2K4VA

Solution structure of uncharacterized protein pa1076 from pseudomonas aeruginosa. northeast structural genomics consortium (nesg) target pat3, ontario center for structural proteomics target pa1076 .
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFEDIRAKLHAHPGEPVDLERIIRHEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein PA1076
publication title Solution structure of uncharacterized protein PA1076 from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16703 DUF5064 Domain of unknown function (DUF5064)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.370 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2k4vA00
2K4VA
chains in the Genus database with same CATH superfamily
2WCC3 2RSMA 1WRJA 2NA2A 1A1JA 1PDAA 4LU9A 4Q28A 4JI8E 3F6GA 1ZU1A 2YZTA 2V83A 2JYAA 3KZZA 2BBGA 5KL6A 1T38A 2EOMA 4M30A 3H09A 2NABA 2G7HA 2EM7A 1HNWE 2L2KB 4JI5E 4DKKA 3IWDA 1PKPA 5A6BA 3JAMC 2HC5A 1TF6A 1N33E 2M1SA 2R76A 4R2DA 4F9CB 4R2SA 2DMIA 5A6AA 3LMLA 1EH7A 4WSPA 3MHHC 2YTQA 2L2NA 4WX9A 2FV4B 2MDRA 1IQOA 1B69A 1STUA 3T1YE 3OTOE 2A25A 2RPCA 5ADZA 3QG5C 2RTXA 3EPJA 1X5WA 2ODRD 4BS9A 3J7Yp 4KWYA 4DUZE 3VK6A 2HJJA 2LUPB 5DNYA 2VRDA 1X47A 4BHBA 1DQ3A 1PJQA 3BBGA 3RMPA 2JVAA 4M2ZA 4GKKE 3HPZA 4IJDA 2ZM6E 1YSAC 1A1IA 4M9VC 2EP3A 2BB8A 5A2QC 1L4SA 2EPKX 4RH8A 1A1KA 2I13A 4WXDA 3FIGA 4LF7E 4DV3E 2EM8A 2WBSA 4DR5E 2CTDA 3ZOQB 1O0WA 2UXBE 2VE7C 1HNXE 1IQSA 4LF6E 4B3RE 2JR1A 4BC9A 2L2MA 2DLQA 1NEIA 2B9DA 1ZBTA 2CPNA 2DIXA 2L33A 2LV2A 4R8OA 2JOBA 3M99B 1P47A 1J5EE 4ZYEA 4IS1C 2DB2A 3J80C 1FKAE 1SR9A 1AH5A 3F6HA 2EPMX 2LTSA 1XMOE 2EOHA 4M0VA 1I94E 2EORA 4X62E 2LMZA 2EMZA 2V8QB 4O43A 3HPSA 2EN3A 1MEYC 2LT7A 2EOXA 2K4VA 2EM2A 2EPOA 4X9JA 4N4RB 1EKZA 2EMXA 3TQMA 1RMDA 1MGTA 2YT4A 1TF3A 2VQFE 1QU6A 5TSEA 2LE2A 4TUGA 4P7DA 4DV7E 5A69A 4JI2E 2EQ1A 1ZBQA 1PJTA 2V87A 3K6QA 1EH8A 2ENCA 1RC7A 2KHXA 2LRSA 2RSIA 2NUEA 3AUZA 2L3CA 2YWQA 2EMHA 1N36E 4R2CA 2DGCA 4HEIA 2UUAE 3C4BA 1UILA 3OMLA 2VF1A 1KJKA 1A1FA 1F2IG 4LF8E 1YPNA 4Q35B 4JI4E 4F6MA 4LF5E 4WSGA 4LFCE 2RS6A 2LVHA 2EN7A 2EMFA 1GTKA 2YTJA 