2K57A

Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
MASPTVITLNDGREIQAVDTPKYDEESGFYEFKQLDGKQTRINKDQVRTVKDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A.
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Structural genomics, unknown function
molecule keywords Putative Lipoprotein
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k57A00
4M77B 4N0AA 4HT8A 1D3BB 4XU0A 5LJ5d 4RCCA 4M75A 4M78F 1D3BA 4M7DF 2QTXA 4M77F 4A53A 4XTVA 5GAOn 4M7AD 1N9SA 4C92F 5GAN6 4C8QD 1WPYA 4C92E 3QHSA 4M75B 5GAN8 4PJOA 1WQWA 2EJ9A 3BFMA 1B34A 4C92C 4HT9A 4M78D 4M7DD 4JLIA 2DXUA 4MMLA 1TH7A 2DTOA 4OP0A 4PNOA 5LJ3f 4PJOF 3RKYA 4PJOE 4C92A 4PJOB 1WNLA 4J5YA 3V7RA 5GAN3 1B34B 3BW1A 4MMKA 4PJOC 3JCMc 5CAIA 1LJOA 3QUIA 4M75F 1KQ1A 2YLBA 4XQ3A 4M75E 2E65A 1H641 4XTZA 4C92B 4QVCA 5GAN5 4M77D 4M75C 4XTYA 4EMHA 5GANf 4QVDA 2EAYA 3JCMf 4C92D 3AHUA 4M78C 4N0AC 1U1TA 5GAN7 2E1HA 3JB9I 1JRIA 4X9DA 4M7DA 4M75G 5GMKj 5GAMg 4M77E 3RERA 4PJOD 5GANe 1Y96B 2DJZA 4Y91A 3FJPA 5I21A 1LNXA 2RA2A 5GAN4 1I8FA 3RESA 4M7AA 4PJOG 2EJGA 4M77C 5GANg 4XU1A 4M75D 4F7UF 4C8QE 4M7DC 1HXDA 3JCMQ 4M7AB 4C8QC 4JUVA 3JCMh 5LJ3e 2DEQA 2EWNA 4NL2A 3SWNC 4M78G 2DZ9A 2RM4A 2VC8A 5GMKh 5LJ5h 5DY9A 4M7DB 3RKXA 4F7UB 1LOJA 3JCMd 5GMKm 1N9RA 1HK9A 1X01A 2E10A 3L2ZA 3JCMX 2Y90A 3HFNA 3RKWA 4F7UG 3JCMb 4M78E 2FYKA 2DVEA 5LJ3h 2DKGA 4JRIA 4JRKA 4NL3A 1I5LA 3V7CA 2DTIA 3JCMe 1I4K1 2FB7A 3INZA 2YHTA 5GAMf 4F7UE 3JCMJ 4X9CA 2YLCA 5LJ3j 2K57A 4EMKC 1Y96A 4M7AG 4HA8A 1BIAA 3QSUA 3V8JA 4EMKB 5LJ5f 5LJ5j 2DXTA 3EFRA 3V8LA 3HFOA 4DQ2A 2I2LA 5GAOl 3JCMW 1WQ7A 1M5Q1 3JB9H 2E64A 3V8KA 4EMKA 4V2SA 1BIBA 4XU3A 3FB9A 3GIBA 2VXEA 4XTUA 4EMGA 3M4GA 4M77A 5GAOm 3JCMV 4J6WA 3JB9G 3PGGA 5GMKl 4F7UA 5GANj 1MGQA 1YCYA 2EJFA 4J6XA 5GANd 5GAOp 4M78B 4J6YA 4XTWA 3V7SA 4C92G 5GAOq 3JB9D 2RD1A 3EFSA 2JN0A 4M77G 1I81A 4M7DG 4M78A 1KQ2A 3BY7A 4M7DE 2DZCA 5GAOr 2E41A 3L1AA 3SWNA 4C8QA 3SB2A 3JCMg 3QO3A 4WF2A 3FIFA 3JB9F 4M7AF 4NOYA 5GAMd 4M7AE 2CGHA 3RIRA 3SWNB 2DTHA 4C8QF 3HSBA 5GANh 5LJ3g 4C8QB 5GAMj 4M7AC 4XTXA 5LJ5e 2RB6A 3BDUA 1JBMA 5LJ3d 3VU3C 5GMKi 2ZGWA 4C8QG 3JB9J 1U1SA 5GMKe 5GAN2 2VXFA 4XU2A 4RCBA 3RUXA 5GAMe 3JCMP 1M8VA 5GAMh 5LJ5g 4A54A 2HNIA
chains in the Genus database with same CATH superfamily
1FXXA 4J8OA 2HSPA 1YJNQ 1WHJA 5I22A 3P8HA 4M7DF 4X1VA 4A53A 4FYWB 1VQ8A 4RG8A 5CR2A 1WPYA 2F1LA 2DLPA 3BFMA 4OB0B 2KRSA 2HBPA 4M7DD 5LJ3f 1WJSA 3QIIA 5D6XA 3CXCA 3EG3A 3M55A 1B34B 4Y28E 3FRNA 1QKWA 3CEYA 4IIMA 2COYA 2YXYA 3HRTA 4ZN1A 1NM7A 1W2BS 1VQKA 1X75C 2W10A 3NHNA 1MUZA 3LGLA 2EVRA 2RA2A 5GANg 3MO8A 3OSVA 1JU5C 3H0FA 1M90U 4C8QC 1YWOA 3MPUB 2J05A 2KGTA 4LUEA 2RNAA 5GMKm 1QVGS 2CP6A 1UJYA 2A08A 4KH1B 2KXCA 1Q86R 3DB3A 1GBQA 1VQ9T 5I2SA 2RJCA 1R8OB 3I5SA 4PLIA 1BIAA 4LE9A 5LJ5j 4QT7A 1PWTA 2VGNA 2V8KA 3KFVA 3L2UA 4BY6C 4DBHA 5GAOm 2AZVA 2LVMA 3EGUA 4ANJA 4M77G 1VQPQ 1K8AR 5FRMA 2KT8A 4RTYA 4QQ6A 1VQ5T 2A0FB 2DMOA 3CCRQ 1X6GA 1UFFA 5GJVB 1VIFA 3OYDA 2D9TA 2DL7A 1VQNT 2DNUA 3C94A 2EGAA 4FYYB 1U1SA 4HCKA 1ZSZB 2F5TX 2PQWA 3CBPA 1YHQA 1K73R 2BTTA 2KQWA 2QQRA 3THKA 2PUKB 2V1QA 1Q7YU 1ZBJA 4C92F 3I5RA 4C8QD 1RLQC 1BK2A 3DLMA 4PJOA 3OYLA 3SFMA 1BI2A 2O4XA 5IH2A 5KYYB 1VQNA 2CSIA 2RQTA 3UDCA 5CAIA 1M1KR 1BBZA 1RADB 3PNWC 2RH2A 3LX7A 4M77D 5L8RE 5CKDA 1SRMA 4M7DA 2OTJQ 3C12A 3VS4A 5M9OA 2EQIA 2C0TA 3QXEB 2DRMA 4EPCA 4PJOG 2V26A 1XNIA 2QK0A 4BB7A 3M59A 1ACMB 1T3LA 5FLXE 4ME7A 1X6BA 1D09B 1M2VB 3UATA 1YJNA 1K9MR 4OB2B 3OYJA 4E7ZA 4AMCA 2YUQA 1NYGA 2QQ9A 1WLPB 3M56A 4OMLA 2YUNA 3A8MB 4BDZA 1O9SA 4JRQA 2DILA 3OS5A 4X9CA 2YUPA 1UTIA 1WXBA 3QYGB 2R5AA 3E19A 2SRCA 2RI2A 3M9QA 3VRYA 4AFQC 1WZOA 3EHQA 3JB9H 2E64A 5KYXA 1ZUKA 3OYFA 5FU6C 3G6EA 4EMGA 2CREA 1VQMA 1RAGB 2EBPA 4OMQA 4J6WA 2L5QA 4TVRA 4D6WA 3VUZA 2KK4A 1YWPA 1XJWB 5GAOp 2LQWA 3EFOA 1KD1R 2RD1A 4PK4A 3CCMA 4M7AF 2X4XA 4BACA 2RB6A 3G1JA 2OI3A 1KIKA 2JS0A 4RCBA 1U3OA 1KG1A 1IHVA 2LP5A 4M75A 1WHLA 2XIDA 4Z89A 1PD1A 1VQLQ 4C92E 2EJ9A 1E7OA 2ROTA 4PNOA 2YSQA 1WNLA 4C5EA 2CT3A 2EYQA 1IREB 1YHQT 1X6OA 2BZYA 4C0DC 3OYCA 2MK5A 1OI1A 1MMDA 1Y96B 4R56A 2KROA 1I8FA 4IIOA 1UHFA 1QCFA 2PTKA 1K4US 2CDTA 1Y0MA 2DEQA 4IUUA 1SRLA 3ZBDA 2QEXQ 3HL8A 3JCMX 2RK2A 4BE0A 1U8RA 2RQUA 3VYHB 4LD9K 1SEMA 3HPWA 2YHTA 5D6YA 2QDLA 3OYYA 4C0GA 3CMAT 2EYWA 3GPLA 3OMGA 1VQOT 3CCQQ 3C0CA 3RMSA 2DYBA 4QVZA 1M90C 4XU3A 3FB9A 3GIBA 2NUTA 4M77A 3JSCA 3CCQA 2QG9B 2XK0A 2FG0A 1TOVA 2X4WA 2RJFA 4XTWA 3CCEA 5CKEA 2JN0A 2WSFE 2KYMA 3CCJQ 1KQ2A 3L1AA 3JB9F 3H9NA 4LXCA 4M7AE 2DTHA 3EG0A 1KQSP 3QPHA 2RJDA 4XU2A 2K79A 5LJ5g 2AKKA 3CCMQ 4QQDA 4HT8A 2KSSA 3M54A 1Q86C 4M78F 1N9SA 1W4SA 3CD6Q 2KXDA 1RUWA 4YTLA 4ELYC 1RAIB 1VOMA 1PG5B 3OS2A 1JJ2A 2GF7A 1GL5A 2KR3A 1XTDA 2DERA 1Z9ZA 3HRSA 2DF6A 1EZZB 2J7IA 2ED0A 4KUIA 1VUBA 2HAXA 2COZA 3L2QA 4E7IA 1IZ6A 1SF9A 2RI5A 1NJIC 4HVVA 4A4FA 3GP8A 4J9IA 3RERA 1N8RU 1R77A 1VQMQ 2M02A 2L8DA 5FRNA 3FJ5A 1Y57A 3QJ6A 3VUBA 4FU6A 2ZPGB 3RKXA 4F7UB 1QVFA 2Y90A 4IURA 2EW3A 3KUFA 1JJ2S 4JRIA 1K73C 3X25B 3INZA 1NYFA 5LJ3j 1OQKA 1GBRA 2L3PA 2OAUA 5L23A 1M8MA 2FRYA 4EMKA 4DEYA 1VQ9Q 4MZPA 2ZZDA 3CCLT 2JTMA 1S72T 2HD0A 2E12A 1GCQC 5KYUA 1MMNA 2XG8D 3REAB 4FYVB 2CT4A 3CCMT 4E2FB 1K9MC 4Q5WA 2DL5A 3CCST 2JXBA 3FDRA 1IB8A 2G3RA 5GANh 3VU3C 4C8QG 2ECZA 1X43A 2FPFA 3OSSC 2P0KA 1I1JA 2KDSA 1OYXA 1SHGA 1Y07A 2K7AA 2K3BA 3VS5A 1YBYA 3OW2A 4RKUE 1IGUA 3HKSA 4IUTA 3CCET 3VS3A 1TH7A 2OTLA 2J6FA 2NLUA 1NLPC 2QA4A 3U23A 2E65A 4KH0B 1HYOA 3CCRA 2L0AA 2LCSA 2YDLA 4M75C 2CZ1B 3JV3A 4CRIA 2XICA 1U1TA 3JB9I 4BI3A 1G2BA 2K3YA 5GAN4 4QW2A 1TWBA 4DA4A 4M77C 2PVGB 3NGPA 3E9GA 2DK3A 1NZ9A 4OMMA 4LDXA 2YUOA 3LGFA 1KD1U 2PZ1A 2CP0A 3PVQA 2PNIA 5CO7A 1I4K1 2OTJT 1I07A 2KI7A 2YLCA 2ED1A 4CC4B 3VYGA 3RNJA 2QQSA 3V8LA 2I2LA 1WJQA 3OYNA 3I56T 4DOVA 1IXDA 4Z8AA 3I56A 2LTOA 3G4SA 1ARKA 3J7AF 3GF5A 1TSFA 5FW9A 3JCMV 2DD4A 4FCYA 1MNDA 2GQVA 5GANj 1MHNA 4C0DB 3JAME 2COWA 2ZPFB 2GFAA 1KHCA 2RHXA 4BI8B 4C92G 1W2BA 2DIQA 2LJ1A 1PD0A 4J9EA 5IHKA 4NS5A 1BCMA 3I55A 4FM4B 1RAEB 3QZ9B 1ZA2B 4JLGA 1UGPB 2CZ0B 1UJ0A 2F2XA 2D0QB 2Z0WA 2C06A 3BDUA 3UA6A 1VQ4T 3RMQA 2DEUA 3RUXA 3L2VA 1M30A 3TSZA 2KY9A 3ME9A 4XU0A 4F14A 2K9GA 3MKDA 1YJ9T 1W1FA 2JMCA 3QKJA 4L6V5 2M0OA 4JLIA 4RTUA 4KGXB 2DRKA 2GQIA 2DBKA 2JM9A 1NLOC 1AD5A 3UT1A 1K9MU 2K5IA 2K5LA 2X4YA 2JS2A 3CC4Q 4N0AC 2HQEA 1U06A 1DJ7B 4Y91A 3G4SQ 3FJPA 1BCOA 2JM8A 1VYVA 1EIFA 4FIBA 4M7AA 3OS1A 2EJGA 2MAMA 4C8QE 2DPPB 2KMTA 3CMEA 3CCSQ 1M3BA 3JCMh 2EWNA 4NL2A 3L42A 2VC8A 5GMKh 2CKKA 1AZGB 2CH4A 2EKHA 2LT1A 1WI7A 3P8BB 1WHGA 1R0BG 1M2OA 1JO8A 4E7LA 1GFDA 1S72Q 1X27A 4B9XA 5A0GA 5GAMf 4M7AG 3M58A 1JB0E 3MEVA 3CCLA 2FO0A 2J6KA 1OPLA 5IT9E 2RK1A 4GLMA 2JW4A 2C0IA 1YIJQ 1UDLA 2DXBA 3MEWA 