2K4VA

Solution structure of uncharacterized protein pa1076 from pseudomonas aeruginosa. northeast structural genomics consortium (nesg) target pat3, ontario center for structural proteomics target pa1076 .
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFEDIRAKLHAHPGEPVDLERIIRHEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of uncharacterized protein PA1076 from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein PA1076
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16703 DUF5064 Domain of unknown function (DUF5064)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.370 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2k4vA00
2K4VA
chains in the Genus database with same CATH superfamily
2R1FA 1MEYC 4WXCA 1X48A 4JI8E 4DV4E 1L4SA 1TN9A 1PJSA 5KL5A 4L5NC 1X3CA 4JI2E 5A6AA 4OOGC 2F8BA 2EPCA 5T6JA 1JK1A 2ODRC 2YU8A 4JYAE 3VK6A 5KL7A 4F54A 1ZBQA 2VQFE 3IWBA 2EOMA 2RSMA 5LLQA 2L3JA 1AAYA 4TUGA 2EM6A 2DGCA 3BIDA 2DIXA 4LF9E 4I8OA 4WXDA 2RTXA 4DMIA 1T4NA 2JXPA 1YYKA 2N8XA 4DUYE 1EH8A 2YRMA 3IWCA 2YTNA 1DGCA 3J80C 5A6BD 1SFEA 4R2AA 4DR7E 1IBKE 4BC9A 3T1YE 4BS9A 2DMYA 2EMAA 2LTSA 2EMCA 4WFTA 4DKKA 2LVHA 1F2IG 2NUGA 4X66E 5IV8B 4DV3E 1KJKA 3BF2A 4F6MA 4BHCA 2EPAA 3C6KA 3AUZA 1J5EE 4AQYE 2D9HA 1NEIA 1EH6A 4GZNC 4DV0E 5LMNE 2V89A 4B3RE 2DLQA 1RMDA 2YWQA 2L33A 1WHQA 4DR2E 1YYOA 2EJ4A 2VF1A 2NA2A 1HNWE 3T1HE 1UN6B 3AV0A 3F6GA 3J7Yp 3C4TA 1IMUA 3C4BA 4M9VC 4X64E 3RMPA 3BGHA 1YFHA 2RPCA 2EN1A 2EOFA 1N3GA 4WSGA 2EM4A 2E1MA 3P1XA 2I13A 3HPZA 2YTFA 2ZM6E 2JVAA 1NCSA 2EMYA 5A2QC 5ADZA 2EMIA 1RC7A 4FK5C 2ENCA 2B7TA 4BHBA 2HC5A 2LUQA 2M7QA 1YUIA 2EOOA 5A6BA 1A1JA 3JTZA 3KZZA 4M30A 2YTEA 4Q35B 4R8OA 2EOIA 1ZBTA 4X9JA 5IT9C 1GQEA 2UXBE 2EE8A 2L8TA 3EPKA 2LV2A 5A6KA 2L92A 1EH7A 1BBOA 2E5LE 4ZYGA 1YPNA 2EOZA 2EORA 2RSIA 2WBTA 2LJUA 2FTXB 2EQ1A 2YTQA 1UILA 2YSPA 3LMLA 1X6HA 5TSEA 4DV7E 4LF4E 3EPHA 4DV6E 2EM2A 1QNTA 2MKNA 4WX9A 3JAMC 4WYQB 3VYYA 4B3TE 1PDAA 1PJTA 5AC5A 4ZYHA 2EP3A 2M9AA 3MHSC 1YSAC 1N34E 2EMBA 4R2CA 2CT1A 2EOEA 4LTYA 2EM0A 2E72A 2ADRA 2ENAA 2YU5A 4R2RA 4BMJA 