2EM6A 2KOUA 1T39A 2K7IA 2DRPA 2M4IA 5LLQA 1WXRA 2EMLA 5LMUE 1BBOA 2EL6A 4X64E 2V89A 1YUJA 4R2PA 2YU8A 4GZNC 2EPRA 3EQ1A 1YYWA 4MLQA 2YSOA 4GKJE 4I8OA 2E5LE 2DMYA 2EMAA 2LCEA 2ELZA 4TUIA 2EMCA 4DR2E 2NUFA 1XNRE 3MHSC 4WFTA 4JI1E 3BGHA 3ECRA 2EPPA 2YRHA 1IBLE 5AASA 1FJGE 2EOQA 2YTNA 2L92A 5KL7A 5A6JA 1QNTA 1N3GA 2E1MA 3BIDA 4DR7E 2EPCA 4DV0E 2IHR1 4F9BB 2V86A 4DV5E 2LJUA 2EOZA 4LF9E 1AAYA 2FGGA 2UXCE 1UN6B 4WYQB 2EOJA 3IWBA 4L5NC 2ELYA 4LF4E 4WPYA 1SFEA 2N3HA 3C6KA 2EM0A 1X6EA 5KL3A 2LTRA 5AC4A 5KL4A 2EM3A 4BHCA 5AE1A 2B7TA 2EE8A 4NXNE 2EMWA 2V85A 3VYYA 2EMKA 3KWRA 4X66E 3IWCA 4O5GA 1YYKA 1UBDC 4O24A 4DMIA 4BMJA 4B3TE 5AE2A 2EOFA 4MLVA 4HTGA 3VHTB 3P1XA 2EPAA 5FLXC 4B3ME 1EH6A 2UU9E 4JV5E 2EMBA 3HXLA 1LLMC 1DGCA 2EQ3A 1X6FA 4JI6E 2E72A 4F9AB 2LO3A 2RQLA 2JPAA 3ADLA 2EN8A 4F2JC 2EN2A 2YTDA 5KL2A 2EMYA 4DR1E 2LBSB 3LLHA 5LL6R 2YSPA 1WHQA 2FTXB 3DF6A 2YTPA 4J8ZA 4DV2E 3HQ1A 1YUIA 1X3CA 3ADJA 2M7QA 4FK5C 4O4KA 1BBGA 1KYQA 4LFAE 2D9HA 3JTZA 1WHNA 2EL4A 2EOSA 3C4TA 2CSHA 2EPUA 4ZYDA 2GLIA 2ENAA 4ZYGA 1TN9A 4NHRA 2NUGA 2HHHE 2EJ4A 2YTOA 4BC7A 2L3JA 4YHHE 5KL5A 5IXMB 5IWAE 3MSWA 5AE3A 4OX9E 5AC5A 5LMNE 4R2QA 2H36X 3ADGA 4RHBB 3EPLA 1T4LB 1A1LA 4L8NA 4JI3E 4DR4E 4DV6E 4WXCA 1GZ6A 1IBKE 3JU0A 5IV8B 2EPXA 1N34E 2EWLA 2EOEA 2MDGA 4JYAE 4LFBE 2EOIA 1NCSA 2JY9A 3EPHA 3EPKA 1IBME 2EPLX 3UK3C 2YPNA 2UUCE 2LJHA 2RS7A 2EMIA 3J81C 5A6KA 1YZ9A 1X49A 4BBYA 4R2RA 1G2FC 2WZOA 4DR6E 2YTEA 3BF2A 1RQ0A 2UXDE 1X48A 3VYXA 3DJWA 2YU5A 4NXME 2EM4A 1IMUA 3HTXA 3J7AG 2GPIA 2N3GA 1T4NA 2GHFA 2R1FA 2JP9A 4KHPE 2MKDA 2J7JA 3THOB 4R2EA 1A1HA 4YY3E 2HGHA 2L8TA 4X8WA 1ZAAC 1PJSA 3AV0A 4B3SE 2EM9A 2ADRA 2JXPA 1N32E 2MC5A 5IT9C 2Q8UA 4P78A 1UHZA 2F8BA 1YFHA 4DR3E 2YTIA 3C6MA 5BR8E 4DV1E 4GEQB 2I9IA 2DSYA 2UUBE 1J26A 2EQ0A 4NZVA 1XMQE 1G2DC 1Z1BA 2EOOA 4F6NA 1ZR9A 4JI0E 2EN6A 2EPNA 1JK2A 1JK1A 2EPZA 2ENHA 4KZSA 4AQYE 1HR0E 2B7VA 2YTFA 3L00A 2WBTA 1XNQE 1WJPA 3KZYA 4DV4E 4BCAA 2JOXA 2DLKA 2EM5A 4R2AA 2CT1A 2LUQA 2EZ6A 2F4VE 2YRKA 2JWOA 2PRTA 2YRMA 2EOYA 1T4OA 2ODRC 5F3WA 3THNA 1BB8A 5CFFE 4F54A 2N8XA 4R03A 4K0KE 1HNZE 4OOGC 1GQEA 2EMGA 4X65E 2KONA 2VQEE 4LTYA 2V88A 1A1GA 2L6MA 2M9AA 1DI2A 1X6HA 2WBUA 2EN4A 2B3TB 2YTGA 2EN1A 5A6BD 2MKNA 2EL5A 2MC6A 3ADIA 4ZYHA 5T6JA 3T1HE 1YYOA 4JI7E 4DUYE
