2K57A

Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
MASPTVITLNDGREIQAVDTPKYDEESGFYEFKQLDGKQTRINKDQVRTVKDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Lipoprotein
publication title Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A.
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Structural genomics, unknown function
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k57A00
4M7AD 1M8VA 4C92E 5LJ3j 4M7AA 4PJOC 3SWNB 4N0AC 4EMHA 4M7DC 2YLCA 5GMKm 4PJOE 4M75G 3JCMf 4M7DE 1WPYA 5GMKl 5LJ5h 1D3BB 4HT9A 3JCMJ 4WF2A 5LJ5g 5LJ3d 4F7UF 2RA2A 4J6YA 1LOJA 2RD1A 5I21A 4M7AC 5CAIA 4M7AG 4PNOA 4C92D 3JCMQ 4C92A 3RKWA 1X01A 4M7AE 4MMLA 4M77G 3BY7A 2DEQA 2DZCA 4M77D 4M75C 5LJ3f 5GANe 1WNLA 5GAOn 4PJOD 4PJOA 5GAMh 3EFRA 4XTXA 4XU3A 4M7DA 5GAOr 2DXTA 3JCMX 3JB9J 3HSBA 3BFMA 3V7SA 5LJ5j 2EAYA 3BDUA 4HA8A 5LJ5e 3EFSA 2YHTA 2DVEA 4NL2A 5GAMg 5GANh 4M77C 4HT8A 5GMKe 3JCMb 4DQ2A 2VC8A 4M77E 1I4K1 4NOYA 3JB9F 1YCYA 4M75D 5LJ5d 2E41A 4JLIA 4M75A 1HXDA 3SWNC 5GAN8 3JB9G 5GAMj 5GANg 3JCMW 5GAMe 3RESA 2CGHA 4EMKA 5GAN3 1U1TA 4M78B 3HFNA 4C8QB 5GMKh 5GMKi 1N9RA 4JRIA 4F7UG 4F7UA 1Y96A 5GAOm 5GAMd 4MMKA 3INZA 2DXUA 4M77A 3V8KA 5GAN4 4M75F 5GAOl 2DTHA 5GANj 4XU0A 4M75E 5GAN5 3SB2A 1B34A 3V8JA 3V7RA 4EMKC 2DJZA 1I81A 2Y90A 4OP0A 1KQ2A 2EJ9A 4M7DB 4J5YA 3JCMh 3SWNA 4V2SA 2I2LA 2FB7A 3GIBA 4J6XA 2E1HA 3RIRA 5GANd 4XU1A 5GAN6 4C8QF 4M78F 4XTZA 5GMKj 5GAN7 1D3BA 1LJOA 4F7UE 4A53A 4EMGA 4M7AB 4Y91A 2FYKA 4JRKA 3JCMg 5GANf 1I5LA 3RKYA 1MGQA 2JN0A 2EWNA 5DY9A 2VXEA 2YLBA 3V7CA 3JB9D 3FIFA 3QHSA 3RKXA 3JCMc 4M7DF 3RUXA 2ZGWA 4XU2A 3QSUA 4JUVA 2EJFA 5LJ5f 2HNIA 3JCMe 3L1AA 2DKGA 4XTYA 3JCMP 3FJPA 2E65A 5GAOq 3JCMV 4A54A 2RM4A 4C92B 3M4GA 1M5Q1 2EJGA 4M77B 3BW1A 4M7AF 3V8LA 2DTIA 4PJOB 3JB9H 4RCCA 4RCBA 3JCMd 1WQ7A 2VXFA 5GAMf 3L2ZA 3QO3A 5LJ3e 3RERA 1LNXA 1KQ1A 1BIBA 1TH7A 5GAOp 1U1SA 4XTUA 1H641 2E10A 4C8QG 3PGGA 4M78G 4M78D 1BIAA 1HK9A 3QUIA 4M78A 4C8QA 2E64A 4C8QD 4C92F 3AHUA 4M77F 5LJ3h 4M75B 3HFOA 4X9DA 3VU3C 4PJOF 4XTVA 2K57A 1N9SA 4C92G 4QVCA 4EMKB 4XTWA 4PJOG 4M7DG 2QTXA 4X9CA 4M7DD 4J6WA 4N0AA 4NL3A 4C8QC 4M78C 5LJ3g 5GAN2 1I8FA 1WQWA 1Y96B 4F7UB 2DZ9A 4QVDA 3FB9A 4M78E 4C8QE 1JBMA 2DTOA 2RB6A 4C92C 4XQ3A 1B34B 3JB9I 1JRIA
chains in the Genus database with same CATH superfamily
4AG2C 4M7AA 4IUTA 3VV0A 2HD0A 1LOJA 1KQSS 2L89A 2HKQB 3CCJQ 3CMET 1MMNA 2BZXA 4M77G 5CIUA 3BDLA 1VQ4T 3NGPA 2P0KA 4J9FA 2KE9A 3E2UA 2A36A 2L8DA 1FXXA 4M77C 3M55A 3A5ZB 3F70A 2QG9B 4QVZA 2R5AA 1WHMA 2O88A 1I4K1 1XQHA 4F04B 4M75A 3CCUA 1QLYA 3JB9G 1N8RC 2HCKA 1QQJA 4NS5A 3CPFA 2VUBA 4F7UA 3GNFB 1K8AU 1BB9A 2XIDA 1JJ2A 5D7UA 3E9FA 2L3RA 1M1KU 2I2LA 1VA7A 4Q5WA 1V1CA 4OMQA 5GMKj 4Y91A 2MCNA 1NPRA 2OAWA 1TS9A 1I0CA 3HRTA 3JB9D 5FWCA 1BU1A 1IO6A 1C6VX 3OYEA 1M9SA 3P8BB 3HTRA 2M9UA 4ELYC 3BW1A 3EG1A 2K3XA 3HRSA 3JB9H 3TVTA 1OOTA 2C0TA 2DPPB 1RLQC 1YFNA 4JPBW 5GAOp 1G8XA 1MMAA 1N8RU 4XTUA 3I56A 2VWFA 1D1BA 3G71T 3CC4T 3MPUB 1VQLT 1HJDA 3LLRA 1RLPC 2K5LA 3OA6A 2EGCA 3M5AA 3VU3C 2LDMA 4QQDA 1ZBJA 4QVCA 2ZPBB 3OW2P 4PJNA 9ATCB 4PJOG 4AFUC 3L2QA 3MJXA 2LC4A 1Y96B 2DRMA 3H8ZA 1IB8A 1V29B 2OAUA 1AWOA 2KI7A 1PSEA 2G3RA 4PJOC 3EG9B 4EMHA 3KXTA 4KUIA 1ABQA 1IRXA 5CKFA 1ZBXA 3CCVQ 3J7AF 1VYTA 3I55A 4PJOD 4ME7A 4RMOA 1OU9A 3JCMX 3QJ6A 4RG8A 4TVRA 1PNJA 2GFUA 2JT4A 2V1RA 5ECAA 3EFOB 2LJ3A 2F5KA 5GANg 5GAMe 2HMAA 2MWPA 3HFNA 4FL6A 3CCLQ 2X4WA 1PKTA 1OPKA 1T3SA 1WI7A 5GAMd 3X28B 4M77A 1M1FA 4FM4B 3CEYA 2O01E 4OB0B 1B34A 3V8JA 4J8OA 1KJWA 5KYUA 2IG0A 3GF5A 3WVDB 4JRQA 4BI3A 4EMGA 2KGTA 1P92A 2CZ6B 2DFUA 1M3AA 1K9MU 1JEGA 7AT1B 2C06A 4PL6A 3X25B 1R0CB 2B86A 3KFVA 3UWNA 1WJQA 3PE0A 2KMTA 3EH2A 3OW2A 4OMMA 2PU9B 3HP9A 3L2ZA 2PQWA 8ATCB 4RG2A 1U1SA 3TSWA 2DXBA 3M57A 4EIKA 4M78G 5GAOq 4J9BA 1HK9A 4C92F 1M4ZA 2CT4A 2DERA 1QWEA 2CP7A 1YIJQ 1K9AA 4XTWA 4X9CA 4E7IA 4M78C 1MUZA 1QVGA 1WQWA 5HCKA 2E3HA 3LGLA 1YHQT 2Y4XA 1PM3A 1G3YA 2JUFA 3QJYA 1ZUKA 1YBYA 3FDRA 1D3BB 4HT9A 1N27A 3TREA 2HL3A 3FJ5A 2ROTA 3A8HB 1C1AA 1VQOT 3CMAT 1EIFA 4KH0B 3BY7A 4E7JA 4PJOA 2EYWA 2D6FA 2YT6A 4KGXB 5GAOr 1NLOC 1DJ7B 3E1SA 1PG5B 4HA8A 4J9DA 5GMKe 1FWZA 4M77E 2MMPA 1M90C 4A4KA 4JJDA 1YJWT 1UE9A 1CKBA 2E5QA 4FYXB 2CGHA 2NWMA 2B8AA 4J7IA 2RHIA 1VQNQ 1YJNA 3META 2GF7A 5GANj 3M53A 1WYXA 4XU0A 1UDLA 3HHTB 3LGFA 3CMAA 1T3LA 2MAMA 4V2SA 1JQQA 1MV0B 3MKDA 4ZGEB 2GNCA 4D8KA 2QQAA 2JXBA 2RQVA 1KC8R 2EQIA 2LCCA 5D6YA 4J7FA 3QG1A 2KEAA 1V76A 1FMVA 1WHJA 2MOXA 5L8RE 2WSEE 1MV3A 4OGCA 3C4SA 3QO3A 1M90U 3NTIA 1SSFA 2EIFA 3G4SQ 2V8JA 1WIEA 2X4XA 4C8QG 1GL5A 3GOXA 2D9TA 1D0ZA 1H3HA 4R56A 4RTZA 3CCEA 4VUBA 4C92G 3DLLA 3OS1A 2FRWA 2E4HA 4IKFA 3I9QA 4M7DG 3CXCP 1GFDA 3EHQA 4N0AA 4C8QC 2D8HA 1UJ0A 2KAFA 2QA4Q 4C92C 1BI2A 3O8VA 2FPDA 2XDPA 1VQ6T 5C0MA 4M7DC 1VQ7T 4PJOE 3NPFA 4JJCA 5GMKl 4UC4A 4D8DA 5CR2A 3MEAA 4IIMA 2HAXA 1YN8A 3CC7A 4C92D 4PJMA 3CMEQ 5EG2A 4LD6A 2K3YA 2E6NA 2FL7A 1GCQC 1GBQA 2VB6A 5LJ5e 3KBGA 3ZL7C 2VC8A 5FU6B 4KGZB 5LJ5d 3H0HA 1TTHB 1VQ6A 1U3OA 3EG0A 2QQBA 4EMKA 3A8OB 2M02A 4JRIA 1N5ZA 2LX9A 1UHFA 4C0GA 3QPHA 1LCKA 2KYMA 2RN8A 4N4IA 5IHKA 3LWHA 2F69A 3GIBA 3VS6A 1UECA 4KULA 3CCMA 2RJDA 1X6GA 2HEQA 2K4YA 2CYZB 1KK7A 1ZUUA 3FLGA 3VKIA 1KD1R 2KR3A 1MGQA 2CUDA 2DIQA 3JCMc 1X2QA 2KRNA 4FT4A 4BI4A 3T9NA 2CS7A 2CP5A 2XI9A 3JCMV 2HSPA 3WXMB 3M4GA 4RTWA 2BUDA 3V8LA 4KBMB 1G5VA 1XTDA 3CXCA 1M8MA 2ABLA 4BY6C 2QQSA 4KUDK 4HVUA 1TH7A 5KYXB 4PJLA 1SPKA 1CKAA 2DL8A 2V8KA 2HQHA 4KT0E 3CC4Q 3G71Q 1VQLQ 2E64A 4X9DA 1FX7A 4XTVA 4AFZC 2JW4A 2CH4W 5LJ3g 3CCQA 1D0YA 4M78E 1JBMA 2LCSA 3I5RA 4M7AG 1XJWB 2HBPA 4PKCC 1OI1A 3OYKA 2YUOA 4X34A 1TG0A 1RAEB 1RACB 5FROA 3FRNA 4OMFB 1EZZB 2JTMA 4M7AC 2O31A 5CAIA 3H0FA 1UJYA 4C92A 3ZBDA 2DZCA 5GANe 5CCAA 4M7DA 2RQWA 2HQEA 2X51A 2ZCFB 2LNVA 4OMOA 5EC7A 2QQRA 3WVEB 2JMAA 3MP6A 4HCCA 1YCYA 2DL5A 2E41A 3OMGA 3MHXA 2PUKB 1VQMA 1SF9A 1BI0A 1NEBA 5HK3A 3CCST 3OYAA 1B3QA 1ZSZC 3OS2A 1NLPC 1W1FA 2L3QA 2DJQA 3PMIA 4F7UG 2CDTA 4O6JA 5KYYB 3VUZA 3TEEA 1G3WA 2FHDA 2LQWA 1UGPB 2EYZA 4J5YA 1QP3A 2VYTA 5GAN6 1K73R 3HRUA 3PVLA 2K7AA 2EQKA 1LJOA 2JTEA 3M0UA 4CRIA 1MMGA 3TQ7P 3A98A 1BI1A 1SSHA 3RKYA 4QT7A 3V7CA 2NUZA 2IIMA 1Y57A 3VRZA 3JCMe 2KRMA 3QIIA 3CCRA 4JZ3A 2MYSA 4RCCA 3JCMd 1KQSP 3EGXB 5FRNA 3PMTA 3PVQA 3RERA 1JO8A 5HY6A 2JS0A 2GGRA 3QUIA 5FW9A 1WXBA 2I0NA 2KRSA 2J7IA 4QQGA 2SRCA 1VQ9T 4BE1A 4PFZA 2D8JA 4C8QE 1YHQQ 1PC0A 2DYIA 4C92E 5LJ3j 4QW2A 4P5NA 1YJNQ 4M7DE 2JM8A 5KE2A 1YI2A 1X75C 3CD6A 2RD1A 3CMAQ 1VQOQ 3GP8A 5GAMh 5A0LA 2YRCA 1AEYA 1VOMA 3L2UA 3V7SA 1G3SA 3RR6A 4KGVB 3EFSA 3CCUT 2DD4A 1K8AC 2DILA 3LH5A 2FO0A 3C95A 2L0AA 3GBQA 1M1KC 3VS1A 1YJWQ 4AT1B 1VYVA 3QWYA 2QI2A 2E70A 1RAAB 5CK9A 4BE2A 3I35A 1PHTA 1ZA1B 2DXUA 