2K57A

Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
MASPTVITLNDGREIQAVDTPKYDEESGFYEFKQLDGKQTRINKDQVRTVKDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A.
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Structural genomics, unknown function
molecule keywords Putative Lipoprotein
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k57A00
1LOJA 5GAMh 2DZ9A 3JCMg 2DZCA 3JB9J 4X9CA 4C8QB 2DEQA 1I5LA 4PJOB 5LJ3h 4M78F 4M7AA 5GANh 3JB9G 4M7AE 5LJ3e 2RB6A 4C92B 4M77C 4M75E 4OP0A 1MGQA 2K57A 5GAOl 3QSUA 4M7DD 4XU1A 1LNXA 4N0AA 5LJ3d 1TH7A 2EJFA 4J6YA 3V7SA 2QTXA 5LJ5e 1U1TA 4J6XA 4M75D 3RUXA 4M77D 5GAMj 4RCCA 4PJOG 4XTUA 5GAN5 3HFNA 5CAIA 5DY9A 4M7AG 4M7DF 3PGGA 2RM4A 4XU2A 4XU0A 5LJ3j 5LJ5d 3JCMb 5GAN4 1N9RA 1WQWA 3FIFA 3JCMf 3V8JA 3JCMX 5GANj 3M4GA 4EMGA 4PJOE 1WNLA 4C8QE 4C92A 4F7UB 3BDUA 4C8QG 5GMKe 3JCMh 4PJOA 5LJ3g 2JN0A 3JB9H 1YCYA 1U1SA 3L1AA 3RESA 4M75F 4XTXA 2VXFA 1KQ2A 1LJOA 4C92G 3VU3C 4C8QA 2DVEA 3BW1A 4C92E 3JB9F 1B34B 3JCMe 5GAOp 2E64A 4HT8A 3V7RA 5GMKh 2I2LA 4F7UG 4M77A 3RKYA 2E41A 3QO3A 4XTYA 2DJZA 1KQ1A 3JCMd 4NOYA 3JB9D 2DTIA 4XTZA 4JUVA 2YLCA 4MMLA 1I81A 2DXUA 3HFOA 4N0AC 4XQ3A 4QVCA 5GAOq 1Y96B 1D3BA 2FB7A 4XTWA 3SWNA 4M7DG 4DQ2A 3HSBA 1I4K1 4X9DA 5GAN6 4M75A 5LJ3f 5GAN2 4F7UF 5LJ5g 5GANf 3V8LA 4EMKA 4F7UA 4M77G 3JCMP 4HT9A 5GAMg 5LJ5h 2ZGWA 2CGHA 3BY7A 4M78G 5GMKj 3EFRA 3V8KA 4C92C 4J6WA 1HK9A 4XU3A 5GAN7 2EAYA 3RKWA 5GAOn 2DTHA 4M7DA 2EJ9A 5GANg 1N9SA 4PJOC 4F7UE 2EWNA 3JCMc 2VXEA 4M75G 2VC8A 4M77F 4MMKA 5GMKm 4PJOD 1M8VA 2YHTA 3FB9A 5GAMe 1B34A 2FYKA 3RIRA 1M5Q1 4M78A 4M7AF 4HA8A 5I21A 2DXTA 4Y91A 4C8QC 1WQ7A 5GAN3 4JRKA 5LJ5j 3FJPA 5GAMd 4A54A 1Y96A 5GMKl 4JRIA 4PJOF 5GANe 3QUIA 3JCMV 3RERA 3JB9I 2E65A 4C92D 3JCMQ 2RD1A 4M77E 3QHSA 1D3BB 4M77B 3SWNB 5GANd 4A53A 1WPYA 4M7AC 2EJGA 1X01A 2HNIA 3SWNC 4J5YA 2YLBA 4C8QD 4M75C 4M7DB 3V7CA 4XTVA 4M7AD 4EMKC 2E1HA 4WF2A 5GAN8 5GAOr 4EMHA 4M78E 2DKGA 1JRIA 4V2SA 3L2ZA 4EMKB 4JLIA 4C92F 5GMKi 3GIBA 3BFMA 3EFSA 3RKXA 2RA2A 4M75B 3AHUA 4M7DC 1BIAA 2DTOA 3JCMW 1HXDA 4M7DE 5GAOm 4M78B 1I8FA 1BIBA 4M7AB 4NL3A 5GAMf 4RCBA 3SB2A 4C8QF 2E10A 4M78C 2Y90A 1JBMA 4NL2A 4PNOA 4QVDA 5LJ5f 1H641 3INZA 3JCMJ 4M78D
chains in the Genus database with same CATH superfamily
2YRVA 5GAMh 2L3PA 1PG5B 2FZKB 4VUBA 2XD0A 3EG0A 1T3LA 4EIKA 1Q82C 2LQNA 2EPDA 5GANh 1EX4A 5ECAA 3EG3A 5CKEA 5CIUA 4ZNXA 1QCNA 2HQXA 3RMSA 2KK4A 4C5HA 3CC7A 1U1TA 1RLQC 4J6XA 4P5NA 5CVIA 2COWA 4EDUA 3JCMf 2HBWA 1G8XA 2XDBA 2V1QA 4KGZB 2EGCA 1YCYA 4M75F 2YUOA 3DLMA 1KQSA 2D8JA 1D0ZA 2OTJT 4PKCC 3CCVQ 2H8HA 2AKLA 3I5SA 2D9TA 3CC7Q 4FU6A 1RACB 1R77A 2H3EB 2O9SA 2P0KA 1LVKA 3OW2P 1MMGA 1CKAA 1SSHA 4X9DA 4J9IA 5KCOA 3SFMA 1NJIR 2LMJA 3E9FA 4XU3A 2LRQA 1M1GA 4LD6A 3CCJQ 1H8KA 2VXEA 4D6WA 4PJOD 3QDFA 1IZ6A 1IRXA 2MPXC 3M59A 3I9QA 1K9MU 3OA6A 1SRLA 3LW5E 2E65A 3GNGA 3JCMQ 1D3BB 1WPYA 1RAHB 1VQ7T 1H92A 2DXCA 3SWNC 1K0XA 2RHXA 2D1XA 1MMDA 4JS4A 4F16A 2DNUA 3QXEB 3EG2A 5J39A 3MP8A 1SPKA 1BI0A 1NZ9A 1T3SA 3CCQT 2QA4T 1WA7A 4E2FB 3MEAA 2IIMA 4GLMA 1OYXA 3OYEA 2D6FA 1UUEA 3EAEA 3A8OB 3OYBA 3PNWC 1VQNT 2ZPIB 2DZCA 4FSSA 4C8QB 2P4RA 5FU7C 2M0YA 4M78F 2RB6A 3G71Q 1G3TA 2EFIA 4OP0A 2G3RA 1NLPC 1IHVA 1BK2A 1ZX6A 1E6GA 3OY9A 4LUDA 3QIIA 1ABQA 4J6YA 2WACA 2RJCA 4OMNA 1GRIA 1UE9A 5CAIA 2FZGB 2ESWA 2M16A 5LJ3j 1VQLA 3GNFB 1UG1A 3FIFA 3CCJT 2O2OA 4PFZA 4EMGA 4C92A 3NGPA 4BI3A 1GCPA 4F17A 3A5ZB 1GCQC 2KT1A 4M4ZA 3G6EA 3CCQQ 4FT4A 1VQ8T 1PNJA 3QZ5B 1NYGA 2Y4XA 3I35A 1I81A 1N6AA 2RI2A 4XQ3A 1OZ2A 5AT1B 1XJWB 4EMKA 2EGEA 3QKJA 6AT1B 5GJWB 1UGPB 1YJNT 2CP7A 3JCMc 1DJ7B 2OAUA 1VQNA 1WXTA 1I07A 3FB9A 4BE1A 1NYFA 1GCQA 2NUTB 2E6NA 1QVPA 5GMKl 1WI7A 3WVDB 2FPFA 4M77E 3EH1A 2KR3A 1VQPT 4M7AC 2E5QA 2EGAA 2CZ6B 2KYBA 5DM7R 1EFNA 4BE0A 2DA9A 1WJRA 5A0DA 3E2UA 3P8DA 1YIJQ 4IUPA 4M7DC 1QKWA 1M2VB 1PHTA 1X43A 3VS3A 1K8AC 4PJNA 1JO8A 2DD4A 3JCMg 3JB9J 1KHCA 2D8HA 3C94A 3CC4T 1NJIU 5FU6B 4M77C 1TUGB 3L2QA 2LZ6B 3OB9A 4KH1B 2JJ9A 3UF4A 4Z02A 3A8LB 2J6KA 3CC4Q 2MWOA 4XU2A 1M8MA 3I55T 1N9RA 3TVTA 3X25B 4UC4A 1KHIA 2J05A 2L0AA 1QVFP 2RHIA 3A8GB 3GOXA 2FPDA 1QVGS 4E47A 3L1AA 1U5SA 3TCJA 1MUZA 2CP6A 2VXFA 1SG5A 4BDYA 2DVEA 3FJ5A 2JTFA 2GTJA 3RR6A 4DOWA 3DLLA 4M77A 1YJ9Q 3OYHA 4N0AC 1AZGB 1QCFA 4JJBA 1TUDA 4CC2A 1M2VA 4FL6A 3HSBA 4QQ6A 4M75A 3PE0A 2LT4A 4Y28E 1QW1A 3BY7A 1WXBA 4M78G 3EFRA 5FU6C 1YHQT 5KE3A 1WJSA 3VS0A 2JXBA 1Q95G 4PLIA 2L5QA 2VWFA 3O5ZA 4FCYA 4M7AF 5GJVB 1V1CA 3EGUA 3MJXA 1P92A 3MEWA 4Y91A 5FRNA 3OYKA 1YJ9A 3FRNA 3SWNB 4A53A 1JXMA 4A4HA 2KMTA 2L89A 4M75C 4C0GA 2DBMA 4A4EA 1VYVA 2EQUA 1Q81R 4V2SA 5GMKi 1VQ8Q 4WCIA 3SHWA 3QJYA 4FYXB 1EZZB 1YJWT 1M3CA 1HXDA 1PKTA 5GAOm 3CXCP 5CKFA 3CCET 2J6FA 1YJNA 1ZBJA 2C06A 3M55A 2E10A 2QASA 1PRLC 1YP5A 4OGEA 2CT4A 2FL7A 1G2BA 3G1JA 2DEQA 2YXYA 1R0BG 2QTVA 5A0LA 1ABOA 2JTMA 1KFZA 1Y7XA 1Q82R 5LJ3d 1TH7A 1S72Q 1ZUYA 2RNAA 1PD0A 4XK8E 4IUUA 2CP5A 2ZPEB 1MV3A 2RQVA 3H0FA 4PJOE 1Q81U 4C8QE 2ROTA 1E7OA 1YWPA 1YHQA 3JCMh 1UGSB 2EKOA 3LX7A 5LL6S 4AFZC 1JEGA 3CPWA 3CCJA 1YBYA 1CKBA 1G5VA 3I55Q 5HCKA 1QP3A 3CMEA 3I56Q 5KYXA 1KD1U 4FW1A 4HT8A 2CH4W 3QJ6A 3RKYA 1S72A 2CP3A 3TREA 1WHGA 3MO8A 4MMLA 5GAOq 2WSEE 4RTTA 5J3BA 1VQ5A 4N4IA 4R0KA 4D8DA 2CZ1B 1M1KU 1NEGA 2XK0A 4J6WA 5CCAA 3RKWA 1AWXA 3M5AA 4M75G 2PTKA 3X26B 2YHTA 4WTOB 2DM1A 1B34A 1C1AA 1XNIA 2K5IA 1RI9A 2DPPB 4KBMB 1OZ3A 1PD1A 2HNIA 4E7JA 3RBBB 3OBWA 4CRIA 5A0GA 4OF1A 5KYUA 2RI3A 5FRMA 3VRYA 1JRIA 1J3TA 5I2SA 1Z9QA 1WX6A 3JCMW 5C6SA 1I8FA 3CCLA 3BDLA 2NUPA 2CUDA 1Q86U 2DZ9A 4PJMA 1U3OA 3CMAT 1ZA2B 4RG8A 4LDVA 2JW4A 3M4YA 3G6EQ 2CUBA 2RHUA 4M75E 3TSWA 5D6YA 1PC0A 4FIBA 3V7SA 1AWWA 4OMLA 4XTUA 1FMVA 3M57A 3FEOA 3A8HB 3CCLQ 2NUPB 4HVWA 1K9AA 4LDUA 5KCHA 1K76A 2RF0A 2KDSA 2K2VA 2WSFE 5AYFA 5KH6A 1IGQA 2A08A 1U1SA 2DE0X 1VQ4Q 3ULRB 2FPEA 2QYZA 2CDTA 3TEEA 3CCSA 4FYWB 1UGQB 4GY5A 2XHCA 2HCKA 1UJYA 4MZMA 1N8RC 4OGCA 1D1BA 4JZ4A 4A4KA 3CMAQ 3ZL7C 4OB3B 1W2BP 2YSQA 2E4HA 5IHNA 3VKIA 2LT1A 1SRMA 3GPLA 3CD6A 5IN1A 3CCST 2AKKA 2HSPA 5LJ3f 4AFUC 2QG9B 2BTTA 4C92C 4PL6A 5KYUB 2BZ8A 2O9VA 4RTUA 1E6HA 2RQRA 2EIFA 4YTLA 3CCSQ 1JXOA 3ZFJA 5KE2A 2DD5A 1LPLA 4HA8A 1VQOA 1QWFA 5LJ5j 1Y96A 4JRIA 4AFSC 3CCUQ 3M9QA 2DJQA 1W6XA 1AZEA 2DMOA 4ELYC 3L2UA 4J5YA 3MKDA 4EMKC 2K9GA 1Q82U 4C92F 1BBZA 3OMGA 1K73R 3REBB 2HDAA 3VS7A 3LWHA 2YRCA 4OMQA 4E7HA 3QSUA 3CPWS 1WHJA 3UWNA 4OMOA 3LLRA 3M56A 2RJEA 5I11A 1Q81C 3VS6A 4M7AA 5LJ3e 2X4XA 3CC2Q 2ZPHB 5HK0A 2IG0A 1OEBA 3L2WA 2QTXA 2EQJA 5GAMj 4JS5A 1Q7YU 1OI1A 1X2KA 1AD5A 5GANj 1M90R 2C0OA 3BDUA 3OYNA 1VQ9T 2F2WA 3G4SQ 2A3LA 1GL5A 1JU5C 1WIEA 5FROA 2AIRB 1ZUUA 3VS1A 4OMPA 3TQ7P 4JLGA 1M1KC 2VGNA 2ENMA 1W1FA 1WHHA 4DEXA 2P84A 1HD3A 4JRPA 2LJ3A 