chains in the Genus database with same CATH topology
1XMOE 4WYQB 4M0VA 2RSMA 3IWBA 4L5NC 1I94E 4X62E 4JYAE 2NA2A 2LMZA 4LF4E 4LFBE 2V8QB 4LU9A 4Q28A 4WPYA 4JI8E 2N3HA 3F6GA 3HPSA 2JY9A 2YZTA 2V83A 1IBME 2K4VA 2LTRA 2UUCE 5AE1A 1EKZA 2LJHA 2RS7A 3J81C 2B7TA 2YT4A 4M30A 3H09A 1X49A 4NXNE 2VQFE 1YZ9A 1QU6A 2V85A 2LE2A 4BBYA 2G7HA 3KWRA 4P7DA 4TUGA 2L2KB 3VYYA 1HNWE 4X66E 4JI5E 3IWCA 3IWDA 4DKKA 4DV7E 1PKPA 2WZOA 4DR6E 1YYKA 4DMIA 3JAMC 1RQ0A 4BMJA 1N33E 2UXDE 4JI2E 4B3TE 1X48A 5AE2A 3VYXA 2M1SA 3DJWA 4NXME 4F9CB 3HTXA 3J7AG 3P1XA 3LMLA 2N3GA 1ZBQA 4WSPA 1T4NA 5FLXC 2V87A 3K6QA 2UU9E 2L2NA 4B3ME 4JV5E 2FV4B 1RC7A 2KHXA 2MDRA 4KHPE 2LRSA 3HXLA 1STUA 2NUEA 3T1YE 3AUZA 3OTOE 4YY3E 2L3CA 5ADZA 1N36E 2L8TA 4X8WA 4JI6E 2RTXA 4F9AB 2UUAE 3AV0A 4B3SE 2ODRD 3C4BA 4BS9A 2UXCE 3J7Yp 4DUZE 1UILA 3ADLA 3OMLA 2VF1A 3VK6A 1N32E 4LF8E 2MC5A 5IT9C 4P78A 1UHZA 2F8BA 5DNYA 4DR3E 1X47A 2LUPB 1DQ3A 4JI4E 5BR8E 4DR1E 2LBSB 3LLHA 4LF5E 5LL6R 4DV1E 1WHQA 2FTXB 3DF6A 3RMPA 2JVAA 4J8ZA 4M2ZA 4DV2E 2RS6A 3HQ1A 4GEQB 4LFCE 4GKKE 2DSYA 3ADJA 2M7QA 3HPZA 2ZM6E 2UUBE 1J26A 2KOUA 1XMQE 2M4IA 1WXRA 4LFAE 5A2QC 3JTZA 1WHNA 4JI0E 3C4TA 5LMUE 4X64E 2V89A 4KZSA 4AQYE 1HR0E 2B7VA 3FIGA 4LF7E 4DV3E 1XNQE 2NUGA 4DV4E 2HHHE 1YYWA 4BCAA 4BC7A 4DR5E 2JOXA 3ZOQB 4YHHE 2L3JA 1O0WA 2UXBE 2VE7C 5IWAE 2LUQA 1HNXE 2EZ6A 4GKJE 2F4VE 4I8OA 4LF6E 4B3RE 2E5LE 3MSWA 2DMYA 2JR1A 2JWOA 4TUIA 4BC9A 2L2MA 4DR2E 5AE3A 4OX9E 2NUFA 1XNRE 1T4OA 2ODRC 5LMNE 5F3WA 4WFTA 5CFFE 4F54A 4JI1E 2H36X 1IBLE 5AASA 3ADGA 4R03A 1T4LB 2B9DA 1FJGE 1HNZE 4K0KE 2L92A 4OOGC 1GQEA 4L8NA 4JI3E 4X65E 2KONA 2VQEE 1ZBTA 4DV6E 4DR4E 2CPNA 2DIXA 2L33A 2V88A 4LTYA 1GZ6A 2L6MA 2E1MA 1IBKE 4R8OA 2JOBA 4DR7E 1J5EE 1DI2A 2B3TB 3JU0A 2DB2A 3J80C 4DV0E 1SR9A 1FKAE 2IHR1 3F6HA 4F9BB 2V86A 1N34E 4DV5E 2MC6A 2EWLA 3ADIA 5T6JA 4LF9E 2FGGA 3T1HE 2LTSA 1YYOA 4JI7E 4DUYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4V A; 
