2K4VA

Solution structure of uncharacterized protein pa1076 from pseudomonas aeruginosa. northeast structural genomics consortium (nesg) target pat3, ontario center for structural proteomics target pa1076 .
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
125
structure length
125
Chain Sequence
b'QGHMFEPGHLHLVSLPGLDQQDINIHIRYEVRQNAESGAYVHFDMDGEIDGKPFSDSFELPRDTAFNFASDATRVAQKHGLHPKFGAITRVHKEYDAMFEDIRAKLHAHPGEPVDLERIIRHEGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein PA1076
publication title Solution structure of uncharacterized protein PA1076 from Pseudomonas aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 27
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16703 DUF5064 Domain of unknown function (DUF5064)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.370 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2k4vA00
2K4VA
chains in the Genus database with same CATH superfamily
3QG5C 2M1SA 2B7TA 2YRMA 4JV5E 1YUIA 1XNQE 5F3WA 4DR2E 4GKJE 2CPNA 3DJWA 4DV5E 1WXRA 1EH6A 2EPLX 1IBKE 4B3RE 4MLQA 2YSPA 1ZR9A 4JI8E 5AE1A 4TUIA 4DMIA 2E5LE 5A6BD 4R03A 3AUZA 5LLQA 4OX9E 4JI5E 1PJSA 1B69A 2WBUA 5LMUE 4DV7E 4DR3E 1IBME 2V83A 2EE8A 4MLVA 2R76A 2UUCE 4YHHE 1YFHA 4ZYDA 2EJ4A 4BHBA 3MSWA 3ZOQB 5A6JA 5FLXC 2YWQA 1N3GA 5A6AA 3EQ1A 5CFFE 2EM2A 4F6MA 3TQMA 2YTQA 1YUJA 2VE7C 5AC5A 2LUQA 1UILA 1X6FA 4LF6E 2RSIA 1XNRE 4RHBB 3VYXA 2EM7A 2YTJA 2DMYA 5T6JA 4LF8E 4NXME 2EOFA 2EPAA 1YZ9A 3ECRA 4BC9A 3UK3C 4IS1C 4HEIA 3VHTB 1A1LA 4TUGA 2EOJA 2KHXA 3J7Yp 1T39A 4WFTA 2MDRA 4F54A 2EPKX 5KL2A 2EOIA 2ODRC 1P47A 1AAYA 2KOUA 2EMKA 3C6KA 1YSAC 4DUYE 3IWDA 4L8NA 4WPYA 2YRHA 2EOZA 2DGCA 2ELZA 2UXCE 2LRSA 3EPHA 1JK1A 3BF2A 1L4SA 2JR1A 3T1HE 3HQ1A 4X66E 4O4KA 4B3SE 4R2AA 1UBDC 3KZYA 3THNA 3K6QA 1ZBQA 2I9IA 2LUPB 2MC6A 4WXCA 1A1IA 1A1FA 1PJTA 4DV4E 1N36E 2EMHA 3MHHC 4Q35B 1FKAE 4JI3E 2EQ1A 2V88A 5LMNE 4JYAE 2RS7A 2EMZA 2MKDA 2EM4A 1YYKA 1GTKA 5AE3A 1SR9A 1X49A 4M0VA 4F9AB 1YYOA 2LCEA 2EMBA 2H36X 4P78A 2FV4B 2NABA 2ENHA 1HNXE 2RPCA 1RMDA 3HXLA 1UHZA 4R2RA 1MGTA 4ZYHA 2EPRA 4O5GA 2L3CA 1TF3A 2EZ6A 2EM0A 2YTFA 3C6MA 