1XMQE 5A6JA 2JPAA 4B3SE 2EMWA 2DMIA 2LT7A 5AE1A 1TF6A 1PJQA 4HTGA 4DV5E 2YRKA 2CTDA 4DR4E 2MDRA 4P78A 4JV5E 4O5GA 1A1FA 4HEIA 2V87A 4DR5E 1A1KA 1J26A 5IWAE 4R2EA 2B7VA 2EM5A 4DV2E 2EN8A 2YRHA 2GHFA 5AE2A 2L2KB 2YTIA 1UHZA 5KL2A 4DR6E 2LUPB 2GPIA 2MC6A 4DV1E 1ZAAC 2PRTA 2EM3A 2YTOA 4F9AB 2ELYA 3TQMA 3KWRA 4OX9E 3EPLA 5LL6R 4M2ZA 4JI0E 4NHRA 3HQ1A 2UXCE 3HTXA 2MDGA 4F9BB 2LE2A 1N33E 1WJPA 4L8NA 4KZSA 1T39A 2YTPA 2BB8A 2EMHA 3C6MA 2EMFA 5BR8E 2EMZA 2I9IA 2L2NA 1XNQE 1GTKA 2LCEA 4LFAE 2YT4A 2DLKA 2EQ3A 1HR0E 1YUJA 1LLMC 2Q8UA 2NABA 1T4LB 3ADIA 1T4OA 2JOXA 1X49A 2EPRA 2FGGA 2V88A 4O43A 1G2FC 2YTJA 4JI5E 2EPOA 4YY3E 4JI4E 2EOHA 2HGHA 1IBLE 4WSPA 4MLQA 3ADGA 2UXDE 2N3GA 1N36E 4LFCE 2EM7A 1Z1BA 2EPLX 1IQSA 2JY9A 2LMZA 3H09A 2K7IA 2HHHE 1A1HA 3HPSA 1IBME 1TF3A 4JI1E 2BBGA 2GLIA 2H36X 4BCAA 3ADJA 3HXLA 4Q28A 2EWLA 2MKDA 4R03A 2EN3A 4X8WA 4R2QA 2KHXA 1KYQA 4GEQB 2UUAE 2EN4A 2EMKA 2R76A 2J7JA 2V83A 4IJDA 5KL4A 2VRDA 1STUA 2RQLA 2YPNA 2KONA 1HNZE 2WBSA 2NUFA 2DRPA 2KOUA 3JU0A 2LBSB 1UBDC 2EPUA 4RHBB 2ENHA 2JP9A 1X47A 3VYXA 1DQ3A 2CPNA 1XMOE 4LF8E 2EPXA 2VE7C 2EOXA 4LF5E 2EMGA 1FJGE 3J81C 4MLVA 2NUEA 3BBGA 2EPNA 5AASA 2LTRA 4NZVA 4LF7E 1I94E 4GKKE 4J8ZA 4NXNE 4M0VA 4JI6E 2LO3A 3EPJA 2EPPA 3J7AG 5CFFE 2EOYA 1GZ6A 2CSHA 4WPYA 1X6EA 2F4VE 1B69A 2EMLA 1P47A 3ECRA 4DR1E 1G2DC 4JI7E 3ADLA 1BBGA 2JWOA 1SR9A 2ELZA 1X5WA 2EPMX 1WRJA 1RQ0A 4IS1C 2EPZA 4BBYA 4F6NA 1IQOA 3K6QA 1BB8A 2L2MA 4F9CB 2IHR1 1XNRE 1QU6A 4O24A 5IXMB 1FKAE 4NXME 3VHTB 1X6FA 1MGTA 4R2PA 3DJWA 1AH5A 1HNXE 2JR1A 2EL5A 4R2DA 2EQ0A 4LU9A 1A1IA 4KWYA 3MSWA 1YYWA 2EM8A 2LRSA 4R2SA 4X65E 1JK2A 4DUZE 4ZYDA 2EN2A 4DR3E 2L6MA 2LJHA 3KZYA 5A69A 4LF6E 3THNA 1N32E 2MC5A 2EOSA 2B3TB 1WHNA 4K0KE 1A1LA 1T38A 4TUIA 2DB2A 2M1SA 2V8QB 5DNYA 2A25A 4B3ME 2EZ6A 1EKZA 2G7HA 2EOJA 2YTGA 5AC4A 2HJJA 1WXRA 2EMXA 2EOQA 2EL6A 4X62E 2ODRD 3MHHC 2EM9A 4N4RB 1ZR9A 4O4KA 5AE3A 2V86A 3UK3C 2UU9E 5F3WA 2N3HA 2UUBE 3ZOQB 2WZOA 2JYAA 1A1GA 5LMUE 2EN6A 2UUCE 4LFBE 2M4IA 2YTDA 2DSYA 4ZYEA 3M99B 3OMLA 1YZ9A 2EN7A 4KHPE 3QG5C 3OTOE 4F2JC 2WBUA 4JI3E 2EPKX 1O0WA 2RS7A 2B9DA 2YSOA 2YZTA 4YHHE 4P7DA 5KL3A 2EL4A 2FV4B 5KL6A 3FIGA 2WCC3 2RS6A 3LLHA 3EQ1A 2V85A 2L3CA 2VQEE 2JOBA 1DI2A 3THOB 4GKJE 4RH8A 1PKPA 2K4VA 3IWDA 3F6HA 1ZU1A 4BC7A 3DF6A 5FLXC 3L00A