4LDVA 4B6MA 2DBMA 2CP3A 5D6WA 3M4GA 1QQJA 2FL7A 2VUBA 3PMTA 1K0SA 4J7FA 1UGVA 1YCYA 3QBYA 1J3TA 1KD1C 4M7DG 3CCJT 2DZCA 4J9CA 4C8QA 3CPFA 4NOYA 3RIRA 3SWNB 3LH0A 3HSBA 2Y4XA 4XTXA 2O31A 2WSEE 4A54A 1ZLMA 2HNIA 2JUFA 2FHDA 2P4TA 5HKCA 3CXCP 4RCCA 5A0DA 1ZUYA 2O9SA 3KXTA 4ZTJA 2QASA 1OX9A 3CBMA 3PE0A 5GAOn 2HBWA 3CC4A 3QWYA 1WQWA 3NTKA 1S1NA 4KGZB 2QAZA 1IHWA 3X26B 4PJOF 2LCLA 2FRWA 4J5YA 5GAN3 3S3MA 4M4ZA 1RLPC 1JXMA 3OW2S 3E2UA 1SHFA 1WJRA 2EAYA 2OJ2A 2ESWA 2E1HA 1FWZA 2EFIA 4M75G 5GMKj 4OMNA 1UB4A 3G71A 1VQ9A 5GANe 5GJWB 2ZPBB 3M53A 1GCPA 2VV5A 4XU1A 4DBRA 1HXDA 2JZ2A 4MZTA 4E47A 3SWNC 2O4XB 3H0IA 4CC3A 1LOJA 2MPXC 3LWHA 2X9HA 3VKIA 4J83A 1MV0B 2E70A 2FZCB 4PLLA 4Z88A 1NJIU 5CK9A 1G3SA 4CI0C 2NUPB 4IUQA 3OBWA 3H8ZA 2K57A 1VQKT 3CCVA 1VQ6Q 2OAWA 3AT1B 3CCQT 2F69A 4DQ2A 5ECAA 3CCUT 5IXFA 3M5AA 3SDZA 1RL2A 2YT6A 1M90R 2KAFA 3A8GB 2EQJA 2BIVA 3A8OB 5C0MA 1K0XA 3M0PA 1GXIE 3PFSA 3MP1A 3CC7A 3JB9D 2H3EB 1BKBA 3M0QA 3RBBB 1YJ9Q 4JZ4A 2GGRA 4PJMA 2DD5A 3CMAQ 2HMAA 1MMGA 4F16A 4PKCC 5LJ3g 3HRUA 5GAMj 2CZ7B 2VXFA 4LD6A 1M8VA 1D1BA 2CP2A 3O8VA 1FMWA 1QVFP 4M77B 3OS0A 1G5VA 4IUVA 2RQWA 4MZMA 2QTXA 2ZPHB 2E5QA 1VQ4A 4N4IA 4E7HA 2L3SA 2DM1A 1PNJA 4X34A 1WHHA 4C5HA 1N27A 1OU8A 2NUZA 1OEBA 2EQMA 4A4KA 3X20B 4PJOE 4LNPA 1VA7A 3WVDB 2KVQG 1X2KA 2RMOA 5FWBA 1LJOA 3QUIA 4E7SA 2OTLQ 2K2VA 1YI2T 2PVDB 4RTXA 2LJ3A 3H6ZA 4N4HA 2AIRB 3NPFA 4MDWA 2DJZA 2DYIA 4BUGA 5I21A 1RAFB 2OX7A 3FEOA 3S3OA 4M75D 7AT1B 5J39A 3Q1JA 5KYXB 4MDXA 2BE9B 4JUVA 1RAAB 2KEAA 3TSWA 1UECA 1XQHA 5IXBA 1KHIA 1VIEA 1X01A 3I35A 2P0QA 4F7UG 4OB1B 3V7CA 4LUDA 4HXJA 3CQTA 1H3HA 1QVGA 1WHKA 2DX1A 5LJ5f 1VYUA 2K2MA 1OULA 2MWPA 2K4YA 3SEMA 2CSQA 1M5Q1 4K11A 2JT4A 1RI9A 4AFSC 2IVWA 4FSXA 1Q82U 1YJWT 1G3TA 4ATOA 1PRLC 3QDFA 4OMOA 4F7UA 1YITA 5GAOq 3EFSA 2QA4T 4OF1A 4M78A 1K8AC 3CCUA 3J80E 4F04B 3CPWP 2ATCB 2O01E 2AKLA 3SWNA 2OTLT 2PU9B 4FYXB 4LDYA 2HCKA 3DB4A 3PIPA 5KCOA 1C6VX 4C8QB 2AHJB 3O5ZA 2XKOC 1KQSS 3JB9G 4ZNXA 4R0KA 3FLGA 2XDPA 3EG9B 3F70A 1C1AA 2X51A 1YI2Q 2ABLA 3MEUA 2CP7A 3M0TA 2LZ6B 4M75B 4J9BA 3MHXA 2H8HA 4MMLA 2XDDA 1ABOA 1WDXA 4A63B 1YP5A 3HHTB 1Q81R 3QZ5B 4R55A 1HJDA 3AHUA 3A98A 3FC3A 3EG9A 2ROLA 2DAQA 4O5VA 3REBB 4C92D 4M78C 2CS7A 4E6RA 3CD6A 1AHJB 2RHIA 3I9QA 3D7SB 2EQKA 5KCHA 2EGEA 4AFUC 3E9FA 3RESA 2W0ZA 4M7AB 1YI2A 2CUDA 4RG2A 1VQ8Q 3CCUQ 2DZ9A 3A1PA 1VQ5A 1UGQB 5AYFA 3CC2Q 2NUTB 5DLQE 3GOXA 1D0YA 2HKNA 4EMKB 4AG2C 2CUBA 1Q7YR 1Q95G 2FZKB 1JJ2P 3G71Q 1M2VA 1PKTA 1SSHA 2A7YA 2R57A 1NJIR 2RQVA 4J6YA 4ZGDB 1YIJT 1N8RC 4D8KA 1P92A 1I0CA 4JS4A 1BI3A 3N5BB 4RTZA 4RUGA 5LJ5e 1Q86U 2FZGB 3QG1A 2D1XA 2DJQA 5GAN2 4OGCA 2DFUA 3OYMA 5J3BA 1V76A 3EG1A 3EHRA 1AVZC 1UHCA 1VQOQ 1ZSZA 4M7AD 1EFNA 3CMET 2LNVA 3QHSA 2Y4YA 1G8XA 2QTVA 2DXUA 4OP0A 1AWXA 2DETA 3QJYA 2J06A 4C92A 2ZPIB 1BI0A 2HDAA 1VQPA 2V8IA 4C5IA 4HVWA 4M75E 2BE7D 4C92B 3ULRB 4LN2A 4ORZA 4HCCA 3OB9A 1NE8A 3JCMf 3ZEHA 1CKAA 1VQ8T 1JRIA 2R5MA 1YIJA 1IO6A 1GCQA 1RI0A 5FU6B 1YCSB 2O9VA 5D7UA 3WVEB 3P8DA 4JJBA 4JS5A 1YJ9A 2BZ8A 2O88A 1M27C 5DY9A 4BE1A 2D8JA 4L59A 3JCMd 3VRZA 2X3WD 3RKWA 3EFOB 2XI9A 1Q82C 2GCXA 4JJDA 3A8HB 2MCNA 2EIFA 3V8JA 1W70A 4ZTFA 1MMAA 4J9FA 4AT1B 1M1GA 2KRNA 1K8AU 5IAYA 2KT1A 1ZBXA 2LX7A 1AT1B 2VXEA 5A2QE 4JPBW 4Z02A 2VB6A 3OYBA 1UGSB 4CC2A 2NWMA 5CIUA 4QKUA 1NBEB 2K5FA 2EYXA 1I81A 2HQHA 1MNEA 1WA7A 2JJ9A 2M51A 4EDUA 4FW2A 3MCAB 1VQ7Q 4KBMB 3QO3A 4KT0E 3FIFA 3L2WA 4PFZA 2KNBB 2CH4W 2ENMA 4PFOA 5KE2A 1VQ6T 4C8QF 2MI6A 1AWJA 2LRQA 1LPLA 2HKQB 3EG2A 1JBMA 3LLRA 2EPDA 4LDWA 5KYUB 1QMCA 2E3IA 2VVKA 2P84A 2GFUA 4JZ3A 2QXFA 1W2BP 2JOYA 4B9WA 4M77F 5KH6A 4XAXB 1WHMA 5GAN6 3TVTA 1E6GA 2FPEA 5HY6A 3HP9A 2FEIA 4HT9A 1LVKA 3DKMA 4PJOC 2WACA 1UE9A 1M1KC 2P4RA 1KFZA 1UUEA 5GANf 5CKFA 3EH2A 4ZGJB 1SG5A 1LNXA 4BY6B 1B3QA 1K9AA 1TUGB 4IUPA 3URGA 1YJWA 1M1FA 5LJ3e 5FROA 4BDYA 2MOXA 2QGGA 2DL8A 1HK9A 4ELZC 2GBQA 1Q81C 1KSWA 3G7ZA 3CMEQ 4EMKC 2BUDA 3EFRA 5GAOl 3MJXA 1UG1A 1Y7XA 3EH1A 5KYWB 1M9SA 1VQ4Q 4XTUA 3OYKA 5HCKA 1OZ3A 4PJJA 4UC4A 3EGDA 1OZ2A 1YNZA 4P5NA 1FX7A 1QP3A 2M0YA 3ER0A 1W6XA 4BI4A 2MYSA 5GAMd 1M1KU 2BKDN 1D0XA 3X24B 2IPOB 4F17A 1QP2A 2QDYB 3VS6A 2KBTA 2ZGWA 3G4ST 3CC7Q 5GAMe 5GAMh 3CD6T 2HL5C 1PC0A 4N0AA 5LJ5d 1Z9QA 2MMPA 2CZ6B 3NMZC 1D3BA 4FL6A 9ATCB 5IN1A 1PM3A 3VV0A 3LW5E 2E3HA 1PRMC 2RJEA 2K3XA 1KQ1A 2X4JA 4XQ3A 1YFNA 2KRMA 1GFCA 4X9DA 5IHIA 3PMIA 4J9GA 5C6SA 2DO3A 1KC8R 1N6AA 3J81E 3LH5A 5KYNA 1UGRB 4FW1A 2LMJA 2E6ZA 2K6DA 1GRIA 4A4EA 3OYIA 3CC2A 3JCMQ 5EG2A 3CCRT 1FYNA 1QW1A 2HQXA 3JRZA 5CCAA 1MV3A 1QWEA 5LJ5h 4QQGA 1AWOA 1D1AA 2AT1B 1T0HA 3OMCA 3JCMb 1VQ7A 2G6FX 2CP5A 4OB3B 4C5GA 3JCMe 1TU0B 1SPKA 4GLKA 1ZSGA 2M9UA 1H3ZA 1SSFA 4RMOA 3JCMJ 4DBQA 2EQUA 4DEXA 1ZHIA 1M3CA 1Q82R 1WQ7A 4HCBA 1TXQA 4XK8E 4KRTA 1BIBA 4V2SA 5FU7C 2ZAEA 1BB9A 4FT2A 4J6XA 5GANd 3VS2A 2RHZA 3G71T 3I56Q 2JNGA 1Y71A 4J9DA 2FVUA 3EGXA 3IQLA 1YHQQ 4M7DE 3DLLA 3GNGA 3M0UA 2M1HA 4PJNA 2YRVA 4C0FA 5KYWA 3OW2P 2F5KA 2SEMA 2XU8A 1V29B 3CBOA 5DLOA 1K73U 3QDRB 1ZSZC 2L89A 3C4SA 2A37A 4CC7A 2RN8A 2QI2A 3UA7A 4J7IA 4C0ZA 1BU1A 1B34A 1H8KA 1WXUA 2LCCA 2JTEA 2I0NA 1PCXA 4ZN3A 2VYTA 4MMKA 4BD3A 3VS0A 3CCEQ 3T9NA 4M75F 3SHWA 5GAN5 3M0RA 4XTZA 4QVCA 4KGVB 4L5GA 2QQBA 4EMHA 4QVDA 2RHYA 5GAN7 2MF2A 4M77E 1PKSA 2AK5A 3OBYA 2A36A 2L3RA 2EGCA 1ZQ1A 3R6OA 2P0PA 2RI3A 4E7KA 2HL3A 1U5SA 4BE2A 3M4YA 1VQLT 3META 3L2ZA 5CQXA 4Y92A 3HFNA 1FMVA 1ZA1B 2DVEA 1NPPA 1I5LA 2D0NA 1EX4A 2PUOB 1JQQA 2LX9A 2FPDA 1VQ5Q 2B86A 2ZPEB 3X28B 3JCMW 2CYZB 5AT1B 3OYGA 1QVPA 5I2MA 1D0ZA 2M16A 2KYBA 2DVJA 4D8DA 2X35A 1IRXA 1I5OB 5GMKl 3M57A 2XMFA 4OMPA 4KUDK 2JTFA 2HSEB 2R58A 1QVFS 3EGDB 2O2OA 3BDLA 3ZL7C 2E41A 4A4HA 1VQLA 1M4ZA 1T0JA 2D6FA 5LJ3d 3UWNA 2DIGA 2VGMA 1VQ6A 4M7DC 1JXOA 3CMAA 3KBGA 1YJNT 1WFWA 1RACB 1YITQ 1OV3A 3RKYA 2E6NA 2RQRA 2RHUA 1JEGA 3UF4A 2YLBA 3S6WA 3CPWA 3I55T 6AT1B 2QA4Q 1QWFA 3WXMB 5GAMg 4PJOD 4VUBA 4HCZA 1RABB 2GNCA 3GLXA 3CCJA 2RM4A 2QGFB 1G83A 4GY5A 4M7DB 1N9RA 5HK0A 2E10A 2VWFA 1C0MA 2A28A 1WGSA 1E6HA 2DKGA 4NL3A 1ZX6A 2X3XD 2FB7A 4HVUA 4WCIA 2D8HA 1X69A 1Y96A 3L2RA 3OA6A 3LWIA 3HFOA 2EKOA 1RAHB 3M0SA 2LQNA 2MIOA 5CKBA 2JVVA 4II1A 3E1SA 4OMFB 1KC8C 1VQPT 2XDBA 1B7TA 3RDVA 4AFZC 2DA9A 1KQSA 3PGGA 2RO0A 3OYHA 1MGQA 3BE3A 2DE0X 2HZYA 1NEGA 1VQ7T 3BY7A 1R0CB 1BI1A 3PT9A 4A4GA 4OVAA 3JCMg 3TQ7P 4WF2A 3TEEA 2CGHA 1VQMT 3G6ET 3ZFJA 1WIEA 3VS1A 1YITT 5HK3A 3CC2T 5GMKe 2LC4A 4IKFA 1D3BB 1K76A 3H0HA 2L3QA 1PSFA 1ABQA 1QVGP 4XTVA 4RTWA 3NTHA 4OGEA 5CVIA 1AEYA 1HSQA 2DL4A 5KYYA 1ZUUA 5LL6S 1XOVA 4AG1C 1Q7YC 4PJOB 1CSKA 2B8AA 2L2PA 5J26A 3V7RA 1SKUB 4J9HA 3JCMc 3CCSA 1PHTA 1WX6A 1H641 3MEAA 1G3YA 4XTYA 1OX8A 2E5KA 3LYIA 5IHNA 5A0LA 1X2QA 2H3JA 1TUDA 2QQAA 3NTIA 1N8RR 