2UXBE 4X64E 2B7VA 2N8XA 1EH8A 2EPNA 4BS9A 2EN8A 1IBLE 4HTGA 2EPXA 3BGHA 2M9AA 4O24A 4I8OA 5TSEA 1TF6A 2YTOA 2EM8A 4WXDA 4NXNE 2J7JA 2YTNA 2K7IA 1DI2A 2D9HA 2RSMA 2L2KB 1T4OA 4B3TE 1N33E 2DMIA 1A1JA 1J26A 2DB2A 4DR4E 2EMFA 1T4LB 3LLHA 1YPNA 2YTEA 2E72A 1A1GA 4KWYA 4K0KE 1F2IG 2CT1A 2HHHE 1T4NA 1UN6B 5KL4A 3JTZA 2RTXA 3EPKA 1BBOA 3HPZA 5AC4A 2YTPA 1EH7A 4M2ZA 4J8ZA 2EOMA 2FGGA 4F2JC 4LFBE 4KZSA 4BCAA 2DRPA 4LF4E 3RMPA 2BBGA 1MEYC 2CTDA 1X3CA 2WBTA 3BIDA 4R8OA 4JI6E 5DNYA 4LF7E 2L2NA 3L00A 2F8BA 1O0WA 2LTRA 1IQOA 2EOHA 5AE2A 2NUFA 1FJGE 3ADGA 4DR1E 2EMIA 3EPLA 5AASA 3J81C 2ZM6E 4BHCA 1IQSA 2HJJA 2LMZA 1GZ6A 4LFCE 3HTXA 2EM3A 2EPZA 2EL5A 4P7DA 2R1FA 1YYWA 2YPNA 5BR8E 2MC5A 5KL5A 2L6MA 2JVAA 3OTOE 2YTDA 4DV2E 1PKPA 2EP3A 2V85A 4GZNC 1G2FC 2UUAE 1N32E 4KHPE 2EPMX 1N34E 1WJPA 2EM5A 3THOB 2EOSA 1X6HA 1BBGA 5IWAE 1WHNA 2N3GA 4L5NC 2RQLA 3ADIA 4O43A 2B3TB 1RC7A 1SFEA 3C4BA 2EMAA 2JOXA 2E1MA 2NUGA 2EOXA 3EPJA 2EWLA 2A25A 4R2DA 2ENAA 1QNTA 2ADRA 3MHSC 4DKKA 4BC7A 2YSOA 3F6HA 2EMXA 2NA2A 1HR0E 4ZYEA 3C4TA 2YU8A 2F4VE 2LT7A 4F6NA 1T38A 4JI4E 4X8WA 4M9VC 2DSYA 2EOEA 2B9DA 2EPPA 2GPIA 2RS6A 2EN2A 4F9CB 4AQYE 4R2CA 1XMQE 2V87A 4BMJA 3H09A 4JI1E 2MDGA 2DIXA 1QU6A 3LMLA 1LLMC 1GQEA 4OOGC 3FIGA 2NUEA 2LJUA 2EQ0A 2DLQA 4R2QA 3M99B 2HC5A 2WZOA 2EOOA 5IT9C 1NEIA 2L3JA 1HNWE 4N4RB 2EL4A 2ELYA 1KYQA 3ADLA 2V8QB 2EN6A 2MKNA 2HGHA 3DF6A 4DR5E 3IWCA 2UUBE 3J7AG 2L92A 5IXMB 4DV3E 2L33A 1Z1BA 2LTSA 2EM6A 1X47A 4BBYA 3T1YE 4WSPA 4FK5C 2LVHA 2L2MA 2I13A 4LF9E 5IV8B 4F9BB 2JP9A 4DUZE 2EOQA 2EN3A 2LJHA 3KZZA 2V89A 1NCSA 2WBSA 1J5EE 1A1KA 2VRDA 4ZYGA 2LBSB 1DQ3A 2KONA 4LF5E 2JPAA 3P1XA 1ZAAC 2LO3A 2YRKA 2EMYA 2JOBA 1X5WA 4X65E 3KWRA 2EPCA 4X62E 2M4IA 2CSHA 2EN7A 2YU5A 4R2SA 2EMWA 3HPSA 4JI7E 4M30A 2LV2A 3VK6A 2EMGA 1WHQA 5A69A 2G7HA 2EM9A 1ZBTA 4GEQB 4X9JA 5A6BA 1XMOE 2K4VA 4WSGA 2VQFE 2JY9A 3ADJA 3J80C 2YTIA 3JAMC 1PJQA 3IWBA 2Q8UA 2V86A 2L8TA 2EL6A 2M7QA 2VF1A 2UU9E 1TN9A 1JK2A 2VQEE 2EQ3A 3OMLA 1DGCA 2EMCA 2WCC3 3F6GA 2EN1A 2ODRD 2DLKA 5ADZA 5KL7A 2EPUA 1X48A 2LE2A 1RQ0A 4IJDA 4JI2E 2PRTA 1G2DC 1BB8A 3VYYA 3BBGA 4YY3E 2YTGA 1EKZA 