2ZPEB 1M1GA 5FRMA 2A08A 3OYFA 1K8AR 3UA6A 2ZPFB 5GAN7 1ZSZA 4J9IA 1KQSA 2D0NA 3TSZA 1M2OA 4OB3B 1X43A 2EWNA 1AZEA 2VXEA 3JSCA 1QVPA 4AG1C 4JUVA 2ESWA 5IXFA 2AZVA 3JCMP 1X27A 1WGSA 1WDXA 4RTYA 2DTIA 1WQ7A 3I56T 1YJ9A 2EYYA 2ED0A 4L59A 2P4RA 1BIBA 1BYMA 3GPLA 3PT9A 3CC7Q 2G6FX 2ZAEA 2KNBB 1N8RR 3LX7A 2LP5A 2DIGA 2XICA 2QQ9A 2JM9A 2QTXA 1Z9ZA 3Q1JA 3LWIA 1ZUYA 4O5VA 3REAB 3QXEB 2MF2A 2PNIA 3ULRB 4XQ3A 4L5GA 3VS4A 3JB9I 2DVJA 3DKMA 1VQ6Q 1Q7YC 1VQ7Q 1XNIA 2LJ0A 1X2KA 4EDUA 4IURA 4C5EA 1NYGA 3OYMA 4ZNXA 4A4FA 2QYZA 3I55T 1SHFA 2OI3A 1ZA2B 4M7AE 4RTVA 3OYYA 2RJEA 1GCPA 1IXDA 1NJIU 2AKKA 3EH1A 1RI0A 4C0FA 5IXBA 3BFMA 4CC4B 1MHNA 2PVGB 3EHRA 1QP2A 2P84A 2A3LA 2RMOA 3J80E 1VQ5A 2H3JA 3VS7A 1UHCA 2DA9A 3ASKA 2VGNA 2LTOA 3VS0A 3H9NA 3OYIA 1TSFA 1GXIE 2JVVA 1QVGP 1WHGA 1Y96A 2E3IA 3L2WA 1W2BS 1K9MC 4M75E 1KQ2A 2LQNA 2EGEA 2WSFE 1Q7YU 3EG9A 4LXCA 2FB7A 3EGUA 1CSKA 5IN1A 5KH6A 4F7UE 3SHWA 1OZ3A 3SDZA 2JN0A 2GBQA 2YLBA 1QVFS 3QHSA 3SD4A 1SRMA 3OSSC 1BKBA 2HNIA 2J6FA 1QCNA 2DF6A 4DOWA 3CPWS 2RM4A 2EJGA 4M77B 4DOVA 4X1VA 6AT1B 2ZPHB 5AT1B 2K6DA 5LJ3e 3A1PA 1Q86C 3EFOA 1TU0B 2DETA 4A4GA 5C6SA 1Y0MA 1UTIA 1N9SA 2QK0A 5GJWB 1SKUB 2HDAA 4E7SA 3M0TA 1Q82C 1WHLA 1WXTA 4LDVA 2GFAA 1UG1A 4LUDA 3VS2A 1O9SA 2W10A 3SWNB 4N0AC 4BB7A 2AT1B 2YLCA 3EG2A 5LJ5h 4N4GA 5L23A 1IZ6A 1AWWA 1U5SA 4Z02A 3OYCA 2X9HA 3M54A 1BBZA 3G1JA 1Q86U 3HSBA 1GFCA 4OB1B 3QDRB 4E7HA 3ZFJA 2NUPB 4NL2A 2CP3A 2EYXA 4LUEA 4E7KA 1YJNT 4PJJA 2J6OA 2CSIA 1X69A 2A28A 1Q82U 3CCSQ 4BDYA 3OS0A 2BZ8A 5I11A 5GAN4 1TUGB 2H3EB 1J3TA 1WZOA 4EMKC 3FEOA 1KIKA 4M4ZA 3RIRA 2NUTB 4CC2A 1D3BA 4MDXA 1WJRA 2FYKA 1PRLC 2DK3A 3S3OA 2MI6A 4ZGJB 1YITA 2PVDB 5FU6C 4KH1B 2ZPGB 1UGRB 5A0GA 4FW1A 4OMPA 5IH2A 2CZ0B 1WLPB 2X3XD 2KBTA 4QQ6A 1YNZA 1PWTA 2OTLA 2FEIA 4RCBA 2WACA 5D6WA 3OMCA 4HVWA 2EFIA 1W4SA 4FYVB 3NMZC 1M90R 3CCET 2E5KA 2L3PA 1UGSB 4LDWA 4DEYA 3AHUA 1WHHA 2OX7A 2DXCA 1X6OA 1PKSA 4JJBA 1VQ9Q 4J6WA 3J81E 2DYBA 1Q81C 4XTXA 2MIOA 1B7TA 4HXJA 3RBBB 3O5ZA 2AZSA 3CC7T 4WF2A 4J6YA 1WXUA 1ACMB 1M2VB 4DEXA 4ESRA 4F16A 3RKWA 4C5IA 2DEQA 5IHIA 4II1A 2CKKA 2X4JA 3CCJA 3JB9J 1R77A 2ATCB 3CCUQ 2YHTA 1KHCA 3JCMb 4EPCA 2KXCA 2O4XB 3LW5E 1D0XA 2KVQG 3PFSA 1QWFA 4C0ZA 3GNGA 4M78B 4F14A 1R8OB 1G2BA 2LX7A 1Q81U 4D6WA 3OB9A 1O75A 3CCMT 4JZ4A 2RJFA 3JCMh 1IHWA 1M30A 2RI2A 1RI9A 1OQKA 1E6HA 2E1HA 2XKOC 4PLLA 2BTTA 2JNGA 2XK0A 3ME9A 4Z89A 3EAEA 4DBHA 1AWJA 4OF1A 1NE8A 2X35A 1KFZA 2DE0X 4YTLA 1EX4A 3EGDB 1OX8A 2EQUA 2VGMA 2RNAA 2RQUA 1YWOA 3I56Q 3CBPA 1LNXA 5CKBA 2CH4A 2LNHB 2BIVA 1JXMA 1BIAA 1VIFA 2GTOA 3OQ5A 1ZQ1A 1OEBA 3CCQT 3VYHB 1GRIA 4C5HA 4GLMA 3DB3A 3CC2T 1VQKA 2OTJT 4BACA 2X4YA 4AFQC 2L5QA 2A0FB 1PSFA 1ZLMA 1JRIA 4OVAA 2GQVA 4C0DC 4A63B 2CP2A 3DLMA 2EGAA 4JS5A 1NEGA 4LDXA 3S3NA 2JS2A 3AT1B 4ZTJA 4N4HA 3I55Q 2RA2A 3P8HA 1RUWA 1VYUA 1TXQA 2NYSA 3JCMQ 4J9CA 2V26A 4PK4A 1KG1A 2CZ7B 2COYA 3CCVA 4XU3A 2IPOB 5KYXA 3CC2A 1VQMT 2OTJA 5GAMg 2F5TX 3G6EA 4ZGDB 2F2VA 3P8DA 1R0BG 3M0PA 1PCXA 4ZN3A 2RHXA 2RHYA 1ZSGA 2KY9A 3REBB 1AT1B 3D7SB 4C8QB 1OZ2A 2OJ2A 1I1JA 2LZ6B 1G3TA 3X24B 4MMKA 3CCLA 3VUBA 4M7DB 1QW1A 2A37A 5GANd 3NFCA 2QDYB 2LT1A 3EG3A 2EBPA 2FZGB 3M0RA 4JRKA 2YWWA 3M9QA 3HKSA 4RTXA 4J9EA 1TWBA 3QZ9B 1SHGA 1WA7A 3L2VA 3CCRT 3OYDA 3H6ZA 2KROA 3LYIA 2KXDA 4CI0C 2W0ZA 4A54A 1M3BA 1BCMA 2ENMA 2YUNA 5I22A 2JOYA 5CQYA 5GAMf 3C94A 4JRPA 1Y07A 3MP8A 4BI8B 5KYWB 4CC3A 1FMWA 4BE0A 2O9VA 4M77F 4LNPA 2WSCE 2DBMA 2YSQA 5AYFA 5KYYA 4NL3A 5GAN2 1I8FA 1UFFA 3S3MA 1YIJA 2CSQA 2FVUA 4RUGA 1NYFA 2DTOA 3MP1A 4A4EA 1UEBA 3VS5A 3M0QA 1YI2T 2QASA 3CD6T 2R58A 2Y4YA 4BD3A 4XAXB 1AVZC 2KT8A 5I21A 3R6OA 3VJPA 1RAHB 5KCHA 4MZMA 2EQMA 5A2QE 2KDSA 1UGVA 2YRVA 1LVKA 3EGXA 2BE7D 4DA4A 3TCJA 4BY6B 2ZPIB 3H0IA 2EYQA 4Z88A 1VIEA 1B07A 1HYOA 2YDLA 3RDVA 4JLIA 2M0YA 5GAMj 1IREB 1VQPT 1OPLA 3OBYA 1E7OA 1OX9A 5J39A 4OMLA 3DB4A 5GAOm 1AD5A 3V8KA 4J9HA 1M3CA 3PIPA 2CREA 3SB2A 3V7RA 2DJZA 2EJ9A 2EKHA 5A0DA 2RO0A 4B9WA 4J6XA 1GBRA 2ECZA 1VQ8T 4M7AB 4K11A 2K5FA 5FU7B 3RUXA 3FJPA 1VUBA 3GLXA 1YJ9T 2DLPA 1VQPA 2J06A 1SEMA 3L42A 4RKUE 3S6WA 3OYLA 2LVMA 3QYGB 3UT1A 1M1KR 4E7ZA 2DL7A 2A7YA 1FMKA 3CCEQ 3TU4K 1ZSZB 4E2FB 3G4SA 4M75B 3M56A 5CKEA 1VQ8A 2LRQA 1QKWA 2SEMA 1W70A 2P0PA 2K79A 3C12A 4F7UB 2F1LA 4E6RA 1A0NB 3FB9A 2DL3A 3UPUA 1M8VA 1NJIC 5DLOA 1JJ2S 3UF4A 2F2WA 2JTFA 1W2BP 3U23A 4JJNK 4IIOA 2RJCA 2QA4A 2DNUA 1IGUA 2GCXA 2LJ1A 1NBEB 2BKDN 2IVWA 4PNOA 2QTVA 5LJ5g 4M77D 4DBQA 2FRYA 1AWXA 3ER0A 3SFMA 4B6MA 3H41A 2DD5A 2E12A 3CMEA 1QVFP 1NJIR 2E6ZA 3UATA 1VQ5T 2K5IA 5CVIA 1VQ4A 3CPWP 1K0XA 4PFPA 3SWNC 2YRDA 5GAN3 1U1TA 5GMKh 5GMKi 2KQWA 5HKCA 1SG5A 1U8RA 2EKOA 3OYHA 1TUDA 3INZA 5D6XA 3CCMQ 5GAN5 4ANJA 1KSWA 2Y90A 4OP0A 2EW3A 4FT2A 3OYGA 1Q7YR 4M78F 4WCIA 1QKXA 4A53A 4XK8E 1VQKQ 1I5LA 3FIFA 2V8IA 1JXOA 4C5GA 2EJFA 2V1QA 5LJ5f 2RHUA 1MNDA 5CKHA 4HCBA 3MO8A 3RMQA 1BK2A 2JZ2A 4DBFA 1M5Q1 3PIOA 2DBKA 3M58A 3HPWA 4B9XA 3QYHB 1QCOA 1S72T 4CC7A 1K1ZA 3NTHA 2K2VA 4Y92A 2J6KA 3I5SA 1H641 5CO7A 3M4YA 3PGGA 3SEMA 1W2BA 4AFSC 3CCQQ 3CC4A 3G71A 1K9MR 1VQLA 3CC2Q 2OTJQ 1SRLA 3G6EQ 3RMSA 2DAQA 2QGGA 2XDBA 2M16A 1B34B 3CQTA 1UGQB 5KYUB 3QBYA 1MMDA 1QVFA 4WTOB 1PRMC 3THKA 5LJ3d 1I5OB 1QCFA 1S72A 3CPWA 5I2SA 4GBQA 3BE3A 5GAOn 4PFOA 2DMOA 1JB0E 3OS5A 2DRKA 1OYXA 1EFNA 1WHKA 2JJ9A 5LJ5j 3BDUA 1Q86R 2DVEA 2VKNA 1VQMQ 4LN2A 4HT8A 2RI5A 4DQ2A 3OW2S 1PD0A 3QZ5B 4FU6A 3JCMW 1AZGB 3RESA 3JAME 1ZHIA 1IHVA 5HK0A 3CBOA 1Q82R 3ZEHA 5DLQE 4QKUA 2C0OA 4FSXA 2LMJA 3SWNA 2ZZDA 1QVGS 1S1NA 2COWA 1YITT 4C8QF 3CBMA 2CT3A 2GTJA 1PD1A 3JCMg 5GANf 2F2XA 4R55A 3M0SA 1D09B 4M7DF 3RKXA 2FPFA 3CCRQ 3M59A 2OTLT 5I2MA 1LPLA 2NUPA 4PJOB 2NLUA 2AK5A 3X26B 2HBWA 4MZTA 3UA7A 2EPDA 4MDWA 1Y7XA 4KRTA 1OV3A 2RK1A 4M78D 2DX1A 4FCYA 2L2PA 2ROLA 2HKNA 2K57A 5FWBA 2PVOB 1I07A 4MZPA 5FLXE 2QEXT 4RTTA 3MEUA 8AT1B 2DZ9A 3A8LB 2RB6A 2NUTA 1YI2Q 4J83A 2CP6A 1YHQA 3CD6Q 3JCMf 2RQTA 5KYNA 4IUVA 3JCMJ 4HCZA 2MWOA 1KC8C 2K3BA 3CCJT 1H3ZA 3PNWC 1X01A 5M9OA 2XDDA 3EFRA 4ORZA 1VQOA 1WFWA 1N6AA 3C0CA 2XD0A 2QEXA 5GANh 1Q95G 1E6GA 2HSEB 4AMCA 1VQPQ 4LD9K 1YJWA 3PTAA 2P0QA 3URGA 2DTHA 4FSSA 1Q81R 2AIRB 2XMFA 4ELZC 1UB4A 1RL2A 2DO3A 2H8HA 2RQRA 2R5MA 1K76A 1HD3A 5IT9E 1VQ8Q 3MCAB 4E7LA 1KC8U 3HL8A 3E19A 3OYJA 1M2VA 3OBWA 2LT4A 1UUEA 2ZGWA 3QSUA 2BE9B 1RAIB 1AOJA 1YJ9Q 3R6NA 2D1XA 4M7AF 3KUFA 4F17A 2O2OA 1RABB 2MK5A 3A8MB 3A8GB 4PLIA 4OMNA 4IUPA 1WX6A 2O4XA 2Z0WA 1Y71A 1D1CA 4C8QD 4M78A 1VQKT 1X6BA 1ZX6A 4LDYA 2FG0A 2CP0A 2AKLA 4EMKB 1D1AA 4M7DD 2PZ1A 1VQ4Q 2R57A 1G83A 2FZKB 4LE9A 2LQ8A 2O9SA 4M75F 2XG8D 5CQXA 1KD1C 1U06A 2KT1A 4F7UF 2L3SA 2YXYA 1VQ7A 3CCVT 5KE3A 3EGDA 5J3BA 1RAFB 2RH2A 4RTUA 3G7ZA 3G6ET 1T0HA 1VQ5Q 2HZYA 2YUPA 2KYBA 2P4TA 2QDLA 3CXCS 