#chains in the Genus database with same CATH topology
 2WCC 3;  2RSM A;  1WRJ A;  2NA2 A;  1A1J A;  1PDA A;  4LU9 A;  4Q28 A;  4JI8 E;  3F6G A;  1ZU1 A;  2YZT A;  2V83 A;  2JYA A;  3KZZ A;  2BBG A;  5KL6 A;  1T38 A;  2EOM A;  4M30 A;  3H09 A;  2NAB A;  2G7H A;  2EM7 A;  1HNW E;  2L2K B;  4JI5 E;  4DKK A;  3IWD A;  1PKP A;  5A6B A;  3JAM C;  2HC5 A;  1TF6 A;  1N33 E;  2M1S A;  2R76 A;  4R2D A;  4F9C B;  4R2S A;  2DMI A;  5A6A A;  3LML A;  1EH7 A;  4WSP A;  3MHH C;  2YTQ A;  2L2N A;  4WX9 A;  2FV4 B;  2MDR A;  1IQO A;  1B69 A;  1STU A;  3T1Y E;  3OTO E;  2A25 A;  2RPC A;  5ADZ A;  3QG5 C;  2RTX A;  3EPJ A;  1X5W A;  2ODR D;  4BS9 A;  3J7Y p;  4KWY A;  4DUZ E;  3VK6 A;  2HJJ A;  2LUP B;  5DNY A;  2VRD A;  1X47 A;  4BHB A;  1DQ3 A;  1PJQ A;  3BBG A;  3RMP A;  2JVA A;  4M2Z A;  4GKK E;  3HPZ A;  4IJD A;  2ZM6 E;  1YSA C;  1A1I A;  4M9V C;  2EP3 A;  2BB8 A;  5A2Q C;  1L4S A;  2EPK X;  4RH8 A;  1A1K A;  2I13 A;  4WXD A;  3FIG A;  4LF7 E;  4DV3 E;  2EM8 A;  2WBS A;  4DR5 E;  2CTD A;  3ZOQ B;  1O0W A;  2UXB E;  2VE7 C;  1HNX E;  1IQS A;  4LF6 E;  4B3R E;  2JR1 A;  4BC9 A;  2L2M A;  2DLQ A;  1NEI A;  2B9D A;  1ZBT A;  2CPN A;  2DIX A;  2L33 A;  2LV2 A;  4R8O A;  2JOB A;  3M99 B;  1P47 A;  1J5E E;  4ZYE A;  4IS1 C;  2DB2 A;  3J80 C;  1FKA E;  1SR9 A;  1AH5 A;  3F6H A;  2EPM X;  2LTS A;  1XMO E;  2EOH A;  4M0V A;  1I94 E;  2EOR A;  4X62 E;  2LMZ A;  2EMZ A;  2V8Q B;  4O43 A;  3HPS A;  2EN3 A;  1MEY C;  2LT7 A;  2EOX A;  2K4V A;  2EM2 A;  2EPO A;  4X9J A;  4N4R B;  1EKZ A;  2EMX A;  3TQM A;  1RMD A;  1MGT A;  2YT4 A;  1TF3 A;  2VQF E;  1QU6 A;  5TSE A;  2LE2 A;  4TUG A;  4P7D A;  4DV7 E;  5A69 A;  4JI2 E;  2EQ1 A;  1ZBQ A;  1PJT A;  2V87 A;  3K6Q A;  1EH8 A;  2ENC A;  1RC7 A;  2KHX A;  2LRS A;  2RSI A;  2NUE A;  3AUZ A;  2L3C A;  2YWQ A;  2EMH A;  1N36 E;  4R2C A;  2DGC A;  4HEI A;  2UUA E;  3C4B A;  1UIL A;  3OML A;  2VF1 A;  1KJK A;  1A1F A;  1F2I G;  4LF8 E;  1YPN A;  4Q35 B;  4JI4 E;  4F6M A;  4LF5 E;  4WSG A;  4LFC E;  2RS6 A;  2LVH A;  2EN7 A;  2EMF A;  