2FTXB 2IHR1 1ZU1A 4JI0E 2JWOA 2EOYA 1STUA 4B3ME 5KL6A 4DR6E 3JU0A 2GHFA 3AV0A 1IMUA 2YT4A 2EMLA 5A6KA 1WRJA 2GLIA 2UXDE 4NZVA 1I94E 4LFAE 4R2PA 4DV1E 1HNZE 4WYQB 5LL6R 2BB8A 1AH5A 4DR7E 1KJKA 4WX9A 2YZTA 2EPOA 4R2EA 4RH8A 5KL3A 2ENCA 4LU9A 4NHRA 4GKKE 1X6EA 2EN4A 2N3HA 4Q28A 1PDAA 4DV6E 2JYAA 4LTYA 5A2QC 4DV0E 2JXPA 1A1HA 2EORA
chains in the Genus database with same CATH topology
2KONA 4LF5E 2M1SA 3P1XA 2B7TA 4KHPE 5BR8E 2MC5A 4JV5E 2L6MA 1YYKA 1XNQE 2JOBA 2JVAA 5AE3A 3OTOE 4X65E 5F3WA 1SR9A 1X49A 3KWRA 4M0VA 4F9AB 1PKPA 4X62E 2V85A 2H36X 4DV2E 2M4IA 4DR2E 1YYOA 2UUAE 1N32E 4P78A 1N34E 4GKJE 2FV4B 2CPNA 3DJWA 4DV5E 1WXRA 1HNXE 1IBKE 3HPSA 4JI7E 4B3RE 5IWAE 1WHNA 2N3GA 3HXLA 4JI8E 5AE1A 1UHZA 4L5NC 4M30A 3ADIA 3VK6A 4DMIA 4TUIA 2B3TB 1WHQA 4R03A 3AUZA 2E5LE 2G7HA 1RC7A 1ZBTA 4JI5E 3C4BA 4GEQB 2L3CA 4DV7E 2JOXA 2E1MA 5LMUE 2K4VA 4DR3E 1XMOE 1IBME 2EZ6A 2VQFE 2V83A 2JY9A 2NUGA 2UUCE 2EWLA 4X64E 2UXBE 4YHHE 3ADJA 3J80C 2B7VA 3MSWA 3ZOQB 4BS9A 1IBLE 5FLXC 3JAMC 4DKKA 5CFFE 1J26A 4BC7A 3F6HA 3IWBA 2NA2A 2VE7C 1HR0E 2V86A 2L8TA 3C4TA 4I8OA 2LUQA 2M7QA 1UILA 2F4VE 4NXNE 2VF1A 2UU9E 4JI4E 4LF6E 1DI2A 2RSMA 1XNRE 2L2KB 2VQEE 4X8WA 2DSYA 3OMLA 1T4OA 2B9DA 3VYXA 4B3TE 3F6GA 2DMYA 2RS6A 5T6JA 4LF8E 4NXME 1N33E 4F9CB 1YZ9A 2DB2A 4BC9A 4AQYE 1XMQE 2V87A 1T4LB 4BMJA 2ODRD 3H09A 4JI1E 4DR4E 2DIXA 3LLHA 5ADZA 4TUGA 2KHXA 1QU6A 3LMLA 3J7Yp 1X48A 1GQEA 2LE2A 4OOGC 4K0KE 3FIGA 2HHHE 1T4NA 1RQ0A 4WFTA 2NUEA 2MDRA 3JTZA 4F54A 4JI2E 2RTXA 3HPZA 2WZOA 2ODRC 3VYYA 4M2ZA 4YY3E 2KOUA 4J8ZA 5IT9C 2FGGA 2L3JA 4DUYE 1HNWE 3IWDA 4LFBE 1EKZA 4L8NA 4OX9E 4KZSA 2FTXB 2IHR1 4WPYA 4BCAA 4LF4E 2LRSA 2V8QB 3RMPA 3ADLA 2UXCE 4JI0E 2JWOA 3DF6A 4DR5E 3IWCA 2UUBE 3J7AG 2L92A 4JI6E 2JR1A 4R8OA 5DNYA 4LF7E 1STUA 2L2NA 4DV3E 4B3ME 2L33A 3T1HE 2LTSA 2F8BA 3T1YE 1X47A 4BBYA 3JU0A 3AV0A 3HQ1A 4DR6E 4WSPA 1O0WA 2LTRA 2YT4A 4X66E 4B3SE 4LFAE 1I94E 2UXDE 2L2MA 3K6QA 1ZBQA 4LF9E 4DV1E 1HNZE 4F9BB 4WYQB 5LL6R 4DUZE 2LUPB 4DR7E 2MC6A 5AE2A 2NUFA 1FJGE 2LJHA 3ADGA 4DR1E 2YZTA 4DV4E 5AASA 3J81C 2V89A 1N36E 2ZM6E 4LU9A 1FKAE 4JI3E 2LMZA 1J5EE 4GKKE 1GZ6A 4LFCE 2V88A 5LMNE 4Q28A 2N3HA 4DV6E 2LBSB 3HTXA 4JYAE 4LTYA 5A2QC 4P7DA 4DV0E 1YYWA 2RS7A 1DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4V A; 