3X20B 1TUCA 5GAN8 1H8KA 5KCOA 3VS3A 3CCLT 3VRYA 2EQJA 3JV3A 5GAOl 4LDUA 2RPNA 1NG2A 1KD1U 1NPPA 1JU5C 2FPEA 4A4HA 3NHNA 3OSVA 2PUOB 3MEVA 5DY9A 2J05A 4XU2A 1XOVA 3L1AA 1BCOA 2DKGA 2JMCA 3MEWA 4HKEA 5IAYA 4C92B 2LCLA 1K0SA 2KK4A 2FZCB 5CKDA 3NTKA 3OY9A 1KHIA 1YWPA 2VXFA 2M1HA 4OGEA 1YCSB 2CUBA 1S72Q 2HQXA 1QMCA 2QAZA 2XU8A 3E9GA 4FYWB 3FC3A 3QDFA 4C8QA 2QGFB 4BUGA 1YIJT 3QKJA 5FU7C 5LL6S 1K4US 4BDZA 4ZTFA 4HVVA 4QVDA 2BZYA 3OYNA 2CZ1B 1IGQA 2M0OA 4M7AD 2AHJB 1K73C 5GMKm 2VASA 4M75G 1WJSA 1WPYA 2D0QB 2GQIA 1GCQA 3OYBA 4E47A 4JDSA 1ABOA 2K2MA 3JRZA 5DM7R 4MMLA 4M75C 5LJ3f 4FYYB 1WNLA 2DM1A 4GLKA 1W6XA 2K9GA 4JS4A 2DXTA 2EAYA 1M27C 5KYWA 2ED1A 2RI3A 4NOYA 3JB9F 4M75D 4Z8AA 1RADB 1HXDA 2KSSA 1ARKA 3L2RA 1VQNT 2COZA 1N9RA 2YUQA 3N5BB 2RK2A 4J9GA 3CCSA 5GJVB 4C0DB 1I81A 2PTKA 1K73U 2M51A 4HCKA 1MNEA 4XU1A 1YITQ 3QWXX 1RAGB 4XTZA 2DL4A 2MPXC 2DEUA 2LQKA 3RNJA 2RF0A 4L6V5 1NZ9A 1JJ2P 1AHJB 1HSQA 4FW2A 2OTLQ 4XTYA 2E65A 4OB2B 1YP5A 2EVRA 2VVKA 4JLGA 4DBRA 1VQNA 1Z9QA 4Y28E 5IHNA 1NM7A 5J26A 1KQ1A 3G4ST 3VYGA 2HL5C 2X3WD 2RHZA 1H92A 2E10A 2VV5A 1C0MA 3IQLA 4FIBA 1TOVA 2QXFA 1BI3A 5LJ3h 3HFOA 4PJOF 2XHCA 2QEXQ 4ATOA 1OU8A 1OULA 2C0IA 4ZN1A 4IUUA 4R0KA 1FYNA 4GY5A 3LH0A 4IUQA 2QA4T 1VQ9A 1F1BB 3UDCA 1T0JA
chains in the Genus database with same CATH topology
4M7AA 1UGQB 2HBPA 4IUTA 3QBYA 1OI1A 4PKCC 3OYKA 1QVFA 4X34A 5FROA 3VV0A 3CC7T 2HD0A 3FRNA 4OMFB 4WF2A 5LJ3d 4J6YA 1S72A 1LOJA 1KQSS 2JTMA 4M7AC 2L89A 3CPWA 5CAIA 5I2SA 4C92A 3RKWA 3ZBDA 3CMET 4M77G 4C5IA 2DEQA 2DZCA 5CIUA 5GANe 5GAOn 4II1A 1JB0E 2CKKA 5CCAA 4M7DA 2X4JA 3BDLA 3OS5A 1VQ4T 3CCJA 2HQEA 2P0KA 1OYXA 3JB9J 2ZCFB 2LNVA 5LJ5j 3BDUA 2L8DA 1FXXA 2DVEA 2QQRA 2YHTA 1KHCA 4M77C 3WVEB 3M55A 4HT8A 3A5ZB 3JCMb 2RI5A 3F70A 4QVZA 4DQ2A 2R5AA 4EPCA 3QZ5B 3MP6A 3OW2S 4HCCA 1I4K1 1XQHA 4FU6A 1YCYA 2O4XB 3OMGA 2E41A 3LW5E 4M75A 3MHXA 3CCUA 2PUKB 1VQMA 2KVQG 3JCMW 3JB9G 3PFSA 1BI0A 3RESA 3JAME 5HK3A 1N8RC 4C0ZA 1ZHIA 3GNGA 3OYAA 3CCST 4M78B 5HK0A 3CBOA 1R8OB 4NS5A 3OS2A 3ZEHA 3CPFA 3PMIA 4F7UG 2VUBA 4F7UA 1Q81U 4D6WA 4O6JA 3OB9A 5DLQE 3GNFB 3VUZA 3TEEA 1G3WA 1O75A 3CCMT 1K8AU 2XIDA 2FHDA 4FSXA 1JJ2A 1UGPB 2RJFA 4J5YA 3E9FA 3JCMh 2L3RA 1M1KU 3SWNA 2RI2A 2I2LA 1QP3A 2E1HA 2VYTA 2ZZDA 1QVGS 5GAN6 1YITT 3HRUA 4Q5WA 4C8QF 2XKOC 4PLLA 3CBMA 5GMKj 2EQKA 1LJOA 4CRIA 2JNGA 4Y91A 3JCMg 5GANf 1NPRA 2XK0A 1BI1A 3ME9A 3RKYA 4R55A 3EAEA 3V7CA 3HRTA 3JB9D 4M7DF 3RKXA 3M59A 4OF1A 1NE8A 3OYEA 3JCMe 2X35A 2OTLT 5I2MA 1M9SA 3P8BB 4YTLA 3QIIA 2M9UA 3CCRA 2EQUA 4ELYC 2VGMA 3BW1A 4PJOB 2K3XA 3HRSA 4RCCA 2NLUA 3JCMd 5FRNA 3JB9H 3PMTA 3CBPA 3X26B 3RERA 2DPPB 1LNXA 5HY6A 4MZTA 5GAOp 5CKBA 4MDWA 1Y7XA 4XTUA 1N8RU 3I56A 2BIVA 3CC4T 2RK1A 1BIAA 3QUIA 4M78D 3G71T 1VQLT 3LLRA 2K5LA 1VIFA 3OA6A 3M5AA 3OQ5A 1ZQ1A 2LDMA 2K57A 3VU3C 3CCQT 3VYHB 4QQDA 4C5HA 4QQGA 4QVCA 2ZPBB 2PVOB 3DB3A 4PJOG 4MZPA 5FLXE 2QEXT 1VQKA 3L2QA 1VQ9T 3CC2T 4BE1A 2OTJT 4BACA 2X4YA 3MEUA 2LC4A 1Y96B 2DZ9A 2L5QA 3A8LB 3H8ZA 1V29B 4C8QE 2OAUA 2RB6A 1PSFA 1PSEA 2G3RA 1JRIA 4C92E 5LJ3j 4PJOC 4OVAA 2GQVA 4C0DC 4J83A 4QW2A 4EMHA 3KXTA 4P5NA 1YHQA 3JCMf 4M7DE 4KUIA 3DLMA 4LDXA 4JS5A 5KE2A 4IUVA 3S3NA 5CKFA 1ZBXA 3JCMJ 4ZTJA 1YI2A 4HCZA 2MWOA 4N4HA 1X75C 2RA2A 3P8HA 3CD6A 2RD1A 1KC8C 3J7AF 3CCJT 1H3ZA 3JCMQ 3PNWC 1X01A 3GP8A 5M9OA 3I55A 2XDDA 5GAMh 4PJOD 1KG1A 2CZ7B 3EFRA 3CCVA 4XU3A 5A0LA 4M7DC 4ME7A 4RMOA 1VQOA 3JCMX 1N6AA 3L2UA 3V7SA 1G3SA 3QJ6A 2XD0A 3CC2A 2QEXA 3EFSA 3CCUT 2DD4A 1VQMT 4RG8A 5GAMg 4TVRA 5GANh 1K8AC 2OTJA 3C95A 2F5TX 3G6EA 4ZGDB 2GFUA 1M1KC 3P8DA 4ZN3A 2RHXA 2RHYA 2F5KA 5GANg 2KY9A 5GAMe 4C8QB 1OZ2A 2MWPA 3HFNA 2QI2A 2E70A 4FL6A 2X4WA 4LD9K 1G3TA 1YJWA 3X24B 5CK9A 4BE2A 3PTAA 2P0QA 4MMKA 3X28B 2DXUA 1M1FA 4M77A 5GAMd 2ZPEB 4FM4B 2DTHA 2O01E 3CEYA 1M1GA 4OB0B 3URGA 3CCLA 3VUBA 5FRMA 1B34A 3V8JA 4J8OA 4M7DB 3OYFA 4ELZC 1UB4A 1QW1A 1RL2A 2DO3A 2IG0A 3GF5A 3WVDB 5GANd 3NFCA 2QDYB 2R5MA 2ZPFB 4JRQA 5IT9E 5GAN7 2LT1A 3MCAB 4E7LA 4BI3A 4EMGA 1KQSA 1KC8U 4JRKA 3M9QA 3HKSA 3QZ9B 3HL8A 1P92A 2CZ6B 3E19A 4OB3B 3OYJA 2EWNA 3OBWA 2VXEA 3JSCA 3L2VA 1K9MU 2LT4A 3CCRT 2ZGWA 1QVPA 3OYDA 4JUVA 3QSUA 3H6ZA 2C06A 3LYIA 4CI0C 4PL6A 3JCMP 3X25B 4A54A 1WGSA 3UWNA 1WJQA 2KMTA 4M7AF 3KUFA 2DTIA 3OW2A 2PU9B 1WQ7A 3A8MB 2JOYA 3HP9A 3I56T 1YJ9A 4L59A 5CQYA 3L2ZA 3A8GB 2PQWA 3C94A 4IUPA 4PLIA 5GAMf 4JRPA 1Y07A 1BIBA 2O4XA 4RG2A 3MP8A 4BI8B 1BYMA 3GPLA 1U1SA 3PT9A 1Y71A 2DXBA 3M57A 4M78G 4C8QD 5GAOq 1HK9A 3LX7A 4M78A 4C92F 4BE0A 1VQKT 1M4ZA 4M77F 4LDYA 2DIGA 2WSCE 2XICA 5AYFA 4EMKB 2QQ9A 4XTWA 2QTXA 4X9CA 4M7DD 4E7IA 4NL3A 3Q1JA 2R57A 4M78C 3LWIA 5GAN2 1QVGA 1I8FA 1WQWA 4O5VA 3S3MA 3LGLA 1YIJA 1YHQT 2Y4XA 2LQ8A 2MF2A 2FVUA 3MP1A 2DTOA 3QXEB 4A4EA 1UEBA 4XQ3A 4L5GA 3JB9I 4M75F 1G3YA 2JUFA 3DKMA 2XG8D 1YI2T 3QJYA 1YBYA 5CQXA 1Q7YC 2R58A 3CD6T 1XNIA 3FDRA 4EDUA 1KD1C 4IURA 4C5EA 1D3BB 4HT9A 2Y4YA 3OYMA 4A4FA 4XAXB 1N27A 4BD3A 3TREA 4F7UF 3I55T 1VQ7A 5I21A 3R6OA 3VJPA 3CCVT 5KE3A 5KCHA 3A8HB 3CMAT 1VQOT 4MZMA 2EQMA 4M7AE 1EIFA 5J3BA 2KDSA 5A2QE 3BY7A 2YRVA 2RH2A 3OYYA 4E7JA 2RJEA 4PJOA 4XTXA 4DA4A 1NJIU 3TCJA 4BY6B 2D6FA 2ZPIB 5GAOr 1RI0A 2EYQA 1DJ7B 4C0FA 3G7ZA 3BFMA 3G6ET 1VIEA 3E1SA 4HA8A 1MHNA 2P4TA 2PVGB 5GMKe 1QP2A 1FWZA 2A3LA 4M77E 2MMPA 3CXCS 3J80E 1VQ5A 3X20B 4A4KA 1M90C 4JLIA 2H3JA 5GAN8 1YJWT 2E5QA 3ASKA 2VGNA 2LTOA 5GAMj 2CGHA 2B8AA 4J7IA 1IREB 3OYIA 5KCOA 1VQPT 2RHIA 2JVVA 3CCLT 1GXIE 3OBYA 1YJNA 3META 5J39A 2GF7A 1Y96A 3L2WA 2EQJA 3DB4A 5GAOm 1W2BS 5GANj 1K9MC 3V8KA 5GAOl 3PIPA 3M53A 4XU0A 4M75E 3HHTB 3LGFA 3SB2A 3V7RA 4LDUA 2DJZA 1KQ2A 2EJ9A 2WSFE 5A0DA 3CMAA 1Q7YU 2MAMA 4V2SA 2RO0A 4B9WA 2FB7A 4J6XA 1KD1U 1NPPA 5IN1A 4ZGEB 5KH6A 1VQ8T 2QQAA 4F7UE 4A4HA 4M7AB 3OSVA 2PUOB 2K5FA 1OZ3A 3MEVA 3SDZA 2JN0A 5DY9A 2YLBA 5FU7B 1QVFS 2LCCA 3QHSA 4J7FA 5D6YA 3SD4A 3RUXA 4XU2A 1XOVA 3OSSC 1BKBA 2HNIA 3L1AA 2DKGA 3FJPA 1VUBA 3GLXA 3MEWA 4HKEA 3QG1A 4DOWA 1YJ9T 5IAYA 2RM4A 3CPWS 4C92B 2LCLA 2EJGA 2KK4A 4M77B 1VQPA 4DOVA 5CKDA 5L8RE 3NTKA 2WSEE 3OY9A 3L42A 1KHIA 4OGCA 4RKUE 2ZPHB 2VXFA 2M1HA 3S6WA 3OYLA 3C4SA 3QO3A 4OGEA 3NTIA 5LJ3e 1M90U 2LVMA 1SSFA 2EIFA 1Q86C 2HQXA 3QYGB 3UT1A 2V8JA 2A7YA 2X4XA 3TU4K 2XU8A 3E9GA 3FC3A 4C8QG 4C8QA 3GOXA 2D9TA 4A4GA 3G4SA 5C6SA 4M75B 3M56A 5CKEA 4R56A 1VQ8A 3CCEA 1N9SA 2LRQA 4VUBA 4C92G 3DLLA 3OS1A 4BUGA 1YIJT 3QKJA 5FU7C 4IKFA 1Q82C 2P0PA 5LL6S 4M7DG 4N0AA 4C8QC 4LDVA 3C12A 4BDZA 4ZTFA 4F7UB 2GFAA 4QVDA 3FB9A 2KAFA 1O9SA 4C92C 1BI2A 3OYNA 2CZ1B 3O8VA 2XDPA 2M0OA 3UPUA 4M7AD 1M8VA 1NJIC 1VQ6T 5C0MA 5DLOA 3SWNB 2AHJB 4N0AC 4BB7A 2JTFA 1JJ2S 2YLCA 1VQ7T 1K73C 5GMKm 4PJOE 4M75G 4JJNK 2QA4A 2RJCA 1WJSA 1WPYA 5GMKl 4UC4A 2D0QB 5LJ5h 4N4GA 1IZ6A 2GCXA 