2K4VA

Solution structure of uncharacterized protein pa1076 from pseudomonas aeruginosa. northeast structural genomics consortium (nesg) target pat3, ontario center for structural proteomics target pa1076 .
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFEDIRAKLHAHPGEPVDLERIIRHEGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of uncharacterized protein PA1076 from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein PA1076
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16703 DUF5064 Domain of unknown function (DUF5064)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.370 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2k4vA00
2K4VA
chains in the Genus database with same CATH superfamily
2E72A 4F9CB 1QNTA 2EL4A 1IQSA 5A6BA 2MKNA 1A1HA 3HXLA 5A6BD 1QU6A 4NXNE 3BGHA 1YUJA 3FIGA 3MSWA 5A6AA 2E1MA 1I94E 2YSOA 4DMIA 5A6JA 4MLQA 2EOZA 2GPIA 4DV3E 1IBLE 3MHHC 4KZSA 2WBSA 5KL2A 3BF2A 2JP9A 5LL6R 4DV5E 2G7HA 2KONA 4R03A 2EPUA 4JYAE 5A6KA 4F9AB 4DR2E 4LF4E 4JV5E 2B7TA 1YFHA 2EMKA 2DB2A 2EPRA 3F6HA 1F2IG 4M9VC 3LMLA 1RC7A 1ZBQA 3KWRA 2CTDA 1YSAC 1PJTA 2RSMA 3ECRA 1BBOA 4R2SA 2EWLA 2UXBE 4DR4E 2LVHA 2JYAA 1RQ0A 1N33E 2EN4A 5KL6A 1X47A 5T6JA 4BHCA 3ADLA 3IWDA 2YTOA 3C6KA 5TSEA 1A1LA 2E5LE 4OX9E 2YT4A 2R76A 2EPOA 2L92A 2EPAA 2EMYA 3IWCA 1ZBTA 3JU0A 2YTFA 2EM3A 1X48A 4IS1C 2YPNA 2EPXA 3MHSC 2M9AA 1JK1A 1WRJA 1ZU1A 2NABA 1KJKA 2ENCA 4GEQB 3J7AG 4OOGC 4LF5E 3OTOE 2V87A 5AE2A 4P7DA 2UXCE 2EN3A 2RSIA 3AV0A 5IV8B 1STUA 5AE3A 2YTPA 3P1XA 1EH7A 1IMUA 1HNZE 2NUGA 2EOIA 2WCC3 2EPNA 2HHHE 2EQ0A 3EPKA 4DUZE 2EMGA 2JWOA 2B7VA 2LUPB 2VE7C 2EOQA 4BMJA 4FK5C 2EMXA 5CFFE 2V88A 2GHFA 2M7QA 2MC6A 3THNA 5KL3A 1GTKA 2UUBE 4X9JA 1DQ3A 2L6MA 2PRTA 2DSYA 2WBTA 4O43A 2K7IA 2EM6A 5F3WA 2CPNA 1WXRA 4F9BB 3EPLA 2VRDA 3ZOQB 3HPSA 1T4LB 2EMBA 1B69A 3ADJA 2GLIA 3J7Yp 4JI7E 2RPCA 2DLKA 1SFEA 2YZTA 1EH6A 4WPYA 2YTEA 2YTJA 5AE1A 2HGHA 2M1SA 4B3ME 2EM9A 3QG5C 1UBDC 2EPPA 4B3RE 4KWYA 2UUAE 1N34E 1HNWE 2EM5A 1YYWA 2EQ1A 1SR9A 4JI6E 2LJUA 4BHBA 2YTIA 2EMCA 5KL4A 3J80C 4I8OA 4DV0E 2EOHA 4DV1E 4JI1E 