1UGRB 1KQ1A 2V26A 3CC4A 2DL7A 1TUCA 3OYCA 2LCSA 1UECA 5GAMg 2CGHA 3GF5A 3VS5A 2QGFB 4HCBA 1B7TA 3NHNA 2QEXA 4F7UE 1X2QA 4ZN3A 3CCVT 5GMKm 2RH2A 4AMCA 1LCKA 3HRSA 1KK7A 4C5GA 1K8AR 5GAN3 1WQ7A 3E9GA 4JRKA 4L6V5 3M0SA 3JCMV 2RD1A 3CPWP 2RK2A 2E3HA 4Y92A 1X01A 5CQXA 3KXTA 2CP0A 2EBPA 2YLBA 1GFDA 2E1HA 4WF2A 5GAOr 4NS5A 1YNZA 1NPRA 4IURA 4M75B 2CSQA 1K4US 4ZN1A 4LNPA 3EGXA 1Y0MA 4OB0B 4J9BA 1UHFA 3EHQA 3THKA 5IXFA 3CEYA 1M3BA 5LJ3h 2R5AA 2JMCA 3H9NA 3MEUA 1UEBA 2L3RA 5J26A 2YUQA 2A28A 2OX7A 4B6MA 3EGDA 1WHKA 2EVRA 1VQ8A 5A2QE 4PJOG 5GAN5 4CC3A 2VYTA 4M7AG 3SDZA 2CZ7B 1YJNQ 1N8RR 3WVEB 1WDXA 4C0DC 4QT7A 2O88A 2EQIA 2V8KA 4OB1B 1Q7YC 2F2VA 3OSVA 4C0DB 1QVGP 3CCRQ 3J7AF 2DJZA 4NOYA 3C12A 1TSFA 3UATA 3I56T 2P0QA 2PUOB 1PWTA 5KYYA 3KUFA 3QYGB 2KYMA 3VS4A 4LN2A 1X75C 2HEQA 1K0SA 3E19A 2ZGWA 2NWMA 1YHQQ 3V8KA 1HK9A 1HYOA 1UDLA 2EAYA 2KY9A 3PTAA 1ZSGA 2A7YA 3JV3A 1TTHB 3I55A 4MMKA 3CMEQ 2EYXA 5DLOA 4M78A 2DLPA 1WYXA 4J9HA 4M7AE 3CBMA 2KNBB 1VQMQ 4GLKA 1M9SA 3CCLT 5CQYA 3QHSA 2QA4A 2EKHA 2EJGA 3NMZC 2X4YA 3G71A 4M7AD 1W2BA 3LGLA 1KC8C 3CCMT 3EGDB 1WLPB 2GFAA 4XAXB 2ED0A 4BE2A 2E6ZA 3U23A 2LP5A 1VQMA 2X51A 1VIFA 5FU7B 4M78C 4PNOA 4Z89A 3INZA 2OTJQ 4OMFB 2RI5A 1SF9A 3PMTA 2OAWA 1M2OA 2COYA 4C92B 2MYSA 2HL3A 1N8RU 1YI2Q 4HVUA 4OB2B 1VOMA 5KYNA 1N5ZA 3ER0A 3PGGA 5LJ5d 5GAN4 1R0CB 4F7UB 2FO0A 4C8QG 2OTJA 1M4ZA 4QW2A 1IB8A 2GGRA 3HTRA 2M9UA 1MHNA 3NTHA 1MMAA 2E70A 3H41A 3VU3C 2NUZA 1I1JA 4J7FA 1MV0B 3JCMd 4J9GA 2DF6A 2KE9A 2QDYB 1Y71A 4E7KA 3AT1B 2HKNA 4QKUA 1OX9A 5IT9E 4PJJA 5LJ5g 3JCMP 1X6BA 1PCXA 3FLGA 2AZVA 5GAN7 2FVUA 2LVMA 4C5EA 1VQ4A 1Y07A 1YIJA 1AWOA 4RTZA 4J7IA 4MZPA 5GAMd 1WFWA 1TU0B 2GF7A 2X4JA 1WHLA 3ME9A 2RJDA 1K73U 2DFUA 3CD6Q 2PVDB 1IGUA 3C0CA 2MI6A 2CKKA 2M0OA 5HK3A 1OU8A 2DRMA 2QAZA 1ZBXA 2O4XB 1IHWA 1NE8A 3VJPA 2ED1A 4RTWA 1OOTA 2XDPA 3PFSA 4FW2A 4D8KA 2C0TA 2F69A 5CKBA 3H0HA 4ESRA 3S3OA 4M7DE 3PIOA 2MWPA 2CREA 1VQ4T 1VQOQ 1YITQ 4NL3A 1SKUB 3M0PA 3SB2A 3TU4K 2ATCB 2DO3A 1A0NB 2G6FX 4R55A 2COZA 4F14A 2DK3A 4Z8AA 1YITT 1OQKA 3UA6A 3BE3A 1NPPA 3LH0A 1M90U 1LNXA 2CS7A 1WXUA 3PMIA 5C0MA 4A4FA 2K2MA 1YJWQ 5DY9A 3EGXB 2MOXA 3QYHB 8AT1B 3JCMb 1ZSZC 3X28B 2QEXT 4DOVA 4FM4B 2XG8D 2Y4YA 2XU8A 5IHIA 1Q86C 2FZCB 4FYVB 4LXCA 3P8BB 2KXDA 3MCAB 4ZGEB 2KRNA 1QVFS 2L8DA 4C8QA 3JB9F 3CC2A 3JRZA 3QO3A 4QVCA 1TS9A 2LJ0A 4DBRA 1Y96B 1BCMA 4XTWA 4DQ2A 2RPNA 1MMNA 2DVJA 3ASKA 5CKDA 1W2BS 3G4SA 3HL8A 1RI0A 3OYFA 1UFFA 1GBRA 5IAYA 2CT3A 4M77F 3OYJA 1BB9A 2LQ8A 4QQGA 1W4SA 3OQ5A 3ZEHA 1TWBA 2QQBA 4Q5WA 4BB7A 3L2RA 3CC7T 1UHCA 1VQMT 4JJNK 2BE9B 4C92D 4A63B 3G71T 2FG0A 3LWIA 2JMAA 4RTXA 5FWBA 4PJLA 2R58A 2JNGA 3LYIA 5GAN8 1B3QA 1PRMC 4HKEA 2YRDA 1VQPA 4LDYA 4RKUE 3EFSA 2EW3A 2DL3A 3M58A 2ZZDA 3PIPA 4RCBA 4C8QF 2RQWA 4QVDA 4B9XA 5CK9A 4HVVA 2XMFA 4PJOB 2V8JA 3I56A 5EG2A 4E7IA 2JT4A 1W70A 1M1FA 2VUBA 3CCMQ 1VQPQ 2PNIA 4M75D 5LJ5e 3WXMB 1R8OB 2GTOA 2J6OA 4EPCA 1QWEA 2IPOB 1VYUA 4HXJA 2ZPFB 2D0QB 5FWCA 4E7ZA 4KUDK 1SHGA 2XI9A 3I5RA 3DKMA 3CD6T 4C92G 2EYQA 4RG2A 4B9WA 2E41A 2VB6A 2LC4A 1RAGB 3RDVA 2DXUA 1M30A 1FXXA 3DB4A 1UGVA 2ZAEA 4AG2C 4M7DG 2PZ1A 2QQ9A 3S3MA 2PUKB 5GMKj 1UTIA 4LUEA 5KYXB 3VV0A 4ANJA 4AG1C 4BACA 3OW2A 2RQTA 1C6VX 5GAMe 1VQ6A 2FYKA 3RMQA 2V1RA 5CO7A 4DA4A 1X69A 4PJOF 2ECZA 3L42A 3QDRB 4GBQA 2KAFA 2ZPGB 1RAEB 1JJ2A 5IXBA 4XTVA 2FHDA 1BCOA 1YJ9T 2QGGA 2L2PA 5L8RE 4EMHA 5CKHA 4HCZA 4ME7A 2YT6A 3RKXA 2RA2A 1VQ6Q 1C0MA 2PVGB 2JOYA 1KC8R 5CR2A 1JBMA 3M0UA 2QA4Q 1BI1A 2LX9A 4K11A 3QG1A 1QVFA 1KJWA 4RMOA 4QVZA 1D1AA 2RN8A 1N27A 4RTYA 1F1BB 4KULA 2SEMA 1Q86R 3UA7A 4M7DD 1ZUKA 2LNHB 1JB0E 3MP6A 5DLQE 1T0HA 3LH5A 4RCCA 2KI7A 1UJ0A 2RMOA 4IIOA 3JCMX 2FEIA 3CBPA 4FYYB 1D1CA 3OS5A 4N4HA 3ZBDA 1S1NA 4DEYA 3OS1A 7AT1B 3OYMA 2PVOB 3RESA 4CC4B 1XQHA 4C92E 3JCMe 1RUWA 5GAOp 1CSKA 3V7RA 2BKDN 1S72T 4MDXA 1ZLMA 2DAQA 1YI2A 1SSFA 4ZGJB 3NTKA 2H3JA 2KT8A 2QK0A 1GXIE 2B86A 3J81E 4BY6B 3HRUA 2W10A 1YWOA 1VUBA 2KQWA 2K3YA 4M77G 3HPWA 1WHMA 1D0YA 1BI2A 2K79A 4LDXA 1AHJB 2OTLQ 1N9SA 3MPUB 1UB4A 2X3XD 3M0TA 2JVVA 2RHZA 4J9CA 2J7IA 3S3NA 3OS2A 1XOVA 1MNDA 5I21A 4L59A 1YITA 3HKSA 3FJPA 4A54A 3A1PA 2KBTA 2EYZA 2MCNA 4LD9K 3MHXA 2GNCA 3SD4A 4RTVA 3META 3UT1A 3M54A 2X4WA 2DKGA 5KYWB 3CCEA 1YJWA 4PK4A 2V8IA 1FX7A 1H641 5LJ3g 4JDSA 1MNEA 2KSSA 2HKQB 1I5LA 1Y57A 3CQTA 3HHTB 2K57A 5GAOl 3NFCA 3URGA 4M77D 4FSXA 4DBHA 2PQWA 2YDLA 4M7DF 1QP2A 2RM4A 2VV5A 5L23A 4A4GA 1WGSA 1GBQA 5HKCA 4BD3A 4LDWA 4PJOA 2KVQG 3NPFA 3QBYA 2QEXQ 1VQLT 2E5KA 1KQ2A 2GBQA 1TOVA 2OJ2A 1OX8A 2E64A 3CCRT 3REAB 4IUTA 1FMKA 4J8OA 2DTIA 4XTZA 4JUVA 3HFOA 2P4TA 1D3BA 3G7ZA 1HSQA 1AEYA 5GAN6 1VQ7Q 4F7UF 5GANf 4HT9A 1ZSZA 4O6JA 2ABLA 2Z0WA 2NYSA 5GAOn 2A36A 3R6OA 3MEVA 1QMCA 1RAFB 2VC8A 4BI4A 1M8VA 2LQWA 3UDCA 3CXCS 2DXBA 1ZSZB 3LGFA 4C8QC 3OYLA 2DL4A 1TG0A 2HZYA 5I2MA 3X20B 2D0NA 2A0FB 1I5OB 2KXCA 3QZ9B 4BDZA 2EQMA 1O75A 1VQNQ 2CSIA 1NEBA 1T0JA 4M78B 1KQSP 4OMMA 1FWZA 3JAME 3JCMJ 5D7UA 2RJFA 2ROLA 1RABB 2EYWA 5FW9A 2JZ2A 2VASA 2RQUA 4XU1A 2W0ZA 2M02A 2EJFA 1ACMB 2XIDA 3CCRA 2O4XA 3N5BB 2K6DA 1KD1C 4O5VA 3HRTA 2BIVA 3OYIA 1NBEB 2K3XA 2LNVA 3X24B 4ORZA 4X1VA 2JN0A 2A37A 2QQSA 5KYYB 2E3IA 3JSCA 3H6ZA 3J80E 1M90C 4XTXA 2DEUA 2OI3A 1LJOA 2QXFA 4HCKA 5M9OA 1K9MC 1B07A 1O9SA 4AFQC 1OU9A 4XTYA 9ATCB 1X27A 3JB9D 1M1KR 1VA7A 3SEMA 2QI2A 3EFOB 2FB7A 3QPHA 2JTEA 1AWJA 2R57A 2MF2A 4OVAA 1G3WA 3EG1A 1U8RA 2RHYA 2BZYA 1SEMA 4KT0E 1AOJA 2SRCA 3D7SB 5IHKA 2XKOC 3VS2A 2KGTA 1IXDA 3EFOA 3QUIA 2O31A 4JJDA 4KGVB 1NLOC 2KRMA 4C8QD 2E12A 2L3QA 3OW2S 3PVQA 2F5KA 4M78E 2CZ0B 1AVZC 1EIFA 3QWYA 4J9DA 2MIOA 2DTOA 1VQKA 4DBFA 4ZGDB 1BIBA 1YCSB 1K1ZA 4ELZC 3QWXX 2DIGA 1RAAB 4M78D 2M51A 1JJ2S 3EG9B 1ZA1B 4LE9A 1YN8A 2AK5A 1G3YA 1V76A 1GFCA 4DBQA 3JB9G 1WJQA 1FMWA 4JRQA 1M3AA 2RO0A 3RNJA 3CCVA 4L5GA 4II1A 2HBPA 2I0NA 4N4GA 2P0PA 4KRTA 2L3SA 2LJ1A 1I0CA 1VQKQ 2K4YA 2QQAA 3V8JA 3M4GA 2K3BA 1BKBA 2IVWA 1JJ2P 2LCCA 4E7LA 2JM8A 2OTLA 4C0ZA 3CC2T 2CP2A 4J9EA 2DL5A 3CXCA 1X6GA 3BW1A 1V29B 1VQ9A 3C95A 2HL5C 2F2XA 2VGMA 2I2LA 2XDDA 1NJIC 2YWWA 3SWNA 2FRWA 1K73C 2DETA 1PSEA 3V8LA 3CPFA 4IKFA 1OPKA 2LDMA 1OPLA 4KUIA 2NUTA 1RL2A 2J06A 4RUGA 3CCUT 3EG9A 4CI0C 1RADB 1WZOA 2DTHA 3NTIA 5GANg 2DRKA 2EWNA 2BUDA 1HJDA 2RK1A 1NM7A 2GCXA 1VQ9Q 3RIRA 4TVRA 2DXTA 1AT1B 5EC7A 3M0QA 2JS2A 2HQEA 1VQKT 3EHRA 4KH0B 2KEAA 1OV3A 1VQ5Q 3KBGA 3A8MB 2X9HA 1BU1A 3OMCA 3OSSC 3L2ZA 3GIBA 2K7AA 1NG2A 3P8HA 2X3WD 5LJ5f 1H3HA 1TXQA 3C4SA 2HSEB 4E6RA 1LOJA 1D09B 3R6NA 3IQLA 3VYHB 4X9CA 1IO6A 1KC8U 1VQOT 2DBKA 1SHFA 2R5MA 3OYYA 2F1LA 1YIJT 1H3ZA 1XTDA 2MAMA 4BY6C 3CCEQ 3HFNA 1PSFA 2K5LA 1WQWA 2LX7A 8ATCB 3VRZA 5HY6A 5KYWA 3M0RA 2BE7D 3O8VA 1JQQA 2FRYA 2LTOA 2AZSA 3E1SA 2DERA 3OBYA 4BUGA 