2K57A

Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
b'MASPTVITLNDGREIQAVDTPKYDEESGFYEFKQLDGKQTRINKDQVRTVKDLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Lipoprotein
publication title Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A.
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Structural genomics, unknown function
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k57A00
4M75G 3RKYA 3BY7A 4F7UF 3M4GA 1WPYA 5GAMg 2DTIA 2K57A 3JCMb 4X9CA 5GAOp 4M7DA 3EFRA 1N9SA 4PNOA 1U1TA 4C8QD 1BIAA 2HNIA 2JN0A 4C92E 2CGHA 5LJ3f 1KQ2A 4PJOE 2I2LA 2VC8A 4M7AG 2DTHA 1TH7A 2YHTA 2DTOA 3JCMf 3V8LA 4M7DC 3SWNC 4M77B 4J6YA 5I21A 1D3BB 2RD1A 3QO3A 4XTZA 3JB9G 4M78A 1I8FA 2DEQA 4M75E 1JRIA 4A54A 3JB9I 1I5LA 1HK9A 4EMGA 1U1SA 1N9RA 2EJFA 4M77G 1LNXA 4M7AF 4XU3A 5GMKh 5LJ5e 3RKWA 3BW1A 4C8QB 3V8JA 4M7DD 5LJ3g 4M7AC 4F7UA 4XTVA 1MGQA 2EJGA 3QUIA 1WNLA 3L1AA 1YCYA 3JCMV 3V7CA 5GANe 3JCMg 3RESA 1M5Q1 4MMKA 3RERA 4JUVA 5GMKj 3INZA 3RKXA 3SWNA 4EMKC 5GAOn 5GAOm 4XU2A 2RM4A 2EWNA 4C8QG 1LJOA 4EMHA 5GAMe 1WQ7A 5GAN8 4M77E 3GIBA 4M78D 4V2SA 3QSUA 1BIBA 2EJ9A 3EFSA 3FB9A 4M78G 4XTUA 3JCMW 2YLCA 4C92A 4C92F 4NL2A 4PJOF 2DKGA 4A53A 4M7DE 1I81A 1Y96A 4HT9A 4N0AA 4C92C 4M7DB 1H641 3JCMP 3BFMA 4PJOC 3SWNB 1LOJA 4M7AA 4RCCA 4XU0A 1HXDA 4J5YA 4NOYA 3RIRA 3JCMQ 4C8QE 4JRKA 4M75A 3V7RA 5GMKi 3HFNA 4N0AC 4M75F 4F7UG 2QTXA 3V7SA 3JCMJ 2FYKA 1JBMA 4EMKA 4M78E 2DVEA 4M75C 5GAOr 4M7DG 4M78B 4HA8A 4J6XA 3JCMX 2DJZA 4QVDA 5LJ3e 5LJ5d 4JRIA 1Y96B 5GAOq 5GAOl 5LJ5j 3JCMe 2YLBA 4C92D 5GANd 5GAN4 4XTYA 4NL3A 3PGGA 3L2ZA 5GAN5 5GANj 4OP0A 3JB9F 4Y91A 4XQ3A 4F7UE 4PJOA 2VXFA 3FJPA 3HFOA 4F7UB 4M7AD 5GAMd 2RB6A 2EAYA 4M77F 4M75D 5LJ5f 1D3BA 5GMKm 4XU1A 5GAMj 3QHSA 4J6WA 4MMLA 4RCBA 3JB9J 3SB2A 5GAN6 