP A;  2WV0 A;  3VOD A;  3FX3 A;  3ELK A;  4XLP F;  4GYG A;  2H6C A;  2RGV A;  2PBI A;  5FFX A;  3C3W A;  1MJB A;  4FX0 A;  1Z05 A;  3WU1 B;  1ZYR F;  5HDK A;  3WTX C;  4YG2 F;  1YW7 A;  3ZN1 A;  4HAM A;  1XDU A;  3GO5 A;  1BC8 C;  4FHT A;  1IXC A;  1BIA A;  3WTY C;  3TO7 A;  5DD8 A;  2QBY A;  5E17 F;  3LQR A;  3TO6 A;  3SQN A;  4Z2Y A;  2BEO A;  2P7C B;  4F7Z A;  2FQ3 A;  4RGR A;  1GXQ A;  5D5U B;  3GWZ A;  4KUM A;  1BOA A;  4KIC A;  4AIH A;  1QGP A;  3WE2 A;  4LLG F;  3ECH A;  5L3E A;  2HFH A;  2BBY A;  1O3T A;  2PG4 A;  3WTS C;  2W24 A;  4ZYE A;  1ON1 A;  2NNY A;  3QPT A;  2FSW A;  5CYV A;  5JHU A;  1D3Y A;  1Z6R A;  2DO7 A;  3FXU A;  1U2W A;  3E97 A;  2FBI A;  4OIO F;  4ASN A;  1C0W A;  1IN6 A;  5DD4 A;  4YII A;  4UUV A;  1IN7 A;  3LAJ A;  2QBY B;  2R7D A;  4M9X A;  4WXC A;  3MEX A;  4RB0 A;  5LEK A;  4U7B A;  1IUY A;  1QZY A;  3Q5F A;  3K69 A;  4MEY F;  1SAX A;  2LNB A;  2VT3 A;  3KE2 A;  4HX7 A;  2NAZ A;  3QU6 A;  4EJU A;  4S05 A;  2RVC A;  3KFW X;  2DPD A;  1QQI A;  4B8X A;  4G6Q A;  1A04 A;  2CWE A;  4P5O A;  1SFE A;  2M8E A;  3FM5 A;  3L00 A;  4AVP A;  4XLN F;  2RC4 A;  1SD5 A;  3TOA A;  3AAF A;  2WWY A;  2ZKZ A;  1LJ9 A;  1L0O C;  3HRT A;  1FC3 A;  4HV6 A;  1GXP A;  4BNC A;  5L3F A;  3RYP A;  4KN4 X;  3U9G A;  4DQ2 A;  3IRR A;  2HYG D;  1H0M A;  5BPI A;  3FZV A;  5FLX Z;  4JK1 X;  5BPD A;  3LWF A;  4L5J A;  1WRJ A;  4M73 A;  1IXR C;  2UXX A;  2GAU A;  1WKM A;  3LA2 A;  1W7P A;  5DYM A;  4A0X A;  2UZK A;  1ZRC A;  2MD5 A;  3NEU A;  4EV0 A;  4M71 A;  3S2W A;  1KU9 A;  2XAH A;  5ED4 A;  1I1S A;  3RKX A;  4B09 A;  1FYL A;  2EFN A;  1ZAR A;  3P9I A;  4OU0 A;  4WCG A;  4PDK A;  1LVA A;  3L7W A;  2A5Y B;  4KYW A;  1U78 A;  2DQL A;  1USS A;  1S7A A;  4KN7 X;  4N0B A;  5FD5 A;  2A6E F;  4WXH A;  2OAZ A;  3ZMS A;  4A5N A;  3I59 A;  1JHF A;  2EWN A;  2CW0 F;  4AIJ A;  4L9T A;  2QQB A;  1Z9C A;  1W7P B;  3TDU C;  4HX4 A;  1BJA A;  1SD6 A;  1LNW A;  4CGZ A;  1KYW A;  3F8B A;  2AS5 F;  3VFZ A;  1MJ9 A;  4KNY A;  2PMH A;  1Z91 A;  3JAM Z;  2RQP A;  3DKW A;  4M74 A;  1U5T A;  5DV5 A;  3WGG A;  4GGG A;  1TQM A;  1O3R A;  1DPR A;  1W4M A;  4HLX A;  3E3V A;  5D5W B;  5E20 A;  4QWQ A;  1BIB A;  4I0B A;  1V4R A;  3IC7 A;  1T39 A;  5D4S A;  5LBQ A;  4I2O A;  3FMQ A;  3T0Y A;  2KIF A;  5K1Y A;  2Q2E A;  1QZZ A;  3I59 B;  3DF8 A;  4LLL A;  2VC1 A;  3O2P E;  2STT A;  3ZMT A;  2DQR A;  2H94 A;  2XHK A;  2Z5U A;  5H6R A;  1IRF A;  1Z1D A;  2GXG A;  3TDZ C;  4AWX B;  2P5L C;  1S7O A;  5L3D A;  1B6A A;  2O6G E;  3ECO A;  2XAJ A;  3F22 A;  1IAW A;  3LA7 A;  1B59 A;  2O03 A;  3T8T A;  4S04 A;  1U5T B;  3KP4 A;  1PUE E;  2KKO A;  2O8X A;  1F1Z A;  3IWF A;  2L4M A;  3I71 A;  4YIF A;  1ZLJ A;  2V79 A;  3VOE A;  5BMZ A;  2EFW A;  4LK0 F;  1OYI A;  2ACJ A;  4A6E A;  3V4G A;  2V1X A;  1G3W A;  1FYM A;  4L9J A;  1K6O A;  1H9T A;  1E17 A;  1YFH A;  5IT9 Z;  2VBX A;  4ZYD A;  4MTD A;  2CYY A;  3JTH A;  1RIO H;  2Z99 A;  2FRH A;  3ZN0 A;  3R6S A;  3U2R A;  1OKR A;  4EJW A;  2FA5 A;  3KET A;  4IF4 A;  3TGN A;  1WSU A;  3BZ6 A;  1MKM A;  5CVJ A;  3IKV A;  1F5T A;  3OOP A;  1UFM A;  3CO7 C;  4ETS A;  3HYI A;  4ZYH A;  3ABT A;  1U3E M;  4LG0 A;  3GYH X;  2NS0 A;  3RJP A;  4OIP F;  1K78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...