4PFOA 1B34B 2VKNA 2X35A 3UPUA 1YI2T 5GMKh 4J9FA 2AT1B 4Z88A 4F7UG 1BYMA 4BI8B 3GP8A 5D6WA 2JM9A 1K8AU 1VQLQ 2ZPBB 1QQJA 1OULA 3PT9A 1QKXA 1BI3A 2MK5A 3MP1A 1RLPC 2LCLA 4FT2A 1K9MR 1D0XA 3F70A 4M7DA 4PJOC 4CC7A 2CH4A 3OS0A 3FC3A 3CCQA 1KQSS 1M5Q1 3H0IA 3CMAA 5GANe 3RERA 4QQDA 2KROA 1G3SA 2F5TX 2EYYA 4J83A 1VQ7A 2ZCFB 4C0FA 3GBQA 2LQKA 4M7DB 4F04B 2WSCE 2XICA 3Q1JA 4IIMA 3TSZA 4ATOA 1VIEA 3CCMA 5I22A 2DL8A 2QDLA 2EQKA 4JJCA 5IH2A 2HAXA 3T9NA 1BIAA 3EH2A 3OYDA 2DILA 1Z9ZA 4IUVA 3CCUA 1Q7YR 3G4ST 2B8AA 1FYNA 4JZ3A 3OYGA 2M1HA 1QVGA 1MGQA 1KG1A 2AHJB 1VQ5T 4N0AA 2JUFA 3RUXA 2YUPA 4E7SA 1VQ6T 2DYBA 1RAIB 4XU0A 2OTLT 2C0IA 1WNLA 4X34A 2DYIA 2JS0A 5GMKe 1ARKA 4IUQA 1KD1R 1QLYA 3H8ZA 4KGXB 4C5IA 3JB9H 3PVLA 3VYGA 2K5FA 1ZHIA 1KSWA 4R56A 2HMAA 4AT1B 2QQRA 2VVKA 3CMET 1YFNA 1KIKA 2DX1A 3GLXA 3VUZA 1VYTA 2YLCA 1X6OA 3CBOA 3G6ET 2HD0A 1U06A 3VUBA 1I4K1 4PLLA 4ZTFA 5GAN2 3S6WA 4F7UA 5LJ5h 2DIQA 2BZXA 1M27C 3L2VA 2KRSA 2EJ9A 1IREB 2NLUA 1PKSA 2GQIA 3JB9I 5D6XA 4M77B 5GANd 4PFPA 5FLXE 1QCOA 2GFUA 2O01E 1G83A 4MDWA 3V7CA 4JPBW 2MMPA 2HQHA 1PM3A 4MZTA 3A98A 4EMKB 2PU9B 4JLIA 3BFMA 4HCCA 3AHUA 3HP9A 3KFVA 1ZQ1A 3M53A 3FDRA 4ZTJA 2YUNA 4M7AB 5GAMf 2Y90A 2CYZB 2GQVA 4NL2A 3OYAA 3DB3A
chains in the Genus database with same CATH topology
2YRVA 4R55A 1Q86U 5GAMh 2DZ9A 4VUBA 2RJFA 2XD0A 2DK3A 3CMAT 1Q82C 1YITT 4RG8A 4LDVA 2JZ2A 5GANh 3M4YA 4M7AE 2RHUA 4M75E 1NPPA 4XU1A 5CKEA 3LH0A 5CIUA 5D6YA 1LNXA 1M90U 2CS7A 3CCRA 2EJFA 2HQXA 2KK4A 2XIDA 4FIBA 3RMSA 2O4XA 3N5BB 3PMIA 1U1TA 4J6XA 3V7SA 4A4FA 4P5NA 5C0MA 3CC7A 4XTUA 5CVIA 4O5VA 1KD1C 3M57A 5DY9A 3QYHB 3FEOA 2BIVA 3HRTA 4EDUA 3A8HB 3JCMb 3OYIA 3X28B 3JCMf 4LDUA 4DOVA 2QEXT 5KCHA 2K3XA 2LNVA 2XDBA 4FM4B 2XG8D 2Y4YA 3X24B 2XU8A 2KDSA 2K2VA 2WSFE 5AYFA 5KH6A 1Q86C 2JN0A 1YCYA 2QQSA 3JSCA 3H6ZA 3J80E 1U1SA 1M90C 3P8BB 3MCAB 4M75F 4XTXA 4ZGEB 3DLMA 3TEEA 3CCSA 1QVFS 1UGQB 1LJOA 4GY5A 2L8DA 1KQSA 4C8QA 4PKCC 2QXFA 3JB9F 2XHCA 2OTJT 3CC2A 3JRZA 5M9OA 1K9MC 4MZMA 1O9SA 1N8RC 4OGCA 4A4KA 2D9TA 3QO3A 4XTYA 4OB3B 4FU6A 3JB9D 4QVCA 3VKIA 2LT1A 1Y96B 2QI2A 3GPLA 2P0KA 2FB7A 4XTWA 5IN1A 3CCST 3CD6A 4DQ2A 4X9DA 5LJ3f 5KCOA 3ASKA 3SFMA 3QPHA 5CKDA 1W2BS 3G4SA 3HL8A 1RI0A 2R57A 4C92C 3OYFA 3E9FA 4PL6A 2MF2A 4XU3A 2LRQA 4OVAA 1M1GA 1G3WA 4LD6A 2EIFA 4YTLA 5IAYA 2VXEA 2RHYA 4M77F 1U8RA 4D6WA 3OYJA 4PJOD 2LQ8A 4QQGA 1W4SA 3OQ5A 4KT0E 3ZEHA 1IZ6A 2QQBA 4Q5WA 3ZFJA 4BB7A 3M59A 5KE2A 3L2RA 3CC7T 2DD5A 2XKOC 4HA8A 3OA6A 1VQMT 1VQOA 1K9MU 5LJ5j 4JJNK 1Y96A 3LW5E 4JRIA 3QUIA 3M9QA 2E65A 4C92D 3GNGA 3JCMQ 3G71T 1D3BB 3LWIA 1WPYA 1VQ7T 2DXCA 3SWNC 2RHXA 2R58A 4J5YA 4ELYC 3L2UA 4C8QD 2JNGA 3LYIA 4JS4A 2E12A 3OW2S 4EMKC 5GAN8 3QXEB 5J39A 2F5KA 4M78E 3MP8A 1BI0A 1NZ9A 1Q82U 4HKEA 1VQPA 2CZ0B 4LDYA 4C92F 4RKUE 3CCQT 2QA4T 1EIFA 3EFSA 3OMGA 3MEAA 2DTOA 3M58A 1VQKA 2ZZDA 3PIPA 1OYXA 4ZGDB 1BIBA 3OYEA 3LWHA 2D6FA 3EAEA 4RCBA 4C8QF 4ELZC 4QVDA 2DIGA 3A8OB 3OYBA 4E7HA 4B9XA 3QSUA 4M78D 3CPWS 3PNWC 3UWNA 5CK9A 1JJ2S 2ZPIB 1VQNT 2DZCA 3LLRA 3M56A 4C8QB 2RJEA 1G3YA 1Q81C 4PJOB 5FU7C 2V8JA 4M78F 4M7AA 3JB9G 3I56A 1WJQA 4JRQA 2RO0A 5LJ3e 2RB6A 5EG2A 1G3TA 4E7IA 2EFIA 2X4XA 2ZPHB 2G3RA 4L5GA 4OP0A 1M1FA 3CCVA 2VUBA 5HK0A 4II1A 2IG0A 3OY9A 3QIIA 4J6YA 2HBPA 3L2WA 2WACA 2RJCA 2QTXA 2EQJA 4M75D 4N4GA 3WXMB 5LJ5e 2P0PA 5GAMj 4JS5A 1Q7YU 1OI1A 5CAIA 1R8OB 2M16A 4EPCA 2K4YA 3GNFB 5LJ3j 1VQLA 2QQAA 3FIFA 3V8JA 3CCJT 5GANj 3M4GA 4EMGA 4C92A 3BDUA 1BKBA 3OYNA 2IVWA 2ZPFB 1VQ9T 2A3LA 2D0QB 2LCCA 5FROA 4E7LA 4BI3A 4KUDK 2OTLA 4C0ZA 3A5ZB 2XI9A 3CC2T 3DKMA 3CD6T 4JLGA 3CXCA 4C92G 3G6EA 1M1KC 2VGNA 1V29B 3BW1A 1VQ9A 2EYQA 4FT4A 1VQ8T 3C95A 3QZ5B 4RG2A 4B9WA 4JRPA 2VGMA 1UGRB 2I2LA 2Y4XA 2E41A 1KQ1A 2LC4A 1I81A 1N6AA 2DXUA 2RI2A 1FXXA 3DB4A 4XQ3A 2XDDA 1NJIC 3CC4A 3SWNA 4M7DG 1K73C 1OZ2A 2QQ9A 3OYCA 1PSEA 3V8LA 3CPFA 4EMKA 3S3MA 4IKFA 2LDMA 5GAMg 4KUIA 3QKJA 2CGHA 2PUKB 3GF5A 5GMKj 1RL2A 3CCUT 4CI0C 4HCBA 2DTHA 3NTIA 3VV0A 5GANg 1UGPB 2QEXA 1YJNT 4F7UE 2EWNA 2BUDA 1DJ7B 3JCMc 2OAUA 4ZN3A 5GMKm 2RH2A 3CCVT 4BACA 2RK1A 3OW2A 1VQNA 2GCXA 3FB9A 5GAMe 4BE1A 1VQ6A 3HRSA 2FYKA 3RMQA 3RIRA 4C5GA 4TVRA 2E6NA 5CO7A 4DA4A 2DXTA 5GAN3 1WQ7A 1QVPA 3E9GA 4JRKA 4L6V5 5GMKl 4PJOF 3WVDB 3JCMV 1VQKT 2HQEA 2RD1A 4M77E 3L42A 3QDRB 2RK2A 1VQPT 4M7AC 2E5QA 1X01A 5CQXA 2CZ6B 2KAFA 3KBGA 5DM7R 3KXTA 2ZPGB 3A8MB 4BE0A 2YLBA 1WJRA 5A0DA 1JJ2A 4XTVA 2FHDA 1YJ9T 2E1HA 4WF2A 5GAOr 3OMCA 5L8RE 4EMHA 3P8DA 3OSSC 5CKHA 4NS5A 4HCZA 4ME7A 3L2ZA 1NPRA 4IURA 3GIBA 3RKXA 2RA2A 4IUPA 4M75B 4M7DC 4ZN1A 2PVGB 2JOYA 5CR2A 3P8HA 1K8AC 1JBMA 4OB0B 5LJ5f 2DD4A 3C4SA 1LOJA 1BI1A 2LX9A 3JCMg 3JB9J 3VYHB 3CEYA 4X9CA 1KHCA 3QG1A 1QVFA 1KC8U 5LJ3h 1VQOT 2R5AA 4RMOA 3C94A 4QVZA 1N27A 3MEUA 3CC4T 2R5MA 1UEBA 1NJIU 4KULA 5FU6B 2L3RA 5J26A 4M77C 3OYYA 3L2QA 1YIJT 4M7DD 1H3ZA 3OB9A 1XTDA 1JB0E 2MAMA 4Z02A 1VQ8A 3MP6A 3A8LB 5DLQE 4BY6C 5A2QE 4RCCA 4PJOG 5GAN5 3HFNA 2VYTA 4M7AG 1PSFA 3SDZA 2MWOA 2CZ7B 4XU2A 3I55T 2K5LA 1N9RA 1WQWA 3JCMX 3X25B 4UC4A 1KHIA 2RHIA 3WVEB 3CBPA 3OS5A 4N4HA 3ZBDA 3A8GB 5HY6A 3OS1A 3GOXA 3O8VA 3OYMA 1QVGS 2PVOB 4E47A 4C0DC 2LTOA 3L1AA 3E1SA 3RESA 3TCJA 2VXFA 4BDYA 3OBYA 1XQHA 2V8KA 4C92E 2DVEA 4OB1B 2JTFA 4BUGA 1B34B 3JCMe 5GAOp 2X35A 4DOWA 1Q7YC 3V7RA 3UPUA 2BKDN 3OSVA 5GMKh 4C0DB 1YI2T 1S72T 4F7UG 4MDXA 3DLLA 2DAQA 4M77A 3J7AF 1BYMA 1YI2A 2DJZA 1SSFA 4BI8B 4NOYA 4ZGJB 3NTKA 3OYHA 2H3JA 3C12A 4N0AC 3GP8A 5D6WA 3I56T 2P0QA 2PUOB 1GXIE 3J81E 3KUFA 3QYGB 4BY6B 3HRUA 4FL6A 1K8AU 3HSBA 4QQ6A 2ZPBB 4M75A 1VUBA 2KQWA 3PT9A 2K3YA 2LT4A 1X75C 4M77G 3HPWA 4Y28E 1QW1A 3E19A 2ZGWA 3BY7A 1BI3A 3MP1A 3EFRA 4M78G 5FU6C 3V8KA 1YHQT 5KE3A 1HK9A 1BI2A 1WJSA 2LCLA 2EAYA 2KY9A 4FT2A 3PTAA 4LDXA 2A7YA 3F70A 4M7DA 1AHJB 1N9SA 4PJOC 3I55A 4MMKA 1UB4A 3OS0A 5DLOA 2JVVA 2RHZA 3FC3A 3S3NA 4PLIA 3CCQA 1KQSS 2L5QA 3OS2A 1XOVA 1M5Q1 4M78A 4M7AF 5I21A 4L59A 1P92A 3MEWA 4Y91A 3HKSA 3CBMA 3CMAA 3FJPA 1YITA 4A54A 4GLKA 1M9SA 5FRNA 5GANe 3CCLT 3OYKA 3RERA 4QQDA 1YJ9A 3FRNA 1G3SA 5CQYA 3QHSA 3SWNB 2QA4A 2F5TX 4A53A 2EJGA 4J83A 1VQ7A 4LD9K 4A4HA 3MHXA 2ZCFB 4C0FA 2KMTA 2L89A 2X4YA 2LQKA 3SD4A 4M75C 3META 4M7DB 2WSCE 2XICA 3UT1A 3G71A 4M7AD 3M54A 2X4WA 4C0GA 1W2BA 3Q1JA 4A4EA 4ATOA 3LGLA 1VIEA 3CCMA 2DKGA 1KC8C 2EQUA 3CCMT 4V2SA 5GMKi 2EQKA 3CCEA 3QJYA 1YJWA 1YJWT 1BIAA 2GFAA 4XAXB 2V8IA 3T9NA 1HXDA 2HAXA 5GAOm 3OYDA 5CKFA 4BE2A 1YJNA 3CCET 1FX7A 2E6ZA 2C06A 3M55A 1VQMA 1VIFA 2E10A 5FU7B 4M78C 4IUVA 4PNOA 3CCUA 1H641 3INZA 5LJ3g 4JDSA 4OMFB 3G4ST 4OGEA 2B8AA 2RI5A 2FL7A 2KSSA 2DEQA 3PMTA 1I5LA 5A0LA 3OYGA 4C92B 2M1HA 1QVGA 2JTMA 1Y7XA 1MGQA 3HHTB 2K57A 5GAOl 3NFCA 1KG1A 2AHJB 1VQ5T 4N0AA 1N8RU 5LJ3d 1TH7A 2JUFA 3RUXA 3URGA 