1OU9A 3PVLA 1S72A 1K1ZA 3EAEA 4F7UF 3RR6A 2KE9A 3ASKA 2YRDA 1D1CA 1TS9A 2RPNA 4EIKA 1M3AA 1VYTA 2QYZA 1Q81U 1BYMA 2V8JA 1PSEA 3QYHB 4M78E 4JRKA 3TREA 1WXTA 3QWXX 4DBFA 3OYEA 2A3LA 4DOWA 4F7UE 1TTHB 2ZCFB 5FU7B 1TUCA 2EYYA 1QKXA 2DXTA 1WYXA 4ESRA 3PIOA 1N5ZA 2LQKA 2DL3A 2NYSA 1QLYA 1VQKQ 2LT4A 2OTJA 3TCJA 2DXCA 1O75A 2GTJA 4ZGEB 4JDSA 1QCNA 1HD3A 4PFPA 3G6EQ 2HEQA 5CQYA 3S3NA 4M78B 3V7SA 2VASA 4RTTA 2XHCA 8ATCB 3OY9A 1KJWA 4PJLA 2RF0A 1TG0A 1H92A 3CC7T 3HTRA 2E4HA 3JB9J 3JCMP 2J6OA 2LNHB 3TU4K 1B07A 1OPKA 4KULA 4JJCA 2JMAA 3MP8A 2AZSA 2QEXA 1KC8U 3I55Q 1NEBA 3UPUA 2LJ0A 4FT4A 2GTOA 3C95A 1IGQA 5GAN8 2V1RA 4E7JA 3CCVT 4C92C 4M78D 1AZEA 2DTOA 2YWWA 5CKHA 1LCKA 2LDMA 3GNFB 3A8LB 3BW1A 2WSCE 2XD0A 2IIMA 1A0NB 3MP6A 4HKEA 2PVOB 3R6NA 1QCOA 3VS7A 1F1BB 1VQNQ 3H41A 1UEBA 4PL6A 8AT1B 3OYAA 1G3WA 2F2WA 1NG2A 4GBQA 4M78G 2QEXT 1VQOA 3CPWS 2YRCA 3GBQA 1KK7A 5I11A 4RTVA 3CXCS 1V1CA 2FYKA 5LJ3h 2NUPA 3OQ5A 2DTIA 2LQ8A 3NFCA 4N4GA 1YJWQ 4HA8A 1YN8A 3QSUA 5KE3A 3CC4T 1T3SA 3PTAA 2MWOA 3V8KA 5DM7R 3SD4A 2EYZA 2VKNA 1FMKA 1AOJA 1NPRA 1OOTA 4O6JA 3CCVQ 2EJFA 3CCLQ 3VJPA 4JRPA 4LDUA 2C0OA 3EGXB 2BZXA 4FSSA 2F2VA 5GAOr 4WTOB 2IG0A 1AWWA 3SB2A 3A5ZB 1CKBA 5EC7A 4JJNK 4M7AC 5GMKi 5FWCA
chains in the Genus database with same CATH topology
1FXXA 1K73U 3QDRB 3FLGA 2XDPA 3F70A 4J8OA 3OSSC 2L89A 2P0KA 2KDSA 1OYXA 3C4SA 3P8HA 4M7DF 1Y07A 4A53A 3MEUA 1VQ8A 2QI2A 4RG8A 5CR2A 3OW2A 1YBYA 1WPYA 4IUTA 3HKSA 4M75B 4J7IA 4RKUE 3CCET 3MHXA 3BFMA 4C0ZA 1B34A 4OB0B 2HBPA 4M7DD 4MMLA 1TH7A 5LJ3f 1WJSA 3QIIA 2LCCA 5D6XA 2XDDA 2OTLA 2NLUA 3CXCA 3M55A 2VYTA 1B34B 3HHTB 4MMKA 4Y28E 3QZ5B 4BD3A 3FRNA 4ZN3A 4R55A 3T9NA 4M75F 3AHUA 3FC3A 5GAN5 4XTZA 3CEYA 2E65A 4QVCA 2QA4A 3HRTA 4ZN1A 3CCRA 4L5GA 4M75C 2QQBA 2CZ1B 4EMHA 2DAQA 4O5VA 4C92D 4CRIA 4QVDA 2XICA 2RHYA 4M78C 1U1TA 2CS7A 5GAN7 3JB9I 1W2BS 3CD6A 1AHJB 2RHIA 2MF2A 1VQKA 4BI3A 2EQKA 4M77E 1X75C 3OBYA 2K3YA 2L3RA 3LGLA 1ZQ1A 5KCHA 3R6OA 2RA2A 5GAN4 2P0PA 3E9FA 3RESA 4QW2A 4DA4A 2RI3A 4E7KA 4M77C 5GANg 2PVGB 3E9GA 2DK3A 3MO8A 4BE2A 3OSVA 1M90U 3M4YA 1NZ9A 4M7AB 4C8QC 3CCMA 1YI2A 4RG2A 1VQLT 2DZ9A 3META 4LDXA 3LGFA 1KD1U 5GMKm 1QVGS 1VQ5A 1UGQB 3L2ZA 5CQXA 5AYFA 3HFNA 2DVEA 1NPPA 3DB3A 5DLQE 5CO7A 1I5LA 1I4K1 2PUOB 2OTJT 2LX9A 3GOXA 1VQ9T 5I2SA 2YLCA 2RJCA 1R8OB 4PLIA 1BIAA 3VYGA 5LJ5j 4EMKB 2QQSA 2ZPEB 3V8LA 3X28B 3JCMW 2I2LA 2VGNA 1WJQA 2CYZB 3OYNA 2V8KA 3I56T 4DOVA 3OYGA 3I56A 3G4SA 1QVPA 2LTOA 5I2MA 3J7AF 3L2UA 3GF5A 4BY6C 2M16A 5GAOm 3JCMV 2DD4A 2X35A 5GMKl 3M57A 2GQVA 5GANj 1MHNA 4C0DB 3JAME 2A7YA 2R57A 2ZPFB 4KUDK 2GFAA 1KHCA 2JTFA 2RHXA 4J6YA 4BI8B 4C92G 4ZGDB 2LVMA 1YIJT 1W2BA 2DIQA 1N8RC 4M77G 1P92A 2R58A 5FRMA 1QVFS 3BDLA 4QQ6A 2E41A 4NS5A 3I55A 4FM4B 1BI3A 4JS4A 3QZ9B 3N5BB 4JLGA 1UGPB 4A4HA 1VQ5T 2CZ0B 2D0QB 1VQLA 1M4ZA 1VIFA 2C06A 3OYDA 2D6FA 5LJ5e 2D9TA 3BDUA 5LJ3d 1Q86U 1VQ4T 3UWNA 3C94A 1VQNT 3QG1A 3RMQA 1U1SA 5GAN2 3RUXA 3L2VA 2DIGA 2VGMA 4OGCA 1VQ6A 4M7DC 3OYMA 2F5TX 2PQWA 3CBPA 2KY9A 3ME9A 3KBGA 4XU0A 5J3BA 3CMAA 1YHQA 2KQWA 2QQRA 1YJNT 1YJ9T 2PUKB 4M7AD 1Q7YU 3QKJA 4C92F 3CMET 2LNVA 4C8QD 3QHSA 4PJOA 3DLMA 2Y4YA 3OYLA 4L6V5 2M0OA 3SFMA 4JLIA 2DXUA 4OP0A 1BI2A 2E6NA 2O4XA 3RKYA 1VQNA 3QJYA 4C92A 2ZPIB 2RHUA 1BI0A 3UT1A 1VQPA 1K9MU 2V8IA 3UDCA 4C5IA 2K5IA 5CAIA 2YLBA 3S6WA 4M75E 2K5LA 3PNWC 4C92B 3CPWA 2RH2A 3LX7A 4M77D 5L8RE 4HCCA 5CKDA 3I55T 2X4YA 1NE8A 3OB9A 3JCMf 3ZEHA 4N0AC 1VQ8T 1JRIA 2R5MA 4M7DA 3C12A 2HQEA 3WXMB 5GAMg 5M9OA 1YIJA 4PJOD 1DJ7B 3QXEB 4Y91A 3FJPA 4EPCA 1RI0A 1EIFA 5FU6B 4FIBA 4PJOG 4BB7A 1XNIA 3OS1A 3WVEB 2EJGA 4VUBA 2MAMA 4HCZA 3M59A 4C8QE 2DPPB 3P8DA 2KMTA 3CMEA 3GLXA 4JS5A 5FLXE 4ME7A 3JCMh 1YJ9A 2EWNA 4NL2A 1YJNA 3CCJA 3L42A 2RM4A 2VC8A 5GMKh 2CKKA 5DY9A 4GY5A 4BE1A 4L59A 3JCMd 4OB2B 3OYJA 2LT1A 4M7DB 1N9RA 3P8BB 5HK0A 2E10A 2QQ9A 3RKWA 1WGSA 4E7LA 2XI9A 2DKGA 3M56A 4NL3A 1Q82C 3A8MB 2GCXA 4BDZA 4B9XA 2FB7A 1O9SA 4JRQA 3A8HB 5A0GA 5GAMf 3OS5A 4X9CA 1Y96A 3M58A 4M7AG 1JB0E 3MEVA 3CCLA 3L2RA 2EIFA 3V8JA 3OA6A 3LWIA 2R5AA 3E19A 3HFOA 3M9QA 3QYGB 2RI2A 2EKOA 5IT9E 2RK1A 4ZTFA 3JB9H 1M1GA 5CKBA 2JVVA 2E64A 3E1SA 4II1A 5IAYA 1K8AU 4OMFB 2DXBA 1ZBXA 3OYFA 1KC8C 3MEWA 4LDVA 1VQPT 2VXEA 5FU6C 5A2QE 5D6WA 4Z02A 4EMGA 3G6EA 3M4GA 2XDBA 3OYBA 1VQMA 1KQSA 4J6WA 1UGSB 2FL7A 2VUBA 3PGGA 3PMTA 4J7FA 2L5QA 4TVRA 4D6WA 2RO0A 3VUZA 5CIUA 3OYHA 1MGQA 2KK4A 1YCYA 3QBYA 5GAOp 2K5FA 1KD1C 2RD1A 1I81A 4M7DG 1VQ7T 3CCJT 3BY7A 3PT9A 1BI1A 2DZCA 4EDUA 4A4GA 3MCAB 4C8QA 4OVAA 3JCMg 4KBMB 3QO3A 4KT0E 3FIFA 4WF2A 3TEEA 3L2WA 3CPFA 4M7AF 4NOYA 5KE2A 2CGHA 3RIRA 2X4XA 3LH0A 3SWNB 4BACA 4C8QF 2MI6A 2Y4XA 2LRQA 1VQMT 3HSBA 3G6ET 4XTXA 3ZFJA 2RB6A 1JBMA 1YITT 3LLRA 5HK3A 3CC2T 5GMKe 2LC4A 4LDWA 4IKFA 4RCBA 2WSEE 4A54A 2JUFA 2HNIA 2GFUA 2FHDA 2P4TA 1D3BB 2QXFA 5HKCA 4RCCA 5A0DA 3KXTA 1KG1A 4ZTJA 4M75A 2XIDA 1PSFA 2JOYA 3CBMA 4B9WA 4M77F 5KH6A 4XTVA 4XAXB 5GAOn 3NTHA 5GAN6 4OGEA 5CVIA 4C92E 3CC4A 1WQWA 3NTKA 2EJ9A 5HY6A 3HP9A 4HT9A 5LL6S 4PJOF 3DKMA 4PNOA 3X26B 1XOVA 2LCLA 1Q7YC 4PJOB 1WNLA 4J5YA 2B8AA 5J26A 3V7RA 5GAN3 4PJOC 2WACA 3S3MA 4C5EA 1M1KC 3JCMc 3CCSA 1H641 3OW2S 2EYQA 3MEAA 1IREB 1WJRA 1G3YA 4XTYA 5GANf 1YHQT 2EAYA 2E1HA 1FWZA 1X6OA 5CKFA 2EFIA 3LYIA 4C0DC 4M75G 5A0LA 2H3JA 5GMKj 3OYCA 1UB4A 2QQAA 3NTIA 1OI1A 3G71A 1VQ9A 5GANe 1Y96B 4ZGJB 4R56A 1LNXA 1I8FA 4BY6B 1S72A 2ZPBB 3M53A 2VV5A 3EAEA 4IUPA 4XU1A 4F7UF 3ASKA 1HXDA 3URGA 1YJWA 2JZ2A 1M1FA 4MZTA 5LJ3e 2DEQA 5FROA 4E47A 4IUUA 2O4XB 3SWNC 4BDYA 3ZBDA 3HL8A 1Q81U 1LOJA 3JCMX 1HK9A 2RK2A 3LWHA 4BE0A 2V8JA 3VKIA 1U8RA 1BYMA 4J83A 4ELZC 1PSEA 3QYHB 2E70A 4M78E 3VYHB 4LD9K 4PLLA 4JRKA 3TREA 1NJIU 5CK9A 3HPWA 1G3SA 4CI0C 3OYEA 2YHTA 1Q81C 4IUQA 3G7ZA 5D6YA 2A3LA 4DOWA 3OBWA 2ZCFB 4F7UE 3H8ZA 2K57A 1VQKT 4EMKC 3CCVA 5FU7B 3OYYA 4C0GA 3CCQT 2BUDA 2DXTA 2F69A 3EFRA 3CMAT 4DQ2A 5GAOl 3CCUT 3PIOA 3OMGA 3GPLA 1VQOT 2LQKA 1Y7XA 3M5AA 3RMSA 4QVZA 3SDZA 1RL2A 1M90C 4XU3A 2LT4A 2OTJA 1M9SA 3FB9A 3TCJA 3GIBA 4XTUA 2DXCA 3OYKA 1O75A 4M77A 3JSCA 2KAFA 3CCQA 3A8GB 4ZGEB 4JDSA 2EQJA 2BIVA 1OZ3A 2XK0A 3A8OB 5C0MA 2X4WA 2RJFA 1GXIE 3PFSA 3MP1A 4UC4A 5CQYA 4M78B 4XTWA 1OZ2A 3V7SA 3CC7A 3CCEA 3S3NA 5CKEA 4P5NA 1BKBA 2JN0A 3JB9D 2XHCA 1FX7A 1QP3A 2WSFE 1KQ2A 3OY9A 3ER0A 3L1AA 2DD5A 4BI4A 3JB9F 5GAMd 4M7AE 4M7AA 1M1KU 2BKDN 2DTHA 3X24B 4PKCC 3CC7T 5LJ3g 1QP2A 3HRUA 5GAMj 2QDYB 3QPHA 2CZ7B 2ZGWA 3G4ST 2RJDA 3JB9J 2VXFA 4XU2A 5GAMe 3JCMP 4LD6A 1M8VA 3O8VA 5GAMh 5LJ5g 3TU4K 3CD6T 4M77B 4N0AA 4KULA 2KSSA 4QQDA 3OS0A 5LJ5d 4HT8A 3M54A 2MMPA 3MP8A 2QEXA 1KC8U 4IUVA 2CZ6B 1G5VA 1Q86C 3UPUA 4M78F 1D3BA 4MZMA 2QTXA 2ZPHB 2E5QA 1VQ4A 4N4IA 4E7HA 1N9SA 4FT4A 1W4SA 3C95A 5GAN8 4FL6A 4E7JA 