5CR2A 3OYBA 3MEAA 2BKDN 4E47A 4JDSA 2IVWA 4PNOA 2HAXA 3CC7A 3JRZA 4C92D 5EG2A 5DM7R 4MMLA 4M75C 4Z02A 4M77D 5LJ3f 5LJ5g 3OYCA 4LD6A 1WNLA 2K3YA 2E6NA 3M54A 3ER0A 2FL7A 4GLKA 3SFMA 4JS4A 2DD5A 2DXTA 2E12A 1Q86U 3CMEA 4OB1B 3HSBA 3QDRB 2E6ZA 2EAYA 5LJ5e 4E7HA 1VQ5T 2K5IA 3ZFJA 3KBGA 4NL2A 5CVIA 1VQ4A 2RI3A 2VC8A 5FU6B 4NOYA 3JB9F 4M75D 5LJ5d 4E7KA 1YJNT 1HXDA 3SWNC 2KSSA 1Q82U 1VQ6A 2QQBA 4EMKA 5GAN3 3L2RA 1U1TA 5GMKh 5GMKi 2KQWA 3A8OB 4BDYA 1VQNT 1N9RA 3OS0A 5HKCA 1U8RA 4JRIA 3N5BB 2EKOA 2RK2A 3OYHA 2LX9A 3INZA 5D6XA 4C0GA 5GAN4 3CCSA 3QPHA 5GAN5 4C0DB 4N4IA 4EMKC 1I81A 2Y90A 4OP0A 1K73U 3LWHA 3FEOA 2F69A 3GIBA 4FT2A 3OYGA 3RIRA 4KULA 4XU1A 3CCMA 2RJDA 4M78F 2K4YA 2CYZB 4XTZA 3VKIA 1D3BA 3FLGA 4MDXA 4A53A 4XK8E 1WJRA 2FYKA 2DK3A 3S3OA 2LQKA 1I5LA 2MI6A 4ZGJB 1YITA 2PVDB 1MGQA 5FU6C 2ZPGB 2DIQA 3FIFA 3JCMc 1UGRB 5A0GA 4L6V5 2V8IA 4FT4A 4C5GA 1NZ9A 2EJFA 2CZ0B 1AHJB 3T9NA 2RHUA 5CKHA 4XTYA 4BI4A 5LJ5f 2CS7A 4HCBA 2E65A 2XI9A 3MO8A 4OB2B 3RMQA 3JCMV 2JZ2A 4JLGA 4QQ6A 3WXMB 3M4GA 1M5Q1 1VQNA 2BUDA 3V8LA 2OTLA 3PIOA 4KBMB 2WACA 4RCBA 5D6WA 4Y28E 3OMCA 1XTDA 3M58A 3CXCA 3HPWA 1G5VA 4BY6C 2EFIA 5J26A 2QQSA 1W4SA 3QYHB 4B9XA 1KQ1A 1TH7A 3VYGA 3G4ST 1S72T 4KUDK 3NTHA 2K2VA 3CCET 2V8KA 2RHZA 1H641 2E10A 1UGSB 2VV5A 4KT0E 4LDWA 3M4YA 3PGGA 5CO7A 3AHUA 4FIBA 2E64A 2QXFA 1BI3A 5LJ3h 3HFOA 4X9DA 2DXCA 1FX7A 4PJOF 4XTVA 1W2BA 1X6OA 3CC4A 3G71A 1VQLA 2XHCA 4ATOA 4J6WA 3J81E 4ZN1A 5LJ3g 4IUUA 3CCQA 4GY5A 3LH0A 4M78E 3RMSA 1JBMA 2DAQA 1Q81C 4IUQA 2QA4T 2XDBA 1VQ9A 2M16A 1B34B 3UDCA 4M7AG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A D;  1M8V A;  4C92 E;  5LJ3 j;  4M7A A;  4PJO C;  3SWN B;  4N0A C;  4EMH A;  4M7D C;  2YLC A;  5GMK m;  4PJO E;  4M75 G;  3JCM f;  4M7D E;  1WPY A;  5GMK l;  5LJ5 h;  1D3B B;  4HT9 A;  3JCM J;  4WF2 A;  5LJ5 g;  5LJ3 d;  4F7U F;  2RA2 A;  4J6Y A;  1LOJ A;  2RD1 A;  5I21 A;  4M7A C;  5CAI A;  4M7A G;  4PNO A;  4C92 D;  3JCM Q;  4C92 A;  3RKW A;  1X01 A;  4M7A E;  4MML A;  4M77 G;  3BY7 A;  2DEQ A;  2DZC A;  4M77 D;  4M75 C;  5LJ3 f;  5GAN e;  1WNL A;  5GAO n;  4PJO D;  4PJO A;  5GAM h;  3EFR A;  4XTX A;  4XU3 A;  4M7D A;  5GAO r;  2DXT A;  3JCM X;  3JB9 J;  3HSB A;  3BFM A;  3V7S A;  5LJ5 j;  2EAY A;  3BDU A;  4HA8 A;  5LJ5 e;  3EFS A;  2YHT A;  2DVE A;  4NL2 A;  5GAM g;  5GAN h;  4M77 C;  4HT8 A;  5GMK e;  3JCM b;  4DQ2 A;  2VC8 A;  4M77 E;  1I4K 1;  4NOY A;  3JB9 F;  1YCY A;  4M75 D;  5LJ5 d;  2E41 A;  4JLI A;  4M75 A;  1HXD A;  3SWN C;  5GAN 8;  3JB9 G;  5GAM j;  5GAN g;  3JCM W;  5GAM e;  3RES A;  2CGH A;  4EMK A;  5GAN 3;  1U1T A;  4M78 B;  3HFN A;  4C8Q B;  5GMK h;  5GMK i;  1N9R A;  4JRI A;  4F7U G;  4F7U A;  1Y96 A;  5GAO m;  5GAM d;  4MMK A;  3INZ A;  2DXU A;  4M77 A;  3V8K A;  5GAN 4;  4M75 F;  5GAO l;  2DTH A;  5GAN j;  4XU0 A;  4M75 E;  5GAN 5;  3SB2 A;  1B34 A;  3V8J A;  3V7R A;  4EMK C;  2DJZ A;  1I81 A;  2Y90 A;  4OP0 A;  1KQ2 A;  2EJ9 A;  4M7D B;  4J5Y A;  3JCM h;  3SWN A;  4V2S A;  2I2L A;  2FB7 A;  3GIB A;  4J6X A;  2E1H A;  3RIR A;  5GAN d;  4XU1 A;  5GAN 6;  4C8Q F;  4M78 F;  4XTZ A;  5GMK j;  5GAN 7;  1D3B A;  1LJO A;  4F7U E;  4A53 A;  4EMG A;  4M7A B;  4Y91 A;  2FYK A;  4JRK A;  3JCM g;  5GAN f;  1I5L A;  3RKY A;  1MGQ A;  2JN0 A;  2EWN A;  5DY9 A;  2VXE A;  2YLB A;  3V7C A;  3JB9 D;  3FIF A;  3QHS A;  3RKX A;  3JCM c;  4M7D F;  3RUX A;  2ZGW A;  4XU2 A;  3QSU A;  4JUV A;  2EJF A;  5LJ5 f;  2HNI A;  3JCM e;  3L1A A;  2DKG A;  4XTY A;  3JCM P;  3FJP A;  2E65 A;  5GAO q;  3JCM V;  4A54 A;  2RM4 A;  4C92 B;  3M4G A;  1M5Q 1;  2EJG A;  4M77 B;  3BW1 A;  4M7A F;  3V8L A;  2DTI A;  4PJO B;  3JB9 H;  4RCC A;  4RCB A;  3JCM d;  1WQ7 A;  2VXF A;  5GAM f;  3L2Z A;  3QO3 A;  5LJ3 e;  3RER A;  1LNX A;  1KQ1 A;  1BIB A;  1TH7 A;  5GAO p;  1U1S A;  4XTU A;  1H64 1;  2E10 A;  4C8Q G;  3PGG A;  4M78 G;  4M78 D;  1BIA A;  1HK9 A;  3QUI A;  4M78 A;  4C8Q A;  2E64 A;  4C8Q D;  4C92 F;  3AHU A;  4M77 F;  5LJ3 h;  4M75 B;  3HFO A;  4X9D A;  3VU3 C;  4PJO F;  4XTV A;  2K57 A;  1N9S A;  4C92 G;  4QVC A;  4EMK B;  4XTW A;  4PJO G;  4M7D G;  2QTX A;  4X9C A;  4M7D D;  4J6W A;  4N0A A;  4NL3 A;  4C8Q C;  4M78 C;  5LJ3 g;  5GAN 2;  1I8F A;  1WQW A;  1Y96 B;  4F7U B;  2DZ9 A;  4QVD A;  3FB9 A;  4M78 E;  4C8Q E;  1JBM A;  2DTO A;  2RB6 A;  4C92 C;  4XQ3 A;  1B34 B;  3JB9 I;  1JRI A; 
#chains in the Genus database with same CATH topology
 4AG2 C;  4M7A A;  4IUT A;  3VV0 A;  2HD0 A;  1LOJ A;  1KQS S;  2L89 A;  2HKQ B;  3CCJ Q;  3CME T;  1MMN A;  2BZX A;  4M77 G;  5CIU A;  3BDL A;  1VQ4 T;  3NGP A;  2P0K A;  4J9F A;  2KE9 A;  3E2U A;  2A36 A;  2L8D A;  1FXX A;  4M77 C;  3M55 A;  3A5Z B;  3F70 A;  2QG9 B;  4QVZ A;  2R5A A;  1WHM A;  2O88 A;  1I4K 1;  1XQH A;  4F04 B;  4M75 A;  3CCU A;  1QLY A;  3JB9 G;  1N8R C;  2HCK A;  1QQJ A;  4NS5 A;  3CPF A;  2VUB A;  4F7U A;  3GNF B;  1K8A U;  1BB9 A;  2XID A;  1JJ2 A;  5D7U A;  3E9F A;  2L3R A;  1M1K U;  2I2L A;  1VA7 A;  4Q5W A;  1V1C A;  4OMQ A;  5GMK j;  4Y91 A;  2MCN A;  1NPR A;  2OAW A;  1TS9 A;  1I0C A;  3HRT A;  3JB9 D;  5FWC A;  1BU1 A;  1IO6 A;  1C6V X;  3OYE A;  1M9S A;  3P8B B;  3HTR A;  2M9U A;  4ELY C;  3BW1 A;  3EG1 A;  2K3X A;  3HRS A;  3JB9 H;  3TVT A;  1OOT A;  2C0T A;  2DPP B;  1RLQ C;  1YFN A;  4JPB W;  5GAO p;  1G8X A;  1MMA A;  1N8R U;  4XTU A;  3I56 A;  2VWF A;  1D1B A;  3G71 T;  3CC4 T;  3MPU B;  1VQL T;  1HJD A;  3LLR A;  1RLP C;  2K5L A;  3OA6 A;  2EGC A;  3M5A A;  3VU3 C;  2LDM A;  4QQD A;  1ZBJ A;  4QVC A;  2ZPB B;  3OW2 P;  4PJN A;  9ATC B;  4PJO G;  4AFU C;  3L2Q A;  3MJX A;  2LC4 A;  1Y96 B;  2DRM A;  3H8Z A;  1IB8 A;  1V29 B;  2OAU A;  1AWO A;  2KI7 A;  1PSE A;  2G3R A;  4PJO C;  3EG9 B;  4EMH A;  3KXT A;  4KUI A;  1ABQ A;  1IRX A;  5CKF A;  1ZBX A;  3CCV Q;  3J7A F;  1VYT A;  3I55 A;  4PJO D;  4ME7 A;  4RMO A;  1OU9 A;  3JCM X;  3QJ6 A;  4RG8 A;  4TVR A;  1PNJ A;  2GFU A;  2JT4 A;  2V1R A;  5ECA A;  3EFO B;  2LJ3 A;  2F5K A;  5GAN g;  5GAM e;  2HMA A;  2MWP A;  3HFN A;  4FL6 A;  3CCL Q;  2X4W A;  1PKT A;  1OPK A;  1T3S A;  1WI7 A;  5GAM d;  3X28 B;  4M77 A;  1M1F A;  4FM4 B;  3CEY A;  2O01 E;  4OB0 B;  1B34 A;  3V8J A;  4J8O A;  1KJW A;  5KYU A;  2IG0 A;  3GF5 A;  3WVD B;  4JRQ A;  4BI3 A;  4EMG A;  2KGT A;  1P92 A;  2CZ6 B;  2DFU A;  1M3A A;  1K9M U;  1JEG A;  7AT1 B;  2C06 A;  4PL6 A;  3X25 B;  1R0C B;  2B86 A;  3KFV A;  3UWN A;  1WJQ A;  3PE0 A;  2KMT A;  3EH2 A;  3OW2 A;  4OMM A;  2PU9 B;  3HP9 A;  3L2Z A;  2PQW A;  8ATC B;  4RG2 A;  1U1S A;  3TSW A;  2DXB A;  3M57 A;  4EIK A;  4M78 G;  5GAO q;  4J9B A;  1HK9 A;  4C92 F;  1M4Z A;  2CT4 A;  2DER A;  1QWE