#chains in the Genus database with same CATH topology
 3QG5 C;  2M1S A;  2B7T A;  2YRM A;  4JV5 E;  1YUI A;  1XNQ E;  5F3W A;  4DR2 E;  4GKJ E;  2CPN A;  3DJW A;  4DV5 E;  1WXR A;  1EH6 A;  2EPL X;  1IBK E;  4B3R E;  4MLQ A;  2YSP A;  1ZR9 A;  4JI8 E;  5AE1 A;  4TUI A;  4DMI A;  2E5L E;  5A6B D;  4R03 A;  3AUZ A;  5LLQ A;  4OX9 E;  4JI5 E;  1PJS A;  1B69 A;  2WBU A;  5LMU E;  4DV7 E;  4DR3 E;  1IBM E;  2V83 A;  2EE8 A;  4MLV A;  2R76 A;  2UUC E;  4YHH E;  1YFH A;  4ZYD A;  2EJ4 A;  4BHB A;  3MSW A;  3ZOQ B;  5A6J A;  5FLX C;  2YWQ A;  1N3G A;  5A6A A;  3EQ1 A;  5CFF E;  2EM2 A;  4F6M A;  3TQM A;  2YTQ A;  1YUJ A;  2VE7 C;  5AC5 A;  2LUQ A;  1UIL A;  1X6F A;  4LF6 E;  2RSI A;  1XNR E;  4RHB B;  3VYX A;  2EM7 A;  2YTJ A;  2DMY A;  5T6J A;  4LF8 E;  4NXM E;  2EOF A;  2EPA A;  1YZ9 A;  3ECR A;  4BC9 A;  3UK3 C;  4IS1 C;  4HEI A;  3VHT B;  1A1L A;  4TUG A;  2EOJ A;  2KHX A;  3J7Y p;  1T39 A;  4WFT A;  2MDR A;  4F54 A;  2EPK X;  5KL2 A;  2EOI A;  2ODR C;  1P47 A;  1AAY A;  2KOU A;  2EMK A;  3C6K A;  1YSA C;  4DUY E;  3IWD A;  4L8N A;  4WPY A;  2YRH A;  2EOZ A;  2DGC A;  2ELZ A;  2UXC E;  2LRS A;  3EPH A;  1JK1 A;  3BF2 A;  1L4S A;  2JR1 A;  3T1H E;  3HQ1 A;  4X66 E;  4O4K A;  4B3S E;  4R2A A;  1UBD C;  3KZY A;  3THN A;  3K6Q A;  1ZBQ A;  2I9I A;  2LUP B;  2MC6 A;  4WXC A;  1A1I A;  1A1F A;  1PJT A;  4DV4 E;  1N36 E;  2EMH A;  3MHH C;  4Q35 B;  1FKA E;  4JI3 E;  2EQ1 A;  2V88 A;  5LMN E;  4JYA E;  2RS7 A;  2EMZ A;  2MKD A;  2EM4 A;  1YYK A;  1GTK A;  5AE3 A;  1SR9 A;  1X49 A;  4M0V A;  4F9A B;  1YYO A;  2LCE A;  2EMB A;  2H36 X;  4P78 A;  2FV4 B;  2NAB A;  2ENH A;  1HNX E;  2RPC A;  1RMD A;  3HXL A;  1UHZ A;  4R2R A;  1MGT A;  4ZYH A;  2EPR A;  4O5G A;  2L3C A;  1TF3 A;  2EZ6 A;  2EM0 A;  2YTF A;  3C6M A;  2UXB E;  4X64 E;  2B7V A;  2N8X A;  1EH8 A;  2EPN A;  4BS9 A;  2EN8 A;  1IBL E;  4HTG A;  2EPX A;  3BGH A;  2M9A A;  4O24 A;  4I8O A;  5TSE A;  1TF6 A;  2YTO A;  