3CCVT 4X34A 4C5HA 4YTLA 5IN1A 4C92C 4ELYC 4M78D 1N27A 2DTOA 2EQMA 5CKHA 3X20B 3VV0A 4A4KA 3OS2A 1JJ2A 4PJOE 3LW5E 2LDMA 2GF7A 2KVQG 3GNFB 1XTDA 3WVDB 3A8LB 2RJEA 3BW1A 3HRSA 1LJOA 3QUIA 2K3XA 1KQ1A 2WSCE 2X4JA 1VUBA 4KUIA 2K2VA 4XQ3A 3JB9G 2HAXA 1YI2T 2PVDB 2XD0A 3L2QA 4E7IA 3H6ZA 3MP6A 4HKEA 1IZ6A 2PVOB 2RI5A 1NJIC 4X9DA 3PMIA 4N4HA 5C6SA 2DO3A 4A4FA 1N6AA 3J81E 3GP8A 3RERA 4MDWA 2DJZA 1VQ6T 4BUGA 5I21A 1UGRB 1N8RU 2E6ZA 3FEOA 1UEBA 4PL6A 3S3OA 4M75D 4A4EA 1G3WA 3OYAA 5J39A 3Q1JA 3OYIA 3CC2A 2L8DA 3JCMQ 4MDXA 5EG2A 5FRNA 4JUVA 3CCRT 1QW1A 2HQXA 3QJ6A 3VUBA 3JRZA 4M78G 4FU6A 5CCAA 2QEXT 1VQOA 1XQHA 2ZPGB 5LJ5h 4QQGA 3CPWS 1KHIA 3RKXA 4F7UB 1VIEA 1X01A 1QVFA 2Y90A 3OMCA 4IURA 2P0QA 4F7UG 3JCMb 3CXCS 2FYKA 1VQ7A 3KUFA 5LJ3h 1JJ2S 4JRIA 1K73C 4OB1B 3X25B 3OQ5A 3V7CA 2DTIA 4OB3B 4C5GA 3JCMe 2LQ8A 3INZA 2M9UA 3NFCA 4GLKA 1SSFA 4N4GA 1H3ZA 1QVGA 4RMOA 3JCMJ 5LJ3j 4HA8A 2EQUA 3QSUA 5LJ5f 5KE3A 2OAUA 3CC4T 2MWPA 2K4YA 1ZHIA 1WQ7A 1M5Q1 2MWOA 3PTAA 4HCBA 4XK8E 2IVWA 3V8KA 4EMKA 5DM7R 3SD4A 4FSXA 1Q82U 1BIBA 1YJWT 4V2SA 5FU7C 1G3TA 4ATOA 4MZPA 2ZZDA 1NPRA 3CCLT 2JTMA 1S72T 2HD0A 2E12A 4F7UA 4O6JA 1YITA 4FT2A 2EJFA 4J6XA 5GANd 3VJPA 4JRPA 4LDUA 2RHZA 5GAOq 3G71T 3EFSA 2JNGA 2XG8D 2QA4T 4OF1A 1Y71A 4M78A 3CCUA 2FVUA 3J80E 1K8AC 4M7DE 5GAOr 2O01E 3CCMT 3DLLA 3SWNA 1K9MC 2IG0A 3GNGA 2OTLT 2PU9B 4LDYA 3SB2A 4Q5WA 2M1HA 3CCST 3DB4A 3PIPA 2YRVA 5KCOA 3FDRA 3A5ZB 2G3RA 4C0FA 5GANh 4C8QB 4JJNK 4M7AC 2AHJB 2F5KA 3VU3C 4C8QG 5GMKi 2XKOC 1KQSS 2XU8A 1V29B 3CBOA 5DLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 B;  4N0A A;  4HT8 A;  1D3B B;  4XU0 A;  5LJ5 d;  4RCC A;  4M75 A;  4M78 F;  1D3B A;  4M7D F;  2QTX A;  4M77 F;  4A53 A;  4XTV A;  5GAO n;  4M7A D;  1N9S A;  4C92 F;  5GAN 6;  4C8Q D;  1WPY A;  4C92 E;  3QHS A;  4M75 B;  5GAN 8;  4PJO A;  1WQW A;  2EJ9 A;  3BFM A;  1B34 A;  4C92 C;  4HT9 A;  4M78 D;  4M7D D;  4JLI A;  2DXU A;  4MML A;  1TH7 A;  2DTO A;  4OP0 A;  4PNO A;  5LJ3 f;  4PJO F;  3RKY A;  4PJO E;  4C92 A;  4PJO B;  1WNL A;  4J5Y A;  3V7R A;  5GAN 3;  1B34 B;  3BW1 A;  4MMK A;  4PJO C;  3JCM c;  5CAI A;  1LJO A;  3QUI A;  4M75 F;  1KQ1 A;  2YLB A;  4XQ3 A;  4M75 E;  2E65 A;  1H64 1;  4XTZ A;  4C92 B;  4QVC A;  5GAN 5;  4M77 D;  4M75 C;  4XTY A;  4EMH A;  5GAN f;  4QVD A;  2EAY A;  3JCM f;  4C92 D;  3AHU A;  4M78 C;  4N0A C;  1U1T A;  5GAN 7;  2E1H A;  3JB9 I;  1JRI A;  4X9D A;  4M7D A;  4M75 G;  5GMK j;  5GAM g;  4M77 E;  3RER A;  4PJO D;  5GAN e;  1Y96 B;  2DJZ A;  4Y91 A;  3FJP A;  5I21 A;  1LNX A;  2RA2 A;  5GAN 4;  1I8F A;  3RES A;  4M7A A;  4PJO G;  2EJG A;  4M77 C;  5GAN g;  4XU1 A;  4M75 D;  4F7U F;  4C8Q E;  4M7D C;  1HXD A;  3JCM Q;  4M7A B;  4C8Q C;  4JUV A;  3JCM h;  5LJ3 e;  2DEQ A;  2EWN A;  4NL2 A;  3SWN C;  4M78 G;  2DZ9 A;  2RM4 A;  2VC8 A;  5GMK h;  5LJ5 h;  5DY9 A;  4M7D B;  3RKX A;  4F7U B;  1LOJ A;  3JCM d;  5GMK m;  1N9R A;  1HK9 A;  1X01 A;  2E10 A;  3L2Z A;  3JCM X;  2Y90 A;  3HFN A;  3RKW A;  4F7U G;  3JCM b;  4M78 E;  2FYK A;  2DVE A;  5LJ3 h;  2DKG A;  4JRI A;  4JRK A;  4NL3 A;  1I5L A;  3V7C A;  2DTI A;  3JCM e;  1I4K 1;  2FB7 A;  3INZ A;  2YHT A;  5GAM f;  4F7U E;  3JCM J;  4X9C A;  2YLC A;  5LJ3 j;  2K57 A;  4EMK C;  1Y96 A;  4M7A G;  4HA8 A;  1BIA A;  3QSU A;  3V8J A;  4EMK B;  5LJ5 f;  5LJ5 j;  2DXT A;  3EFR A;  3V8L A;  3HFO A;  4DQ2 A;  2I2L A;  5GAO l;  3JCM W;  1WQ7 A;  1M5Q 1;  3JB9 H;  2E64 A;  3V8K A;  4EMK A;  4V2S A;  1BIB A;  4XU3 A;  3FB9 A;  3GIB A;  2VXE A;  4XTU A;  4EMG A;  3M4G A;  4M77 A;  5GAO m;  3JCM V;  4J6W A;  3JB9 G;  3PGG A;  5GMK l;  4F7U A;  5GAN j;  1MGQ A;  1YCY A;  2EJF A;  4J6X A;  5GAN d;  5GAO p;  4M78 B;  4J6Y A;  4XTW A;  3V7S A;  4C92 G;  5GAO q;  3JB9 D;  2RD1 A;  3EFS A;  2JN0 A;  4M77 G;  1I81 A;  4M7D G;  4M78 A;  1KQ2 A;  3BY7 A;  4M7D E;  2DZC A;  5GAO r;  2E41 A;  3L1A A;  3SWN A;  4C8Q A;  3SB2 A;  3JCM g;  3QO3 A;  4WF2 A;  3FIF A;  3JB9 F;  4M7A F;  4NOY A;  5GAM d;  4M7A E;  2CGH A;  3RIR A;  3SWN B;  2DTH A;  4C8Q F;  3HSB A;  5GAN h;  5LJ3 g;  4C8Q B;  5GAM j;  4M7A C;  4XTX A;  5LJ5 e;  2RB6 A;  3BDU A;  1JBM A;  5LJ3 d;  3VU3 C;  5GMK i;  2ZGW A;  4C8Q G;  3JB9 J;  1U1S A;  5GMK e;  5GAN 2;  2VXF A;  4XU2 A;  4RCB A;  3RUX A;  5GAM e;  3JCM P;  1M8V A;  5GAM h;  5LJ5 g;  4A54 A;  2HNI A; 
#chains in the Genus database with same CATH topology
 1FXX A;  4J8O A;  2HSP A;  1YJN Q;  1WHJ A;  5I22 A;  3P8H A;  4M7D F;  4X1V A;  4A53 A;  4FYW B;  1VQ8 A;  4RG8 A;  5CR2 A;  1WPY A;  2F1L A;  2DLP A;  3BFM A;  4OB0 B;  2KRS A;  2HBP A;  4M7D D;  5LJ3 f;  1WJS A;  3QII A;  5D6X A;  3CXC A;  3EG3 A;  3M55 A;  1B34 B;  4Y28 E;  3FRN A;  1QKW A;  3CEY A;  4IIM A;  2COY A;  2YXY A;  3HRT A;  4ZN1 A;  1NM7 A;  1W2B S;  1VQK A;  1X75 C;  2W10 A;  3NHN A;  1MUZ A;  3LGL A;  2EVR A;  2RA2 A;  5GAN g;  3MO8 A;  3OSV A;  1JU5 C;  3H0F A;  1M90 U;  4C8Q C;  1YWO A;  3MPU B;  2J05 A;  2KGT A;  4LUE A;  2RNA A;  5GMK m;  1QVG S;  2CP6 A;  1UJY A;  2A08 A;  4KH1 B;  2KXC A;  1Q86 R;  3DB3 A;  1GBQ A;  1VQ9 T;  5I2S A;  2RJC A;  1R8O B;  3I5S A;  4PLI A;  1BIA A;  4LE9 A;  5LJ5 j;  4QT7 A;  1PWT A;  2VGN A;  2V8K A;  3KFV A;  3L2U A;  4BY6 C;  4DBH A;  5GAO m;  2AZV A;  2LVM A;  3EGU A;  4ANJ A;  4M77 G;  1VQP Q;  1K8A R;  5FRM A;  2KT8 A;  4RTY A;  4QQ6 A;  1VQ5 T;  2A0F B;  2DMO A;  3CCR Q;  1X6G A;  1UFF A;  5GJV B;  1VIF A;  3OYD A;  2D9T A;  2DL7 A;  1VQN T;  2DNU A;  3C94 A;  2EGA A;  4FYY B;  1U1S A;  4HCK A;  1ZSZ B;  2F5T X;  2PQW A;  3CBP A;  1YHQ A;  1K73 R;  2BTT A;  2KQW A;  2QQR A;  3THK A;  2PUK B;  2V1Q A;  1Q7Y U;  1ZBJ A;  4C92 F;  3I5R A;  4C8Q D;  1RLQ C;  1BK2 A;  3DLM A;  4PJO A;  3OYL A;  3SFM A;  1BI2 A;  2O4X A;  5IH2 A;  5KYY B;  1VQN A;  2CSI A;  2RQT A;  3UDC A;  5CAI A;  1M1K R;  1BBZ A;  1RAD B;  3PNW C;  2RH2 A;  3LX7 A;  4M77 D;  5L8R E;  5CKD A;  1SRM A;  4M7D A;  2OTJ Q;  3C12 A;  3VS4 A;  5M9O A;  2EQI A;  2C0T A;  3QXE B;  2DRM A;  4EPC A;  4PJO G;  2V26 A;  1XNI A;  2QK0 A;  4BB7 A;  3M59 A;  1ACM B;  1T3L A;  5FLX E;  4ME7 A;  1X6B A;  1D09 B;  1M2V B;  3UAT A;  1YJN A;  1K9M R;  4OB2 B;  3OYJ A;  4E7Z A;  4AMC A;  2YUQ A;  1NYG A;  2QQ9 A;  1WLP B;  3M56 A;  4OML A;  2YUN A;  3A8M B;  4BDZ A;  1O9S A;  4JRQ A;  2DIL A;  3OS5 A;  4X9C A;  2YUP A;  1UTI A;  1WXB A;  3QYG B;  2R5A A;  3E19 A;  2SRC A;  2RI2 A;  3M9Q A;  3VRY A;  4AFQ C;  1WZO A;  3EHQ A;  3JB9 H;  2E64 A;  5KYX A;  1ZUK A;  3OYF A;  5FU6 C;  3G6E A;  4EMG A;  2CRE A;  1VQM A;  1RAG B;  2EBP A;  4OMQ A;  4J6W A;  2L5Q A;  4TVR A;  4D6W A;  3VUZ A;  2KK4 A;  1YWP A;  1XJW B;  