A;  2CP7 A;  1YIJ Q;  1K9A A;  4XTW A;  4X9C A;  4E7I A;  4M78 C;  1MUZ A;  1QVG A;  1WQW A;  5HCK A;  2E3H A;  3LGL A;  1YHQ T;  2Y4X A;  1PM3 A;  1G3Y A;  2JUF A;  3QJY A;  1ZUK A;  1YBY A;  3FDR A;  1D3B B;  4HT9 A;  1N27 A;  3TRE A;  2HL3 A;  3FJ5 A;  2ROT A;  3A8H B;  1C1A A;  1VQO T;  3CMA T;  1EIF A;  4KH0 B;  3BY7 A;  4E7J A;  4PJO A;  2EYW A;  2D6F A;  2YT6 A;  4KGX B;  5GAO r;  1NLO C;  1DJ7 B;  3E1S A;  1PG5 B;  4HA8 A;  4J9D A;  5GMK e;  1FWZ A;  4M77 E;  2MMP A;  1M90 C;  4A4K A;  4JJD A;  1YJW T;  1UE9 A;  1CKB A;  2E5Q A;  4FYX B;  2CGH A;  2NWM A;  2B8A A;  4J7I A;  2RHI A;  1VQN Q;  1YJN A;  3MET A;  2GF7 A;  5GAN j;  3M53 A;  1WYX A;  4XU0 A;  1UDL A;  3HHT B;  3LGF A;  3CMA A;  1T3L A;  2MAM A;  4V2S A;  1JQQ A;  1MV0 B;  3MKD A;  4ZGE B;  2GNC A;  4D8K A;  2QQA A;  2JXB A;  2RQV A;  1KC8 R;  2EQI A;  2LCC A;  5D6Y A;  4J7F A;  3QG1 A;  2KEA A;  1V76 A;  1FMV A;  1WHJ A;  2MOX A;  5L8R E;  2WSE E;  1MV3 A;  4OGC A;  3C4S A;  3QO3 A;  1M90 U;  3NTI A;  1SSF A;  2EIF A;  3G4S Q;  2V8J A;  1WIE A;  2X4X A;  4C8Q G;  1GL5 A;  3GOX A;  2D9T A;  1D0Z A;  1H3H A;  4R56 A;  4RTZ A;  3CCE A;  4VUB A;  4C92 G;  3DLL A;  3OS1 A;  2FRW A;  2E4H A;  4IKF A;  3I9Q A;  4M7D G;  3CXC P;  1GFD A;  3EHQ A;  4N0A A;  4C8Q C;  2D8H A;  1UJ0 A;  2KAF A;  2QA4 Q;  4C92 C;  1BI2 A;  3O8V A;  2FPD A;  2XDP A;  1VQ6 T;  5C0M A;  4M7D C;  1VQ7 T;  4PJO E;  3NPF A;  4JJC A;  5GMK l;  4UC4 A;  4D8D A;  5CR2 A;  3MEA A;  4IIM A;  2HAX A;  1YN8 A;  3CC7 A;  4C92 D;  4PJM A;  3CME Q;  5EG2 A;  4LD6 A;  2K3Y A;  2E6N A;  2FL7 A;  1GCQ C;  1GBQ A;  2VB6 A;  5LJ5 e;  3KBG A;  3ZL7 C;  2VC8 A;  5FU6 B;  4KGZ B;  5LJ5 d;  3H0H A;  1TTH B;  1VQ6 A;  1U3O A;  3EG0 A;  2QQB A;  4EMK A;  3A8O B;  2M02 A;  4JRI A;  1N5Z A;  2LX9 A;  1UHF A;  4C0G A;  3QPH A;  1LCK A;  2KYM A;  2RN8 A;  4N4I A;  5IHK A;  3LWH A;  2F69 A;  3GIB A;  3VS6 A;  1UEC A;  4KUL A;  3CCM A;  2RJD A;  1X6G A;  2HEQ A;  2K4Y A;  2CYZ B;  1KK7 A;  1ZUU A;  3FLG A;  3VKI A;  1KD1 R;  2KR3 A;  1MGQ A;  2CUD A;  2DIQ A;  3JCM c;  1X2Q A;  2KRN A;  4FT4 A;  4BI4 A;  3T9N A;  2CS7 A;  2CP5 A;  2XI9 A;  3JCM V;  2HSP A;  3WXM B;  3M4G A;  4RTW A;  2BUD A;  3V8L A;  4KBM B;  1G5V A;  1XTD A;  3CXC A;  1M8M A;  2ABL A;  4BY6 C;  2QQS A;  4KUD K;  4HVU A;  1TH7 A;  5KYX B;  4PJL A;  1SPK A;  1CKA A;  2DL8 A;  2V8K A;  2HQH A;  4KT0 E;  3CC4 Q;  3G71 Q;  1VQL Q;  2E64 A;  4X9D A;  1FX7 A;  4XTV A;  4AFZ C;  2JW4 A;  2CH4 W;  5LJ3 g;  3CCQ A;  1D0Y A;  4M78 E;  1JBM A;  2LCS A;  3I5R A;  4M7A G;  1XJW B;  2HBP A;  4PKC C;  1OI1 A;  3OYK A;  2YUO A;  4X34 A;  1TG0 A;  1RAE B;  1RAC B;  5FRO A;  3FRN A;  4OMF B;  1EZZ B;  2JTM A;  4M7A C;  2O31 A;  5CAI A;  3H0F A;  1UJY A;  4C92 A;  3ZBD A;  2DZC A;  5GAN e;  5CCA A;  4M7D A;  2RQW A;  2HQE A;  2X51 A;  2ZCF B;  2LNV A;  4OMO A;  5EC7 A;  2QQR A;  3WVE B;  2JMA A;  3MP6 A;  4HCC A;  1YCY A;  2DL5 A;  2E41 A;  3OMG A;  3MHX A;  2PUK B;  1VQM A;  1SF9 A;  1BI0 A;  1NEB A;  5HK3 A;  3CCS T;  3OYA A;  1B3Q A;  1ZSZ C;  3OS2 A;  1NLP C;  1W1F A;  2L3Q A;  2DJQ A;  3PMI A;  4F7U G;  2CDT A;  4O6J A;  5KYY B;  3VUZ A;  3TEE A;  1G3W A;  2FHD A;  2LQW A;  1UGP B;  2EYZ A;  4J5Y A;  1QP3 A;  2VYT A;  5GAN 6;  1K73 R;  3HRU A;  3PVL A;  2K7A A;  2EQK A;  1LJO A;  2JTE A;  3M0U A;  4CRI A;  1MMG A;  3TQ7 P;  3A98 A;  1BI1 A;  1SSH A;  3RKY A;  4QT7 A;  3V7C A;  2NUZ A;  2IIM A;  1Y57 A;  3VRZ A;  3JCM e;  2KRM A;  3QII A;  3CCR A;  4JZ3 A;  2MYS A;  4RCC A;  3JCM d;  1KQS P;  3EGX B;  5FRN A;  3PMT A;  3PVQ A;  3RER A;  1JO8 A;  5HY6 A;  2JS0 A;  2GGR A;  3QUI A;  5FW9 A;  1WXB A;  2I0N A;  2KRS A;  2J7I A;  4QQG A;  2SRC A;  1VQ9 T;  4BE1 A;  4PFZ A;  2D8J A;  4C8Q E;  1YHQ Q;  1PC0 A;  2DYI A;  4C92 E;  5LJ3 j;  4QW2 A;  4P5N A;  1YJN Q;  4M7D E;  2JM8 A;  5KE2 A;  1YI2 A;  1X75 C;  3CD6 A;  2RD1 A;  3CMA Q;  1VQO Q;  3GP8 A;  5GAM h;  5A0L A;  2YRC A;  1AEY A;  1VOM A;  3L2U A;  3V7S A;  1G3S A;  3RR6 A;  4KGV B;  3EFS A;  3CCU T;  2DD4 A;  1K8A C;  2DIL A;  3LH5 A;  2FO0 A;  3C95 A;  2L0A A;  3GBQ A;  1M1K C;  3VS1 A;  1YJW Q;  4AT1 B;  1VYV A;  3QWY A;  2QI2 A;  2E70 A;  1RAA B;  5CK9 A;  4BE2 A;  3I35 A;  1PHT A;  1ZA1 B;  2DXU A;  2ZPE B;  1M1G A;  5FRM A;  2A08 A;  3OYF A;  1K8A R;  3UA6 A;  2ZPF B;  5GAN 7;  1ZSZ A;  4J9I A;  1KQS A;  2D0N A;  3TSZ A;  1M2O A;  4OB3 B;  1X43 A;  2EWN A;  1AZE A;  2VXE A;  3JSC A;  1QVP A;  4AG1 C;  4JUV A;  2ESW A;  5IXF A;  2AZV A;  3JCM P;  1X27 A;  1WGS A;  1WDX A;  4RTY A;  2DTI A;  1WQ7 A;  3I56 T;  1YJ9 A;  2EYY A;  2ED0 A;  4L59 A;  2P4R A;  1BIB A;  1BYM A;  3GPL A;  3PT9 A;  3CC7 Q;  2G6F X;  2ZAE A;  2KNB B;  1N8R R;  3LX7 A;  2LP5 A;  2DIG A;  2XIC A;  2QQ9 A;  2JM9 A;  2QTX A;  1Z9Z A;  3Q1J A;  3LWI A;  1ZUY A;  4O5V A;  3REA B;  3QXE B;  2MF2 A;  2PNI A;  3ULR B;  4XQ3 A;  4L5G A;  3VS4 A;  3JB9 I;  2DVJ A;  3DKM A;  1VQ6 Q;  1Q7Y C;  1VQ7 Q;  1XNI A;  2LJ0 A;  1X2K A;  4EDU A;  4IUR A;  4C5E A;  1NYG A;  3OYM A;  4ZNX A;  4A4F A;  2QYZ A;  3I55 T;  1SHF A;  2OI3 A;  1ZA2 B;  4M7A E;  4RTV A;  3OYY A;  2RJE A;  1GCP A;  1IXD A;  1NJI U;  2AKK A;  3EH1 A;  1RI0 A;  4C0F A;  5IXB A;  3BFM A;  4CC4 B;  1MHN A;  2PVG B;  3EHR A;  1QP2 A;  2P84 A;  2A3L A;  2RMO A;  3J80 E;  1VQ5 A;  2H3J A;  3VS7 A;  1UHC A;  2DA9 A;  3ASK A;  2VGN A;  2LTO A;  3VS0 A;  3H9N A;  3OYI A;  1TSF A;  1GXI E;  2JVV A;  1QVG P;  1WHG A;  1Y96 A;  2E3I A;  3L2W A;  1W2B S;  1K9M C;  4M75 E;  1KQ2 A;  2LQN A;  2EGE A;  2WSF E;  1Q7Y U;  3EG9 A;  4LXC A;  2FB7 A;  3EGU A;  1CSK A;  5IN1 A;  5KH6 A;  4F7U E;  3SHW A;  1OZ3 A;  3SDZ A;  2JN0 A;  2GBQ A;  2YLB A;  1QVF S;  3QHS A;  3SD4 A;  1SRM A;  3OSS C;  1BKB A;  2HNI A;  2J6F A;  1QCN A;  2DF6 A;  4DOW A;  3CPW S;  2RM4 A;  2EJG A;  4M77 B;  4DOV A;  4X1V A;  6AT1 B;  2ZPH B;  5AT1 B;  2K6D A;  5LJ3 e;  3A1P A;  1Q86 C;  3EFO A;  1TU0 B;  2DET A;  4A4G A;  5C6S A;  1Y0M A;  1UTI A;  1N9S A;  2QK0 A;  5GJW B;  1SKU B;  2HDA A;  4E7S A;  3M0T A;  1Q82 C;  1WHL A;  1WXT A;  4LDV A;  2GFA A;  1UG1 A;  4LUD A;  3VS2 A;  1O9S A;  2W10 A;  3SWN B;  4N0A C;  4BB7 A;  2AT1 B;  2YLC A;  3EG2 A;  5LJ5 h;  4N4G A;  5L23 A;  1IZ6 A;  1AWW A;  1U5S A;  4Z02 A;  3OYC A;  2X9H A;  3M54 A;  1BBZ A;  3G1J A;  1Q86 U;  3HSB A;  1GFC A;  4OB1 B;  3QDR B;  4E7H A;  3ZFJ A;  2NUP B;  4NL2 A;  2CP3 A;  2EYX A;  4LUE A;  4E7K A;  1YJN T;  4PJJ A;  2J6O A;  2CSI A;  1X69 A;  2A28 A;  1Q82 U;  3CCS Q;  4BDY A;  3OS0 A;  2BZ8 A;  5I11 A;  5GAN 4;  1TUG B;  2H3E B;  1J3T A;  1WZO A;  4EMK C;  3FEO A;  1KIK