chains in the Genus database with same CATH topology
4JI7E 3ADLA 2JWOA 1RC7A 5BR8E 1SR9A 1X48A 4JI8E 2L2NA 4DV4E 2B7TA 1XNQE 4L5NC 1RQ0A 4LFAE 4BBYA 2LUQA 2YT4A 2M7QA 4JI2E 3K6QA 4OOGC 2F8BA 3JTZA 5T6JA 2L2MA 2ODRC 4M30A 1HR0E 4JYAE 3VK6A 4F9CB 2IHR1 4R8OA 1T4LB 1ZBTA 1XNRE 3ADIA 1QU6A 1T4OA 5IT9C 4F54A 1FKAE 1GQEA 4NXME 1ZBQA 2JOXA 2VQFE 1X49A 2L8TA 3IWBA 2UXBE 2RSMA 3DJWA 2FGGA 2V88A 2L3JA 2JR1A 1HNXE 4TUGA 2DIXA 4LF9E 2L92A 4I8OA 4LU9A 2E5LE 4JI5E 4YY3E 4JI4E 3MSWA 1IBLE 1YYWA 4WSPA 2RTXA 3ADGA 2LRSA 4DMIA 1T4NA 2N3GA 4X65E 2FTXB 1N36E 4LFCE 1YYKA 2UXDE 1UILA 4DUYE 3LMLA 4DUZE 2JY9A 2LMZA 3H09A 4DV7E 4DR3E 2HHHE 2L6MA 4LF4E 2LJHA 5ADZA 3IWCA 3HPSA 4DV6E 3J80C 4LF6E 2MC5A 1N32E 1IBME 3JAMC 4WYQB 3VYYA 2B3TB 4B3TE 4JI1E 1WHNA 2H36X 4BCAA 4K0KE 4DR7E 3ADJA 4TUIA 3HXLA 1N34E 2DB2A 1IBKE 4Q28A 2M1SA 2EWLA 2V8QB 4R03A 4BC9A 5DNYA 3T1YE 4LTYA 4X8WA 4BS9A 2DMYA 4B3ME 2EZ6A 2KHXA 1EKZA 4GEQB 2UUAE 2G7HA 4BMJA 1XMQE 2LTSA 1WXRA 4B3SE 2V83A 4WFTA 4DKKA 2NUGA 4X62E 1STUA 5AE1A 4X66E 2ODRD 2KONA 1HNZE 4DV3E 2NUFA 4DV5E 2KOUA 3JU0A 2LBSB 5AE3A 2V86A 2UU9E 5F3WA 2N3HA 2UUBE 1X47A 3AUZA 1J5EE 3ZOQB 2WZOA 4DR4E 2MDRA 4P78A 3VYXA 4AQYE 4JV5E 5LMUE 1DQ3A 2CPNA 2UUCE 2V87A 1XMOE 4LFBE 4DV0E 2M4IA 4DR5E 4LF8E 1J26A 5A2QC 2DSYA 5LMNE 2V89A 2VE7C 5IWAE 4LF5E 4B3RE 1FJGE 2B7VA 3OMLA 3J81C 1YZ9A 2NUEA 4DV2E 2L33A 1WHQA 4DR2E 3OTOE 1YYOA 5AE2A 4KHPE 2VF1A 2NA2A 2LTRA 5AASA 4LF7E 2L2KB 1HNWE 1UHZA 4JI3E 2RS7A 1O0WA 3T1HE 3AV0A 3F6GA 2B9DA 3J7Yp 1I94E 4J8ZA 4DR6E 2YZTA 4YHHE 4GKKE 2LUPB 2MC6A 4DV1E 3C4TA 4M0VA 3C4BA 4P7DA 4NXNE 2FV4B 4JI6E 4F9AB 3FIGA 4X64E 4OX9E 2RS6A 3KWRA 3LLHA 3RMPA 3J7AG 5CFFE 2L3CA 2V85A 2VQEE 5LL6R 2JOBA 1GZ6A 4M2ZA 4JI0E 4GKJE 1DI2A 4WPYA 3HQ1A 2E1MA 2UXCE 3P1XA 3HTXA 2F4VE 1PKPA 3HPZA 2K4VA 4F9BB 3IWDA 3F6HA 2LE2A 2ZM6E 2JVAA 1N33E 4DR1E 4BC7A 4L8NA 4KZSA 3DF6A 5FLXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4V A; 