2V86A 2ELZA 4LF8E 2ELYA 2BB8A 2L2KB 2EPKX 2K4VA 2ODRC 3C4TA 4F6NA 4DR7E 3H09A 2NUFA 4B3SE 5AC4A 1GQEA 1XNQE 2YU5A 3ADGA 5LMUE 4WFTA 1PJQA 4Q35B 3HPZA 2IHR1 5FLXC 4M2ZA 2EPMX 1TN9A 1MGTA 2EN8A 3L00A 2A25A 4JI4E 4WYQB 2YU8A 4X66E 5KL7A 1RMDA 4R2CA 3BBGA 2ZM6E 1A1KA 2B9DA 5A69A 2EOYA 4TUIA 2N3GA 5A2QC 3RMPA 1EKZA 2EOFA 1J5EE 4RH8A 4GKJE 2V83A 2LUQA 2YRKA 1UN6B 2Q8UA 2FGGA 2EZ6A 4DUYE 3EPJA 3EPHA 4DV7E 4LTYA 1YZ9A 3HTXA 1KYQA 2F8BA 3OMLA 2JOXA 2EMLA 1DGCA 4WSPA 4WSGA 4R2EA 2MC5A 4R8OA 4GKKE 4WXDA 5AASA 1T39A 4JI2E 2MKDA 4JI5E 4O24A 3DJWA 3DF6A 2YTGA 2DLQA 1HNXE 4GZNC 4X65E 2EL5A 2EM7A 1XMQE 4JI8E 1AAYA 4DKKA 2YSPA 2JOBA 2LBSB 2EPLX 3ADIA 2YRHA 2EJ4A 3F6GA 4AQYE 1GZ6A 3UK3C 2L3CA 5BR8E 2N3HA 1X49A 5AC5A 2EOMA 1T38A 4DV6E 4F54A 4R2DA 1IBME 2CSHA 2EPCA 2NA2A 2EMHA 1NCSA 4ZYHA 2ADRA 3THOB 2CT1A 4B3TE 4YHHE 2VQFE 2LO3A 2LJHA 1PDAA 1X6HA 4R2AA 2UXDE 2DMIA 4LF7E 1A1FA 4L5NC 2EMIA 1XNRE 2I9IA 4DR5E 4NZVA 2DRPA 1YUIA 1IBKE 4DV2E 1WHQA 2EORA 2DIXA 2VF1A 2UUCE 1ZR9A 2LTSA 3HQ1A 3JTZA 3J81C 4O4KA 2HJJA 2EMAA 1BBGA 4LU9A 4L8NA 4JI0E 2KHXA 1N32E 2EE8A 2V89A 2ENHA 2UU9E 3VYYA 4MLVA 2YTDA 1TF6A 2L2NA 4JI3E 5DNYA 1X5WA 4DV4E 4M30A 4IJDA 4R2RA 1Z1BA 2D9HA 5LMNE 2FTXB 5IT9C 2BBGA 2WBUA 2EM4A 2YRMA 3K6QA 5LLQA 2ODRD 1ZAAC 4X62E 2I13A 2EOSA 1EH8A 4N4RB 4R2QA 1YYOA 3VYXA 5KL5A 4NXME 3M99B 2YWQA 4HEIA 2RS6A 1N3GA 1IQOA 2EOEA 4LFCE 4M0VA 4F2JC 4R2PA 1FJGE 2EM2A 2ENAA 2B3TB 3BIDA 1BB8A 1WJPA 1UHZA 2DMYA 2JPAA 2V85A 4LFBE 1G2FC 2JVAA 1HR0E 2J7JA 2FV4B 4LF9E 2F4VE 2EQ3A 1FKAE 4NHRA 2EN2A 4ZYEA 2YTQA 5IWAE 4HTGA 4BCAA 2EM8A 3C4BA 2EMZA 4BC9A 2KOUA 1N36E 2EOOA 2V8QB 1XMOE 4J8ZA 1X6EA 3EQ1A 3IWBA 2L3JA 3T1YE 1LLMC 2WZOA 2YTNA 2LT7A 1PKPA 3VK6A 1A1GA 3KZZA 3LLHA 3C6MA 4LF6E 2MDGA 2EM0A 2LCEA 1TF3A 3AUZA 4BC7A 3T1HE 1DI2A 5ADZA 2L8TA 5IXMB 2JR1A 2LE2A 2EMWA 3JAMC 3VHTB 1O0WA 1PJSA 2L2MA 2LTRA 4DR6E 1A1IA 4LFAE 4WXCA 1MEYC 4DR3E 2RS7A 4KHPE 2H36X 2RTXA 2EMFA 4BBYA 4RHBB 1G2DC 1L4SA 4F6MA 1WHNA 1T4OA 1YYKA 4DR1E 1NEIA 4P78A 2LMZA 2M4IA 4BS9A 3KZYA 4K0KE 2EPZA 2RQLA 2HC5A 1YPNA 4Q28A 1X3CA 2EP3A 2N8XA 2MDRA 2EL6A 2JXPA 1T4NA 2LRSA 1AH5A 2VQEE 2LV2A 4YY3E 2EN7A 2EOXA 4X8WA 4X64E 2JY9A 1A1JA 3TQMA 4WX9A 4O5GA 1JK2A 4ZYGA 2NUEA 2R1FA 1P47A 2L33A 4TUGA 1X6FA 2EOJA 4ZYDA 2EN1A 1J26A 2EN6A 1UILA 2DGCA