A;  4M4Z A;  3RIR A;  2NUT B;  4CC2 A;  1D3B A;  4MDX A;  1WJR A;  2FYK A;  1PRL C;  2DK3 A;  3S3O A;  2MI6 A;  4ZGJ B;  1YIT A;  2PVD B;  5FU6 C;  4KH1 B;  2ZPG B;  1UGR B;  5A0G A;  4FW1 A;  4OMP A;  5IH2 A;  2CZ0 B;  1WLP B;  2X3X D;  2KBT A;  4QQ6 A;  1YNZ A;  1PWT A;  2OTL A;  2FEI A;  4RCB A;  2WAC A;  5D6W A;  3OMC A;  4HVW A;  2EFI A;  1W4S A;  4FYV B;  3NMZ C;  1M90 R;  3CCE T;  2E5K A;  2L3P A;  1UGS B;  4LDW A;  4DEY A;  3AHU A;  1WHH A;  2OX7 A;  2DXC A;  1X6O A;  1PKS A;  4JJB A;  1VQ9 Q;  4J6W A;  3J81 E;  2DYB A;  1Q81 C;  4XTX A;  2MIO A;  1B7T A;  4HXJ A;  3RBB B;  3O5Z A;  2AZS A;  3CC7 T;  4WF2 A;  4J6Y A;  1WXU A;  1ACM B;  1M2V B;  4DEX A;  4ESR A;  4F16 A;  3RKW A;  4C5I A;  2DEQ A;  5IHI A;  4II1 A;  2CKK A;  2X4J A;  3CCJ A;  3JB9 J;  1R77 A;  2ATC B;  3CCU Q;  2YHT A;  1KHC A;  3JCM b;  4EPC A;  2KXC A;  2O4X B;  3LW5 E;  1D0X A;  2KVQ G;  3PFS A;  1QWF A;  4C0Z A;  3GNG A;  4M78 B;  4F14 A;  1R8O B;  1G2B A;  2LX7 A;  1Q81 U;  4D6W A;  3OB9 A;  1O75 A;  3CCM T;  4JZ4 A;  2RJF A;  3JCM h;  1IHW A;  1M30 A;  2RI2 A;  1RI9 A;  1OQK A;  1E6H A;  2E1H A;  2XKO C;  4PLL A;  2BTT A;  2JNG A;  2XK0 A;  3ME9 A;  4Z89 A;  3EAE A;  4DBH A;  1AWJ A;  4OF1 A;  1NE8 A;  2X35 A;  1KFZ A;  2DE0 X;  4YTL A;  1EX4 A;  3EGD B;  1OX8 A;  2EQU A;  2VGM A;  2RNA A;  2RQU A;  1YWO A;  3I56 Q;  3CBP A;  1LNX A;  5CKB A;  2CH4 A;  2LNH B;  2BIV A;  1JXM A;  1BIA A;  1VIF A;  2GTO A;  3OQ5 A;  1ZQ1 A;  1OEB A;  3CCQ T;  3VYH B;  1GRI A;  4C5H A;  4GLM A;  3DB3 A;  3CC2 T;  1VQK A;  2OTJ T;  4BAC A;  2X4Y A;  4AFQ C;  2L5Q A;  2A0F B;  1PSF A;  1ZLM A;  1JRI A;  4OVA A;  2GQV A;  4C0D C;  4A63 B;  2CP2 A;  3DLM A;  2EGA A;  4JS5 A;  1NEG A;  4LDX A;  3S3N A;  2JS2 A;  3AT1 B;  4ZTJ A;  4N4H A;  3I55 Q;  2RA2 A;  3P8H A;  1RUW A;  1VYU A;  1TXQ A;  2NYS A;  3JCM Q;  4J9C A;  2V26 A;  4PK4 A;  1KG1 A;  2CZ7 B;  2COY A;  3CCV A;  4XU3 A;  2IPO B;  5KYX A;  3CC2 A;  1VQM T;  2OTJ A;  5GAM g;  2F5T X;  3G6E A;  4ZGD B;  2F2V A;  3P8D A;  1R0B G;  3M0P A;  1PCX A;  4ZN3 A;  2RHX A;  2RHY A;  1ZSG A;  2KY9 A;  3REB B;  1AT1 B;  3D7S B;  4C8Q B;  1OZ2 A;  2OJ2 A;  1I1J A;  2LZ6 B;  1G3T A;  3X24 B;  4MMK A;  3CCL A;  3VUB A;  4M7D B;  1QW1 A;  2A37 A;  5GAN d;  3NFC A;  2QDY B;  2LT1 A;  3EG3 A;  2EBP A;  2FZG B;  3M0R A;  4JRK A;  2YWW A;  3M9Q A;  3HKS A;  4RTX A;  4J9E A;  1TWB A;  3QZ9 B;  1SHG A;  1WA7 A;  3L2V A;  3CCR T;  3OYD A;  3H6Z A;  2KRO A;  3LYI A;  2KXD A;  4CI0 C;  2W0Z A;  4A54 A;  1M3B A;  1BCM A;  2ENM A;  2YUN A;  5I22 A;  2JOY A;  5CQY A;  5GAM f;  3C94 A;  4JRP A;  1Y07 A;  3MP8 A;  4BI8 B;  5KYW B;  4CC3 A;  1FMW A;  4BE0 A;  2O9V A;  4M77 F;  4LNP A;  2WSC E;  2DBM A;  2YSQ A;  5AYF A;  5KYY A;  4NL3 A;  5GAN 2;  1I8F A;  1UFF A;  3S3M A;  1YIJ A;  2CSQ A;  2FVU A;  4RUG A;  1NYF A;  2DTO A;  3MP1 A;  4A4E A;  1UEB A;  3VS5 A;  3M0Q A;  1YI2 T;  2QAS A;  3CD6 T;  2R58 A;  2Y4Y A;  4BD3 A;  4XAX B;  1AVZ C;  2KT8 A;  5I21 A;  3R6O A;  3VJP A;  1RAH B;  5KCH A;  4MZM A;  2EQM A;  5A2Q E;  2KDS A;  1UGV A;  2YRV A;  1LVK A;  3EGX A;  2BE7 D;  4DA4 A;  3TCJ A;  4BY6 B;  2ZPI B;  3H0I A;  2EYQ A;  4Z88 A;  1VIE A;  1B07 A;  1HYO A;  2YDL A;  3RDV A;  4JLI A;  2M0Y A;  5GAM j;  1IRE B;  1VQP T;  1OPL A;  3OBY A;  1E7O A;  1OX9 A;  5J39 A;  4OML A;  3DB4 A;  5GAO m;  1AD5 A;  3V8K A;  4J9H A;  1M3C A;  3PIP A;  2CRE A;  3SB2 A;  3V7R A;  2DJZ A;  2EJ9 A;  2EKH A;  5A0D A;  2RO0 A;  4B9W A;  4J6X A;  1GBR A;  2ECZ A;  1VQ8 T;  4M7A B;  4K11 A;  2K5F A;  5FU7 B;  3RUX A;  3FJP A;  1VUB A;  3GLX A;  1YJ9 T;  2DLP A;  1VQP A;  2J06 A;  1SEM A;  3L42 A;  4RKU E;  3S6W A;  3OYL A;  2LVM A;  3QYG B;  3UT1 A;  1M1K R;  4E7Z A;  2DL7 A;  2A7Y A;  1FMK A;  3CCE Q;  3TU4 K;  1ZSZ B;  4E2F B;  3G4S A;  4M75 B;  3M56 A;  5CKE A;  1VQ8 A;  2LRQ A;  1QKW A;  2SEM A;  1W70 A;  2P0P A;  2K79 A;  3C12 A;  4F7U B;  2F1L A;  4E6R A;  1A0N B;  3FB9 A;  2DL3 A;  3UPU A;  1M8V A;  1NJI C;  5DLO A;  1JJ2 S;  3UF4 A;  2F2W A;  2JTF A;  1W2B P;  3U23 A;  4JJN K;  4IIO A;  2RJC A;  2QA4 A;  2DNU A;  1IGU A;  2GCX A;  2LJ1 A;  1NBE B;  2BKD N;  2IVW A;  4PNO A;  2QTV A;  5LJ5 g;  4M77 D;  4DBQ A;  2FRY A;  1AWX A;  3ER0 A;  3SFM A;  4B6M A;  3H41 A;  2DD5 A;  2E12 A;  3CME A;  1QVF P;  1NJI R;  2E6Z A;  3UAT A;  1VQ5 T;  2K5I A;  5CVI A;  1VQ4 A;  3CPW P;  1K0X A;  4PFP A;  3SWN C;  2YRD A;  5GAN 3;  1U1T A;  5GMK h;  5GMK i;  2KQW A;  5HKC A;  1SG5 A;  1U8R A;  2EKO A;  3OYH A;  1TUD A;  3INZ A;  5D6X A;  3CCM Q;  5GAN 5;  4ANJ A;  1KSW A;  2Y90 A;  4OP0 A;  2EW3 A;  4FT2 A;  3OYG A;  1Q7Y R;  4M78 F;  4WCI A;  1QKX A;  4A53 A;  4XK8 E;  1VQK Q;  1I5L A;  3FIF A;  2V8I A;  1JXO A;  4C5G A;  2EJF A;  2V1Q A;  5LJ5 f;  2RHU A;  1MND A;  5CKH A;  4HCB A;  3MO8 A;  3RMQ A;  1BK2 A;  2JZ2 A;  4DBF A;  1M5Q 1;  3PIO A;  2DBK A;  3M58 A;  3HPW A;  4B9X A;  3QYH B;  1QCO A;  1S72 T;  4CC7 A;  1K1Z A;  3NTH A;  2K2V A;  4Y92 A;  2J6K A;  3I5S A;  1H64 1;  5CO7 A;  3M4Y A;  3PGG A;  3SEM A;  1W2B A;  4AFS C;  3CCQ Q;  3CC4 A;  3G71 A;  1K9M R;  1VQL A;  3CC2 Q;  2OTJ Q;  1SRL A;  3G6E Q;  3RMS A;  2DAQ A;  2QGG A;  2XDB A;  2M16 A;  1B34 B;  3CQT A;  1UGQ B;  5KYU B;  3QBY A;  1MMD A;  1QVF A;  4WTO B;  1PRM C;  3THK A;  5LJ3 d;  1I5O B;  1QCF A;  1S72 A;  3CPW A;  5I2S A;  4GBQ A;  3BE3 A;  5GAO n;  4PFO A;  2DMO A;  1JB0 E;  3OS5 A;  2DRK A;  1OYX A;  1EFN A;  1WHK A;  2JJ9 A;  5LJ5 j;  3BDU A;  1Q86 R;  2DVE A;  2VKN A;  1VQM Q;  4LN2 A;  4HT8 A;  2RI5 A;  4DQ2 A;  3OW2 S;  1PD0 A;  3QZ5 B;  4FU6 A;  3JCM W;  1AZG B;  3RES A;  3JAM E;  1ZHI A;  1IHV A;  5HK0 A;  3CBO A;  1Q82 R;  3ZEH A;  5DLQ E;  4QKU A;  2C0O A;  4FSX A;  2LMJ A;  3SWN A;  2ZZD A;  1QVG S;  1S1N A;  2COW A;  1YIT T;  4C8Q F;  3CBM A;  2CT3 A;  2GTJ A;  1PD1 A;  3JCM g;  5GAN f;  2F2X A;  4R55 A;  3M0S A;  1D09 B;  4M7D F;  3RKX A;  2FPF A;  3CCR Q;  3M59 A;  2OTL T;  5I2M A;  1LPL A;  2NUP A;  4PJO B;  2NLU A;  2AK5 A;  3X26 B;  2HBW A;  4MZT A;  3UA7 A;  2EPD A;  4MDW A;  1Y7X A;  4KRT A;  1OV3 A;  2RK1 A;  4M78 D;  2DX1 A;  4FCY A;  2L2P A;  2ROL A;  2HKN A;  2K57 A;  5FWB A;  2PVO B;  1I07 A;  4MZP A;  5FLX E;  2QEX T;  4RTT A;  3MEU A;  8AT1 B;  2DZ9 A;  3A8L B;  2RB6 A;  2NUT A;  1YI2 Q;  4J83 A;  2CP6 A;  1YHQ A;  3CD6 Q;  3JCM f;  2RQT A;  5KYN A;  4IUV A;  3JCM J;  4HCZ A;  2MWO A;  1KC8 C;  2K3B A;  3CCJ T;  1H3Z A;  3PNW C;  1X01 A;  5M9O A;  2XDD A;  3EFR A;  4ORZ A;  1VQO A;  1WFW A;  1N6A A;  3C0C A;  2XD0 A;  2QEX A;  5GAN h;  1Q95 G;  1E6G A;  2HSE B;  4AMC A;  1VQP Q;  4LD9 K;  