4M77D 4OB2B 4FSXA 4XK8E 2PQWA 3ER0A 1VQ6T 4M7DF 1QP2A 4IUUA 3PGGA 2RM4A 2VV5A 4XU0A 2ZPEB 5LJ5d 5GAN4 2OTLT 4A4GA 4PJOE 1WGSA 1WNLA 1Q81U 4X34A 4C8QE 4F7UB 5GMKe 4C5HA 4C8QG 5HKCA 4IUQA 2OTJA 1M4ZA 4BD3A 1YHQA 4QW2A 1UGSB 3JCMh 2EKOA 3H8ZA 4LDWA 3LX7A 5LL6S 4C5IA 3JB9H 4PJOA 2KVQG 2M9UA 3VYGA 2K5FA 3CPWA 1MHNA 3NTHA 1ZHIA 3CCJA 1YBYA 3QBYA 1G5VA 4R56A 1VQLT 2E70A 1QP3A 3CMEA 1KQ2A 3VU3C 1KD1U 2QQRA 3CMET 2E64A 4HT8A 3CCRT 3QJ6A 4J7FA 3RKYA 4IUTA 1S72A 3JCMd 3TREA 3GLXA 3MO8A 4J8OA 2DTIA 4XTZA 4JUVA 2YLCA 4MMLA 3VUZA 3HFOA 2QDYB 2P4TA 5GAOq 1X6OA 3CBOA 3G6ET 1D3BA 1Y71A 2WSEE 2HD0A 3G7ZA 5J3BA 3VUBA 4E7KA 1I4K1 5GAN6 1VQ5A 4PLLA 5IT9E 5GAN2 4F7UF 5LJ5g 4ZTFA 3S6WA 5GANf 4F7UA 3JCMP 4HT9A 4O6JA 5LJ5h 4N4IA 2DIQA 3FLGA 2CZ1B 1M1KU 2XK0A 4J6WA 3L2VA 5GAN7 5CCAA 3RKWA 5GAOn 2FVUA 3R6OA 2EJ9A 2LVMA 1IREB 3M5AA 3MEVA 4C5EA 1VQ4A 1Y07A 1YIJA 4M75G 2VC8A 4BI4A 3X26B 1M8VA 2YHTA 1B34A 3UDCA 3CXCS 2DXBA 1XNIA 4J7IA 2K5IA 2NLUA 4MZPA 3LGFA 4C8QC 5GAMd 2X4JA 2GF7A 3ME9A 3JB9I 5D6XA 2RJDA 1K73U 2DPPB 4KBMB 1OZ3A 3OYLA 4M77B 5GANd 2PVDB 2MI6A 5FLXE 2CKKA 2HNIA 2GFUA 5I2MA 4E7JA 2M0OA 3X20B 5HK3A 3OBWA 4CRIA 5A0GA 1ZBXA 2O01E 2O4XB 4MDWA 1NE8A 3QZ9B 3V7CA 3VJPA 4OF1A 2XDPA 2MMPA 3PFSA 2RI3A 5FRMA 4BDZA 2EQMA 1JRIA 1O75A 4MZTA 2F69A 2PU9B 4JLIA 5CKBA 4EMKB 5I2SA 3BFMA 4HCCA 3AHUA 3HP9A 3S3OA 1ZQ1A 3M53A 3JCMW 4M7DE 3FDRA 4M78B 1I8FA 5C6SA 3PIOA 2MWPA 4ZTJA 1VQ4T 4M7AB 3CCLA 1FWZA 4NL3A 3BDLA 5GAMf 3JAME 3SB2A 2Y90A 2CYZB 2GQVA 4NL2A 3OYAA 3TU4K 3DB3A 3JCMJ 2DO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LOJ A;  5GAM h;  2DZ9 A;  3JCM g;  2DZC A;  3JB9 J;  4X9C A;  4C8Q B;  2DEQ A;  1I5L A;  4PJO B;  5LJ3 h;  4M78 F;  4M7A A;  5GAN h;  3JB9 G;  4M7A E;  5LJ3 e;  2RB6 A;  4C92 B;  4M77 C;  4M75 E;  4OP0 A;  1MGQ A;  2K57 A;  5GAO l;  3QSU A;  4M7D D;  4XU1 A;  1LNX A;  4N0A A;  5LJ3 d;  1TH7 A;  2EJF A;  4J6Y A;  3V7S A;  2QTX A;  5LJ5 e;  1U1T A;  4J6X A;  4M75 D;  3RUX A;  4M77 D;  5GAM j;  4RCC A;  4PJO G;  4XTU A;  5GAN 5;  3HFN A;  5CAI A;  5DY9 A;  4M7A G;  4M7D F;  3PGG A;  2RM4 A;  4XU2 A;  4XU0 A;  5LJ3 j;  5LJ5 d;  3JCM b;  5GAN 4;  1N9R A;  1WQW A;  3FIF A;  3JCM f;  3V8J A;  3JCM X;  5GAN j;  3M4G A;  4EMG A;  4PJO E;  1WNL A;  4C8Q E;  4C92 A;  4F7U B;  3BDU A;  4C8Q G;  5GMK e;  3JCM h;  4PJO A;  5LJ3 g;  2JN0 A;  3JB9 H;  1YCY A;  1U1S A;  3L1A A;  3RES A;  4M75 F;  4XTX A;  2VXF A;  1KQ2 A;  1LJO A;  4C92 G;  3VU3 C;  4C8Q A;  2DVE A;  3BW1 A;  4C92 E;  3JB9 F;  1B34 B;  3JCM e;  5GAO p;  2E64 A;  4HT8 A;  3V7R A;  5GMK h;  2I2L A;  4F7U G;  4M77 A;  3RKY A;  2E41 A;  3QO3 A;  4XTY A;  2DJZ A;  1KQ1 A;  3JCM d;  4NOY A;  3JB9 D;  2DTI A;  4XTZ A;  4JUV A;  2YLC A;  4MML A;  1I81 A;  2DXU A;  3HFO A;  4N0A C;  4XQ3 A;  4QVC A;  5GAO q;  1Y96 B;  1D3B A;  2FB7 A;  4XTW A;  3SWN A;  4M7D G;  4DQ2 A;  3HSB A;  1I4K 1;  4X9D A;  5GAN 6;  4M75 A;  5LJ3 f;  5GAN 2;  4F7U F;  5LJ5 g;  5GAN f;  3V8L A;  4EMK A;  4F7U A;  4M77 G;  3JCM P;  4HT9 A;  5GAM g;  5LJ5 h;  2ZGW A;  2CGH A;  3BY7 A;  4M78 G;  5GMK j;  3EFR A;  3V8K A;  4C92 C;  4J6W A;  1HK9 A;  4XU3 A;  5GAN 7;  2EAY A;  3RKW A;  5GAO n;  2DTH A;  4M7D A;  2EJ9 A;  5GAN g;  1N9S A;  4PJO C;  4F7U E;  2EWN A;  3JCM c;  2VXE A;  4M75 G;  2VC8 A;  4M77 F;  4MMK A;  5GMK m;  4PJO D;  1M8V A;  2YHT A;  3FB9 A;  5GAM e;  1B34 A;  2FYK A;  3RIR A;  1M5Q 1;  4M78 A;  4M7A F;  4HA8 A;  5I21 A;  2DXT A;  4Y91 A;  4C8Q C;  1WQ7 A;  5GAN 3;  4JRK A;  5LJ5 j;  3FJP A;  5GAM d;  4A54 A;  1Y96 A;  5GMK l;  4JRI A;  4PJO F;  5GAN e;  3QUI A;  3JCM V;  3RER A;  3JB9 I;  2E65 A;  4C92 D;  3JCM Q;  2RD1 A;  4M77 E;  3QHS A;  1D3B B;  4M77 B;  3SWN B;  5GAN d;  4A53 A;  1WPY A;  4M7A C;  2EJG A;  1X01 A;  2HNI A;  3SWN C;  4J5Y A;  2YLB A;  4C8Q D;  4M75 C;  4M7D B;  3V7C A;  4XTV A;  4M7A D;  4EMK C;  2E1H A;  4WF2 A;  5GAN 8;  5GAO r;  4EMH A;  4M78 E;  2DKG A;  1JRI A;  4V2S A;  3L2Z A;  4EMK B;  4JLI A;  4C92 F;  5GMK i;  3GIB A;  3BFM A;  3EFS A;  3RKX A;  2RA2 A;  4M75 B;  3AHU A;  4M7D C;  1BIA A;  2DTO A;  3JCM W;  1HXD A;  4M7D E;  5GAO m;  4M78 B;  1I8F A;  1BIB A;  4M7A B;  4NL3 A;  5GAM f;  4RCB A;  3SB2 A;  4C8Q F;  2E10 A;  4M78 C;  2Y90 A;  1JBM A;  4NL2 A;  4PNO A;  4QVD A;  5LJ5 f;  1H64 1;  3INZ A;  3JCM J;  4M78 D; 
#chains in the Genus database with same CATH topology
 2YRV A;  5GAM h;  2L3P A;  1PG5 B;  2FZK B;  4VUB A;  2XD0 A;  3EG0 A;  1T3L A;  4EIK A;  1Q82 C;  2LQN A;  2EPD A;  5GAN h;  1EX4 A;  5ECA A;  3EG3 A;  5CKE A;  5CIU A;  4ZNX A;  1QCN A;  2HQX A;  3RMS A;  2KK4 A;  4C5H A;  3CC7 A;  1U1T A;  1RLQ C;  4J6X A;  4P5N A;  5CVI A;  2COW A;  4EDU A;  3JCM f;  2HBW A;  1G8X A;  2XDB A;  2V1Q A;  4KGZ B;  2EGC A;  1YCY A;  4M75 F;  2YUO A;  3DLM A;  1KQS A;  2D8J A;  1D0Z A;  2OTJ T;  4PKC C;  3CCV Q;  2H8H A;  2AKL A;  3I5S A;  2D9T A;  3CC7 Q;  4FU6 A;  1RAC B;  1R77 A;  2H3E B;  2O9S A;  2P0K A;  1LVK A;  3OW2 P;  1MMG A;  1CKA A;  1SSH A;  4X9D A;  4J9I A;  5KCO A;  3SFM A;  1NJI R;  2LMJ A;  3E9F A;  4XU3 A;  2LRQ A;  1M1G A;  4LD6 A;  3CCJ Q;  1H8K A;  2VXE A;  4D6W A;  4PJO D;  3QDF A;  1IZ6 A;  1IRX A;  2MPX C;  3M59 A;  3I9Q A;  1K9M U;  3OA6 A;  1SRL A;  3LW5 E;  2E65 A;  3GNG A;  3JCM Q;  1D3B B;  1WPY A;  1RAH B;  1VQ7 T;  1H92 A;  2DXC A;  3SWN C;  1K0X A;  2RHX A;  2D1X A;  1MMD A;  4JS4 A;  4F16 A;  2DNU A;  3QXE B;  3EG2 A;  5J39 A;  3MP8 A;  1SPK A;  1BI0 A;  1NZ9 A;  1T3S A;  3CCQ T;  2QA4 T;  1WA7 A;  4E2F B;  3MEA A;  2IIM A;  4GLM A;  1OYX A;  3OYE A;  2D6F A;  1UUE A;  3EAE A;  3A8O B;  3OYB A;  3PNW C;  1VQN T;  2ZPI B;  2DZC A;  4FSS A;  4C8Q B;  2P4R A;  5FU7 C;  2M0Y A;  4M78 F;  2RB6 A;  3G71 Q;  1G3T A;  2EFI A;  4OP0 A;  2G3R A;  1NLP C;  1IHV A;  1BK2 A;  1ZX6 A;  1E6G A;  3OY9 A;  4LUD A;  3QII A;  1ABQ A;  4J6Y A;  2WAC A;  2RJC A;  4OMN A;  1GRI A;  1UE9 A;  5CAI A;  2FZG B;  2ESW A;  2M16 A;  5LJ3 j;  1VQL A;  3GNF B;  1UG1 A;  3FIF A;  3CCJ T;  2O2O A;  4PFZ A;  4EMG A;  4C92 A;  3NGP A;  4BI3 A;  1GCP A;  4F17 A;  3A5Z B;  1GCQ C;  2KT1 A;  4M4Z A;  3G6E A;  3CCQ Q;  4FT4 A;  1VQ8 T;  1PNJ A;  3QZ5 B;  1NYG A;  2Y4X A;  3I35 A;  1I81 A;  1N6A A;  2RI2 A;  4XQ3 A;  1OZ2 A;  5AT1 B;  1XJW B;  4EMK A;  2EGE A;  3QKJ A;  6AT1 B;  5GJW B;  1UGP B;  1YJN T;  2CP7 A;  3JCM c;  1DJ7 B;  2OAU A;  1VQN A;  1WXT A;  1I07 A;  3FB9 A;  4BE1 A;  1NYF A;  1GCQ A;  2NUT B;  2E6N A;  1QVP A;  5GMK l;  1WI7 A;  3WVD B;  2FPF A;  4M77 E;  3EH1 A;  2KR3 A;  1VQP T;  4M7A C;  2E5Q A;  2EGA A;  2CZ6 B;  2KYB A;  5DM7 R;  1EFN A;  4BE0 A;  2DA9 A;  1WJR A;  