chains in the Genus database with same CATH topology
1UHZA 4F9CB 2F8BA 2DMYA 3OMLA 2JWOA 2B7VA 2JOXA 2LUPB 2VE7C 4WSPA 4DV7E 2V85A 4BMJA 4LFBE 2MC5A 4R8OA 3HXLA 4GKKE 5AASA 1QU6A 5CFFE 2V88A 2JVAA 4NXNE 2M7QA 1HR0E 2MC6A 2FV4B 4LF9E 2F4VE 3FIGA 4JI2E 3MSWA 1FKAE 2E1MA 1XMOE 2UUBE 4JI5E 3DJWA 3DF6A 5IWAE 1DQ3A 2L6MA 4BCAA 1I94E 4DMIA 1HNXE 2DSYA 3C4BA 4DV3E 1IBLE 4X65E 4KZSA 1XMQE 4JI8E 5F3WA 2CPNA 4BC9A 2KOUA 4DKKA 4F9BB 1WXRA 3ZOQB 3HPSA 2JOBA 2V8QB 2LBSB 1T4LB 3ADIA 3ADJA 3F6GA 4J8ZA 1GZ6A 5LL6R 3J7Yp 2L3CA 4DV5E 3IWBA 5BR8E 4JI7E 2L3JA 3T1YE 2G7HA 2WZOA 2N3HA 1X49A 2KONA 4R03A 4JYAE 1PKPA 4DV6E 2YZTA 4F54A 4WPYA 1IBME 3VK6A 4F9AB 4DR2E 3LLHA 4LF4E 5AE1A 4JV5E 2B7TA 2M1SA 4B3ME 4LF6E 4B3RE 2NA2A 2UUAE 2DB2A 3AUZA 4BC7A 3T1HE 1DI2A 5ADZA 1N34E 4AQYE 1HNWE 2L8TA 3F6HA 4B3TE 3LMLA 2JR1A 1RC7A 1ZBQA 2LE2A 4YHHE 1YYWA 3KWRA 2VQFE 1SR9A 2LJHA 4JI6E 2RSMA 3JAMC 2UXDE 1O0WA 2L2MA 2LTRA 2EWLA 4LF7E 4DR6E 4DR4E 3J80C 2UXBE 4LFAE 4L5NC 4I8OA 1XNRE 1RQ0A 4DR5E 4DV0E 1N33E 4DR3E 2RS7A 4KHPE 1X47A 2H36X 1IBKE 2RTXA 4DV2E 5T6JA 1WHQA 3HTXA 2DIXA 3ADLA 2VF1A 4BBYA 2UUCE 3IWDA 2LTSA 4DV1E 3HQ1A 2V86A 4JI1E 3JTZA 3J81C 1WHNA 4LF8E 2E5LE 1T4OA 4OX9E 1YYKA 4DR1E 2YT4A 4LU9A 2L92A 4L8NA 4P78A 2K4VA 2KHXA 2ODRC 3C4TA 2LMZA 3IWCA 2M4IA 4JI0E 1N32E 4DR7E 1ZBTA 3H09A 3JU0A 2V89A 1N36E 4BS9A 2NUFA 2UU9E 3VYYA 1X48A 4B3SE 2L2NA 1GQEA 1XNQE 4JI3E 5DNYA 4K0KE 4DV4E 4M30A 4Q28A 3ADGA 5LMUE 5LMNE 2MDRA 2FTXB 4WFTA 1T4NA 2IHR1 2LRSA 3HPZA 5FLXC 5IT9C 4M2ZA 2VQEE 3K6QA 4JI4E 2ODRD 4YY3E 4X62E 4WYQB 4GEQB 3J7AG 4OOGC 4LF5E 4X66E 3OTOE 2V87A 5AE2A 4X8WA 1YYOA 4P7DA 2L2KB 3VYXA 4X64E 2JY9A 2UXCE 2ZM6E 2NUEA 3AV0A 4NXME 1STUA 2B9DA 5AE3A 2L33A 4TUGA 2RS6A 3P1XA 1HNZE 2NUGA 4TUIA 2N3GA 5A2QC 3RMPA 1EKZA 4LFCE 1YZ9A 4M0VA 1J26A 1J5EE 4GKJE 1FJGE 2V83A 2LUQA 2B3TB 2HHHE 2FGGA 2EZ6A 1UILA 4DUYE 4DUZE 4LTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4V A; 