#chains in the Genus database with same CATH topology
 2R1F A;  1MEY C;  4WXC A;  1X48 A;  4JI8 E;  4DV4 E;  1L4S A;  1TN9 A;  1PJS A;  5KL5 A;  4L5N C;  1X3C A;  4JI2 E;  5A6A A;  4OOG C;  2F8B A;  2EPC A;  5T6J A;  1JK1 A;  2ODR C;  2YU8 A;  4JYA E;  3VK6 A;  5KL7 A;  4F54 A;  1ZBQ A;  2VQF E;  3IWB A;  2EOM A;  2RSM A;  5LLQ A;  2L3J A;  1AAY A;  4TUG A;  2EM6 A;  2DGC A;  3BID A;  2DIX A;  4LF9 E;  4I8O A;  4WXD A;  2RTX A;  4DMI A;  1T4N A;  2JXP A;  1YYK A;  2N8X A;  4DUY E;  1EH8 A;  2YRM A;  3IWC A;  2YTN A;  1DGC A;  3J80 C;  5A6B D;  1SFE A;  4R2A A;  4DR7 E;  1IBK E;  4BC9 A;  3T1Y E;  4BS9 A;  2DMY A;  2EMA A;  2LTS A;  2EMC A;  4WFT A;  4DKK A;  2LVH A;  1F2I G;  2NUG A;  4X66 E;  5IV8 B;  4DV3 E;  1KJK A;  3BF2 A;  4F6M A;  4BHC A;  2EPA A;  3C6K A;  3AUZ A;  1J5E E;  4AQY E;  2D9H A;  1NEI A;  1EH6 A;  4GZN C;  4DV0 E;  5LMN E;  2V89 A;  4B3R E;  2DLQ A;  1RMD A;  2YWQ A;  2L33 A;  1WHQ A;  4DR2 E;  1YYO A;  2EJ4 A;  2VF1 A;  2NA2 A;  1HNW E;  3T1H E;  1UN6 B;  3AV0 A;  3F6G A;  3J7Y p;  3C4T A;  1IMU A;  3C4B A;  4M9V C;  4X64 E;  3RMP A;  3BGH A;  1YFH A;  2RPC A;  2EN1 A;  2EOF A;  1N3G A;  4WSG A;  2EM4 A;  2E1M A;  3P1X A;  2I13 A;  3HPZ A;  2YTF A;  2ZM6 E;  2JVA A;  1NCS A;  2EMY A;  5A2Q C;  5ADZ A;  2EMI A;  1RC7 A;  4FK5 C;  2ENC A;  2B7T A;  4BHB A;  2HC5 A;  2LUQ A;  2M7Q A;  1YUI A;  2EOO A;  5A6B A;  1A1J A;  3JTZ A;  3KZZ A;  4M30 A;  2YTE A;  4Q35 B;  4R8O A;  2EOI A;  1ZBT A;  4X9J A;  5IT9 C;  1GQE A;  2UXB E;  2EE8 A;  2L8T A;  3EPK A;  2LV2 A;  5A6K A;  2L92 A;  1EH7 A;  1BBO A;  2E5L E;  4ZYG A;  1YPN A;  2EOZ A;  2EOR A;  2RSI A;  2WBT A;  2LJU A;  2FTX B;  2EQ1 A;  2YTQ A;  1UIL A;  2YSP A;  3LML A;  1X6H A;  5TSE A;  4DV7 E;  4LF4 E;  3EPH A;  4DV6 E;  2EM2 A;  1QNT A;  2MKN A;  4WX9 A;  3JAM C;  4WYQ B;  3VYY A;  4B3T E;  1PDA A;  1PJT A;  5AC5 A;  4ZYH A;  2EP3 A;  2M9A A;  3MHS C;  1YSA C;  1N34 E;  2EMB A;  4R2C A;  2CT1 A;  2EOE A;  4LTY A;  2EM0 A;  2E72 A;  2ADR A;  2ENA A;  2YU5 A;  4R2R A;  