4JLIA 1M8VA 3VU3C 1I4K1 4M77C 3RUXA 2E65A 5GANf 2E41A 1X01A 1B34A 4M7DF 3AHUA 3V8KA 4WF2A 5LJ5h 2ZGWA 5GAN2 2DXUA 4C92B 2E10A 4C8QA 5GAMf 2DZ9A 2E64A 2Y90A 4XTXA 4C8QF 3JCMc 2RA2A 2E1HA 5CAIA 5GANh 3JB9D 1WQWA 4M7AE 2DXTA 4C8QC 3FIFA 5DY9A 4M7AB 5LJ3h 4M78F 4XTWA 4PJOD 1KQ1A 4M75B 5GAN3 4C92G 2DZCA 5LJ5g 3JCMh 5GAMh 3BDUA 4M77D 4PJOG 5GAN7 5GMKe 1B34B 2VXEA 4M78C 5LJ3d 4QVCA 5GANg 4EMKB 4HT8A 5LJ3j 3JB9H 4M77A 3JCMd 4PJOB 2FB7A 4X9DA 5GMKl 4DQ2A 3HSBA
chains in the Genus database with same CATH superfamily
1M27C 3RKYA 3ZL7C 4ELZC 2W0ZA 4O5VA 4E7ZA 1Q82C 2CGHA 1W70A 3O5ZA 4PJOB 4OB3B 3V8LA 5HK0A 4KGVB 2DE0X 4PFOA 3M57A 2E3IA 1GCQC 5CKHA 4M78A 4KULA 1XNIA 3J81E 5CIUA 1ZBXA 3WVEB 1M1KR 3G7ZA 4M7AF 1KC8R 3RKWA 4BY6C 2BZ8A 2MWPA 3QUIA 5GANe 1WNLA 3M54A 1QWFA 1GBRA 4EMKC 2IIMA 1GCQA 1M2VB 4DBFA 1QCOA 2HCKA 2E6NA 1TUGB 1YI2A 2RJEA 2HZYA 2J06A 1OYXA 4HT9A 4LDYA 3JCMP 1S72Q 4GLKA 2OTJA 4RTYA 1SHFA 2M16A 4L5GA 3MHXA 1M9SA 4C8QE 3P8DA 1JB0E 2HL3A 3G4ST 1VQ5T 1IO6A 4EMKA 4M75C 2LCLA 2LZ6B 2HBPA 4AFSC 1BI2A 4PLIA 3CCST 4M7DG 2LX9A 3I5SA 1RAHB 2EFIA 2CZ6B 5FLXE 2QGGA 1U06A 2ZPFB 5GAN4 4PJMA 2LC4A 3OYDA 3QDFA 1UGVA 5IH2A 2E6ZA 2OTLQ 1VQKT 3SFMA 4RG2A 1MV3A 4Y92A 3A8OB 1Q7YU 2CP7A 5FROA 2PZ1A 2VKNA 1RAFB 4CC4B 3ZBDA 3OYNA 1VQMQ 3LGLA 3G4SA 2E1HA 4F16A 3JB9D 4O6JA 1VQ5A 2HQXA 5KYUA 3CCSA 2NLUA 2EGEA 1V29B 3HRTA 3PFSA 2C0TA 1PWTA 1UFFA 1M30A 2PTKA 4IIMA 3JCMb 3R6OA 1VQKA 4X9CA 1KSWA 1ZA2B 3CCVQ 1AHJB 2RK2A 3OMCA 3SDZA 4DBQA 4B6MA 2YT6A 3CBPA 2CSIA 4RUGA 2FPEA 2ESWA 4XTZA 1BCMA 2NUTB 2P0PA 5IXFA 3G71T 2K2VA 2PU9B 2DJQA 3BW1A 2H8HA 1IRXA 3KUFA 1YCYA 2XI9A 1YIJQ 2FO0A 1K1ZA 3O8VA 2EWNA 1UE9A 4EIKA 1AZEA 1YJWQ 3MKDA 1UG1A 4XTUA 3OYCA 1VQ4Q 5I11A 1H8KA 3PT9A 3M0TA 4PJOF 2DKGA 3CMAQ 3PE0A 5C6SA 3OQ5A 