#chains in the Genus database with same CATH topology
 2E72 A;  4F9C B;  1QNT A;  2EL4 A;  1IQS A;  5A6B A;  2MKN A;  1A1H A;  3HXL A;  5A6B D;  1QU6 A;  4NXN E;  3BGH A;  1YUJ A;  3FIG A;  3MSW A;  5A6A A;  2E1M A;  1I94 E;  2YSO A;  4DMI A;  5A6J A;  4MLQ A;  2EOZ A;  2GPI A;  4DV3 E;  1IBL E;  3MHH C;  4KZS A;  2WBS A;  5KL2 A;  3BF2 A;  2JP9 A;  5LL6 R;  4DV5 E;  2G7H A;  2KON A;  4R03 A;  2EPU A;  4JYA E;  5A6K A;  4F9A B;  4DR2 E;  4LF4 E;  4JV5 E;  2B7T A;  1YFH A;  2EMK A;  2DB2 A;  2EPR A;  3F6H A;  1F2I G;  4M9V C;  3LML A;  1RC7 A;  1ZBQ A;  3KWR A;  2CTD A;  1YSA C;  1PJT A;  2RSM A;  3ECR A;  1BBO A;  4R2S A;  2EWL A;  2UXB E;  4DR4 E;  2LVH A;  2JYA A;  1RQ0 A;  1N33 E;  2EN4 A;  5KL6 A;  1X47 A;  5T6J A;  4BHC A;  3ADL A;  3IWD A;  2YTO A;  3C6K A;  5TSE A;  1A1L A;  2E5L E;  4OX9 E;  2YT4 A;  2R76 A;  2EPO A;  2L92 A;  2EPA A;  2EMY A;  3IWC A;  1ZBT A;  3JU0 A;  2YTF A;  2EM3 A;  1X48 A;  4IS1 C;  2YPN A;  2EPX A;  3MHS C;  2M9A A;  1JK1 A;  1WRJ A;  1ZU1 A;  2NAB A;  1KJK A;  2ENC A;  4GEQ B;  3J7A G;  4OOG C;  4LF5 E;  3OTO E;  2V87 A;  5AE2 A;  4P7D A;  2UXC E;  2EN3 A;  2RSI A;  3AV0 A;  5IV8 B;  1STU A;  5AE3 A;  2YTP A;  3P1X A;  1EH7 A;  1IMU A;  1HNZ E;  2NUG A;  2EOI A;  2WCC 3;  2EPN A;  2HHH E;  2EQ0 A;  3EPK A;  4DUZ E;  2EMG A;  2JWO A;  2B7V A;  2LUP B;  2VE7 C;  2EOQ A;  4BMJ A;  4FK5 C;  2EMX A;  5CFF E;  2V88 A;  2GHF A;  2M7Q A;  2MC6 A;  3THN A;  5KL3 A;  1GTK A;  2UUB E;  4X9J A;  1DQ3 A;  2L6M A;  2PRT A;  2DSY A;  2WBT A;  4O43 A;  2K7I A;  2EM6 A;  5F3W A;  2CPN A;  1WXR A;  4F9B B;  3EPL A;  2VRD A;  3ZOQ B;  3HPS A;  1T4L B;  2EMB A;  1B69 A;  3ADJ A;  2GLI A;  3J7Y p;  4JI7 E;  2RPC A;  2DLK A;  1SFE A;  2YZT A;  1EH6 A;  4WPY A;  2YTE A;  2YTJ A;  5AE1 A;  2HGH A;  2M1S A;  4B3M E;  2EM9 A;  3QG5 C;  1UBD C;  2EPP A;  4B3R E;  4KWY A;  2UUA E;  1N34 E;  1HNW E;  2EM5 A;  1YYW A;  2EQ1 A;  1SR9 A;  4JI6 E;  2LJU A;  4BHB A;  2YTI A;  2EMC A;  5KL4 A;  3J80 C;  4I8O A;  4DV0 E;  2EOH A;  4DV1 E;  