1YJW A;  3PTA A;  2P0Q A;  3URG A;  2DTH A;  4FSS A;  1Q81 R;  2AIR B;  2XMF A;  4ELZ C;  1UB4 A;  1RL2 A;  2DO3 A;  2H8H A;  2RQR A;  2R5M A;  1K76 A;  1HD3 A;  5IT9 E;  1VQ8 Q;  3MCA B;  4E7L A;  1KC8 U;  3HL8 A;  3E19 A;  3OYJ A;  1M2V A;  3OBW A;  2LT4 A;  1UUE A;  2ZGW A;  3QSU A;  2BE9 B;  1RAI B;  1AOJ A;  1YJ9 Q;  3R6N A;  2D1X A;  4M7A F;  3KUF A;  4F17 A;  2O2O A;  1RAB B;  2MK5 A;  3A8M B;  3A8G B;  4PLI A;  4OMN A;  4IUP A;  1WX6 A;  2O4X A;  2Z0W A;  1Y71 A;  1D1C A;  4C8Q D;  4M78 A;  1VQK T;  1X6B A;  1ZX6 A;  4LDY A;  2FG0 A;  2CP0 A;  2AKL A;  4EMK B;  1D1A A;  4M7D D;  2PZ1 A;  1VQ4 Q;  2R57 A;  1G83 A;  2FZK B;  4LE9 A;  2LQ8 A;  2O9S A;  4M75 F;  2XG8 D;  5CQX A;  1KD1 C;  1U06 A;  2KT1 A;  4F7U F;  2L3S A;  2YXY A;  1VQ7 A;  3CCV T;  5KE3 A;  3EGD A;  5J3B A;  1RAF B;  2RH2 A;  4RTU A;  3G7Z A;  3G6E T;  1T0H A;  1VQ5 Q;  2HZY A;  2YUP A;  2KYB A;  2P4T A;  2QDL A;  3CXC S;  3X20 B;  1TUC A;  5GAN 8;  1H8K A;  5KCO A;  3VS3 A;  3CCL T;  3VRY A;  2EQJ A;  3JV3 A;  5GAO l;  4LDU A;  2RPN A;  1NG2 A;  1KD1 U;  1NPP A;  1JU5 C;  2FPE A;  4A4H A;  3NHN A;  3OSV A;  2PUO B;  3MEV A;  5DY9 A;  2J05 A;  4XU2 A;  1XOV A;  3L1A A;  1BCO A;  2DKG A;  2JMC A;  3MEW A;  4HKE A;  5IAY A;  4C92 B;  2LCL A;  1K0S A;  2KK4 A;  2FZC B;  5CKD A;  3NTK A;  3OY9 A;  1KHI A;  1YWP A;  2VXF A;  2M1H A;  4OGE A;  1YCS B;  2CUB A;  1S72 Q;  2HQX A;  1QMC A;  2QAZ A;  2XU8 A;  3E9G A;  4FYW B;  3FC3 A;  3QDF A;  4C8Q A;  2QGF B;  4BUG A;  1YIJ T;  3QKJ A;  5FU7 C;  5LL6 S;  1K4U S;  4BDZ A;  4ZTF A;  4HVV A;  4QVD A;  2BZY A;  3OYN A;  2CZ1 B;  1IGQ A;  2M0O A;  4M7A D;  2AHJ B;  1K73 C;  5GMK m;  2VAS A;  4M75 G;  1WJS A;  1WPY A;  2D0Q B;  2GQI A;  1GCQ A;  3OYB A;  4E47 A;  4JDS A;  1ABO A;  2K2M A;  3JRZ A;  5DM7 R;  4MML A;  4M75 C;  5LJ3 f;  4FYY B;  1WNL A;  2DM1 A;  4GLK A;  1W6X A;  2K9G A;  4JS4 A;  2DXT A;  2EAY A;  1M27 C;  5KYW A;  2ED1 A;  2RI3 A;  4NOY A;  3JB9 F;  4M75 D;  4Z8A A;  1RAD B;  1HXD A;  2KSS A;  1ARK A;  3L2R A;  1VQN T;  2COZ A;  1N9R A;  2YUQ A;  3N5B B;  2RK2 A;  4J9G A;  3CCS A;  5GJV B;  4C0D B;  1I81 A;  2PTK A;  1K73 U;  2M51 A;  4HCK A;  1MNE A;  4XU1 A;  1YIT Q;  3QWX X;  1RAG B;  4XTZ A;  2DL4 A;  2MPX C;  2DEU A;  2LQK A;  3RNJ A;  2RF0 A;  4L6V 5;  1NZ9 A;  1JJ2 P;  1AHJ B;  1HSQ A;  4FW2 A;  2OTL Q;  4XTY A;  2E65 A;  4OB2 B;  1YP5 A;  2EVR A;  2VVK A;  4JLG A;  4DBR A;  1VQN A;  1Z9Q A;  4Y28 E;  5IHN A;  1NM7 A;  5J26 A;  1KQ1 A;  3G4S T;  3VYG A;  2HL5 C;  2X3W D;  2RHZ A;  1H92 A;  2E10 A;  2VV5 A;  1C0M A;  3IQL A;  4FIB A;  1TOV A;  2QXF A;  1BI3 A;  5LJ3 h;  3HFO A;  4PJO F;  2XHC A;  2QEX Q;  4ATO A;  1OU8 A;  1OUL A;  2C0I A;  4ZN1 A;  4IUU A;  4R0K A;  1FYN A;  4GY5 A;  3LH0 A;  4IUQ A;  2QA4 T;  1VQ9 A;  1F1B B;  3UDC A;  1T0J A; 
#chains in the Genus database with same CATH homology
 4M7A A;  1UGQ B;  2HBP A;  4IUT A;  3QBY A;  1OI1 A;  4PKC C;  3OYK A;  1QVF A;  4X34 A;  5FRO A;  3VV0 A;  3CC7 T;  2HD0 A;  3FRN A;  4OMF B;  4WF2 A;  5LJ3 d;  4J6Y A;  1S72 A;  1LOJ A;  1KQS S;  2JTM A;  4M7A C;  2L89 A;  3CPW A;  5CAI A;  5I2S A;  4C92 A;  3RKW A;  3ZBD A;  3CME T;  4M77 G;  4C5I A;  2DEQ A;  2DZC A;  5CIU A;  5GAN e;  5GAO n;  4II1 A;  1JB0 E;  2CKK A;  5CCA A;  4M7D A;  2X4J A;  3BDL A;  3OS5 A;  1VQ4 T;  3CCJ A;  2HQE A;  2P0K A;  1OYX A;  3JB9 J;  2ZCF B;  2LNV A;  5LJ5 j;  3BDU A;  2L8D A;  1FXX A;  2DVE A;  2QQR A;  2YHT A;  1KHC A;  4M77 C;  3WVE B;  3M55 A;  4HT8 A;  3A5Z B;  3JCM b;  2RI5 A;  3F70 A;  4QVZ A;  4DQ2 A;  2R5A A;  4EPC A;  3QZ5 B;  3MP6 A;  3OW2 S;  4HCC A;  1I4K 1;  1XQH A;  4FU6 A;  1YCY A;  2O4X B;  3OMG A;  2E41 A;  3LW5 E;  4M75 A;  3MHX A;  3CCU A;  2PUK B;  1VQM A;  2KVQ G;  3JCM W;  3JB9 G;  3PFS A;  1BI0 A;  3RES A;  3JAM E;  5HK3 A;  1N8R C;  4C0Z A;  1ZHI A;  3GNG A;  3OYA A;  3CCS T;  4M78 B;  5HK0 A;  3CBO A;  1R8O B;  4NS5 A;  3OS2 A;  3ZEH A;  3CPF A;  3PMI A;  4F7U G;  2VUB A;  4F7U A;  1Q81 U;  4D6W A;  4O6J A;  3OB9 A;  5DLQ E;  3GNF B;  3VUZ A;  3TEE A;  1G3W A;  1O75 A;  3CCM T;  1K8A U;  2XID A;  2FHD A;  4FSX A;  1JJ2 A;  1UGP B;  2RJF A;  4J5Y A;  3E9F A;  3JCM h;  2L3R A;  1M1K U;  3SWN A;  2RI2 A;  2I2L A;  1QP3 A;  2E1H A;  2VYT A;  2ZZD A;  1QVG S;  5GAN 6;  1YIT T;  3HRU A;  4Q5W A;  4C8Q F;  2XKO C;  4PLL A;  3CBM A;  5GMK j;  2EQK A;  1LJO A;  4CRI A;  2JNG A;  4Y91 A;  3JCM g;  5GAN f;  1NPR A;  2XK0 A;  1BI1 A;  3ME9 A;  3RKY A;  4R55 A;  3EAE A;  3V7C A;  3HRT A;  3JB9 D;  4M7D F;  3RKX A;  3M59 A;  4OF1 A;  1NE8 A;  3OYE A;  3JCM e;  2X35 A;  2OTL T;  5I2M A;  1M9S A;  3P8B B;  4YTL A;  3QII A;  2M9U A;  3CCR A;  2EQU A;  4ELY C;  2VGM A;  3BW1 A;  4PJO B;  2K3X A;  3HRS A;  4RCC A;  2NLU A;  3JCM d;  5FRN A;  3JB9 H;  3PMT A;  3CBP A;  3X26 B;  3RER A;  2DPP B;  1LNX A;  5HY6 A;  4MZT A;  5GAO p;  5CKB A;  4MDW A;  1Y7X A;  4XTU A;  1N8R U;  3I56 A;  2BIV A;  3CC4 T;  2RK1 A;  1BIA A;  3QUI A;  4M78 D;  3G71 T;  1VQL T;  3LLR A;  2K5L A;  1VIF A;  3OA6 A;  3M5A A;  3OQ5 A;  1ZQ1 A;  2LDM A;  2K57 A;  3VU3 C;  3CCQ T;  3VYH B;  4QQD A;  4C5H A;  4QQG A;  4QVC A;  2ZPB B;  2PVO B;  3DB3 A;  4PJO G;  4MZP A;  5FLX E;  2QEX T;  1VQK A;  3L2Q A;  1VQ9 T;  3CC2 T;  4BE1 A;  2OTJ T;  4BAC A;  2X4Y A;  3MEU A;  2LC4 A;  1Y96 B;  2DZ9 A;  2L5Q A;  3A8L B;  3H8Z A;  1V29 B;  4C8Q E;  2OAU A;  2RB6 A;  1PSF A;  1PSE A;  2G3R A;  1JRI A;  4C92 E;  5LJ3 j;  4PJO C;  4OVA A;  2GQV A;  4C0D C;  4J83 A;  4QW2 A;  4EMH A;  3KXT A;  4P5N A;  1YHQ A;  3JCM f;  4M7D E;  4KUI A;  3DLM A;  4LDX A;  4JS5 A;  5KE2 A;  4IUV A;  3S3N A;  5CKF A;  1ZBX A;  3JCM J;  4ZTJ A;  1YI2 A;  4HCZ A;  2MWO A;  4N4H A;  1X75 C;  2RA2 A;  3P8H A;  3CD6 A;  2RD1 A;  1KC8 C;  3J7A F;  3CCJ T;  1H3Z A;  3JCM Q;  3PNW C;  1X01 A;  3GP8 A;  5M9O A;  3I55 A;  2XDD A;  5GAM h;  4PJO D;  1KG1 A;  2CZ7 B;  3EFR A;  3CCV A;  4XU3 A;  5A0L A;  4M7D C;  4ME7 A;  4RMO A;  1VQO A;  3JCM X;  1N6A A;  3L2U A;  3V7S A;  1G3S A;  3QJ6 A;  2XD0 A;  3CC2 A;  2QEX A;  3EFS A;  3CCU T;  2DD4 A;  1VQM T;  4RG8 A;  5GAM g;  4TVR A;  5GAN h;  1K8A C;  2OTJ A;  3C95 A;  2F5T X;  3G6E A;  4ZGD B;  2GFU A;  1M1K C;  3P8D A;  4ZN3 A;  2RHX A;  2RHY A;  2F5K A;  5GAN g;  2KY9 A;  5GAM e;  4C8Q B;  1OZ2 A;  2MWP A;  3HFN A;  2QI2 A;  2E70 A;  4FL6 A;  2X4W A;  4LD9 K;  1G3T A;  1YJW A;  3X24 B;  5CK9 A;  4BE2 A;  3PTA A;  2P0Q A;  4MMK A;  3X28 B;  2DXU A;  1M1F A;  4M77 A;  5GAM d;  2ZPE B;  4FM4 B;  2DTH A;  2O01 E;  3CEY A;  1M1G A;  4OB0 B;  3URG A;  3CCL A;  3VUB A;  5FRM A;  1B34 A;  3V8J A;  