1GTK A;  2YTJ A;  2EM6 A;  2KOU A;  1T39 A;  2K7I A;  2DRP A;  2M4I A;  5LLQ A;  1WXR A;  2EML A;  5LMU E;  1BBO A;  2EL6 A;  4X64 E;  2V89 A;  1YUJ A;  4R2P A;  2YU8 A;  4GZN C;  2EPR A;  3EQ1 A;  1YYW A;  4MLQ A;  2YSO A;  4GKJ E;  4I8O A;  2E5L E;  2DMY A;  2EMA A;  2LCE A;  2ELZ A;  4TUI A;  2EMC A;  4DR2 E;  2NUF A;  1XNR E;  3MHS C;  4WFT A;  4JI1 E;  3BGH A;  3ECR A;  2EPP A;  2YRH A;  1IBL E;  5AAS A;  1FJG E;  2EOQ A;  2YTN A;  2L92 A;  5KL7 A;  5A6J A;  1QNT A;  1N3G A;  2E1M A;  3BID A;  4DR7 E;  2EPC A;  4DV0 E;  2IHR 1;  4F9B B;  2V86 A;  4DV5 E;  2LJU A;  2EOZ A;  4LF9 E;  1AAY A;  2FGG A;  2UXC E;  1UN6 B;  4WYQ B;  2EOJ A;  3IWB A;  4L5N C;  2ELY A;  4LF4 E;  4WPY A;  1SFE A;  2N3H A;  3C6K A;  2EM0 A;  1X6E A;  5KL3 A;  2LTR A;  5AC4 A;  5KL4 A;  2EM3 A;  4BHC A;  5AE1 A;  2B7T A;  2EE8 A;  4NXN E;  2EMW A;  2V85 A;  3VYY A;  2EMK A;  3KWR A;  4X66 E;  3IWC A;  4O5G A;  1YYK A;  1UBD C;  4O24 A;  4DMI A;  4BMJ A;  4B3T E;  5AE2 A;  2EOF A;  4MLV A;  4HTG A;  3VHT B;  3P1X A;  2EPA A;  5FLX C;  4B3M E;  1EH6 A;  2UU9 E;  4JV5 E;  2EMB A;  3HXL A;  1LLM C;  1DGC A;  2EQ3 A;  1X6F A;  4JI6 E;  2E72 A;  4F9A B;  2LO3 A;  2RQL A;  2JPA A;  3ADL A;  2EN8 A;  4F2J C;  2EN2 A;  2YTD A;  5KL2 A;  2EMY A;  4DR1 E;  2LBS B;  3LLH A;  5LL6 R;  2YSP A;  1WHQ A;  2FTX B;  3DF6 A;  2YTP A;  4J8Z A;  4DV2 E;  3HQ1 A;  1YUI A;  1X3C A;  3ADJ A;  2M7Q A;  4FK5 C;  4O4K A;  1BBG A;  1KYQ A;  4LFA E;  2D9H A;  3JTZ A;  1WHN A;  2EL4 A;  2EOS A;  3C4T A;  2CSH A;  2EPU A;  4ZYD A;  2GLI A;  2ENA A;  4ZYG A;  1TN9 A;  4NHR A;  2NUG A;  2HHH E;  2EJ4 A;  2YTO A;  4BC7 A;  2L3J A;  4YHH E;  5KL5 A;  5IXM B;  5IWA E;  3MSW A;  5AE3 A;  4OX9 E;  5AC5 A;  5LMN E;  4R2Q A;  2H36 X;  3ADG A;  4RHB B;  3EPL A;  1T4L B;  1A1L A;  4L8N A;  4JI3 E;  4DR4 E;  4DV6 E;  4WXC A;  1GZ6 A;  1IBK E;  3JU0 A;  5IV8 B;  2EPX A;  1N34 E;  2EWL A;  2EOE A;  2MDG A;  4JYA E;  4LFB E;  2EOI A;  1NCS A;  2JY9 A;  3EPH A;  3EPK A;  1IBM E;  2EPL X;  3UK3 C;  2YPN A;  2UUC E;  2LJH A;  2RS7 A;  2EMI A;  