4JI1 E;  2V86 A;  2ELZ A;  4LF8 E;  2ELY A;  2BB8 A;  2L2K B;  2EPK X;  2K4V A;  2ODR C;  3C4T A;  4F6N A;  4DR7 E;  3H09 A;  2NUF A;  4B3S E;  5AC4 A;  1GQE A;  1XNQ E;  2YU5 A;  3ADG A;  5LMU E;  4WFT A;  1PJQ A;  4Q35 B;  3HPZ A;  2IHR 1;  5FLX C;  4M2Z A;  2EPM X;  1TN9 A;  1MGT A;  2EN8 A;  3L00 A;  2A25 A;  4JI4 E;  4WYQ B;  2YU8 A;  4X66 E;  5KL7 A;  1RMD A;  4R2C A;  3BBG A;  2ZM6 E;  1A1K A;  2B9D A;  5A69 A;  2EOY A;  4TUI A;  2N3G A;  5A2Q C;  3RMP A;  1EKZ A;  2EOF A;  1J5E E;  4RH8 A;  4GKJ E;  2V83 A;  2LUQ A;  2YRK A;  1UN6 B;  2Q8U A;  2FGG A;  2EZ6 A;  4DUY E;  3EPJ A;  3EPH A;  4DV7 E;  4LTY A;  1YZ9 A;  3HTX A;  1KYQ A;  2F8B A;  3OML A;  2JOX A;  2EML A;  1DGC A;  4WSP A;  4WSG A;  4R2E A;  2MC5 A;  4R8O A;  4GKK E;  4WXD A;  5AAS A;  1T39 A;  4JI2 E;  2MKD A;  4JI5 E;  4O24 A;  3DJW A;  3DF6 A;  2YTG A;  2DLQ A;  1HNX E;  4GZN C;  4X65 E;  2EL5 A;  2EM7 A;  1XMQ E;  4JI8 E;  1AAY A;  4DKK A;  2YSP A;  2JOB A;  2LBS B;  2EPL X;  3ADI A;  2YRH A;  2EJ4 A;  3F6G A;  4AQY E;  1GZ6 A;  3UK3 C;  2L3C A;  5BR8 E;  2N3H A;  1X49 A;  5AC5 A;  2EOM A;  1T38 A;  4DV6 E;  4F54 A;  4R2D A;  1IBM E;  2CSH A;  2EPC A;  2NA2 A;  2EMH A;  1NCS A;  4ZYH A;  2ADR A;  3THO B;  2CT1 A;  4B3T E;  4YHH E;  2VQF E;  2LO3 A;  2LJH A;  1PDA A;  1X6H A;  4R2A A;  2UXD E;  2DMI A;  4LF7 E;  1A1F A;  4L5N C;  2EMI A;  1XNR E;  2I9I A;  4DR5 E;  4NZV A;  2DRP A;  1YUI A;  1IBK E;  4DV2 E;  1WHQ A;  2EOR A;  2DIX A;  2VF1 A;  2UUC E;  1ZR9 A;  2LTS A;  3HQ1 A;  3JTZ A;  3J81 C;  4O4K A;  2HJJ A;  2EMA A;  1BBG A;  4LU9 A;  4L8N A;  4JI0 E;  2KHX A;  1N32 E;  2EE8 A;  2V89 A;  2ENH A;  2UU9 E;  3VYY A;  4MLV A;  2YTD A;  1TF6 A;  2L2N A;  4JI3 E;  5DNY A;  1X5W A;  4DV4 E;  4M30 A;  4IJD A;  4R2R A;  1Z1B A;  2D9H A;  5LMN E;  2FTX B;  5IT9 C;  2BBG A;  2WBU A;  2EM4 A;  2YRM A;  3K6Q A;  5LLQ A;  2ODR D;  1ZAA C;  4X62 E;  2I13 A;  2EOS A;  1EH8 A;  4N4R B;  4R2Q A;  1YYO A;  3VYX A;  5KL5 A;  4NXM E;  3M99 B;  2YWQ A;  4HEI A;  2RS6 A;  1N3G A;  1IQO A;  2EOE A;  4LFC E;  4M0V A;  4F2J