5GAO p;  2LQW A;  3EFO A;  1KD1 R;  2RD1 A;  4PK4 A;  3CCM A;  4M7A F;  2X4X A;  4BAC A;  2RB6 A;  3G1J A;  2OI3 A;  1KIK A;  2JS0 A;  4RCB A;  1U3O A;  1KG1 A;  1IHV A;  2LP5 A;  4M75 A;  1WHL A;  2XID A;  4Z89 A;  1PD1 A;  1VQL Q;  4C92 E;  2EJ9 A;  1E7O A;  2ROT A;  4PNO A;  2YSQ A;  1WNL A;  4C5E A;  2CT3 A;  2EYQ A;  1IRE B;  1YHQ T;  1X6O A;  2BZY A;  4C0D C;  3OYC A;  2MK5 A;  1OI1 A;  1MMD A;  1Y96 B;  4R56 A;  2KRO A;  1I8F A;  4IIO A;  1UHF A;  1QCF A;  2PTK A;  1K4U S;  2CDT A;  1Y0M A;  2DEQ A;  4IUU A;  1SRL A;  3ZBD A;  2QEX Q;  3HL8 A;  3JCM X;  2RK2 A;  4BE0 A;  1U8R A;  2RQU A;  3VYH B;  4LD9 K;  1SEM A;  3HPW A;  2YHT A;  5D6Y A;  2QDL A;  3OYY A;  4C0G A;  3CMA T;  2EYW A;  3GPL A;  3OMG A;  1VQO T;  3CCQ Q;  3C0C A;  3RMS A;  2DYB A;  4QVZ A;  1M90 C;  4XU3 A;  3FB9 A;  3GIB A;  2NUT A;  4M77 A;  3JSC A;  3CCQ A;  2QG9 B;  2XK0 A;  2FG0 A;  1TOV A;  2X4W A;  2RJF A;  4XTW A;  3CCE A;  5CKE A;  2JN0 A;  2WSF E;  2KYM A;  3CCJ Q;  1KQ2 A;  3L1A A;  3JB9 F;  3H9N A;  4LXC A;  4M7A E;  2DTH A;  3EG0 A;  1KQS P;  3QPH A;  2RJD A;  4XU2 A;  2K79 A;  5LJ5 g;  2AKK A;  3CCM Q;  4QQD A;  4HT8 A;  2KSS A;  3M54 A;  1Q86 C;  4M78 F;  1N9S A;  1W4S A;  3CD6 Q;  2KXD A;  1RUW A;  4YTL A;  4ELY C;  1RAI B;  1VOM A;  1PG5 B;  3OS2 A;  1JJ2 A;  2GF7 A;  1GL5 A;  2KR3 A;  1XTD A;  2DER A;  1Z9Z A;  3HRS A;  2DF6 A;  1EZZ B;  2J7I A;  2ED0 A;  4KUI A;  1VUB A;  2HAX A;  2COZ A;  3L2Q A;  4E7I A;  1IZ6 A;  1SF9 A;  2RI5 A;  1NJI C;  4HVV A;  4A4F A;  3GP8 A;  4J9I A;  3RER A;  1N8R U;  1R77 A;  1VQM Q;  2M02 A;  2L8D A;  5FRN A;  3FJ5 A;  1Y57 A;  3QJ6 A;  3VUB A;  4FU6 A;  2ZPG B;  3RKX A;  4F7U B;  1QVF A;  2Y90 A;  4IUR A;  2EW3 A;  3KUF A;  1JJ2 S;  4JRI A;  1K73 C;  3X25 B;  3INZ A;  1NYF A;  5LJ3 j;  1OQK A;  1GBR A;  2L3P A;  2OAU A;  5L23 A;  1M8M A;  2FRY A;  4EMK A;  4DEY A;  1VQ9 Q;  4MZP A;  2ZZD A;  3CCL T;  2JTM A;  1S72 T;  2HD0 A;  2E12 A;  1GCQ C;  5KYU A;  1MMN A;  2XG8 D;  3REA B;  4FYV B;  2CT4 A;  3CCM T;  4E2F B;  1K9M C;  4Q5W A;  2DL5 A;  3CCS T;  2JXB A;  3FDR A;  1IB8 A;  2G3R A;  5GAN h;  3VU3 C;  4C8Q G;  2ECZ A;  1X43 A;  2FPF A;  3OSS C;  2P0K A;  1I1J A;  2KDS A;  1OYX A;  1SHG A;  1Y07 A;  2K7A A;  2K3B A;  3VS5 A;  1YBY A;  3OW2 A;  4RKU E;  1IGU A;  3HKS A;  4IUT A;  3CCE T;  3VS3 A;  1TH7 A;  2OTL A;  2J6F A;  2NLU A;  1NLP C;  2QA4 A;  3U23 A;  2E65 A;  4KH0 B;  1HYO A;  3CCR A;  2L0A A;  2LCS A;  2YDL A;  4M75 C;  2CZ1 B;  3JV3 A;  4CRI A;  2XIC A;  1U1T A;  3JB9 I;  4BI3 A;  1G2B A;  2K3Y A;  5GAN 4;  4QW2 A;  1TWB A;  4DA4 A;  4M77 C;  2PVG B;  3NGP A;  3E9G A;  2DK3 A;  1NZ9 A;  4OMM A;  4LDX A;  2YUO A;  3LGF A;  1KD1 U;  2PZ1 A;  2CP0 A;  3PVQ A;  2PNI A;  5CO7 A;  1I4K 1;  2OTJ T;  1I07 A;  2KI7 A;  2YLC A;  2ED1 A;  4CC4 B;  3VYG A;  3RNJ A;  2QQS A;  3V8L A;  2I2L A;  1WJQ A;  3OYN A;  3I56 T;  4DOV A;  1IXD A;  4Z8A A;  3I56 A;  2LTO A;  3G4S A;  1ARK A;  3J7A F;  3GF5 A;  1TSF A;  5FW9 A;  3JCM V;  2DD4 A;  4FCY A;  1MND A;  2GQV A;  5GAN j;  1MHN A;  4C0D B;  3JAM E;  2COW A;  2ZPF B;  2GFA A;  1KHC A;  2RHX A;  4BI8 B;  4C92 G;  1W2B A;  2DIQ A;  2LJ1 A;  1PD0 A;  4J9E A;  5IHK A;  4NS5 A;  1BCM A;  3I55 A;  4FM4 B;  1RAE B;  3QZ9 B;  1ZA2 B;  4JLG A;  1UGP B;  2CZ0 B;  1UJ0 A;  2F2X A;  2D0Q B;  2Z0W A;  2C06 A;  3BDU A;  3UA6 A;  1VQ4 T;  3RMQ A;  2DEU A;  3RUX A;  3L2V A;  1M30 A;  3TSZ A;  2KY9 A;  3ME9 A;  4XU0 A;  4F14 A;  2K9G A;  3MKD A;  1YJ9 T;  1W1F A;  2JMC A;  3QKJ A;  4L6V 5;  2M0O A;  4JLI A;  4RTU A;  4KGX B;  2DRK A;  2GQI A;  2DBK A;  2JM9 A;  1NLO C;  1AD5 A;  3UT1 A;  1K9M U;  2K5I A;  2K5L A;  2X4Y A;  2JS2 A;  3CC4 Q;  4N0A C;  2HQE A;  1U06 A;  1DJ7 B;  4Y91 A;  3G4S Q;  3FJP A;  1BCO A;  2JM8 A;  1VYV A;  1EIF A;  4FIB A;  4M7A A;  3OS1 A;  2EJG A;  2MAM A;  4C8Q E;  2DPP B;  2KMT A;  3CME A;  3CCS Q;  1M3B A;  3JCM h;  2EWN A;  4NL2 A;  3L42 A;  2VC8 A;  5GMK h;  2CKK A;  1AZG B;  2CH4 A;  2EKH A;  2LT1 A;  1WI7 A;  3P8B B;  1WHG A;  1R0B G;  1M2O A;  1JO8 A;  4E7L A;  1GFD A;  1S72 Q;  1X27 A;  4B9X A;  5A0G A;  5GAM f;  4M7A G;  3M58 A;  1JB0 E;  3MEV A;  3CCL A;  2FO0 A;  2J6K A;  1OPL A;  5IT9 E;  2RK1 A;  4GLM A;  2JW4 A;  2C0I A;  1YIJ Q;  1UDL A;  2DXB A;  3MEW A;  4LDV A;  4B6M A;  2DBM A;  2CP3 A;  5D6W A;  3M4G A;  1QQJ A;  2FL7 A;  2VUB A;  3PMT A;  1K0S A;  4J7F A;  1UGV A;  1YCY A;  3QBY A;  1J3T A;  1KD1 C;  4M7D G;  3CCJ T;  2DZC A;  4J9C A;  4C8Q A;  3CPF A;  4NOY A;  3RIR A;  3SWN B;  3LH0 A;  3HSB A;  2Y4X A;  4XTX A;  2O31 A;  2WSE E;  4A54 A;  1ZLM A;  2HNI A;  2JUF A;  2FHD A;  2P4T A;  5HKC A;  3CXC P;  4RCC A;  5A0D A;  1ZUY A;  2O9S A;  3KXT A;  4ZTJ A;  2QAS A;  1OX9 A;  3CBM A;  3PE0 A;  5GAO n;  2HBW A;  3CC4 A;  3QWY A;  1WQW A;  3NTK A;  1S1N A;  4KGZ B;  2QAZ A;  1IHW A;  3X26 B;  4PJO F;  2LCL A;  2FRW A;  4J5Y A;  5GAN 3;  3S3M A;  4M4Z A;  1RLP C;  1JXM A;  3OW2 S;  3E2U A;  1SHF A;  1WJR A;  2EAY A;  2OJ2 A;  2ESW A;  2E1H A;  1FWZ A;  2EFI A;  4M75 G;  5GMK j;  4OMN A;  1UB4 A;  3G71 A;  1VQ9 A;  5GAN e;  5GJW B;  2ZPB B;  3M53 A;  1GCP A;  2VV5 A;  4XU1 A;  4DBR A;  1HXD A;  2JZ2 A;  4MZT A;  4E47 A;  3SWN C;  2O4X B;  3H0I A;  4CC3 A;  1LOJ A;  2MPX C;  3LWH A;  2X9H A;  3VKI A;  4J83 A;  1MV0 B;  2E70 A;  2FZC B;  4PLL A;  4Z88 A;  1NJI U;  5CK9 A;  1G3S A;  4CI0 C;  2NUP B;  4IUQ A;  3OBW A;  3H8Z A;  2K57 A;  1VQK T;  3CCV A;  1VQ6 Q;  2OAW A;  3AT1 B;  3CCQ T;  2F69 A;  4DQ2 A;  5ECA A;  3CCU T;  5IXF A;  3M5A A;  3SDZ A;  1RL2 A;  2YT6 A;  1M90 R;  2KAF A;  3A8G B;  2EQJ A;  2BIV A;  3A8O B;  5C0M A;  1K0X A;  3M0P A;  1GXI E;  3PFS A;  3MP1 A;  3CC7 A;  3JB9 D;  2H3E B;  1BKB A;  3M0Q A;  3RBB B;  1YJ9 Q;  4JZ4 A;  2GGR A;  4PJM A;  2DD5 A;  3CMA Q;  2HMA A;  1MMG A;  4F16 A;  4PKC C;  5LJ3 g;  3HRU A;  5GAM j;  2CZ7 B;  2VXF A;  4LD6 A;  1M8V A;  1D1B A;  2CP2 A;  3O8V A;  1FMW A;  1QVF P;  4M77 B;  3OS0 A;  1G5V A;  4IUV A;  2RQW A;  4MZM A;  2QTX A;  2ZPH B;  2E5Q A;  1VQ4 A;  4N4I A;  4E7H A;  2L3S A;  2DM1 A;  1PNJ A;  4X34 A;  1WHH A;  4C5H A;  1N27 A;  1OU8 A;  2NUZ A;  1OEB A;  2EQM A;  4A4K A;  3X20 B;  4PJO E;  4LNP A;  1VA7 A;  3WVD B;  2KVQ G;  1X2K A;  2RMO A;  5FWB A;  1LJO A;  3QUI A;  4E7S A;  2OTL Q;  2K2V A;  1YI2 T;  2PVD B;  4RTX A;  2LJ3 A;  3H6Z A;  4N4H A;  2AIR B;  3NPF A;  4MDW A;  2DJZ A;  2DYI A;  4BUG A;  5I21 A;  1RAF B;  2OX7 A;  3FEO A;  3S3O A;  4M75 D;  7AT1 B;  5J39 A;  3Q1J A;  5KYX B;  4MDX A;  2BE9 B;  4JUV A;  1RAA B;  2KEA A;  3TSW A;  1UEC A;  1XQH A;  5IXB A;  1KHI A;  1VIE