3J81 C;  5A6K A;  1YZ9 A;  1X49 A;  4BBY A;  4R2R A;  1G2F C;  2WZO A;  4DR6 E;  2YTE A;  3BF2 A;  1RQ0 A;  2UXD E;  1X48 A;  3VYX A;  3DJW A;  2YU5 A;  4NXM E;  2EM4 A;  1IMU A;  3HTX A;  3J7A G;  2GPI A;  2N3G A;  1T4N A;  2GHF A;  2R1F A;  2JP9 A;  4KHP E;  2MKD A;  2J7J A;  3THO B;  4R2E A;  1A1H A;  4YY3 E;  2HGH A;  2L8T A;  4X8W A;  1ZAA C;  1PJS A;  3AV0 A;  4B3S E;  2EM9 A;  2ADR A;  2JXP A;  1N32 E;  2MC5 A;  5IT9 C;  2Q8U A;  4P78 A;  1UHZ A;  2F8B A;  1YFH A;  4DR3 E;  2YTI A;  3C6M A;  5BR8 E;  4DV1 E;  4GEQ B;  2I9I A;  2DSY A;  2UUB E;  1J26 A;  2EQ0 A;  4NZV A;  1XMQ E;  1G2D C;  1Z1B A;  2EOO A;  4F6N A;  1ZR9 A;  4JI0 E;  2EN6 A;  2EPN A;  1JK2 A;  1JK1 A;  2EPZ A;  2ENH A;  4KZS A;  4AQY E;  1HR0 E;  2B7V A;  2YTF A;  3L00 A;  2WBT A;  1XNQ E;  1WJP A;  3KZY A;  4DV4 E;  4BCA A;  2JOX A;  2DLK A;  2EM5 A;  4R2A A;  2CT1 A;  2LUQ A;  2EZ6 A;  2F4V E;  2YRK A;  2JWO A;  2PRT A;  2YRM A;  2EOY A;  1T4O A;  2ODR C;  5F3W A;  3THN A;  1BB8 A;  5CFF E;  4F54 A;  2N8X A;  4R03 A;  4K0K E;  1HNZ E;  4OOG C;  1GQE A;  2EMG A;  4X65 E;  2KON A;  2VQE E;  4LTY A;  2V88 A;  1A1G A;  2L6M A;  2M9A A;  1DI2 A;  1X6H A;  2WBU A;  2EN4 A;  2B3T B;  2YTG A;  2EN1 A;  5A6B D;  2MKN A;  2EL5 A;  2MC6 A;  3ADI A;  4ZYH A;  5T6J A;  3T1H E;  1YYO A;  4JI7 E;  4DUY E; 
#chains in the Genus database with same CATH homology
 1XMO E;  4WYQ B;  4M0V A;  2RSM A;  3IWB A;  4L5N C;  1I94 E;  4X62 E;  4JYA E;  2NA2 A;  2LMZ A;  4LF4 E;  4LFB E;  2V8Q B;  4LU9 A;  4Q28 A;  4WPY A;  4JI8 E;  2N3H A;  3F6G A;  3HPS A;  2JY9 A;  2YZT A;  2V83 A;  1IBM E;  2K4V A;  2LTR A;  2UUC E;  5AE1 A;  1EKZ A;  2LJH A;  2RS7 A;  3J81 C;  2B7T A;  2YT4 A;  4M30 A;  3H09 A;  1X49 A;  4NXN E;  2VQF E;  1YZ9 A;  1QU6 A;  2V85 A;  2LE2 A;  4BBY A;  2G7H A;  3KWR A;  4P7D A;  4TUG A;  2L2K B;  3VYY A;  1HNW E;  4X66 E;  4JI5 E;  3IWC A;  3IWD A;  4DKK A;  4DV7 E;  1PKP A;  2WZO A;  4DR6 E;  1YYK A;  4DMI A;  3JAM C;  1RQ0 A;  4BMJ A;  1N33 E;  2UXD E;  4JI2 E;  4B3T E;  1X48 A;  5AE2 A;  3VYX A;  2M1S