4BMJ A;  1XMQ E;  5A6J A;  2JPA A;  4B3S E;  2EMW A;  2DMI A;  2LT7 A;  5AE1 A;  1TF6 A;  1PJQ A;  4HTG A;  4DV5 E;  2YRK A;  2CTD A;  4DR4 E;  2MDR A;  4P78 A;  4JV5 E;  4O5G A;  1A1F A;  4HEI A;  2V87 A;  4DR5 E;  1A1K A;  1J26 A;  5IWA E;  4R2E A;  2B7V A;  2EM5 A;  4DV2 E;  2EN8 A;  2YRH A;  2GHF A;  5AE2 A;  2L2K B;  2YTI A;  1UHZ A;  5KL2 A;  4DR6 E;  2LUP B;  2GPI A;  2MC6 A;  4DV1 E;  1ZAA C;  2PRT A;  2EM3 A;  2YTO A;  4F9A B;  2ELY A;  3TQM A;  3KWR A;  4OX9 E;  3EPL A;  5LL6 R;  4M2Z A;  4JI0 E;  4NHR A;  3HQ1 A;  2UXC E;  3HTX A;  2MDG A;  4F9B B;  2LE2 A;  1N33 E;  1WJP A;  4L8N A;  4KZS A;  1T39 A;  2YTP A;  2BB8 A;  2EMH A;  3C6M A;  2EMF A;  5BR8 E;  2EMZ A;  2I9I A;  2L2N A;  1XNQ E;  1GTK A;  2LCE A;  4LFA E;  2YT4 A;  2DLK A;  2EQ3 A;  1HR0 E;  1YUJ A;  1LLM C;  2Q8U A;  2NAB A;  1T4L B;  3ADI A;  1T4O A;  2JOX A;  1X49 A;  2EPR A;  2FGG A;  2V88 A;  4O43 A;  1G2F C;  2YTJ A;  4JI5 E;  2EPO A;  4YY3 E;  4JI4 E;  2EOH A;  2HGH A;  1IBL E;  4WSP A;  4MLQ A;  3ADG A;  2UXD E;  2N3G A;  1N36 E;  4LFC E;  2EM7 A;  1Z1B A;  2EPL X;  1IQS A;  2JY9 A;  2LMZ A;  3H09 A;  2K7I A;  2HHH E;  1A1H A;  3HPS A;  1IBM E;  1TF3 A;  4JI1 E;  2BBG A;  2GLI A;  2H36 X;  4BCA A;  3ADJ A;  3HXL A;  4Q28 A;  2EWL A;  2MKD A;  4R03 A;  2EN3 A;  4X8W A;  4R2Q A;  2KHX A;  1KYQ A;  4GEQ B;  2UUA E;  2EN4 A;  2EMK A;  2R76 A;  2J7J A;  2V83 A;  4IJD A;  5KL4 A;  2VRD A;  1STU A;  2RQL A;  2YPN A;  2KON A;  1HNZ E;  2WBS A;  2NUF A;  2DRP A;  2KOU A;  3JU0 A;  2LBS B;  1UBD C;  2EPU A;  4RHB B;  2ENH A;  2JP9 A;  1X47 A;  3VYX A;  1DQ3 A;  2CPN A;  1XMO E;  4LF8 E;  2EPX A;  2VE7 C;  2EOX A;  4LF5 E;  2EMG A;  1FJG E;  3J81 C;  4MLV A;  2NUE A;  3BBG A;  2EPN A;  5AAS A;  2LTR A;  4NZV A;  4LF7 E;  1I94 E;  4GKK E;  4J8Z A;  4NXN E;  4M0V A;  4JI6 E;  2LO3 A;  3EPJ A;  2EPP A;  3J7A G;  5CFF E;  2EOY A;  1GZ6 A;  2CSH A;  4WPY A;  1X6E A;  2F4V E;  1B69 A;  2EML A;  1P47 A;  3ECR A;  4DR1 E;  1G2D C;  4JI7 E;  3ADL A;  1BBG A;  2JWO A;  1SR9 A;  2ELZ A;  1X5W A;  2EPM X;  1WRJ A;  1RQ0 