5A0D A;  3E2U A;  3P8D A;  1YIJ Q;  4IUP A;  4M7D C;  1QKW A;  1M2V B;  1PHT A;  1X43 A;  3VS3 A;  1K8A C;  4PJN A;  1JO8 A;  2DD4 A;  3JCM g;  3JB9 J;  1KHC A;  2D8H A;  3C94 A;  3CC4 T;  1NJI U;  5FU6 B;  4M77 C;  1TUG B;  3L2Q A;  2LZ6 B;  3OB9 A;  4KH1 B;  2JJ9 A;  3UF4 A;  4Z02 A;  3A8L B;  2J6K A;  3CC4 Q;  2MWO A;  4XU2 A;  1M8M A;  3I55 T;  1N9R A;  3TVT A;  3X25 B;  4UC4 A;  1KHI A;  2J05 A;  2L0A A;  1QVF P;  2RHI A;  3A8G B;  3GOX A;  2FPD A;  1QVG S;  4E47 A;  3L1A A;  1U5S A;  3TCJ A;  1MUZ A;  2CP6 A;  2VXF A;  1SG5 A;  4BDY A;  2DVE A;  3FJ5 A;  2JTF A;  2GTJ A;  3RR6 A;  4DOW A;  3DLL A;  4M77 A;  1YJ9 Q;  3OYH A;  4N0A C;  1AZG B;  1QCF A;  4JJB A;  1TUD A;  4CC2 A;  1M2V A;  4FL6 A;  3HSB A;  4QQ6 A;  4M75 A;  3PE0 A;  2LT4 A;  4Y28 E;  1QW1 A;  3BY7 A;  1WXB A;  4M78 G;  3EFR A;  5FU6 C;  1YHQ T;  5KE3 A;  1WJS A;  3VS0 A;  2JXB A;  1Q95 G;  4PLI A;  2L5Q A;  2VWF A;  3O5Z A;  4FCY A;  4M7A F;  5GJV B;  1V1C A;  3EGU A;  3MJX A;  1P92 A;  3MEW A;  4Y91 A;  5FRN A;  3OYK A;  1YJ9 A;  3FRN A;  3SWN B;  4A53 A;  1JXM A;  4A4H A;  2KMT A;  2L89 A;  4M75 C;  4C0G A;  2DBM A;  4A4E A;  1VYV A;  2EQU A;  1Q81 R;  4V2S A;  5GMK i;  1VQ8 Q;  4WCI A;  3SHW A;  3QJY A;  4FYX B;  1EZZ B;  1YJW T;  1M3C A;  1HXD A;  1PKT A;  5GAO m;  3CXC P;  5CKF A;  3CCE T;  2J6F A;  1YJN A;  1ZBJ A;  2C06 A;  3M55 A;  2E10 A;  2QAS A;  1PRL C;  1YP5 A;  4OGE A;  2CT4 A;  2FL7 A;  1G2B A;  3G1J A;  2DEQ A;  2YXY A;  1R0B G;  2QTV A;  5A0L A;  1ABO A;  2JTM A;  1KFZ A;  1Y7X A;  1Q82 R;  5LJ3 d;  1TH7 A;  1S72 Q;  1ZUY A;  2RNA A;  1PD0 A;  4XK8 E;  4IUU A;  2CP5 A;  2ZPE B;  1MV3 A;  2RQV A;  3H0F A;  4PJO E;  1Q81 U;  4C8Q E;  2ROT A;  1E7O A;  1YWP A;  1YHQ A;  3JCM h;  1UGS B;  2EKO A;  3LX7 A;  5LL6 S;  4AFZ C;  1JEG A;  3CPW A;  3CCJ A;  1YBY A;  1CKB A;  1G5V A;  3I55 Q;  5HCK A;  1QP3 A;  3CME A;  3I56 Q;  5KYX A;  1KD1 U;  4FW1 A;  4HT8 A;  2CH4 W;  3QJ6 A;  3RKY A;  1S72 A;  2CP3 A;  3TRE A;  1WHG A;  3MO8 A;  4MML A;  5GAO q;  2WSE E;  4RTT A;  5J3B A;  1VQ5 A;  4N4I A;  4R0K A;  4D8D A;  2CZ1 B;  1M1K U;  1NEG A;  2XK0 A;  4J6W A;  5CCA A;  3RKW A;  1AWX A;  3M5A A;  4M75 G;  2PTK A;  3X26 B;  2YHT A;  4WTO B;  2DM1 A;  1B34 A;  1C1A A;  1XNI A;  2K5I A;  1RI9 A;  2DPP B;  4KBM B;  1OZ3 A;  1PD1 A;  2HNI A;  4E7J A;  3RBB B;  3OBW A;  4CRI A;  5A0G A;  4OF1 A;  5KYU A;  2RI3 A;  5FRM A;  3VRY A;  1JRI A;  1J3T A;  5I2S A;  1Z9Q A;  1WX6 A;  3JCM W;  5C6S A;  1I8F A;  3CCL A;  3BDL A;  2NUP A;  2CUD A;  1Q86 U;  2DZ9 A;  4PJM A;  1U3O A;  3CMA T;  1ZA2 B;  4RG8 A;  4LDV A;  2JW4 A;  3M4Y A;  3G6E Q;  2CUB A;  2RHU A;  4M75 E;  3TSW A;  5D6Y A;  1PC0 A;  4FIB A;  3V7S A;  1AWW A;  4OML A;  4XTU A;  1FMV A;  3M57 A;  3FEO A;  3A8H B;  3CCL Q;  2NUP B;  4HVW A;  1K9A A;  4LDU A;  5KCH A;  1K76 A;  2RF0 A;  2KDS A;  2K2V A;  2WSF E;  5AYF A;  5KH6 A;  1IGQ A;  2A08 A;  1U1S A;  2DE0 X;  1VQ4 Q;  3ULR B;  2FPE A;  2QYZ A;  2CDT A;  3TEE A;  3CCS A;  4FYW B;  1UGQ B;  4GY5 A;  2XHC A;  2HCK A;  1UJY A;  4MZM A;  1N8R C;  4OGC A;  1D1B A;  4JZ4 A;  4A4K A;  3CMA Q;  3ZL7 C;  4OB3 B;  1W2B P;  2YSQ A;  2E4H A;  5IHN A;  3VKI A;  2LT1 A;  1SRM A;  3GPL A;  3CD6 A;  5IN1 A;  3CCS T;  2AKK A;  2HSP A;  5LJ3 f;  4AFU C;  2QG9 B;  2BTT A;  4C92 C;  4PL6 A;  5KYU B;  2BZ8 A;  2O9V A;  4RTU A;  1E6H A;  2RQR A;  2EIF A;  4YTL A;  3CCS Q;  1JXO A;  3ZFJ A;  5KE2 A;  2DD5 A;  1LPL A;  4HA8 A;  1VQO A;  1QWF A;  5LJ5 j;  1Y96 A;  4JRI A;  4AFS C;  3CCU Q;  3M9Q A;  2DJQ A;  1W6X A;  1AZE A;  2DMO A;  4ELY C;  3L2U A;  4J5Y A;  3MKD A;  4EMK C;  2K9G A;  1Q82 U;  4C92 F;  1BBZ A;  3OMG A;  1K73 R;  3REB B;  2HDA A;  3VS7 A;  3LWH A;  2YRC A;  4OMQ A;  4E7H A;  3QSU A;  3CPW S;  1WHJ A;  3UWN A;  4OMO A;  3LLR A;  3M56 A;  2RJE A;  5I11 A;  1Q81 C;  3VS6 A;  4M7A A;  5LJ3 e;  2X4X A;  3CC2 Q;  2ZPH B;  5HK0 A;  2IG0 A;  1OEB A;  3L2W A;  2QTX A;  2EQJ A;  5GAM j;  4JS5 A;  1Q7Y U;  1OI1 A;  1X2K A;  1AD5 A;  5GAN j;  1M90 R;  2C0O A;  3BDU A;  3OYN A;  1VQ9 T;  2F2W A;  3G4S Q;  2A3L A;  1GL5 A;  1JU5 C;  1WIE A;  5FRO A;  2AIR B;  1ZUU A;  3VS1 A;  4OMP A;  3TQ7 P;  4JLG A;  1M1K C;  2VGN A;  2ENM A;  1W1F A;  1WHH A;  4DEX A;  2P84 A;  1HD3 A;  4JRP A;  2LJ3 A;  1UGR B;  1KQ1 A;  2V26 A;  3CC4 A;  2DL7 A;  1TUC A;  3OYC A;  2LCS A;  1UEC A;  5GAM g;  2CGH A;  3GF5 A;  3VS5 A;  2QGF B;  4HCB A;  1B7T A;  3NHN A;  2QEX A;  4F7U E;  1X2Q A;  4ZN3 A;  3CCV T;  5GMK m;  2RH2 A;  4AMC A;  1LCK A;  3HRS A;  1KK7 A;  4C5G A;  1K8A R;  5GAN 3;  1WQ7 A;  3E9G A;  4JRK A;  4L6V 5;  3M0S A;  3JCM V;  2RD1 A;  3CPW P;  2RK2 A;  2E3H A;  4Y92 A;  1X01 A;  5CQX A;  3KXT A;  2CP0 A;  2EBP A;  2YLB A;  1GFD A;  2E1H A;  4WF2 A;  5GAO r;  4NS5 A;  1YNZ A;  1NPR A;  4IUR A;  4M75 B;  2CSQ A;  1K4U S;  4ZN1 A;  4LNP A;  3EGX A;  1Y0M A;  4OB0 B;  4J9B A;  1UHF A;  3EHQ A;  3THK A;  5IXF A;  3CEY A;  1M3B A;  5LJ3 h;  2R5A A;  2JMC A;  3H9N A;  3MEU A;  1UEB A;  2L3R A;  5J26 A;  2YUQ A;  2A28 A;  2OX7 A;  4B6M A;  3EGD A;  1WHK A;  2EVR A;  1VQ8 A;  5A2Q E;  4PJO G;  5GAN 5;  4CC3 A;  2VYT A;  4M7A G;  3SDZ A;  2CZ7 B;  1YJN Q;  1N8R R;  3WVE B;  1WDX A;  4C0D C;  4QT7 A;  2O88 A;  2EQI A;  2V8K A;  4OB1 B;  1Q7Y C;  2F2V A;  3OSV A;  4C0D B;  1QVG P;  3CCR Q;  3J7A F;  2DJZ A;  4NOY A;  3C12 A;  1TSF A;  3UAT A;  3I56 T;  2P0Q A;  2PUO B;  1PWT A;  5KYY A;  3KUF A;  3QYG B;  2KYM A;  3VS4 A;  4LN2 A;  1X75 C;  2HEQ A;  1K0S A;  3E19 A;  2ZGW A;  2NWM A;  1YHQ Q;  3V8K A;  1HK9 A;  1HYO A;  1UDL A;  2EAY A;  2KY9 A;  3PTA A;  1ZSG A;  2A7Y A;  3JV3 A;  1TTH B;  3I55 A;  4MMK A;  3CME Q;  2EYX A;  5DLO A;  4M78 A;  2DLP A;  1WYX A;  4J9H A;  4M7A E;  3CBM A;  2KNB B;  1VQM Q;  4GLK A;  1M9S A;  3CCL T;  5CQY A;  3QHS A;  2QA4 A;  2EKH A;  2EJG A;  3NMZ C;  2X4Y A;  3G71 A;  4M7A D;  1W2B A;  3LGL A;  1KC8 C;  3CCM T;  3EGD B;  1WLP B;  2GFA A;  4XAX B;  2ED0 A;  4BE2 A;  2E6Z A;  3U23 A;  2LP5 A;  1VQM A;  2X51 A;  1VIF A;  5FU7 B;  4M78 C;  4PNO A;  4Z89 A;  3INZ A;  2OTJ Q;  4OMF B;  2RI5 A;  1SF9 A;  3PMT A;  2OAW A;  1M2O A;  2COY A;  4C92 B;  2MYS A;  2HL3 A;  1N8R U;  1YI2 Q;  4HVU A;  4OB2 B;  1VOM A;  5KYN A;  1N5Z A;  3ER0 A;  3PGG A;  5LJ5 d;  5GAN 4;  1R0C B;  4F7U B;  2FO0 A;  4C8Q G;  2OTJ A;  1M4Z A;  4QW2 A;  1IB8 A;  2GGR A;  3HTR A;  2M9U A;  1MHN A;  3NTH A;  1MMA A;  2E70 A;  3H41 A;  3VU3 C;  2NUZ A;  1I1J A;  4J7F A;  1MV0 B;  3JCM d;  4J9G A;  2DF6 A;  2KE9 A;  2QDY B;  1Y71 A;  4E7K A;  3AT1 B;  2HKN A;  4QKU A;  1OX9 A;  5IT9 E;  4PJJ A;  5LJ5 