2EM8 A;  4WXD A;  4NXN E;  2J7J A;  2YTN A;  2K7I A;  1DI2 A;  2D9H A;  2RSM A;  2L2K B;  1T4O A;  4B3T E;  1N33 E;  2DMI A;  1A1J A;  1J26 A;  2DB2 A;  4DR4 E;  2EMF A;  1T4L B;  3LLH A;  1YPN A;  2YTE A;  2E72 A;  1A1G A;  4KWY A;  4K0K E;  1F2I G;  2CT1 A;  2HHH E;  1T4N A;  1UN6 B;  5KL4 A;  3JTZ A;  2RTX A;  3EPK A;  1BBO A;  3HPZ A;  5AC4 A;  2YTP A;  1EH7 A;  4M2Z A;  4J8Z A;  2EOM A;  2FGG A;  4F2J C;  4LFB E;  4KZS A;  4BCA A;  2DRP A;  4LF4 E;  3RMP A;  2BBG A;  1MEY C;  2CTD A;  1X3C A;  2WBT A;  3BID A;  4R8O A;  4JI6 E;  5DNY A;  4LF7 E;  2L2N A;  3L00 A;  2F8B A;  1O0W A;  2LTR A;  1IQO A;  2EOH A;  5AE2 A;  2NUF A;  1FJG E;  3ADG A;  4DR1 E;  2EMI A;  3EPL A;  5AAS A;  3J81 C;  2ZM6 E;  4BHC A;  1IQS A;  2HJJ A;  2LMZ A;  1GZ6 A;  4LFC E;  3HTX A;  2EM3 A;  2EPZ A;  2EL5 A;  4P7D A;  2R1F A;  1YYW A;  2YPN A;  5BR8 E;  2MC5 A;  5KL5 A;  2L6M A;  2JVA A;  3OTO E;  2YTD A;  4DV2 E;  1PKP A;  2EP3 A;  2V85 A;  4GZN C;  1G2F C;  2UUA E;  1N32 E;  4KHP E;  2EPM X;  1N34 E;  1WJP A;  2EM5 A;  3THO B;  2EOS A;  1X6H A;  1BBG A;  5IWA E;  1WHN A;  2N3G A;  4L5N C;  2RQL A;  3ADI A;  4O43 A;  2B3T B;  1RC7 A;  1SFE A;  3C4B A;  2EMA A;  2JOX A;  2E1M A;  2NUG A;  2EOX A;  3EPJ A;  2EWL A;  2A25 A;  4R2D A;  2ENA A;  1QNT A;  2ADR A;  3MHS C;  4DKK A;  4BC7 A;  2YSO A;  3F6H A;  2EMX A;  2NA2 A;  1HR0 E;  4ZYE A;  3C4T A;  2YU8 A;  2F4V E;  2LT7 A;  4F6N A;  1T38 A;  4JI4 E;  4X8W A;  4M9V C;  2DSY A;  2EOE A;  2B9D A;  2EPP A;  2GPI A;  2RS6 A;  2EN2 A;  4F9C B;  4AQY E;  4R2C A;  1XMQ E;  2V87 A;  4BMJ A;  3H09 A;  4JI1 E;  2MDG A;  2DIX A;  1QU6 A;  3LML A;  1LLM C;  1GQE A;  4OOG C;  3FIG A;  2NUE A;  2LJU A;  2EQ0 A;  2DLQ A;  4R2Q A;  3M99 B;  2HC5 A;  2WZO A;  2EOO A;  5IT9 C;  1NEI A;  2L3J A;  1HNW E;  4N4R B;  2EL4 A;  2ELY A;  1KYQ A;  3ADL A;  2V8Q B;  2EN6 A;  2MKN A;  2HGH A;  3DF6 A;  4DR5 E;  3IWC A;  2UUB E;  3J7A G;  2L92 A;  5IXM B;  4DV3 E;  2L33 A;  1Z1B A;  2LTS A;  2EM6 A;  1X47 A;  4BBY A;  3T1Y E;  4WSP A;  4FK5 C;  2LVH A;  2L2M A;  2I13 A;  4LF9 E;  5IV8 B;  4F9B B;  