A;  4IS1 C;  2EPZ A;  4BBY A;  4F6N A;  1IQO A;  3K6Q A;  1BB8 A;  2L2M A;  4F9C B;  2IHR 1;  1XNR E;  1QU6 A;  4O24 A;  5IXM B;  1FKA E;  4NXM E;  3VHT B;  1X6F A;  1MGT A;  4R2P A;  3DJW A;  1AH5 A;  1HNX E;  2JR1 A;  2EL5 A;  4R2D A;  2EQ0 A;  4LU9 A;  1A1I A;  4KWY A;  3MSW A;  1YYW A;  2EM8 A;  2LRS A;  4R2S A;  4X65 E;  1JK2 A;  4DUZ E;  4ZYD A;  2EN2 A;  4DR3 E;  2L6M A;  2LJH A;  3KZY A;  5A69 A;  4LF6 E;  3THN A;  1N32 E;  2MC5 A;  2EOS A;  2B3T B;  1WHN A;  4K0K E;  1A1L A;  1T38 A;  4TUI A;  2DB2 A;  2M1S A;  2V8Q B;  5DNY A;  2A25 A;  4B3M E;  2EZ6 A;  1EKZ A;  2G7H A;  2EOJ A;  2YTG A;  5AC4 A;  2HJJ A;  1WXR A;  2EMX A;  2EOQ A;  2EL6 A;  4X62 E;  2ODR D;  3MHH C;  2EM9 A;  4N4R B;  1ZR9 A;  4O4K A;  5AE3 A;  2V86 A;  3UK3 C;  2UU9 E;  5F3W A;  2N3H A;  2UUB E;  3ZOQ B;  2WZO A;  2JYA A;  1A1G A;  5LMU E;  2EN6 A;  2UUC E;  4LFB E;  2M4I A;  2YTD A;  2DSY A;  4ZYE A;  3M99 B;  3OML A;  1YZ9 A;  2EN7 A;  4KHP E;  3QG5 C;  3OTO E;  4F2J C;  2WBU A;  4JI3 E;  2EPK X;  1O0W A;  2RS7 A;  2B9D A;  2YSO A;  2YZT A;  4YHH E;  4P7D A;  5KL3 A;  2EL4 A;  2FV4 B;  5KL6 A;  3FIG A;  2WCC 3;  2RS6 A;  3LLH A;  3EQ1 A;  2V85 A;  2L3C A;  2VQE E;  2JOB A;  1DI2 A;  3THO B;  4GKJ E;  4RH8 A;  1PKP A;  2K4V A;  3IWD A;  3F6H A;  1ZU1 A;  4BC7 A;  3DF6 A;  5FLX C;  3L00 A; 
#chains in the Genus database with same CATH homology
 4JI7 E;  3ADL A;  2JWO A;  1RC7 A;  5BR8 E;  1SR9 A;  1X48 A;  4JI8 E;  2L2N A;  4DV4 E;  2B7T A;  1XNQ E;  4L5N C;  1RQ0 A;  4LFA E;  4BBY A;  2LUQ A;  2YT4 A;  2M7Q A;  4JI2 E;  3K6Q A;  4OOG C;  2F8B A;  3JTZ A;  5T6J A;  2L2M A;  2ODR C;  4M30 A;  1HR0 E;  4JYA E;  3VK6 A;  4F9C B;  2IHR 1;  4R8O A;  1T4L B;  1ZBT A;  1XNR E;  3ADI A;  1QU6 A;  1T4O A;  5IT9 C;  4F54 A;  1FKA E;  1GQE A;  4NXM E;  1ZBQ A;  2JOX A;  2VQF E;  1X49 A;  2L8T A;  3IWB A;  2UXB E;  2RSM A;  3DJW A;  2FGG A;  2V88 A;  2L3J A;  2JR1 A;  1HNX E;  4TUG A;  2DIX A;  4LF9 E;  2L92 A;  4I8O A;  4LU9 A;  2E5L E;  4JI5 E;  4YY3 E;  4JI4 E;  3MSW A;  1IBL E;  1YYW A;  4WSP A;  2RTX