g;  3JCM P;  1X6B A;  1PCX A;  3FLG A;  2AZV A;  5GAN 7;  2FVU A;  2LVM A;  4C5E A;  1VQ4 A;  1Y07 A;  1YIJ A;  1AWO A;  4RTZ A;  4J7I A;  4MZP A;  5GAM d;  1WFW A;  1TU0 B;  2GF7 A;  2X4J A;  1WHL A;  3ME9 A;  2RJD A;  1K73 U;  2DFU A;  3CD6 Q;  2PVD B;  1IGU A;  3C0C A;  2MI6 A;  2CKK A;  2M0O A;  5HK3 A;  1OU8 A;  2DRM A;  2QAZ A;  1ZBX A;  2O4X B;  1IHW A;  1NE8 A;  3VJP A;  2ED1 A;  4RTW A;  1OOT A;  2XDP A;  3PFS A;  4FW2 A;  4D8K A;  2C0T A;  2F69 A;  5CKB A;  3H0H A;  4ESR A;  3S3O A;  4M7D E;  3PIO A;  2MWP A;  2CRE A;  1VQ4 T;  1VQO Q;  1YIT Q;  4NL3 A;  1SKU B;  3M0P A;  3SB2 A;  3TU4 K;  2ATC B;  2DO3 A;  1A0N B;  2G6F X;  4R55 A;  2COZ A;  4F14 A;  2DK3 A;  4Z8A A;  1YIT T;  1OQK A;  3UA6 A;  3BE3 A;  1NPP A;  3LH0 A;  1M90 U;  1LNX A;  2CS7 A;  1WXU A;  3PMI A;  5C0M A;  4A4F A;  2K2M A;  1YJW Q;  5DY9 A;  3EGX B;  2MOX A;  3QYH B;  8AT1 B;  3JCM b;  1ZSZ C;  3X28 B;  2QEX T;  4DOV A;  4FM4 B;  2XG8 D;  2Y4Y A;  2XU8 A;  5IHI A;  1Q86 C;  2FZC B;  4FYV B;  4LXC A;  3P8B B;  2KXD A;  3MCA B;  4ZGE B;  2KRN A;  1QVF S;  2L8D A;  4C8Q A;  3JB9 F;  3CC2 A;  3JRZ A;  3QO3 A;  4QVC A;  1TS9 A;  2LJ0 A;  4DBR A;  1Y96 B;  1BCM A;  4XTW A;  4DQ2 A;  2RPN A;  1MMN A;  2DVJ A;  3ASK A;  5CKD A;  1W2B S;  3G4S A;  3HL8 A;  1RI0 A;  3OYF A;  1UFF A;  1GBR A;  5IAY A;  2CT3 A;  4M77 F;  3OYJ A;  1BB9 A;  2LQ8 A;  4QQG A;  1W4S A;  3OQ5 A;  3ZEH A;  1TWB A;  2QQB A;  4Q5W A;  4BB7 A;  3L2R A;  3CC7 T;  1UHC A;  1VQM T;  4JJN K;  2BE9 B;  4C92 D;  4A63 B;  3G71 T;  2FG0 A;  3LWI A;  2JMA A;  4RTX A;  5FWB A;  4PJL A;  2R58 A;  2JNG A;  3LYI A;  5GAN 8;  1B3Q A;  1PRM C;  4HKE A;  2YRD A;  1VQP A;  4LDY A;  4RKU E;  3EFS A;  2EW3 A;  2DL3 A;  3M58 A;  2ZZD A;  3PIP A;  4RCB A;  4C8Q F;  2RQW A;  4QVD A;  4B9X A;  5CK9 A;  4HVV A;  2XMF A;  4PJO B;  2V8J A;  3I56 A;  5EG2 A;  4E7I A;  2JT4 A;  1W70 A;  1M1F A;  2VUB A;  3CCM Q;  1VQP Q;  2PNI A;  4M75 D;  5LJ5 e;  3WXM B;  1R8O B;  2GTO A;  2J6O A;  4EPC A;  1QWE A;  2IPO B;  1VYU A;  4HXJ A;  2ZPF B;  2D0Q B;  5FWC A;  4E7Z A;  4KUD K;  1SHG A;  2XI9 A;  3I5R A;  3DKM A;  3CD6 T;  4C92 G;  2EYQ A;  4RG2 A;  4B9W A;  2E41 A;  2VB6 A;  2LC4 A;  1RAG B;  3RDV A;  2DXU A;  1M30 A;  1FXX A;  3DB4 A;  1UGV A;  2ZAE A;  4AG2 C;  4M7D G;  2PZ1 A;  2QQ9 A;  3S3M A;  2PUK B;  5GMK j;  1UTI A;  4LUE A;  5KYX B;  3VV0 A;  4ANJ A;  4AG1 C;  4BAC A;  3OW2 A;  2RQT A;  1C6V X;  5GAM e;  1VQ6 A;  2FYK A;  3RMQ A;  2V1R A;  5CO7 A;  4DA4 A;  1X69 A;  4PJO F;  2ECZ A;  3L42 A;  3QDR B;  4GBQ A;  2KAF A;  2ZPG B;  1RAE B;  1JJ2 A;  5IXB A;  4XTV A;  2FHD A;  1BCO A;  1YJ9 T;  2QGG A;  2L2P A;  5L8R E;  4EMH A;  5CKH A;  4HCZ A;  4ME7 A;  2YT6 A;  3RKX A;  2RA2 A;  1VQ6 Q;  1C0M A;  2PVG B;  2JOY A;  1KC8 R;  5CR2 A;  1JBM A;  3M0U A;  2QA4 Q;  1BI1 A;  2LX9 A;  4K11 A;  3QG1 A;  1QVF A;  1KJW A;  4RMO A;  4QVZ A;  1D1A A;  2RN8 A;  1N27 A;  4RTY A;  1F1B B;  4KUL A;  2SEM A;  1Q86 R;  3UA7 A;  4M7D D;  1ZUK A;  2LNH B;  1JB0 E;  3MP6 A;  5DLQ E;  1T0H A;  3LH5 A;  4RCC A;  2KI7 A;  1UJ0 A;  2RMO A;  4IIO A;  3JCM X;  2FEI A;  3CBP A;  4FYY B;  1D1C A;  3OS5 A;  4N4H A;  3ZBD A;  1S1N A;  4DEY A;  3OS1 A;  7AT1 B;  3OYM A;  2PVO B;  3RES A;  4CC4 B;  1XQH A;  4C92 E;  3JCM e;  1RUW A;  5GAO p;  1CSK A;  3V7R A;  2BKD N;  1S72 T;  4MDX A;  1ZLM A;  2DAQ A;  1YI2 A;  1SSF A;  4ZGJ B;  3NTK A;  2H3J A;  2KT8 A;  2QK0 A;  1GXI E;  2B86 A;  3J81 E;  4BY6 B;  3HRU A;  2W10 A;  1YWO A;  1VUB A;  2KQW A;  2K3Y A;  4M77 G;  3HPW A;  1WHM A;  1D0Y A;  1BI2 A;  2K79 A;  4LDX A;  1AHJ B;  2OTL Q;  1N9S A;  3MPU B;  1UB4 A;  2X3X D;  3M0T A;  2JVV A;  2RHZ A;  4J9C A;  2J7I A;  3S3N A;  3OS2 A;  1XOV A;  1MND A;  5I21 A;  4L59 A;  1YIT A;  3HKS A;  3FJP A;  4A54 A;  3A1P A;  2KBT A;  2EYZ A;  2MCN A;  4LD9 K;  3MHX A;  2GNC A;  3SD4 A;  4RTV A;  3MET A;  3UT1 A;  3M54 A;  2X4W A;  2DKG A;  5KYW B;  3CCE A;  1YJW A;  4PK4 A;  2V8I A;  1FX7 A;  1H64 1;  5LJ3 g;  4JDS A;  1MNE A;  2KSS A;  2HKQ B;  1I5L A;  1Y57 A;  3CQT A;  3HHT B;  2K57 A;  5GAO l;  3NFC A;  3URG A;  4M77 D;  4FSX A;  4DBH A;  2PQW A;  2YDL A;  4M7D F;  1QP2 A;  2RM4 A;  2VV5 A;  5L23 A;  4A4G A;  1WGS A;  1GBQ A;  5HKC A;  4BD3 A;  4LDW A;  4PJO A;  2KVQ G;  3NPF A;  3QBY A;  2QEX Q;  1VQL T;  2E5K A;  1KQ2 A;  2GBQ A;  1TOV A;  2OJ2 A;  1OX8 A;  2E64 A;  3CCR T;  3REA B;  4IUT A;  1FMK A;  4J8O A;  2DTI A;  4XTZ A;  4JUV A;  3HFO A;  2P4T A;  1D3B A;  3G7Z A;  1HSQ A;  1AEY A;  5GAN 6;  1VQ7 Q;  4F7U F;  5GAN f;  4HT9 A;  1ZSZ A;  4O6J A;  2ABL A;  2Z0W A;  2NYS A;  5GAO n;  2A36 A;  3R6O A;  3MEV A;  1QMC A;  1RAF B;  2VC8 A;  4BI4 A;  1M8V A;  2LQW A;  3UDC A;  3CXC S;  2DXB A;  1ZSZ B;  3LGF A;  4C8Q C;  3OYL A;  2DL4 A;  1TG0 A;  2HZY A;  5I2M A;  3X20 B;  2D0N A;  2A0F B;  1I5O B;  2KXC A;  3QZ9 B;  4BDZ A;  2EQM A;  1O75 A;  1VQN Q;  2CSI A;  1NEB A;  1T0J A;  4M78 B;  1KQS P;  4OMM A;  1FWZ A;  3JAM E;  3JCM J;  5D7U A;  2RJF A;  2ROL A;  1RAB B;  2EYW A;  5FW9 A;  2JZ2 A;  2VAS A;  2RQU A;  4XU1 A;  2W0Z A;  2M02 A;  2EJF A;  1ACM B;  2XID A;  3CCR A;  2O4X A;  3N5B B;  2K6D A;  1KD1 C;  4O5V A;  3HRT A;  2BIV A;  3OYI A;  1NBE B;  2K3X A;  2LNV A;  3X24 B;  4ORZ A;  4X1V A;  2JN0 A;  2A37 A;  2QQS A;  5KYY B;  2E3I A;  3JSC A;  3H6Z A;  3J80 E;  1M90 C;  4XTX A;  2DEU A;  2OI3 A;  1LJO A;  2QXF A;  4HCK A;  5M9O A;  1K9M C;  1B07 A;  1O9S A;  4AFQ C;  1OU9 A;  4XTY A;  9ATC B;  1X27 A;  3JB9 D;  1M1K R;  1VA7 A;  3SEM A;  2QI2 A;  3EFO B;  2FB7 A;  3QPH A;  2JTE A;  1AWJ A;  2R57 A;  2MF2 A;  4OVA A;  1G3W A;  3EG1 A;  1U8R A;  2RHY A;  2BZY A;  1SEM A;  4KT0 E;  1AOJ A;  2SRC A;  3D7S B;  5IHK A;  2XKO C;  3VS2 A;  2KGT A;  1IXD A;  3EFO A;  3QUI A;  2O31 A;  4JJD A;  4KGV B;  1NLO C;  2KRM A;  4C8Q D;  2E12 A;  2L3Q A;  3OW2 S;  3PVQ A;  2F5K A;  4M78 E;  2CZ0 B;  1AVZ C;  1EIF A;  3QWY A;  4J9D A;  2MIO A;  2DTO A;  1VQK A;  4DBF A;  4ZGD B;  1BIB A;  1YCS B;  1K1Z A;  4ELZ C;  3QWX X;  2DIG A;  1RAA B;  4M78 D;  2M51 A;  1JJ2 S;  3EG9 B;  1ZA1 B;  4LE9 A;  1YN8 A;  2AK5 A;  1G3Y A;  1V76 A;  1GFC A;  4DBQ A;  3JB9 G;  1WJQ A;  1FMW A;  4JRQ A;  1M3A A;  2RO0 A;  3RNJ A;  3CCV A;  4L5G A;  4II1 A;  2HBP A;  2I0N A;  4N4G A;  2P0P A;  4KRT A;  2L3S A;  2LJ1 A;  1I0C A;  1VQK Q;  2K4Y A;  2QQA A;  3V8J A;  3M4G A;  2K3B A;  1BKB A;  2IVW A;  1JJ2 P;  2LCC A;  4E7L A;  2JM8 A;  2OTL A;  4C0Z A;  3CC2 T;  2CP2 A;  4J9E A;  2DL5 A;  3CXC A;  1X6G A;  3BW1 A;  1V29 B;  1VQ9 A;  3C95 A;  2HL5 C;  2F2X A;  2VGM A;  2I2L A;  2XDD A;  1NJI