2JP9 A;  4DUZ E;  2EOQ A;  2EN3 A;  2LJH A;  3KZZ A;  2V89 A;  1NCS A;  2WBS A;  1J5E E;  1A1K A;  2VRD A;  4ZYG A;  2LBS B;  1DQ3 A;  2KON A;  4LF5 E;  2JPA A;  3P1X A;  1ZAA C;  2LO3 A;  2YRK A;  2EMY A;  2JOB A;  1X5W A;  4X65 E;  3KWR A;  2EPC A;  4X62 E;  2M4I A;  2CSH A;  2EN7 A;  2YU5 A;  4R2S A;  2EMW A;  3HPS A;  4JI7 E;  4M30 A;  2LV2 A;  3VK6 A;  2EMG A;  1WHQ A;  5A69 A;  2G7H A;  2EM9 A;  1ZBT A;  4GEQ B;  4X9J A;  5A6B A;  1XMO E;  2K4V A;  4WSG A;  2VQF E;  2JY9 A;  3ADJ A;  3J80 C;  2YTI A;  3JAM C;  1PJQ A;  3IWB A;  2Q8U A;  2V86 A;  2L8T A;  2EL6 A;  2M7Q A;  2VF1 A;  2UU9 E;  1TN9 A;  1JK2 A;  2VQE E;  2EQ3 A;  3OML A;  1DGC A;  2EMC A;  2WCC 3;  3F6G A;  2EN1 A;  2ODR D;  2DLK A;  5ADZ A;  5KL7 A;  2EPU A;  1X48 A;  2LE2 A;  1RQ0 A;  4IJD A;  4JI2 E;  2PRT A;  1G2D C;  1BB8 A;  3VYY A;  3BBG A;  4YY3 E;  2YTG A;  1EKZ A;  2FTX B;  2IHR 1;  1ZU1 A;  4JI0 E;  2JWO A;  2EOY A;  1STU A;  4B3M E;  5KL6 A;  4DR6 E;  3JU0 A;  2GHF A;  3AV0 A;  1IMU A;  2YT4 A;  2EML A;  5A6K A;  1WRJ A;  2GLI A;  2UXD E;  4NZV A;  1I94 E;  4LFA E;  4R2P A;  4DV1 E;  1HNZ E;  4WYQ B;  5LL6 R;  2BB8 A;  1AH5 A;  4DR7 E;  1KJK A;  4WX9 A;  2YZT A;  2EPO A;  4R2E A;  4RH8 A;  5KL3 A;  2ENC A;  4LU9 A;  4NHR A;  4GKK E;  1X6E A;  2EN4 A;  2N3H A;  4Q28 A;  1PDA A;  4DV6 E;  2JYA A;  4LTY A;  5A2Q C;  4DV0 E;  2JXP A;  1A1H A;  2EOR A; 
#chains in the Genus database with same CATH homology
 2KON A;  4LF5 E;  2M1S A;  3P1X A;  2B7T A;  4KHP E;  5BR8 E;  2MC5 A;  4JV5 E;  2L6M A;  1YYK A;  1XNQ E;  2JOB A;  2JVA A;  5AE3 A;  3OTO E;  4X65 E;  5F3W A;  1SR9 A;  1X49 A;  3KWR A;  4M0V A;  4F9A B;  1PKP A;  4X62 E;  2V85 A;  2H36 X;  4DV2 E;  2M4I A;  4DR2 E;  1YYO A;  2UUA E;  1N32 E;  4P78 A;  1N34 E;  4GKJ E;  2FV4 B;  2CPN A;  3DJW A;  4DV5 E;  1WXR A;  1HNX E;  1IBK E;  3HPS A;  4JI7 E;  4B3R E;  5IWA E;  1WHN A;  2N3G A;  3HXL A;  4JI8 E;  5AE1 A;  1UHZ A;  4L5N C;  4M30 A;  3ADI A;  3VK6 A;  4DMI A;  4TUI A;  2B3T B;  1WHQ A;  4R03 A;  3AUZ A;  2E5L E;  2G7H A;  1RC7 A;  1ZBT A;  4JI5 E;  3C4B A;  4GEQ B;  