A;  1X01 A;  3I35 A;  2P0Q A;  4F7U G;  4OB1 B;  3V7C A;  4LUD A;  4HXJ A;  3CQT A;  1H3H A;  1QVG A;  1WHK A;  2DX1 A;  5LJ5 f;  1VYU A;  2K2M A;  1OUL A;  2MWP A;  2K4Y A;  3SEM A;  2CSQ A;  1M5Q 1;  4K11 A;  2JT4 A;  1RI9 A;  4AFS C;  2IVW A;  4FSX A;  1Q82 U;  1YJW T;  1G3T A;  4ATO A;  1PRL C;  3QDF A;  4OMO A;  4F7U A;  1YIT A;  5GAO q;  3EFS A;  2QA4 T;  4OF1 A;  4M78 A;  1K8A C;  3CCU A;  3J80 E;  4F04 B;  3CPW P;  2ATC B;  2O01 E;  2AKL A;  3SWN A;  2OTL T;  2PU9 B;  4FYX B;  4LDY A;  2HCK A;  3DB4 A;  3PIP A;  5KCO A;  1C6V X;  4C8Q B;  2AHJ B;  3O5Z A;  2XKO C;  1KQS S;  3JB9 G;  4ZNX A;  4R0K A;  3FLG A;  2XDP A;  3EG9 B;  3F70 A;  1C1A A;  2X51 A;  1YI2 Q;  2ABL A;  3MEU A;  2CP7 A;  3M0T A;  2LZ6 B;  4M75 B;  4J9B A;  3MHX A;  2H8H A;  4MML A;  2XDD A;  1ABO A;  1WDX A;  4A63 B;  1YP5 A;  3HHT B;  1Q81 R;  3QZ5 B;  4R55 A;  1HJD A;  3AHU A;  3A98 A;  3FC3 A;  3EG9 A;  2ROL A;  2DAQ A;  4O5V A;  3REB B;  4C92 D;  4M78 C;  2CS7 A;  4E6R A;  3CD6 A;  1AHJ B;  2RHI A;  3I9Q A;  3D7S B;  2EQK A;  5KCH A;  2EGE A;  4AFU C;  3E9F A;  3RES A;  2W0Z A;  4M7A B;  1YI2 A;  2CUD A;  4RG2 A;  1VQ8 Q;  3CCU Q;  2DZ9 A;  3A1P A;  1VQ5 A;  1UGQ B;  5AYF A;  3CC2 Q;  2NUT B;  5DLQ E;  3GOX A;  1D0Y A;  2HKN A;  4EMK B;  4AG2 C;  2CUB A;  1Q7Y R;  1Q95 G;  2FZK B;  1JJ2 P;  3G71 Q;  1M2V A;  1PKT A;  1SSH A;  2A7Y A;  2R57 A;  1NJI R;  2RQV A;  4J6Y A;  4ZGD B;  1YIJ T;  1N8R C;  4D8K A;  1P92 A;  1I0C A;  4JS4 A;  1BI3 A;  3N5B B;  4RTZ A;  4RUG A;  5LJ5 e;  1Q86 U;  2FZG B;  3QG1 A;  2D1X A;  2DJQ A;  5GAN 2;  4OGC A;  2DFU A;  3OYM A;  5J3B A;  1V76 A;  3EG1 A;  3EHR A;  1AVZ C;  1UHC A;  1VQO Q;  1ZSZ A;  4M7A D;  1EFN A;  3CME T;  2LNV A;  3QHS A;  2Y4Y A;  1G8X A;  2QTV A;  2DXU A;  4OP0 A;  1AWX A;  2DET A;  3QJY A;  2J06 A;  4C92 A;  2ZPI B;  1BI0 A;  2HDA A;  1VQP A;  2V8I A;  4C5I A;  4HVW A;  4M75 E;  2BE7 D;  4C92 B;  3ULR B;  4LN2 A;  4ORZ A;  4HCC A;  3OB9 A;  1NE8 A;  3JCM f;  3ZEH A;  1CKA A;  1VQ8 T;  1JRI A;  2R5M A;  1YIJ A;  1IO6 A;  1GCQ A;  1RI0 A;  5FU6 B;  1YCS B;  2O9V A;  5D7U A;  3WVE B;  3P8D A;  4JJB A;  4JS5 A;  1YJ9 A;  2BZ8 A;  2O88 A;  1M27 C;  5DY9 A;  4BE1 A;  2D8J A;  4L59 A;  3JCM d;  3VRZ A;  2X3W D;  3RKW A;  3EFO B;  2XI9 A;  1Q82 C;  2GCX A;  4JJD A;  3A8H B;  2MCN A;  2EIF A;  3V8J A;  1W70 A;  4ZTF A;  1MMA A;  4J9F A;  4AT1 B;  1M1G A;  2KRN A;  1K8A U;  5IAY A;  2KT1 A;  1ZBX A;  2LX7 A;  1AT1 B;  2VXE A;  5A2Q E;  4JPB W;  4Z02 A;  2VB6 A;  3OYB A;  1UGS B;  4CC2 A;  2NWM A;  5CIU A;  4QKU A;  1NBE B;  2K5F A;  2EYX A;  1I81 A;  2HQH A;  1MNE A;  1WA7 A;  2JJ9 A;  2M51 A;  4EDU A;  4FW2 A;  3MCA B;  1VQ7 Q;  4KBM B;  3QO3 A;  4KT0 E;  3FIF A;  3L2W A;  4PFZ A;  2KNB B;  2CH4 W;  2ENM A;  4PFO A;  5KE2 A;  1VQ6 T;  4C8Q F;  2MI6 A;  1AWJ A;  2LRQ A;  1LPL A;  2HKQ B;  3EG2 A;  1JBM A;  3LLR A;  2EPD A;  4LDW A;  5KYU B;  1QMC A;  2E3I A;  2VVK A;  2P84 A;  2GFU A;  4JZ3 A;  2QXF A;  1W2B P;  2JOY A;  4B9W A;  4M77 F;  5KH6 A;  4XAX B;  1WHM A;  5GAN 6;  3TVT A;  1E6G A;  2FPE A;  5HY6 A;  3HP9 A;  2FEI A;  4HT9 A;  1LVK A;  3DKM A;  4PJO C;  2WAC A;  1UE9 A;  1M1K C;  2P4R A;  1KFZ A;  1UUE A;  5GAN f;  5CKF A;  3EH2 A;  4ZGJ B;  1SG5 A;  1LNX A;  4BY6 B;  1B3Q A;  1K9A A;  1TUG B;  4IUP A;  3URG A;  1YJW A;  1M1F A;  5LJ3 e;  5FRO A;  4BDY A;  2MOX A;  2QGG A;  2DL8 A;  1HK9 A;  4ELZ C;  2GBQ A;  1Q81 C;  1KSW A;  3G7Z A;  3CME Q;  4EMK C;  2BUD A;  3EFR A;  5GAO l;  3MJX A;  1UG1 A;  1Y7X A;  3EH1 A;  5KYW B;  1M9S A;  1VQ4 Q;  4XTU A;  3OYK A;  5HCK A;  1OZ3 A;  4PJJ A;  4UC4 A;  3EGD A;  1OZ2 A;  1YNZ A;  4P5N A;  1FX7 A;  1QP3 A;  2M0Y A;  3ER0 A;  1W6X A;  4BI4 A;  2MYS A;  5GAM d;  1M1K U;  2BKD N;  1D0X A;  3X24 B;  2IPO B;  4F17 A;  1QP2 A;  2QDY B;  3VS6 A;  2KBT A;  2ZGW A;  3G4S T;  3CC7 Q;  5GAM e;  5GAM h;  3CD6 T;  2HL5 C;  1PC0 A;  4N0A A;  5LJ5 d;  1Z9Q A;  2MMP A;  2CZ6 B;  3NMZ C;  1D3B A;  4FL6 A;  9ATC B;  5IN1 A;  1PM3 A;  3VV0 A;  3LW5 E;  2E3H A;  1PRM C;  2RJE A;  2K3X A;  1KQ1 A;  2X4J A;  4XQ3 A;  1YFN A;  2KRM A;  1GFC A;  4X9D A;  5IHI A;  3PMI A;  4J9G A;  5C6S A;  2DO3 A;  1KC8 R;  1N6A A;  3J81 E;  3LH5 A;  5KYN A;  1UGR B;  4FW1 A;  2LMJ A;  2E6Z A;  2K6D A;  1GRI A;  4A4E A;  3OYI A;  3CC2 A;  3JCM Q;  5EG2 A;  3CCR T;  1FYN A;  1QW1 A;  2HQX A;  3JRZ A;  5CCA A;  1MV3 A;  1QWE A;  5LJ5 h;  4QQG A;  1AWO A;  1D1A A;  2AT1 B;  1T0H A;  3OMC A;  3JCM b;  1VQ7 A;  2G6F X;  2CP5 A;  4OB3 B;  4C5G A;  3JCM e;  1TU0 B;  1SPK A;  4GLK A;  1ZSG A;  2M9U A;  1H3Z A;  1SSF A;  4RMO A;  3JCM J;  4DBQ A;  2EQU A;  4DEX A;  1ZHI A;  1M3C A;  1Q82 R;  1WQ7 A;  4HCB A;  1TXQ A;  4XK8 E;  4KRT A;  1BIB A;  4V2S A;  5FU7 C;  2ZAE A;  1BB9 A;  4FT2 A;  4J6X A;  5GAN d;  3VS2 A;  2RHZ A;  3G71 T;  3I56 Q;  2JNG A;  1Y71 A;  4J9D A;  2FVU A;  3EGX A;  3IQL A;  1YHQ Q;  4M7D E;  3DLL A;  3GNG A;  3M0U A;  2M1H A;  4PJN A;  2YRV A;  4C0F A;  5KYW A;  3OW2 P;  2F5K A;  2SEM A;  2XU8 A;  1V29 B;  3CBO A;  5DLO A;  1K73 U;  3QDR B;  1ZSZ C;  2L89 A;  3C4S A;  2A37 A;  4CC7 A;  2RN8 A;  2QI2 A;  3UA7 A;  4J7I A;  4C0Z A;  1BU1 A;  1B34 A;  1H8K A;  1WXU A;  2LCC A;  2JTE A;  2I0N A;  1PCX A;  4ZN3 A;  2VYT A;  4MMK A;  4BD3 A;  3VS0 A;  3CCE Q;  3T9N A;  4M75 F;  3SHW A;  5GAN 5;  3M0R A;  4XTZ A;  4QVC A;  4KGV B;  4L5G A;  2QQB A;  4EMH A;  4QVD A;  2RHY A;  5GAN 7;  2MF2 A;  4M77 E;  1PKS A;  2AK5 A;  3OBY A;  2A36 A;  2L3R A;  2EGC A;  1ZQ1 A;  3R6O A;  2P0P A;  2RI3 A;  4E7K A;  2HL3 A;  1U5S A;  4BE2 A;  3M4Y A;  1VQL T;  3MET A;  3L2Z A;  5CQX A;  4Y92 A;  3HFN A;  1FMV A;  1ZA1 B;  2DVE A;  1NPP A;  1I5L A;  2D0N A;  1EX4 A;  2PUO B;  1JQQ A;  2LX9 A;  2FPD A;  1VQ5 Q;  2B86 A;  2ZPE B;  3X28 B;  3JCM W;  2CYZ B;  5AT1 B;  3OYG A;  1QVP A;  5I2M A;  1D0Z A;  2M16 A;  2KYB A;  2DVJ A;  4D8D A;  2X35 A;  1IRX A;  1I5O B;  5GMK l;  3M57 A;  2XMF A;  4OMP A;  4KUD K;  2JTF A;  2HSE B;  2R58 A;  1QVF S;  3EGD B;  2O2O A;  3BDL A;  3ZL7 C;  2E41 A;  4A4H A;  1VQL A;  1M4Z A;  1T0J A;  2D6F A;  5LJ3 d;  3UWN A;  2DIG A;  2VGM A;  1VQ6 A;  4M7D C;  1JXO A;  3CMA A;  3KBG A;  1YJN T;  1WFW A;  1RAC B;  1YIT Q;  1OV3 A;  3RKY A;  2E6N A;  2RQR A;  2RHU A;  1JEG A;  3UF4 A;  2YLB A;  3S6W A;  3CPW A;  3I55 T;  6AT1 B;  2QA4 Q;  1QWF A;  3WXM B;  5GAM g;  4PJO D;  4VUB A;  4HCZ A;  1RAB B;  2GNC A;  3GLX A;  3CCJ A;  2RM4 A;  2QGF B;  1G83 A;  4GY5 A;  4M7D B;  1N9R A;  5HK0 A;  2E10 A;  2VWF A;  1C0M A;  2A28 A;  1WGS A;  1E6H A;  2DKG A;  4NL3 A;  1ZX6 A;  2X3X D;  2FB7 A;  4HVU A;  