4J8O A;  4M7D B;  3OYF A;  4ELZ C;  1UB4 A;  1QW1 A;  1RL2 A;  2DO3 A;  2IG0 A;  3GF5 A;  3WVD B;  5GAN d;  3NFC A;  2QDY B;  2R5M A;  2ZPF B;  4JRQ A;  5IT9 E;  5GAN 7;  2LT1 A;  3MCA B;  4E7L A;  4BI3 A;  4EMG A;  1KQS A;  1KC8 U;  4JRK A;  3M9Q A;  3HKS A;  3QZ9 B;  3HL8 A;  1P92 A;  2CZ6 B;  3E19 A;  4OB3 B;  3OYJ A;  2EWN A;  3OBW A;  2VXE A;  3JSC A;  3L2V A;  1K9M U;  2LT4 A;  3CCR T;  2ZGW A;  1QVP A;  3OYD A;  4JUV A;  3QSU A;  3H6Z A;  2C06 A;  3LYI A;  4CI0 C;  4PL6 A;  3JCM P;  3X25 B;  4A54 A;  1WGS A;  3UWN A;  1WJQ A;  2KMT A;  4M7A F;  3KUF A;  2DTI A;  3OW2 A;  2PU9 B;  1WQ7 A;  3A8M B;  2JOY A;  3HP9 A;  3I56 T;  1YJ9 A;  4L59 A;  5CQY A;  3L2Z A;  3A8G B;  2PQW A;  3C94 A;  4IUP A;  4PLI A;  5GAM f;  4JRP A;  1Y07 A;  1BIB A;  2O4X A;  4RG2 A;  3MP8 A;  4BI8 B;  1BYM A;  3GPL A;  1U1S A;  3PT9 A;  1Y71 A;  2DXB A;  3M57 A;  4M78 G;  4C8Q D;  5GAO q;  1HK9 A;  3LX7 A;  4M78 A;  4C92 F;  4BE0 A;  1VQK T;  1M4Z A;  4M77 F;  4LDY A;  2DIG A;  2WSC E;  2XIC A;  5AYF A;  4EMK B;  2QQ9 A;  4XTW A;  2QTX A;  4X9C A;  4M7D D;  4E7I A;  4NL3 A;  3Q1J A;  2R57 A;  4M78 C;  3LWI A;  5GAN 2;  1QVG A;  1I8F A;  1WQW A;  4O5V A;  3S3M A;  3LGL A;  1YIJ A;  1YHQ T;  2Y4X A;  2LQ8 A;  2MF2 A;  2FVU A;  3MP1 A;  2DTO A;  3QXE B;  4A4E A;  1UEB A;  4XQ3 A;  4L5G A;  3JB9 I;  4M75 F;  1G3Y A;  2JUF A;  3DKM A;  2XG8 D;  1YI2 T;  3QJY A;  1YBY A;  5CQX A;  1Q7Y C;  2R58 A;  3CD6 T;  1XNI A;  3FDR A;  4EDU A;  1KD1 C;  4IUR A;  4C5E A;  1D3B B;  4HT9 A;  2Y4Y A;  3OYM A;  4A4F A;  4XAX B;  1N27 A;  4BD3 A;  3TRE A;  4F7U F;  3I55 T;  1VQ7 A;  5I21 A;  3R6O A;  3VJP A;  3CCV T;  5KE3 A;  5KCH A;  3A8H B;  3CMA T;  1VQO T;  4MZM A;  2EQM A;  4M7A E;  1EIF A;  5J3B A;  2KDS A;  5A2Q E;  3BY7 A;  2YRV A;  2RH2 A;  3OYY A;  4E7J A;  2RJE A;  4PJO A;  4XTX A;  4DA4 A;  1NJI U;  3TCJ A;  4BY6 B;  2D6F A;  2ZPI B;  5GAO r;  1RI0 A;  2EYQ A;  1DJ7 B;  4C0F A;  3G7Z A;  3BFM A;  3G6E T;  1VIE A;  3E1S A;  4HA8 A;  1MHN A;  2P4T A;  2PVG B;  5GMK e;  1QP2 A;  1FWZ A;  2A3L A;  4M77 E;  2MMP A;  3CXC S;  3J80 E;  1VQ5 A;  3X20 B;  4A4K A;  1M90 C;  4JLI A;  2H3J A;  5GAN 8;  1YJW T;  2E5Q A;  3ASK A;  2VGN A;  2LTO A;  5GAM j;  2CGH A;  2B8A A;  4J7I A;  1IRE B;  3OYI A;  5KCO A;  1VQP T;  2RHI A;  2JVV A;  3CCL T;  1GXI E;  3OBY A;  1YJN A;  3MET A;  5J39 A;  2GF7 A;  1Y96 A;  3L2W A;  2EQJ A;  3DB4 A;  5GAO m;  1W2B S;  5GAN j;  1K9M C;  3V8K A;  5GAO l;  3PIP A;  3M53 A;  4XU0 A;  4M75 E;  3HHT B;  3LGF A;  3SB2 A;  3V7R A;  4LDU A;  2DJZ A;  1KQ2 A;  2EJ9 A;  2WSF E;  5A0D A;  3CMA A;  1Q7Y U;  2MAM A;  4V2S A;  2RO0 A;  4B9W A;  2FB7 A;  4J6X A;  1KD1 U;  1NPP A;  5IN1 A;  4ZGE B;  5KH6 A;  1VQ8 T;  2QQA A;  4F7U E;  4A4H A;  4M7A B;  3OSV A;  2PUO B;  2K5F A;  1OZ3 A;  3MEV A;  3SDZ A;  2JN0 A;  5DY9 A;  2YLB A;  5FU7 B;  1QVF S;  2LCC A;  3QHS A;  4J7F A;  5D6Y A;  3SD4 A;  3RUX A;  4XU2 A;  1XOV A;  3OSS C;  1BKB A;  2HNI A;  3L1A A;  2DKG A;  3FJP A;  1VUB A;  3GLX A;  3MEW A;  4HKE A;  3QG1 A;  4DOW A;  1YJ9 T;  5IAY A;  2RM4 A;  3CPW S;  4C92 B;  2LCL A;  2EJG A;  2KK4 A;  4M77 B;  1VQP A;  4DOV A;  5CKD A;  5L8R E;  3NTK A;  2WSE E;  3OY9 A;  3L42 A;  1KHI A;  4OGC A;  4RKU E;  2ZPH B;  2VXF A;  2M1H A;  3S6W A;  3OYL A;  3C4S A;  3QO3 A;  4OGE A;  3NTI A;  5LJ3 e;  1M90 U;  2LVM A;  1SSF A;  2EIF A;  1Q86 C;  2HQX A;  3QYG B;  3UT1 A;  2V8J A;  2A7Y A;  2X4X A;  3TU4 K;  2XU8 A;  3E9G A;  3FC3 A;  4C8Q G;  4C8Q A;  3GOX A;  2D9T A;  4A4G A;  3G4S A;  5C6S A;  4M75 B;  3M56 A;  5CKE A;  4R56 A;  1VQ8 A;  3CCE A;  1N9S A;  2LRQ A;  4VUB A;  4C92 G;  3DLL A;  3OS1 A;  4BUG A;  1YIJ T;  3QKJ A;  5FU7 C;  4IKF A;  1Q82 C;  2P0P A;  5LL6 S;  4M7D G;  4N0A A;  4C8Q C;  4LDV A;  3C12 A;  4BDZ A;  4ZTF A;  4F7U B;  2GFA A;  4QVD A;  3FB9 A;  2KAF A;  1O9S A;  4C92 C;  1BI2 A;  3OYN A;  2CZ1 B;  3O8V A;  2XDP A;  2M0O A;  3UPU A;  4M7A D;  1M8V A;  1NJI C;  1VQ6 T;  5C0M A;  5DLO A;  3SWN B;  2AHJ B;  4N0A C;  4BB7 A;  2JTF A;  1JJ2 S;  2YLC A;  1VQ7 T;  1K73 C;  5GMK m;  4PJO E;  4M75 G;  4JJN K;  2QA4 A;  2RJC A;  1WJS A;  1WPY A;  5GMK l;  4UC4 A;  2D0Q B;  5LJ5 h;  4N4G A;  1IZ6 A;  2GCX A;  5CR2 A;  3OYB A;  3MEA A;  2BKD N;  4E47 A;  4JDS A;  2IVW A;  4PNO A;  2HAX A;  3CC7 A;  3JRZ A;  4C92 D;  5EG2 A;  5DM7 R;  4MML A;  4M75 C;  4Z02 A;  4M77 D;  5LJ3 f;  5LJ5 g;  3OYC A;  4LD6 A;  1WNL A;  2K3Y A;  2E6N A;  3M54 A;  3ER0 A;  2FL7 A;  4GLK A;  3SFM A;  4JS4 A;  2DD5 A;  2DXT A;  2E12 A;  1Q86 U;  3CME A;  4OB1 B;  3HSB A;  3QDR B;  2E6Z A;  2EAY A;  5LJ5 e;  4E7H A;  1VQ5 T;  2K5I A;  3ZFJ A;  3KBG A;  4NL2 A;  5CVI A;  1VQ4 A;  2RI3 A;  2VC8 A;  5FU6 B;  4NOY A;  3JB9 F;  4M75 D;  5LJ5 d;  4E7K A;  1YJN T;  1HXD A;  3SWN C;  2KSS A;  1Q82 U;  1VQ6 A;  2QQB A;  4EMK A;  5GAN 3;  3L2R A;  1U1T A;  5GMK h;  5GMK i;  2KQW A;  3A8O B;  4BDY A;  1VQN T;  1N9R A;  3OS0 A;  5HKC A;  1U8R A;  4JRI A;  3N5B B;  2EKO A;  2RK2 A;  3OYH A;  2LX9 A;  3INZ A;  5D6X A;  4C0G A;  5GAN 4;  3CCS A;  3QPH A;  5GAN 5;  4C0D B;  4N4I A;  4EMK C;  1I81 A;  2Y90 A;  4OP0 A;  1K73 U;  3LWH A;  3FEO A;  2F69 A;  3GIB A;  4FT2 A;  3OYG A;  3RIR A;  4KUL A;  4XU1 A;  3CCM A;  2RJD A;  4M78 F;  2K4Y A;  2CYZ B;  4XTZ A;  3VKI A;  1D3B A;  3FLG A;  4MDX A;  4A53 A;  4XK8 E;  1WJR A;  2FYK A;  2DK3 A;  3S3O A;  2LQK A;  1I5L A;  2MI6 A;  4ZGJ B;  1YIT A;  2PVD B;  1MGQ A;  5FU6 C;  2ZPG B;  2DIQ A;  3FIF A;  3JCM c;  1UGR B;  5A0G A;  4L6V 5;  2V8I A;  4FT4 A;  4C5G A;  1NZ9 A;  2EJF A;  2CZ0 B;  1AHJ B;  3T9N A;  2RHU A;  5CKH A;  4XTY A;  4BI4 A;  5LJ5 f;  2CS7 A;  4HCB A;  2E65 A;  2XI9 A;  3MO8 A;  4OB2 B;  3RMQ A;  3JCM V;  2JZ2 A;  4JLG A;  4QQ6 A;  3WXM B;  3M4G A;  1M5Q 1;  1VQN A;  2BUD A;  3V8L A;  2OTL A;  3PIO A;  4KBM B;  2WAC A;  4RCB A;  5D6W A;  4Y28 E;  3OMC A;  1XTD A;  3M58 A;  3CXC A;  3HPW A;  1G5V A;  4BY6 C;  2EFI A;  5J26 A;  2QQS A;  1W4S A;  3QYH B;  4B9X A;  1KQ1 A;  1TH7 A;  3VYG A;  3G4S T;  1S72 T;  4KUD K;  3NTH A;  2K2V A;  3CCE T;  2V8K A;  2RHZ A;  1H64 1;  2E10 A;  1UGS B;  2VV5 A;  4KT0 E;  4LDW A;  3M4Y A;  3PGG A;  5CO7 A;  3AHU A;  4FIB A;  2E64 A;  2QXF A;  1BI3 A;  5LJ3 h;  3HFO A;  4X9D A;  2DXC A;  1FX7 A;  4PJO F;  4XTV A;  1W2B A;  1X6O A;  3CC4 A;  3G71 A;  1VQL A;  2XHC A;  4ATO A;  4J6W A;  3J81 E;  4ZN1 A;  5LJ3 g;  4IUU A;  3CCQ A;  4GY5 A;  3LH0 A;  4M78 E;  3RMS A;  1JBM A;  2DAQ A;  1Q81 C;  4IUQ A;  2QA4 T;  2XDB A;  1VQ9 A;  2M16 A;  1B34 B;  3UDC A;  4M7A G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...