C;  4R2P A;  1FJG E;  2EM2 A;  2ENA A;  2B3T B;  3BID A;  1BB8 A;  1WJP A;  1UHZ A;  2DMY A;  2JPA A;  2V85 A;  4LFB E;  1G2F C;  2JVA A;  1HR0 E;  2J7J A;  2FV4 B;  4LF9 E;  2F4V E;  2EQ3 A;  1FKA E;  4NHR A;  2EN2 A;  4ZYE A;  2YTQ A;  5IWA E;  4HTG A;  4BCA A;  2EM8 A;  3C4B A;  2EMZ A;  4BC9 A;  2KOU A;  1N36 E;  2EOO A;  2V8Q B;  1XMO E;  4J8Z A;  1X6E A;  3EQ1 A;  3IWB A;  2L3J A;  3T1Y E;  1LLM C;  2WZO A;  2YTN A;  2LT7 A;  1PKP A;  3VK6 A;  1A1G A;  3KZZ A;  3LLH A;  3C6M A;  4LF6 E;  2MDG A;  2EM0 A;  2LCE A;  1TF3 A;  3AUZ A;  4BC7 A;  3T1H E;  1DI2 A;  5ADZ A;  2L8T A;  5IXM B;  2JR1 A;  2LE2 A;  2EMW A;  3JAM C;  3VHT B;  1O0W A;  1PJS A;  2L2M A;  2LTR A;  4DR6 E;  1A1I A;  4LFA E;  4WXC A;  1MEY C;  4DR3 E;  2RS7 A;  4KHP E;  2H36 X;  2RTX A;  2EMF A;  4BBY A;  4RHB B;  1G2D C;  1L4S A;  4F6M A;  1WHN A;  1T4O A;  1YYK A;  4DR1 E;  1NEI A;  4P78 A;  2LMZ A;  2M4I A;  4BS9 A;  3KZY A;  4K0K E;  2EPZ A;  2RQL A;  2HC5 A;  1YPN A;  4Q28 A;  1X3C A;  2EP3 A;  2N8X A;  2MDR A;  2EL6 A;  2JXP A;  1T4N A;  2LRS A;  1AH5 A;  2VQE E;  2LV2 A;  4YY3 E;  2EN7 A;  2EOX A;  4X8W A;  4X64 E;  2JY9 A;  1A1J A;  3TQM A;  4WX9 A;  4O5G A;  1JK2 A;  4ZYG A;  2NUE A;  2R1F A;  1P47 A;  2L33 A;  4TUG A;  1X6F A;  2EOJ A;  4ZYD A;  2EN1 A;  1J26 A;  2EN6 A;  1UIL A;  2DGC A; 
#chains in the Genus database with same CATH homology
 1UHZ A;  4F9C B;  2F8B A;  2DMY A;  3OML A;  2JWO A;  2B7V A;  2JOX A;  2LUP B;  2VE7 C;  4WSP A;  4DV7 E;  2V85 A;  4BMJ A;  4LFB E;  2MC5 A;  4R8O A;  3HXL A;  4GKK E;  5AAS A;  1QU6 A;  5CFF E;  2V88 A;  2JVA A;  4NXN E;  2M7Q A;  1HR0 E;  2MC6 A;  2FV4 B;  4LF9 E;  2F4V E;  3FIG A;  4JI2 E;  3MSW A;  1FKA E;  2E1M A;  1XMO E;  2UUB E;  4JI5 E;  3DJW A;  3DF6 A;  5IWA E;  1DQ3 A;  2L6M A;  4BCA A;  1I94 E;  4DMI A;  1HNX E;  2DSY A;  3C4B A;  4DV3 E;  1IBL E;  4X65 E;  4KZS A;  1XMQ E;  4JI8 E;  5F3W A;  2CPN A;  4BC9 A;  2KOU A;  4DKK A;  4F9B B;  1WXR A;  3ZOQ B;  3HPS A;  2JOB A;  2V8Q B;  2LBS B;  1T4L B;  3ADI A;  3ADJ A;  3F6G A;  4J8Z A;  1GZ6 