4WCI A;  2D8H A;  1X69 A;  1Y96 A;  3L2R A;  3OA6 A;  3LWI A;  3HFO A;  2EKO A;  1RAH B;  3M0S A;  2LQN A;  2MIO A;  5CKB A;  2JVV A;  4II1 A;  3E1S A;  4OMF B;  1KC8 C;  1VQP T;  2XDB A;  1B7T A;  3RDV A;  4AFZ C;  2DA9 A;  1KQS A;  3PGG A;  2RO0 A;  3OYH A;  1MGQ A;  3BE3 A;  2DE0 X;  2HZY A;  1NEG A;  1VQ7 T;  3BY7 A;  1R0C B;  1BI1 A;  3PT9 A;  4A4G A;  4OVA A;  3JCM g;  3TQ7 P;  4WF2 A;  3TEE A;  2CGH A;  1VQM T;  3G6E T;  3ZFJ A;  1WIE A;  3VS1 A;  1YIT T;  5HK3 A;  3CC2 T;  5GMK e;  2LC4 A;  4IKF A;  1D3B B;  1K76 A;  3H0H A;  2L3Q A;  1PSF A;  1ABQ A;  1QVG P;  4XTV A;  4RTW A;  3NTH A;  4OGE A;  5CVI A;  1AEY A;  1HSQ A;  2DL4 A;  5KYY A;  1ZUU A;  5LL6 S;  1XOV A;  4AG1 C;  1Q7Y C;  4PJO B;  1CSK A;  2B8A A;  2L2P A;  5J26 A;  3V7R A;  1SKU B;  4J9H A;  3JCM c;  3CCS A;  1PHT A;  1WX6 A;  1H64 1;  3MEA A;  1G3Y A;  4XTY A;  1OX8 A;  2E5K A;  3LYI A;  5IHN A;  5A0L A;  1X2Q A;  2H3J A;  1TUD A;  2QQA A;  3NTI A;  1N8R R;  1OU9 A;  3PVL A;  1S72 A;  1K1Z A;  3EAE A;  4F7U F;  3RR6 A;  2KE9 A;  3ASK A;  2YRD A;  1D1C A;  1TS9 A;  2RPN A;  4EIK A;  1M3A A;  1VYT A;  2QYZ A;  1Q81 U;  1BYM A;  2V8J A;  1PSE A;  3QYH B;  4M78 E;  4JRK A;  3TRE A;  1WXT A;  3QWX X;  4DBF A;  3OYE A;  2A3L A;  4DOW A;  4F7U E;  1TTH B;  2ZCF B;  5FU7 B;  1TUC A;  2EYY A;  1QKX A;  2DXT A;  1WYX A;  4ESR A;  3PIO A;  1N5Z A;  2LQK A;  2DL3 A;  2NYS A;  1QLY A;  1VQK Q;  2LT4 A;  2OTJ A;  3TCJ A;  2DXC A;  1O75 A;  2GTJ A;  4ZGE B;  4JDS A;  1QCN A;  1HD3 A;  4PFP A;  3G6E Q;  2HEQ A;  5CQY A;  3S3N A;  4M78 B;  3V7S A;  2VAS A;  4RTT A;  2XHC A;  8ATC B;  3OY9 A;  1KJW A;  4PJL A;  2RF0 A;  1TG0 A;  1H92 A;  3CC7 T;  3HTR A;  2E4H A;  3JB9 J;  3JCM P;  2J6O A;  2LNH B;  3TU4 K;  1B07 A;  1OPK A;  4KUL A;  4JJC A;  2JMA A;  3MP8 A;  2AZS A;  2QEX A;  1KC8 U;  3I55 Q;  1NEB A;  3UPU A;  2LJ0 A;  4FT4 A;  2GTO A;  3C95 A;  1IGQ A;  5GAN 8;  2V1R A;  4E7J A;  3CCV T;  4C92 C;  4M78 D;  1AZE A;  2DTO A;  2YWW A;  5CKH A;  1LCK A;  2LDM A;  3GNF B;  3A8L B;  3BW1 A;  2WSC E;  2XD0 A;  2IIM A;  1A0N B;  3MP6 A;  4HKE A;  2PVO B;  3R6N A;  1QCO A;  3VS7 A;  1F1B B;  1VQN Q;  3H41 A;  1UEB A;  4PL6 A;  8AT1 B;  3OYA A;  1G3W A;  2F2W A;  1NG2 A;  4GBQ A;  4M78 G;  2QEX T;  1VQO A;  3CPW S;  2YRC A;  3GBQ A;  1KK7 A;  5I11 A;  4RTV A;  3CXC S;  1V1C A;  2FYK A;  5LJ3 h;  2NUP A;  3OQ5 A;  2DTI A;  2LQ8 A;  3NFC A;  4N4G A;  1YJW Q;  4HA8 A;  1YN8 A;  3QSU A;  5KE3 A;  3CC4 T;  1T3S A;  3PTA A;  2MWO A;  3V8K A;  5DM7 R;  3SD4 A;  2EYZ A;  2VKN A;  1FMK A;  1AOJ A;  1NPR A;  1OOT A;  4O6J A;  3CCV Q;  2EJF A;  3CCL Q;  3VJP A;  4JRP A;  4LDU A;  2C0O A;  3EGX B;  2BZX A;  4FSS A;  2F2V A;  5GAO r;  4WTO B;  2IG0 A;  1AWW A;  3SB2 A;  3A5Z B;  1CKB A;  5EC7 A;  4JJN K;  4M7A C;  5GMK i;  5FWC A; 
#chains in the Genus database with same CATH homology
 1FXX A;  1K73 U;  3QDR B;  3FLG A;  2XDP A;  3F70 A;  4J8O A;  3OSS C;  2L89 A;  2P0K A;  2KDS A;  1OYX A;  3C4S A;  3P8H A;  4M7D F;  1Y07 A;  4A53 A;  3MEU A;  1VQ8 A;  2QI2 A;  4RG8 A;  5CR2 A;  3OW2 A;  1YBY A;  1WPY A;  4IUT A;  3HKS A;  4M75 B;  4J7I A;  4RKU E;  3CCE T;  3MHX A;  3BFM A;  4C0Z A;  1B34 A;  4OB0 B;  2HBP A;  4M7D D;  4MML A;  1TH7 A;  5LJ3 f;  1WJS A;  3QII A;  2LCC A;  5D6X A;  2XDD A;  2OTL A;  2NLU A;  3CXC A;  3M55 A;  2VYT A;  1B34 B;  3HHT B;  4MMK A;  4Y28 E;  3QZ5 B;  4BD3 A;  3FRN A;  4ZN3 A;  4R55 A;  3T9N A;  4M75 F;  3AHU A;  3FC3 A;  5GAN 5;  4XTZ A;  3CEY A;  2E65 A;  4QVC A;  2QA4 A;  3HRT A;  4ZN1 A;  3CCR A;  4L5G A;  4M75 C;  2QQB A;  2CZ1 B;  4EMH A;  2DAQ A;  4O5V A;  4C92 D;  4CRI A;  4QVD A;  2XIC A;  2RHY A;  4M78 C;  1U1T A;  2CS7 A;  5GAN 7;  3JB9 I;  1W2B S;  3CD6 A;  1AHJ B;  2RHI A;  2MF2 A;  1VQK A;  4BI3 A;  2EQK A;  4M77 E;  1X75 C;  3OBY A;  2K3Y A;  2L3R A;  3LGL A;  1ZQ1 A;  5KCH A;  3R6O A;  2RA2 A;  5GAN 4;  2P0P A;  3E9F A;  3RES A;  4QW2 A;  4DA4 A;  2RI3 A;  4E7K A;  4M77 C;  5GAN g;  2PVG B;  3E9G A;  2DK3 A;  3MO8 A;  4BE2 A;  3OSV A;  1M90 U;  3M4Y A;  1NZ9 A;  4M7A B;  4C8Q C;  3CCM A;  1YI2 A;  4RG2 A;  1VQL T;  2DZ9 A;  3MET A;  4LDX A;  3LGF A;  1KD1 U;  5GMK m;  1QVG S;  1VQ5 A;  1UGQ B;  3L2Z A;  5CQX A;  5AYF A;  3HFN A;  2DVE A;  1NPP A;  3DB3 A;  5DLQ E;  5CO7 A;  1I5L A;  1I4K 1;  2PUO B;  2OTJ T;  2LX9 A;  3GOX A;  1VQ9 T;  5I2S A;  2YLC A;  2RJC A;  1R8O B;  4PLI A;  1BIA A;  3VYG A;  5LJ5 j;  4EMK B;  2QQS A;  2ZPE B;  3V8L A;  3X28 B;  3JCM W;  2I2L A;  2VGN A;  1WJQ A;  2CYZ B;  3OYN A;  2V8K A;  3I56 T;  4DOV A;  3OYG A;  3I56 A;  3G4S A;  1QVP A;  2LTO A;  5I2M A;  3J7A F;  3L2U A;  3GF5 A;  4BY6 C;  2M16 A;  5GAO m;  3JCM V;  2DD4 A;  2X35 A;  5GMK l;  3M57 A;  2GQV A;  5GAN j;  1MHN A;  4C0D B;  3JAM E;  2A7Y A;  2R57 A;  2ZPF B;  4KUD K;  2GFA A;  1KHC A;  2JTF A;  2RHX A;  4J6Y A;  4BI8 B;  4C92 G;  4ZGD B;  2LVM A;  1YIJ T;  1W2B A;  2DIQ A;  1N8R C;  4M77 G;  1P92 A;  2R58 A;  5FRM A;  1QVF S;  3BDL A;  4QQ6 A;  2E41 A;  4NS5 A;  3I55 A;  4FM4 B;  1BI3 A;  4JS4 A;  3QZ9 B;  3N5B B;  4JLG A;  1UGP B;  4A4H A;  1VQ5 T;  2CZ0 B;  2D0Q B;  1VQL A;  1M4Z A;  1VIF A;  2C06 A;  3OYD A;  2D6F A;  5LJ5 e;  2D9T A;  3BDU A;  5LJ3 d;  1Q86 U;  1VQ4 T;  3UWN A;  3C94 A;  1VQN T;  3QG1 A;  3RMQ A;  1U1S A;  5GAN 2;  3RUX A;  3L2V A;  2DIG A;  2VGM A;  4OGC A;  1VQ6 A;  4M7D C;  3OYM A;  2F5T X;  2PQW A;  3CBP A;  2KY9 A;  3ME9 A;  3KBG A;  4XU0 A;  5J3B A;  3CMA A;  1YHQ A;  2KQW A;  2QQR A;  1YJN T;  1YJ9 T;  2PUK B;  4M7A D;  1Q7Y U;  3QKJ A;  4C92 F;  3CME T;  2LNV A;  4C8Q D;  3QHS A;  4PJO A;  3DLM A;  2Y4Y A;  3OYL A;  4L6V 5;  2M0O A;  3SFM A;  4JLI A;  2DXU A;  4OP0 A;  1BI2 A;  2E6N A;  2O4X A;  3RKY A;  1VQN A;  3QJY A;  4C92 A;  2ZPI B;  2RHU A;  1BI0 A;  3UT1 A;  1VQP A;  1K9M U;  2V8I A;  3UDC A;  4C5I A;  2K5I A;  5CAI A;  2YLB A;  3S6W A;  4M75 E;  2K5L A;  3PNW C;  4C92 B;  3CPW A;  2RH2 A;  3LX7 A;  4M77 D;  5L8R E;  4HCC A;  5CKD A;  3I55 T;  2X4Y A;  1NE8 A;  3OB9 A;  3JCM f;  3ZEH A;  4N0A C;  1VQ8 T;  1JRI A;  2R5M A;  4M7D A;  3C12 A;  2HQE A;  3WXM B;  5GAM g;  5M9O A;  1YIJ A;  4PJO D;  1DJ7 B;  3QXE B;  4Y91 A;  3FJP A;  4EPC A;  1RI0 A;  1EIF A;  5FU6 B;  4FIB A;  4PJO G;  4BB7 A;  1XNI A;  3OS1 A;  3WVE B;  2EJG A;  4VUB A;  2MAM A;  4HCZ A;  3M59 A;  4C8Q E;  2DPP B;  3P8D A;  2KMT A;  3CME A;  3GLX A;  4JS5 A;  5FLX E;  4ME7 A;  3JCM h;  1YJ9 A;  2EWN A;  4NL2 A;  1YJN A;  3CCJ A;  3L42 A;  2RM4 A;  2VC8 A;  5GMK h;  2CKK A;  5DY9 A;  4GY5 A;  4BE1 A;  4L59 A;  3JCM d;  4OB2 B;  3OYJ A;  2LT1 A;  4M7D B;  