A;  3ADG A;  2LRS A;  4DMI A;  1T4N A;  2N3G A;  4X65 E;  2FTX B;  1N36 E;  4LFC E;  1YYK A;  2UXD E;  1UIL A;  4DUY E;  3LML A;  4DUZ E;  2JY9 A;  2LMZ A;  3H09 A;  4DV7 E;  4DR3 E;  2HHH E;  2L6M A;  4LF4 E;  2LJH A;  5ADZ A;  3IWC A;  3HPS A;  4DV6 E;  3J80 C;  4LF6 E;  2MC5 A;  1N32 E;  1IBM E;  3JAM C;  4WYQ B;  3VYY A;  2B3T B;  4B3T E;  4JI1 E;  1WHN A;  2H36 X;  4BCA A;  4K0K E;  4DR7 E;  3ADJ A;  4TUI A;  3HXL A;  1N34 E;  2DB2 A;  1IBK E;  4Q28 A;  2M1S A;  2EWL A;  2V8Q B;  4R03 A;  4BC9 A;  5DNY A;  3T1Y E;  4LTY A;  4X8W A;  4BS9 A;  2DMY A;  4B3M E;  2EZ6 A;  2KHX A;  1EKZ A;  4GEQ B;  2UUA E;  2G7H A;  4BMJ A;  1XMQ E;  2LTS A;  1WXR A;  4B3S E;  2V83 A;  4WFT A;  4DKK A;  2NUG A;  4X62 E;  1STU A;  5AE1 A;  4X66 E;  2ODR D;  2KON A;  1HNZ E;  4DV3 E;  2NUF A;  4DV5 E;  2KOU A;  3JU0 A;  2LBS B;  5AE3 A;  2V86 A;  2UU9 E;  5F3W A;  2N3H A;  2UUB E;  1X47 A;  3AUZ A;  1J5E E;  3ZOQ B;  2WZO A;  4DR4 E;  2MDR A;  4P78 A;  3VYX A;  4AQY E;  4JV5 E;  5LMU E;  1DQ3 A;  2CPN A;  2UUC E;  2V87 A;  1XMO E;  4LFB E;  4DV0 E;  2M4I A;  4DR5 E;  4LF8 E;  1J26 A;  5A2Q C;  2DSY A;  5LMN E;  2V89 A;  2VE7 C;  5IWA E;  4LF5 E;  4B3R E;  1FJG E;  2B7V A;  3OML A;  3J81 C;  1YZ9 A;  2NUE A;  4DV2 E;  2L33 A;  1WHQ A;  4DR2 E;  3OTO E;  1YYO A;  5AE2 A;  4KHP E;  2VF1 A;  2NA2 A;  2LTR A;  5AAS A;  4LF7 E;  2L2K B;  1HNW E;  1UHZ A;  4JI3 E;  2RS7 A;  1O0W A;  3T1H E;  3AV0 A;  3F6G A;  2B9D A;  3J7Y p;  1I94 E;  4J8Z A;  4DR6 E;  2YZT A;  4YHH E;  4GKK E;  2LUP B;  2MC6 A;  4DV1 E;  3C4T A;  4M0V A;  3C4B A;  4P7D A;  4NXN E;  2FV4 B;  4JI6 E;  4F9A B;  3FIG A;  4X64 E;  4OX9 E;  2RS6 A;  3KWR A;  3LLH A;  3RMP A;  3J7A G;  5CFF E;  2L3C A;  2V85 A;  2VQE E;  5LL6 R;  2JOB A;  1GZ6 A;  4M2Z A;  4JI0 E;  4GKJ E;  1DI2 A;  4WPY A;  3HQ1 A;  2E1M A;  2UXC E;  3P1X A;  3HTX A;  2F4V E;  1PKP A;  3HPZ A;  2K4V A;  4F9B B;  3IWD A;  3F6H A;  2LE2 A;  2ZM6 E;  2JVA A;  1N33 E;  4DR1 E;  4BC7 A;  4L8N A;  4KZS A;  3DF6 A;  5FLX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...