C;  2YWW A;  3SWN A;  2FRW A;  1K73 C;  2DET A;  1PSE A;  3V8L A;  3CPF A;  4IKF A;  1OPK A;  2LDM A;  1OPL A;  4KUI A;  2NUT A;  1RL2 A;  2J06 A;  4RUG A;  3CCU T;  3EG9 A;  4CI0 C;  1RAD B;  1WZO A;  2DTH A;  3NTI A;  5GAN g;  2DRK A;  2EWN A;  2BUD A;  1HJD A;  2RK1 A;  1NM7 A;  2GCX A;  1VQ9 Q;  3RIR A;  4TVR A;  2DXT A;  1AT1 B;  5EC7 A;  3M0Q A;  2JS2 A;  2HQE A;  1VQK T;  3EHR A;  4KH0 B;  2KEA A;  1OV3 A;  1VQ5 Q;  3KBG A;  3A8M B;  2X9H A;  1BU1 A;  3OMC A;  3OSS C;  3L2Z A;  3GIB A;  2K7A A;  1NG2 A;  3P8H A;  2X3W D;  5LJ5 f;  1H3H A;  1TXQ A;  3C4S A;  2HSE B;  4E6R A;  1LOJ A;  1D09 B;  3R6N A;  3IQL A;  3VYH B;  4X9C A;  1IO6 A;  1KC8 U;  1VQO T;  2DBK A;  1SHF A;  2R5M A;  3OYY A;  2F1L A;  1YIJ T;  1H3Z A;  1XTD A;  2MAM A;  4BY6 C;  3CCE Q;  3HFN A;  1PSF A;  2K5L A;  1WQW A;  2LX7 A;  8ATC B;  3VRZ A;  5HY6 A;  5KYW A;  3M0R A;  2BE7 D;  3O8V A;  1JQQ A;  2FRY A;  2LTO A;  2AZS A;  3E1S A;  2DER A;  3OBY A;  4BUG A;  4PFO A;  1B34 B;  2VKN A;  2X35 A;  3UPU A;  1YI2 T;  5GMK h;  4J9F A;  2AT1 B;  4Z88 A;  4F7U G;  1BYM A;  4BI8 B;  3GP8 A;  5D6W A;  2JM9 A;  1K8A U;  1VQL Q;  2ZPB B;  1QQJ A;  1OUL A;  3PT9 A;  1QKX A;  1BI3 A;  2MK5 A;  3MP1 A;  1RLP C;  2LCL A;  4FT2 A;  1K9M R;  1D0X A;  3F70 A;  4M7D A;  4PJO C;  4CC7 A;  2CH4 A;  3OS0 A;  3FC3 A;  3CCQ A;  1KQS S;  1M5Q 1;  3H0I A;  3CMA A;  5GAN e;  3RER A;  4QQD A;  2KRO A;  1G3S A;  2F5T X;  2EYY A;  4J83 A;  1VQ7 A;  2ZCF B;  4C0F A;  3GBQ A;  2LQK A;  4M7D B;  4F04 B;  2WSC E;  2XIC A;  3Q1J A;  4IIM A;  3TSZ A;  4ATO A;  1VIE A;  3CCM A;  5I22 A;  2DL8 A;  2QDL A;  2EQK A;  4JJC A;  5IH2 A;  2HAX A;  3T9N A;  1BIA A;  3EH2 A;  3OYD A;  2DIL A;  1Z9Z A;  4IUV A;  3CCU A;  1Q7Y R;  3G4S T;  2B8A A;  1FYN A;  4JZ3 A;  3OYG A;  2M1H A;  1QVG A;  1MGQ A;  1KG1 A;  2AHJ B;  1VQ5 T;  4N0A A;  2JUF A;  3RUX A;  2YUP A;  4E7S A;  1VQ6 T;  2DYB A;  1RAI B;  4XU0 A;  2OTL T;  2C0I A;  1WNL A;  4X34 A;  2DYI A;  2JS0 A;  5GMK e;  1ARK A;  4IUQ A;  1KD1 R;  1QLY A;  3H8Z A;  4KGX B;  4C5I A;  3JB9 H;  3PVL A;  3VYG A;  2K5F A;  1ZHI A;  1KSW A;  4R56 A;  2HMA A;  4AT1 B;  2QQR A;  2VVK A;  3CME T;  1YFN A;  1KIK A;  2DX1 A;  3GLX A;  3VUZ A;  1VYT A;  2YLC A;  1X6O A;  3CBO A;  3G6E T;  2HD0 A;  1U06 A;  3VUB A;  1I4K 1;  4PLL A;  4ZTF A;  5GAN 2;  3S6W A;  4F7U A;  5LJ5 h;  2DIQ A;  2BZX A;  1M27 C;  3L2V A;  2KRS A;  2EJ9 A;  1IRE B;  2NLU A;  1PKS A;  2GQI A;  3JB9 I;  5D6X A;  4M77 B;  5GAN d;  4PFP A;  5FLX E;  1QCO A;  2GFU A;  2O01 E;  1G83 A;  4MDW A;  3V7C A;  4JPB W;  2MMP A;  2HQH A;  1PM3 A;  4MZT A;  3A98 A;  4EMK B;  2PU9 B;  4JLI A;  3BFM A;  4HCC A;  3AHU A;  3HP9 A;  3KFV A;  1ZQ1 A;  3M53 A;  3FDR A;  4ZTJ A;  2YUN A;  4M7A B;  5GAM f;  2Y90 A;  2CYZ B;  2GQV A;  4NL2 A;  3OYA A;  3DB3 A; 
#chains in the Genus database with same CATH homology
 2YRV A;  4R55 A;  1Q86 U;  5GAM h;  2DZ9 A;  4VUB A;  2RJF A;  2XD0 A;  2DK3 A;  3CMA T;  1Q82 C;  1YIT T;  4RG8 A;  4LDV A;  2JZ2 A;  5GAN h;  3M4Y A;  4M7A E;  2RHU A;  4M75 E;  1NPP A;  4XU1 A;  5CKE A;  3LH0 A;  5CIU A;  5D6Y A;  1LNX A;  1M90 U;  2CS7 A;  3CCR A;  2EJF A;  2HQX A;  2KK4 A;  2XID A;  4FIB A;  3RMS A;  2O4X A;  3N5B B;  3PMI A;  1U1T A;  4J6X A;  3V7S A;  4A4F A;  4P5N A;  5C0M A;  3CC7 A;  4XTU A;  5CVI A;  4O5V A;  1KD1 C;  3M57 A;  5DY9 A;  3QYH B;  3FEO A;  2BIV A;  3HRT A;  4EDU A;  3A8H B;  3JCM b;  3OYI A;  3X28 B;  3JCM f;  4LDU A;  4DOV A;  2QEX T;  5KCH A;  2K3X A;  2LNV A;  2XDB A;  4FM4 B;  2XG8 D;  2Y4Y A;  3X24 B;  2XU8 A;  2KDS A;  2K2V A;  2WSF E;  5AYF A;  5KH6 A;  1Q86 C;  2JN0 A;  1YCY A;  2QQS A;  3JSC A;  3H6Z A;  3J80 E;  1U1S A;  1M90 C;  3P8B B;  3MCA B;  4M75 F;  4XTX A;  4ZGE B;  3DLM A;  3TEE A;  3CCS A;  1QVF S;  1UGQ B;  1LJO A;  4GY5 A;  2L8D A;  1KQS A;  4C8Q A;  4PKC C;  2QXF A;  3JB9 F;  2XHC A;  2OTJ T;  3CC2 A;  3JRZ A;  5M9O A;  1K9M C;  4MZM A;  1O9S A;  1N8R C;  4OGC A;  4A4K A;  2D9T A;  3QO3 A;  4XTY A;  4OB3 B;  4FU6 A;  3JB9 D;  4QVC A;  3VKI A;  2LT1 A;  1Y96 B;  2QI2 A;  3GPL A;  2P0K A;  2FB7 A;  4XTW A;  5IN1 A;  3CCS T;  3CD6 A;  4DQ2 A;  4X9D A;  5LJ3 f;  5KCO A;  3ASK A;  3SFM A;  3QPH A;  5CKD A;  1W2B S;  3G4S A;  3HL8 A;  1RI0 A;  2R57 A;  4C92 C;  3OYF A;  3E9F A;  4PL6 A;  2MF2 A;  4XU3 A;  2LRQ A;  4OVA A;  1M1G A;  1G3W A;  4LD6 A;  2EIF A;  4YTL A;  5IAY A;  2VXE A;  2RHY A;  4M77 F;  1U8R A;  4D6W A;  3OYJ A;  4PJO D;  2LQ8 A;  4QQG A;  1W4S A;  3OQ5 A;  4KT0 E;  3ZEH A;  1IZ6 A;  2QQB A;  4Q5W A;  3ZFJ A;  4BB7 A;  3M59 A;  5KE2 A;  3L2R A;  3CC7 T;  2DD5 A;  2XKO C;  4HA8 A;  3OA6 A;  1VQM T;  1VQO A;  1K9M U;  5LJ5 j;  4JJN K;  1Y96 A;  3LW5 E;  4JRI A;  3QUI A;  3M9Q A;  2E65 A;  4C92 D;  3GNG A;  3JCM Q;  3G71 T;  1D3B B;  3LWI A;  1WPY A;  1VQ7 T;  2DXC A;  3SWN C;  2RHX A;  2R58 A;  4J5Y A;  4ELY C;  3L2U A;  4C8Q D;  2JNG A;  3LYI A;  4JS4 A;  2E12 A;  3OW2 S;  4EMK C;  5GAN 8;  3QXE B;  5J39 A;  2F5K A;  4M78 E;  3MP8 A;  1BI0 A;  1NZ9 A;  1Q82 U;  4HKE A;  1VQP A;  2CZ0 B;  4LDY A;  4C92 F;  4RKU E;  3CCQ T;  2QA4 T;  1EIF A;  3EFS A;  3OMG A;  3MEA A;  2DTO A;  3M58 A;  1VQK A;  2ZZD A;  3PIP A;  1OYX A;  4ZGD B;  1BIB A;  3OYE A;  3LWH A;  2D6F A;  3EAE A;  4RCB A;  4C8Q F;  4ELZ C;  4QVD A;  2DIG A;  3A8O B;  3OYB A;  4E7H A;  4B9X A;  3QSU A;  4M78 D;  3CPW S;  3PNW C;  3UWN A;  5CK9 A;  1JJ2 S;  2ZPI B;  1VQN T;  2DZC A;  3LLR A;  3M56 A;  4C8Q B;  2RJE A;  1G3Y A;  1Q81 C;  4PJO B;  5FU7 C;  2V8J A;  4M78 F;  4M7A A;  3JB9 G;  3I56 A;  1WJQ A;  4JRQ A;  2RO0 A;  5LJ3 e;  2RB6 A;  5EG2 A;  1G3T A;  4E7I A;  2EFI A;  2X4X A;  2ZPH B;  2G3R A;  4L5G A;  4OP0 A;  1M1F A;  3CCV A;  2VUB A;  5HK0 A;  4II1 A;  2IG0 A;  3OY9 A;  3QII A;  4J6Y A;  2HBP A;  3L2W A;  2WAC A;  2RJC A;  2QTX A;  2EQJ A;  4M75 D;  4N4G A;  3WXM B;  5LJ5 e;  2P0P A;  5GAM j;  4JS5 A;  1Q7Y U;  1OI1 A;  5CAI A;  1R8O B;  2M16 A;  4EPC A;  2K4Y A;  3GNF B;  5LJ3 j;  1VQL A;  2QQA A;  3FIF A;  3V8J A;  3CCJ T;  5GAN j;  3M4G A;  4EMG A;  4C92 A;  3BDU A;  1BKB A;  3OYN A;  2IVW A;  2ZPF B;  1VQ9 T;  2A3L A;  2D0Q B;  2LCC A;  5FRO A;  4E7L A;  4BI3 A;  4KUD K;  2OTL A;  4C0Z A;  3A5Z B;  2XI9 A;  3CC2 T;  3DKM A;  3CD6 T;  4JLG A;  3CXC A;  4C92 G;  3G6E A;  1M1K C;  2VGN A;  1V29 B;  3BW1 A;  1VQ9 A;  2EYQ A;  4FT4 A;  1VQ8 T;  3C95 A;  3QZ5 B;  4RG2 A;  4B9W A;  4JRP A;  2VGM A;  1UGR B;  2I2L A;  2Y4X A;  2E41 A;  1KQ1 A;  2LC4 A;  1I81 A;  1N6A A;  2DXU A;  2RI2 A;  1FXX A;  3DB4 A;  4XQ3 A;  2XDD A;  1NJI C;  3CC4 A;  3SWN A;  4M7D G;  1K73 C;  