A;  5LL6 R;  3J7Y p;  2L3C A;  4DV5 E;  3IWB A;  5BR8 E;  4JI7 E;  2L3J A;  3T1Y E;  2G7H A;  2WZO A;  2N3H A;  1X49 A;  2KON A;  4R03 A;  4JYA E;  1PKP A;  4DV6 E;  2YZT A;  4F54 A;  4WPY A;  1IBM E;  3VK6 A;  4F9A B;  4DR2 E;  3LLH A;  4LF4 E;  5AE1 A;  4JV5 E;  2B7T A;  2M1S A;  4B3M E;  4LF6 E;  4B3R E;  2NA2 A;  2UUA E;  2DB2 A;  3AUZ A;  4BC7 A;  3T1H E;  1DI2 A;  5ADZ A;  1N34 E;  4AQY E;  1HNW E;  2L8T A;  3F6H A;  4B3T E;  3LML A;  2JR1 A;  1RC7 A;  1ZBQ A;  2LE2 A;  4YHH E;  1YYW A;  3KWR A;  2VQF E;  1SR9 A;  2LJH A;  4JI6 E;  2RSM A;  3JAM C;  2UXD E;  1O0W A;  2L2M A;  2LTR A;  2EWL A;  4LF7 E;  4DR6 E;  4DR4 E;  3J80 C;  2UXB E;  4LFA E;  4L5N C;  4I8O A;  1XNR E;  1RQ0 A;  4DR5 E;  4DV0 E;  1N33 E;  4DR3 E;  2RS7 A;  4KHP E;  1X47 A;  2H36 X;  1IBK E;  2RTX A;  4DV2 E;  5T6J A;  1WHQ A;  3HTX A;  2DIX A;  3ADL A;  2VF1 A;  4BBY A;  2UUC E;  3IWD A;  2LTS A;  4DV1 E;  3HQ1 A;  2V86 A;  4JI1 E;  3JTZ A;  3J81 C;  1WHN A;  4LF8 E;  2E5L E;  1T4O A;  4OX9 E;  1YYK A;  4DR1 E;  2YT4 A;  4LU9 A;  2L92 A;  4L8N A;  4P78 A;  2K4V A;  2KHX A;  2ODR C;  3C4T A;  2LMZ A;  3IWC A;  2M4I A;  4JI0 E;  1N32 E;  4DR7 E;  1ZBT A;  3H09 A;  3JU0 A;  2V89 A;  1N36 E;  4BS9 A;  2NUF A;  2UU9 E;  3VYY A;  1X48 A;  4B3S E;  2L2N A;  1GQE A;  1XNQ E;  4JI3 E;  5DNY A;  4K0K E;  4DV4 E;  4M30 A;  4Q28 A;  3ADG A;  5LMU E;  5LMN E;  2MDR A;  2FTX B;  4WFT A;  1T4N A;  2IHR 1;  2LRS A;  3HPZ A;  5FLX C;  5IT9 C;  4M2Z A;  2VQE E;  3K6Q A;  4JI4 E;  2ODR D;  4YY3 E;  4X62 E;  4WYQ B;  4GEQ B;  3J7A G;  4OOG C;  4LF5 E;  4X66 E;  3OTO E;  2V87 A;  5AE2 A;  4X8W A;  1YYO A;  4P7D A;  2L2K B;  3VYX A;  4X64 E;  2JY9 A;  2UXC E;  2ZM6 E;  2NUE A;  3AV0 A;  4NXM E;  1STU A;  2B9D A;  5AE3 A;  2L33 A;  4TUG A;  2RS6 A;  3P1X A;  1HNZ E;  2NUG A;  4TUI A;  2N3G A;  5A2Q C;  3RMP A;  1EKZ A;  4LFC E;  1YZ9 A;  4M0V A;  1J26 A;  1J5E E;  4GKJ E;  1FJG E;  2V83 A;  2LUQ A;  2B3T B;  2HHH E;  2FGG A;  2EZ6 A;  1UIL A;  4DUY E;  4DUZ E;  4LTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...