2L3C A;  4DV7 E;  2JOX A;  2E1M A;  5LMU E;  2K4V A;  4DR3 E;  1XMO E;  1IBM E;  2EZ6 A;  2VQF E;  2V83 A;  2JY9 A;  2NUG A;  2UUC E;  2EWL A;  4X64 E;  2UXB E;  4YHH E;  3ADJ A;  3J80 C;  2B7V A;  3MSW A;  3ZOQ B;  4BS9 A;  1IBL E;  5FLX C;  3JAM C;  4DKK A;  5CFF E;  1J26 A;  4BC7 A;  3F6H A;  3IWB A;  2NA2 A;  2VE7 C;  1HR0 E;  2V86 A;  2L8T A;  3C4T A;  4I8O A;  2LUQ A;  2M7Q A;  1UIL A;  2F4V E;  4NXN E;  2VF1 A;  2UU9 E;  4JI4 E;  4LF6 E;  1DI2 A;  2RSM A;  1XNR E;  2L2K B;  2VQE E;  4X8W A;  2DSY A;  3OML A;  1T4O A;  2B9D A;  3VYX A;  4B3T E;  3F6G A;  2DMY A;  2RS6 A;  5T6J A;  4LF8 E;  4NXM E;  1N33 E;  4F9C B;  1YZ9 A;  2DB2 A;  4BC9 A;  4AQY E;  1XMQ E;  2V87 A;  1T4L B;  4BMJ A;  2ODR D;  3H09 A;  4JI1 E;  4DR4 E;  2DIX A;  3LLH A;  5ADZ A;  4TUG A;  2KHX A;  1QU6 A;  3LML A;  3J7Y p;  1X48 A;  1GQE A;  2LE2 A;  4OOG C;  4K0K E;  3FIG A;  2HHH E;  1T4N A;  1RQ0 A;  4WFT A;  2NUE A;  2MDR A;  3JTZ A;  4F54 A;  4JI2 E;  2RTX A;  3HPZ A;  2WZO A;  2ODR C;  3VYY A;  4M2Z A;  4YY3 E;  2KOU A;  4J8Z A;  5IT9 C;  2FGG A;  2L3J A;  4DUY E;  1HNW E;  3IWD A;  4LFB E;  1EKZ A;  4L8N A;  4OX9 E;  4KZS A;  2FTX B;  2IHR 1;  4WPY A;  4BCA A;  4LF4 E;  2LRS A;  2V8Q B;  3RMP A;  3ADL A;  2UXC E;  4JI0 E;  2JWO A;  3DF6 A;  4DR5 E;  3IWC A;  2UUB E;  3J7A G;  2L92 A;  4JI6 E;  2JR1 A;  4R8O A;  5DNY A;  4LF7 E;  1STU A;  2L2N A;  4DV3 E;  4B3M E;  2L33 A;  3T1H E;  2LTS A;  2F8B A;  3T1Y E;  1X47 A;  4BBY A;  3JU0 A;  3AV0 A;  3HQ1 A;  4DR6 E;  4WSP A;  1O0W A;  2LTR A;  2YT4 A;  4X66 E;  4B3S E;  4LFA E;  1I94 E;  2UXD E;  2L2M A;  3K6Q A;  1ZBQ A;  4LF9 E;  4DV1 E;  1HNZ E;  4F9B B;  4WYQ B;  5LL6 R;  4DUZ E;  2LUP B;  4DR7 E;  2MC6 A;  5AE2 A;  2NUF A;  1FJG E;  2LJH A;  3ADG A;  4DR1 E;  2YZT A;  4DV4 E;  5AAS A;  3J81 C;  2V89 A;  1N36 E;  2ZM6 E;  4LU9 A;  1FKA E;  4JI3 E;  2LMZ A;  1J5E E;  4GKK E;  1GZ6 A;  4LFC E;  2V88 A;  5LMN E;  4Q28 A;  2N3H A;  4DV6 E;  2LBS B;  3HTX A;  4JYA E;  4LTY A;  5A2Q C;  4P7D A;  4DV0 E;  1YYW A;  2RS7 A;  1DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...