A;  3DJW A;  4NXM E;  4F9C B;  3HTX A;  3J7A G;  3P1X A;  3LML A;  2N3G A;  1ZBQ A;  4WSP A;  1T4N A;  5FLX C;  2V87 A;  3K6Q A;  2UU9 E;  2L2N A;  4B3M E;  4JV5 E;  2FV4 B;  1RC7 A;  2KHX A;  2MDR A;  4KHP E;  2LRS A;  3HXL A;  1STU A;  2NUE A;  3T1Y E;  3AUZ A;  3OTO E;  4YY3 E;  2L3C A;  5ADZ A;  1N36 E;  2L8T A;  4X8W A;  4JI6 E;  2RTX A;  4F9A B;  2UUA E;  3AV0 A;  4B3S E;  2ODR D;  3C4B A;  4BS9 A;  2UXC E;  3J7Y p;  4DUZ E;  1UIL A;  3ADL A;  3OML A;  2VF1 A;  3VK6 A;  1N32 E;  4LF8 E;  2MC5 A;  5IT9 C;  4P78 A;  1UHZ A;  2F8B A;  5DNY A;  4DR3 E;  1X47 A;  2LUP B;  1DQ3 A;  4JI4 E;  5BR8 E;  4DR1 E;  2LBS B;  3LLH A;  4LF5 E;  5LL6 R;  4DV1 E;  1WHQ A;  2FTX B;  3DF6 A;  3RMP A;  2JVA A;  4J8Z A;  4M2Z A;  4DV2 E;  2RS6 A;  3HQ1 A;  4GEQ B;  4LFC E;  4GKK E;  2DSY A;  3ADJ A;  2M7Q A;  3HPZ A;  2ZM6 E;  2UUB E;  1J26 A;  2KOU A;  1XMQ E;  2M4I A;  1WXR A;  4LFA E;  5A2Q C;  3JTZ A;  1WHN A;  4JI0 E;  3C4T A;  5LMU E;  4X64 E;  2V89 A;  4KZS A;  4AQY E;  1HR0 E;  2B7V A;  3FIG A;  4LF7 E;  4DV3 E;  1XNQ E;  2NUG A;  4DV4 E;  2HHH E;  1YYW A;  4BCA A;  4BC7 A;  4DR5 E;  2JOX A;  3ZOQ B;  4YHH E;  2L3J A;  1O0W A;  2UXB E;  2VE7 C;  5IWA E;  2LUQ A;  1HNX E;  2EZ6 A;  4GKJ E;  2F4V E;  4I8O A;  4LF6 E;  4B3R E;  2E5L E;  3MSW A;  2DMY A;  2JR1 A;  2JWO A;  4TUI A;  4BC9 A;  2L2M A;  4DR2 E;  5AE3 A;  4OX9 E;  2NUF A;  1XNR E;  1T4O A;  2ODR C;  5LMN E;  5F3W A;  4WFT A;  5CFF E;  4F54 A;  4JI1 E;  2H36 X;  1IBL E;  5AAS A;  3ADG A;  4R03 A;  1T4L B;  2B9D A;  1FJG E;  1HNZ E;  4K0K E;  2L92 A;  4OOG C;  1GQE A;  4L8N A;  4JI3 E;  4X65 E;  2KON A;  2VQE E;  1ZBT A;  4DV6 E;  4DR4 E;  2CPN A;  2DIX A;  2L33 A;  2V88 A;  4LTY A;  1GZ6 A;  2L6M A;  2E1M A;  1IBK E;  4R8O A;  2JOB A;  4DR7 E;  1J5E E;  1DI2 A;  2B3T B;  3JU0 A;  2DB2 A;  3J80 C;  4DV0 E;  1SR9 A;  1FKA E;  2IHR 1;  3F6H A;  4F9B B;  2V86 A;  1N34 E;  4DV5 E;  2MC6 A;  2EWL A;  3ADI A;  5T6J A;  4LF9 E;  2FGG A;  3T1H E;  2LTS A;  1YYO A;  4JI7 E;  4DUY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...