1N9R A;  3P8B B;  5HK0 A;  2E10 A;  2QQ9 A;  3RKW A;  1WGS A;  4E7L A;  2XI9 A;  2DKG A;  3M56 A;  4NL3 A;  1Q82 C;  3A8M B;  2GCX A;  4BDZ A;  4B9X A;  2FB7 A;  1O9S A;  4JRQ A;  3A8H B;  5A0G A;  5GAM f;  3OS5 A;  4X9C A;  1Y96 A;  3M58 A;  4M7A G;  1JB0 E;  3MEV A;  3CCL A;  3L2R A;  2EIF A;  3V8J A;  3OA6 A;  3LWI A;  2R5A A;  3E19 A;  3HFO A;  3M9Q A;  3QYG B;  2RI2 A;  2EKO A;  5IT9 E;  2RK1 A;  4ZTF A;  3JB9 H;  1M1G A;  5CKB A;  2JVV A;  2E64 A;  3E1S A;  4II1 A;  5IAY A;  1K8A U;  4OMF B;  2DXB A;  1ZBX A;  3OYF A;  1KC8 C;  3MEW A;  4LDV A;  1VQP T;  2VXE A;  5FU6 C;  5A2Q E;  5D6W A;  4Z02 A;  4EMG A;  3G6E A;  3M4G A;  2XDB A;  3OYB A;  1VQM A;  1KQS A;  4J6W A;  1UGS B;  2FL7 A;  2VUB A;  3PGG A;  3PMT A;  4J7F A;  2L5Q A;  4TVR A;  4D6W A;  2RO0 A;  3VUZ A;  5CIU A;  3OYH A;  1MGQ A;  2KK4 A;  1YCY A;  3QBY A;  5GAO p;  2K5F A;  1KD1 C;  2RD1 A;  1I81 A;  4M7D G;  1VQ7 T;  3CCJ T;  3BY7 A;  3PT9 A;  1BI1 A;  2DZC A;  4EDU A;  4A4G A;  3MCA B;  4C8Q A;  4OVA A;  3JCM g;  4KBM B;  3QO3 A;  4KT0 E;  3FIF A;  4WF2 A;  3TEE A;  3L2W A;  3CPF A;  4M7A F;  4NOY A;  5KE2 A;  2CGH A;  3RIR A;  2X4X A;  3LH0 A;  3SWN B;  4BAC A;  4C8Q F;  2MI6 A;  2Y4X A;  2LRQ A;  1VQM T;  3HSB A;  3G6E T;  4XTX A;  3ZFJ A;  2RB6 A;  1JBM A;  1YIT T;  3LLR A;  5HK3 A;  3CC2 T;  5GMK e;  2LC4 A;  4LDW A;  4IKF A;  4RCB A;  2WSE E;  4A54 A;  2JUF A;  2HNI A;  2GFU A;  2FHD A;  2P4T A;  1D3B B;  2QXF A;  5HKC A;  4RCC A;  5A0D A;  3KXT A;  1KG1 A;  4ZTJ A;  4M75 A;  2XID A;  1PSF A;  2JOY A;  3CBM A;  4B9W A;  4M77 F;  5KH6 A;  4XTV A;  4XAX B;  5GAO n;  3NTH A;  5GAN 6;  4OGE A;  5CVI A;  4C92 E;  3CC4 A;  1WQW A;  3NTK A;  2EJ9 A;  5HY6 A;  3HP9 A;  4HT9 A;  5LL6 S;  4PJO F;  3DKM A;  4PNO A;  3X26 B;  1XOV A;  2LCL A;  1Q7Y C;  4PJO B;  1WNL A;  4J5Y A;  2B8A A;  5J26 A;  3V7R A;  5GAN 3;  4PJO C;  2WAC A;  3S3M A;  4C5E A;  1M1K C;  3JCM c;  3CCS A;  1H64 1;  3OW2 S;  2EYQ A;  3MEA A;  1IRE B;  1WJR A;  1G3Y A;  4XTY A;  5GAN f;  1YHQ T;  2EAY A;  2E1H A;  1FWZ A;  1X6O A;  5CKF A;  2EFI A;  3LYI A;  4C0D C;  4M75 G;  5A0L A;  2H3J A;  5GMK j;  3OYC A;  1UB4 A;  2QQA A;  3NTI A;  1OI1 A;  3G71 A;  1VQ9 A;  5GAN e;  1Y96 B;  4ZGJ B;  4R56 A;  1LNX A;  1I8F A;  4BY6 B;  1S72 A;  2ZPB B;  3M53 A;  2VV5 A;  3EAE A;  4IUP A;  4XU1 A;  4F7U F;  3ASK A;  1HXD A;  3URG A;  1YJW A;  2JZ2 A;  1M1F A;  4MZT A;  5LJ3 e;  2DEQ A;  5FRO A;  4E47 A;  4IUU A;  2O4X B;  3SWN C;  4BDY A;  3ZBD A;  3HL8 A;  1Q81 U;  1LOJ A;  3JCM X;  1HK9 A;  2RK2 A;  3LWH A;  4BE0 A;  2V8J A;  3VKI A;  1U8R A;  1BYM A;  4J83 A;  4ELZ C;  1PSE A;  3QYH B;  2E70 A;  4M78 E;  3VYH B;  4LD9 K;  4PLL A;  4JRK A;  3TRE A;  1NJI U;  5CK9 A;  3HPW A;  1G3S A;  4CI0 C;  3OYE A;  2YHT A;  1Q81 C;  4IUQ A;  3G7Z A;  5D6Y A;  2A3L A;  4DOW A;  3OBW A;  2ZCF B;  4F7U E;  3H8Z A;  2K57 A;  1VQK T;  4EMK C;  3CCV A;  5FU7 B;  3OYY A;  4C0G A;  3CCQ T;  2BUD A;  2DXT A;  2F69 A;  3EFR A;  3CMA T;  4DQ2 A;  5GAO l;  3CCU T;  3PIO A;  3OMG A;  3GPL A;  1VQO T;  2LQK A;  1Y7X A;  3M5A A;  3RMS A;  4QVZ A;  3SDZ A;  1RL2 A;  1M90 C;  4XU3 A;  2LT4 A;  2OTJ A;  1M9S A;  3FB9 A;  3TCJ A;  3GIB A;  4XTU A;  2DXC A;  3OYK A;  1O75 A;  4M77 A;  3JSC A;  2KAF A;  3CCQ A;  3A8G B;  4ZGE B;  4JDS A;  2EQJ A;  2BIV A;  1OZ3 A;  2XK0 A;  3A8O B;  5C0M A;  2X4W A;  2RJF A;  1GXI E;  3PFS A;  3MP1 A;  4UC4 A;  5CQY A;  4M78 B;  4XTW A;  1OZ2 A;  3V7S A;  3CC7 A;  3CCE A;  3S3N A;  5CKE A;  4P5N A;  1BKB A;  2JN0 A;  3JB9 D;  2XHC A;  1FX7 A;  1QP3 A;  2WSF E;  1KQ2 A;  3OY9 A;  3ER0 A;  3L1A A;  2DD5 A;  4BI4 A;  3JB9 F;  5GAM d;  4M7A E;  4M7A A;  1M1K U;  2BKD N;  2DTH A;  3X24 B;  4PKC C;  3CC7 T;  5LJ3 g;  1QP2 A;  3HRU A;  5GAM j;  2QDY B;  3QPH A;  2CZ7 B;  2ZGW A;  3G4S T;  2RJD A;  3JB9 J;  2VXF A;  4XU2 A;  5GAM e;  3JCM P;  4LD6 A;  1M8V A;  3O8V A;  5GAM h;  5LJ5 g;  3TU4 K;  3CD6 T;  4M77 B;  4N0A A;  4KUL A;  2KSS A;  4QQD A;  3OS0 A;  5LJ5 d;  4HT8 A;  3M54 A;  2MMP A;  3MP8 A;  2QEX A;  1KC8 U;  4IUV A;  2CZ6 B;  1G5V A;  1Q86 C;  3UPU A;  4M78 F;  1D3B A;  4MZM A;  2QTX A;  2ZPH B;  2E5Q A;  1VQ4 A;  4N4I A;  4E7H A;  1N9S A;  4FT4 A;  1W4S A;  3C95 A;  5GAN 8;  4FL6 A;  4E7J A;  3CCV T;  4X34 A;  4C5H A;  4YTL A;  5IN1 A;  4C92 C;  4ELY C;  4M78 D;  1N27 A;  2DTO A;  2EQM A;  5CKH A;  3X20 B;  3VV0 A;  4A4K A;  3OS2 A;  1JJ2 A;  4PJO E;  3LW5 E;  2LDM A;  2GF7 A;  2KVQ G;  3GNF B;  1XTD A;  3WVD B;  3A8L B;  2RJE A;  3BW1 A;  3HRS A;  1LJO A;  3QUI A;  2K3X A;  1KQ1 A;  2WSC E;  2X4J A;  1VUB A;  4KUI A;  2K2V A;  4XQ3 A;  3JB9 G;  2HAX A;  1YI2 T;  2PVD B;  2XD0 A;  3L2Q A;  4E7I A;  3H6Z A;  3MP6 A;  4HKE A;  1IZ6 A;  2PVO B;  2RI5 A;  1NJI C;  4X9D A;  3PMI A;  4N4H A;  5C6S A;  2DO3 A;  4A4F A;  1N6A A;  3J81 E;  3GP8 A;  3RER A;  4MDW A;  2DJZ A;  1VQ6 T;  4BUG A;  5I21 A;  1UGR B;  1N8R U;  2E6Z A;  3FEO A;  1UEB A;  4PL6 A;  3S3O A;  4M75 D;  4A4E A;  1G3W A;  3OYA A;  5J39 A;  3Q1J A;  3OYI A;  3CC2 A;  2L8D A;  3JCM Q;  4MDX A;  5EG2 A;  5FRN A;  4JUV A;  3CCR T;  1QW1 A;  2HQX A;  3QJ6 A;  3VUB A;  3JRZ A;  4M78 G;  4FU6 A;  5CCA A;  2QEX T;  1VQO A;  1XQH A;  2ZPG B;  5LJ5 h;  4QQG A;  3CPW S;  1KHI A;  3RKX A;  4F7U B;  1VIE A;  1X01 A;  1QVF A;  2Y90 A;  3OMC A;  4IUR A;  2P0Q A;  4F7U G;  3JCM b;  3CXC S;  2FYK A;  1VQ7 A;  3KUF A;  5LJ3 h;  1JJ2 S;  4JRI A;  1K73 C;  4OB1 B;  3X25 B;  3OQ5 A;  3V7C A;  2DTI A;  4OB3 B;  4C5G A;  3JCM e;  2LQ8 A;  3INZ A;  2M9U A;  3NFC A;  4GLK A;  1SSF A;  4N4G A;  1H3Z A;  1QVG A;  4RMO A;  3JCM J;  5LJ3 j;  4HA8 A;  2EQU A;  3QSU A;  5LJ5 f;  5KE3 A;  2OAU A;  3CC4 T;  2MWP A;  2K4Y A;  1ZHI A;  1WQ7 A;  1M5Q 1;  2MWO A;  3PTA A;  4HCB A;  4XK8 E;  2IVW A;  3V8K A;  4EMK A;  5DM7 R;  3SD4 A;  4FSX A;  1Q82 U;  1BIB A;  1YJW T;  4V2S A;  5FU7 C;  1G3T A;  4ATO A;  4MZP A;  2ZZD A;  1NPR A;  3CCL T;  2JTM A;  1S72 T;  2HD0 A;  2E12 A;  4F7U A;  4O6J A;  1YIT A;  4FT2 A;  2EJF A;  4J6X A;  5GAN d;  3VJP A;  4JRP A;  4LDU A;  2RHZ A;  5GAO q;  3G71 T;  3EFS A;  2JNG A;  2XG8 D;  2QA4 T;  4OF1 A;  1Y71 A;  4M78 A;  3CCU A;  2FVU A;  3J80 E;  1K8A C;  4M7D E;  5GAO r;  2O01 E;  3CCM T;  3DLL A;  3SWN A;  1K9M C;  2IG0 A;  3GNG A;  2OTL T;  2PU9 B;  4LDY A;  3SB2 A;  4Q5W A;  2M1H A;  3CCS T;  3DB4 A;  3PIP A;  2YRV A;  5KCO A;  3FDR A;  3A5Z B;  2G3R A;  4C0F A;  5GAN h;  4C8Q B;  4JJN K;  4M7A C;  2AHJ B;  2F5K A;  3VU3 C;  4C8Q G;  5GMK i;  2XKO C;  1KQS S;  2XU8 A;  1V29 B;  3CBO A;  5DLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...