1OZ2 A;  2QQ9 A;  3OYC A;  1PSE A;  3V8L A;  3CPF A;  4EMK A;  3S3M A;  4IKF A;  2LDM A;  5GAM g;  4KUI A;  3QKJ A;  2CGH A;  2PUK B;  3GF5 A;  5GMK j;  1RL2 A;  3CCU T;  4CI0 C;  4HCB A;  2DTH A;  3NTI A;  3VV0 A;  5GAN g;  1UGP B;  2QEX A;  1YJN T;  4F7U E;  2EWN A;  2BUD A;  1DJ7 B;  3JCM c;  2OAU A;  4ZN3 A;  5GMK m;  2RH2 A;  3CCV T;  4BAC A;  2RK1 A;  3OW2 A;  1VQN A;  2GCX A;  3FB9 A;  5GAM e;  4BE1 A;  1VQ6 A;  3HRS A;  2FYK A;  3RMQ A;  3RIR A;  4C5G A;  4TVR A;  2E6N A;  5CO7 A;  4DA4 A;  2DXT A;  5GAN 3;  1WQ7 A;  1QVP A;  3E9G A;  4JRK A;  4L6V 5;  5GMK l;  4PJO F;  3WVD B;  3JCM V;  1VQK T;  2HQE A;  2RD1 A;  4M77 E;  3L42 A;  3QDR B;  2RK2 A;  1VQP T;  4M7A C;  2E5Q A;  1X01 A;  5CQX A;  2CZ6 B;  2KAF A;  3KBG A;  5DM7 R;  3KXT A;  2ZPG B;  3A8M B;  4BE0 A;  2YLB A;  1WJR A;  5A0D A;  1JJ2 A;  4XTV A;  2FHD A;  1YJ9 T;  2E1H A;  4WF2 A;  5GAO r;  3OMC A;  5L8R E;  4EMH A;  3P8D A;  3OSS C;  5CKH A;  4NS5 A;  4HCZ A;  4ME7 A;  3L2Z A;  1NPR A;  4IUR A;  3GIB A;  3RKX A;  2RA2 A;  4IUP A;  4M75 B;  4M7D C;  4ZN1 A;  2PVG B;  2JOY A;  5CR2 A;  3P8H A;  1K8A C;  1JBM A;  4OB0 B;  5LJ5 f;  2DD4 A;  3C4S A;  1LOJ A;  1BI1 A;  2LX9 A;  3JCM g;  3JB9 J;  3VYH B;  3CEY A;  4X9C A;  1KHC A;  3QG1 A;  1QVF A;  1KC8 U;  5LJ3 h;  1VQO T;  2R5A A;  4RMO A;  3C94 A;  4QVZ A;  1N27 A;  3MEU A;  3CC4 T;  2R5M A;  1UEB A;  1NJI U;  4KUL A;  5FU6 B;  2L3R A;  5J26 A;  4M77 C;  3OYY A;  3L2Q A;  1YIJ T;  4M7D D;  1H3Z A;  3OB9 A;  1XTD A;  1JB0 E;  2MAM A;  4Z02 A;  1VQ8 A;  3MP6 A;  3A8L B;  5DLQ E;  4BY6 C;  5A2Q E;  4RCC A;  4PJO G;  5GAN 5;  3HFN A;  2VYT A;  4M7A G;  1PSF A;  3SDZ A;  2MWO A;  2CZ7 B;  4XU2 A;  3I55 T;  2K5L A;  1N9R A;  1WQW A;  3JCM X;  3X25 B;  4UC4 A;  1KHI A;  2RHI A;  3WVE B;  3CBP A;  3OS5 A;  4N4H A;  3ZBD A;  3A8G B;  5HY6 A;  3OS1 A;  3GOX A;  3O8V A;  3OYM A;  1QVG S;  2PVO B;  4E47 A;  4C0D C;  2LTO A;  3L1A A;  3E1S A;  3RES A;  3TCJ A;  2VXF A;  4BDY A;  3OBY A;  1XQH A;  2V8K A;  4C92 E;  2DVE A;  4OB1 B;  2JTF A;  4BUG A;  1B34 B;  3JCM e;  5GAO p;  2X35 A;  4DOW A;  1Q7Y C;  3V7R A;  3UPU A;  2BKD N;  3OSV A;  5GMK h;  4C0D B;  1YI2 T;  1S72 T;  4F7U G;  4MDX A;  3DLL A;  2DAQ A;  4M77 A;  3J7A F;  1BYM A;  1YI2 A;  2DJZ A;  1SSF A;  4BI8 B;  4NOY A;  4ZGJ B;  3NTK A;  3OYH A;  2H3J A;  3C12 A;  4N0A C;  3GP8 A;  5D6W A;  3I56 T;  2P0Q A;  2PUO B;  1GXI E;  3J81 E;  3KUF A;  3QYG B;  4BY6 B;  3HRU A;  4FL6 A;  1K8A U;  3HSB A;  4QQ6 A;  2ZPB B;  4M75 A;  1VUB A;  2KQW A;  3PT9 A;  2K3Y A;  2LT4 A;  1X75 C;  4M77 G;  3HPW A;  4Y28 E;  1QW1 A;  3E19 A;  2ZGW A;  3BY7 A;  1BI3 A;  3MP1 A;  3EFR A;  4M78 G;  5FU6 C;  3V8K A;  1YHQ T;  5KE3 A;  1HK9 A;  1BI2 A;  1WJS A;  2LCL A;  2EAY A;  2KY9 A;  4FT2 A;  3PTA A;  4LDX A;  2A7Y A;  3F70 A;  4M7D A;  1AHJ B;  1N9S A;  4PJO C;  3I55 A;  4MMK A;  1UB4 A;  3OS0 A;  5DLO A;  2JVV A;  2RHZ A;  3FC3 A;  3S3N A;  4PLI A;  3CCQ A;  1KQS S;  2L5Q A;  3OS2 A;  1XOV A;  1M5Q 1;  4M78 A;  4M7A F;  5I21 A;  4L59 A;  1P92 A;  3MEW A;  4Y91 A;  3HKS A;  3CBM A;  3CMA A;  3FJP A;  1YIT A;  4A54 A;  4GLK A;  1M9S A;  5FRN A;  5GAN e;  3CCL T;  3OYK A;  3RER A;  4QQD A;  1YJ9 A;  3FRN A;  1G3S A;  5CQY A;  3QHS A;  3SWN B;  2QA4 A;  2F5T X;  4A53 A;  2EJG A;  4J83 A;  1VQ7 A;  4LD9 K;  4A4H A;  3MHX A;  2ZCF B;  4C0F A;  2KMT A;  2L89 A;  2X4Y A;  2LQK A;  3SD4 A;  4M75 C;  3MET A;  4M7D B;  2WSC E;  2XIC A;  3UT1 A;  3G71 A;  4M7A D;  3M54 A;  2X4W A;  4C0G A;  1W2B A;  3Q1J A;  4A4E A;  4ATO A;  3LGL A;  1VIE A;  3CCM A;  2DKG A;  1KC8 C;  2EQU A;  3CCM T;  4V2S A;  5GMK i;  2EQK A;  3CCE A;  3QJY A;  1YJW A;  1YJW T;  1BIA A;  2GFA A;  4XAX B;  2V8I A;  3T9N A;  1HXD A;  2HAX A;  5GAO m;  3OYD A;  5CKF A;  4BE2 A;  1YJN A;  3CCE T;  1FX7 A;  2E6Z A;  2C06 A;  3M55 A;  1VQM A;  1VIF A;  2E10 A;  5FU7 B;  4M78 C;  4IUV A;  4PNO A;  3CCU A;  1H64 1;  3INZ A;  5LJ3 g;  4JDS A;  4OMF B;  3G4S T;  4OGE A;  2B8A A;  2RI5 A;  2FL7 A;  2KSS A;  2DEQ A;  3PMT A;  1I5L A;  5A0L A;  3OYG A;  4C92 B;  2M1H A;  1QVG A;  2JTM A;  1Y7X A;  1MGQ A;  3HHT B;  2K57 A;  5GAO l;  3NFC A;  1KG1 A;  2AHJ B;  1VQ5 T;  4N0A A;  1N8R U;  5LJ3 d;  1TH7 A;  2JUF A;  3RUX A;  3URG A;  4M77 D;  4OB2 B;  4FSX A;  4XK8 E;  2PQW A;  3ER0 A;  1VQ6 T;  4M7D F;  1QP2 A;  4IUU A;  3PGG A;  2RM4 A;  2VV5 A;  4XU0 A;  2ZPE B;  5LJ5 d;  5GAN 4;  2OTL T;  4A4G A;  4PJO E;  1WGS A;  1WNL A;  1Q81 U;  4X34 A;  4C8Q E;  4F7U B;  5GMK e;  4C5H A;  4C8Q G;  5HKC A;  4IUQ A;  2OTJ A;  1M4Z A;  4BD3 A;  1YHQ A;  4QW2 A;  1UGS B;  3JCM h;  2EKO A;  3H8Z A;  4LDW A;  3LX7 A;  5LL6 S;  4C5I A;  3JB9 H;  4PJO A;  2KVQ G;  2M9U A;  3VYG A;  2K5F A;  3CPW A;  1MHN A;  3NTH A;  1ZHI A;  3CCJ A;  1YBY A;  3QBY A;  1G5V A;  4R56 A;  1VQL T;  2E70 A;  1QP3 A;  3CME A;  1KQ2 A;  3VU3 C;  1KD1 U;  2QQR A;  3CME T;  2E64 A;  4HT8 A;  3CCR T;  3QJ6 A;  4J7F A;  3RKY A;  4IUT A;  1S72 A;  3JCM d;  3TRE A;  3GLX A;  3MO8 A;  4J8O A;  2DTI A;  4XTZ A;  4JUV A;  2YLC A;  4MML A;  3VUZ A;  3HFO A;  2QDY B;  2P4T A;  5GAO q;  1X6O A;  3CBO A;  3G6E T;  1D3B A;  1Y71 A;  2WSE E;  2HD0 A;  3G7Z A;  5J3B A;  3VUB A;  4E7K A;  1I4K 1;  5GAN 6;  1VQ5 A;  4PLL A;  5IT9 E;  5GAN 2;  4F7U F;  5LJ5 g;  4ZTF A;  3S6W A;  5GAN f;  4F7U A;  3JCM P;  4HT9 A;  4O6J A;  5LJ5 h;  4N4I A;  2DIQ A;  3FLG A;  2CZ1 B;  1M1K U;  2XK0 A;  4J6W A;  3L2V A;  5GAN 7;  5CCA A;  3RKW A;  5GAO n;  2FVU A;  3R6O A;  2EJ9 A;  2LVM A;  1IRE B;  3M5A A;  3MEV A;  4C5E A;  1VQ4 A;  1Y07 A;  1YIJ A;  4M75 G;  2VC8 A;  4BI4 A;  3X26 B;  1M8V A;  2YHT A;  1B34 A;  3UDC A;  3CXC S;  2DXB A;  1XNI A;  4J7I A;  2K5I A;  2NLU A;  4MZP A;  3LGF A;  4C8Q C;  5GAM d;  2X4J A;  2GF7 A;  3ME9 A;  3JB9 I;  5D6X A;  2RJD A;  1K73 U;  2DPP B;  4KBM B;  1OZ3 A;  3OYL A;  4M77 B;  5GAN d;  2PVD B;  2MI6 A;  5FLX E;  2CKK A;  2HNI A;  2GFU A;  5I2M A;  4E7J A;  2M0O A;  3X20 B;  5HK3 A;  3OBW A;  4CRI A;  5A0G A;  1ZBX A;  2O01 E;  2O4X B;  4MDW A;  1NE8 A;  3QZ9 B;  3V7C A;  3VJP A;  4OF1 A;  2XDP A;  2MMP A;  3PFS A;  2RI3 A;  5FRM A;  4BDZ A;  2EQM A;  1JRI A;  1O75 A;  4MZT A;  2F69 A;  2PU9 B;  4JLI A;  5CKB A;  4EMK B;  5I2S A;  3BFM A;  4HCC A;  3AHU A;  3HP9 A;  3S3O A;  1ZQ1 A;  3M53 A;  3JCM W;  4M7D E;  3FDR A;  4M78 B;  1I8F A;  5C6S A;  3PIO A;  2MWP A;  4ZTJ A;  1VQ4 T;  4M7A B;  3CCL A;  1FWZ A;  4NL3 A;  3BDL A;  5GAM f;  3JAM E;  3SB2 A;  2Y90 A;  2CYZ B;  2GQV A;  4NL2 A;  3OYA A;  3TU4 K;  3DB3 A;  3JCM J;  2DO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...