4BD3A 1BI3A 2P84A 2PUKB 2HKQB 2VUBA 3G71A 4LN2A 1UJYA 1K73C 2LQWA 4DEXA 4ZGEB 2HMAA 2WSCE 4LNPA 4JS5A 2CP3A 4OP0A 4Y91A 2JZ2A 3JV3A 1VQOQ 4X34A 1C1AA 2KI7A 2RB6A 4FCYA 4OMOA 2Z0WA 4F14A 1UB4A 1C6VX 1UECA 3DLMA 1X01A 1S72T 5J3BA 2J7IA 5HKCA 3AHUA 3FLGA 1K8AC 3P8HA 4XTXA 5GJWB 2X9HA 5HCKA 2DLPA 3OS1A 4FT2A 4M7AE 1RAAB 1UHCA 3BDUA 4IUVA 2QTVA 4QVZA 2E4HA 2EGAA 1YCSB 5C0MA 1KD1U 1VQ6Q 2OTLT 4OGCA 3EG2A 4BI3A 2O2OA 4C8QD 3M4YA 3JCMf 1BB9A 1S72A 2JM8A 2KSSA 1VQLQ 3META 1VQMT 2ECZA 4ESRA 1JJ2S 2XDBA 1QW1A 3S3OA 1R0BG 3ASKA 3ZEHA 5FRMA 4OB0B 5A0DA 2C0OA 2HQEA 4LD9K 1I07A 3GF5A 1Y0MA 2X3XD 2ABLA 3QBYA 2DPPB 1TUCA 4BE1A 4EPCA 4UC4A 1KQSA 1LJOA 3QSUA 1NPPA 4D6WA 3MEWA 4IUQA 2BTTA 4M78G 2OJ2A 3CCVT 4C92A 3S3NA 1RI9A 4A53A 1GBQA 2DXBA 1ZSGA 3SWNB 2K5LA 4QQDA 3ULRB 1IHWA 1X6GA 4M78B 1Q82U 4J6XA 2FHDA 1D0XA 2DYBA 5GAOl 1NYFA 2YSQA 1YIJT 2GQVA 3L2ZA 3QZ5B 1YJWT 4FYYB 2MYSA 2EAYA 1VQ4T 3CCVA 4RTVA 2O9SA 3UDCA 5GAN6 3CC2Q 1I4K1 3CMAT 1OX8A 2A0FB 1PC0A 1G83A 2JTMA 2GFAA 2DYIA 2M51A 1CKAA 4B9XA 1G3TA 2CZ1B 2RQTA 3RMSA 2J6KA 5GANh 4ZTFA 3CCLA 1KIKA 1YITQ 4BY6B 4PK4A 3M0PA 3QJ6A 3OYLA 1AWJA 2DZCA 2ZPEB 1EIFA 3GBQA 5LJ3d 5A0LA 4WTOB 1PSEA 4EMKB 1RLQC 4DEYA 5LJ3j 1YIJA 2J6OA 3A8GB 2KQWA 1VQOT 4M75G 1ARKA 2DD4A 3BY7A 1YJWA 1DJ7B 5IHNA 1JJ2P 2XICA 5KYYA 1VQ4A 2JN0A 4PJOE 2KXDA 2DK3A 2HD0A 3OYYA 2ROTA 2DL7A 2YRDA 5J26A 3M56A 2PVGB 1RADB 3VJPA 3UA7A 2YUQA 1LNXA 1WJSA 3L1AA 5KYUB 2GBQA 3JCMg 4MMKA 5GMKj 1YJNQ 4PJLA 2ZPHB 2HDAA 4R56A 2MF2A 2C06A 1VQ6T 1TWBA 1MV0B 1WGSA 4PLLA 2XG8D 3TREA 2DILA 2M9UA 3VYHB 2B8AA 1WZOA 4KBMB 1P92A 1VQLT 1HXDA 3JCMQ 2DO3A 1BU1A 2LJ3A 1AWXA 2MI6A 4LD6A 3UA6A 4E7JA 3CXCS 4JRIA 1GCPA 1G3YA 2IVWA 1OU8A 1K8AR 1M1KC 1D0YA 1YJ9A 1VQ6A 1M90R 1OQKA 2QGFB 2F2VA 1NPRA 1WHJA 3PMIA 4WF2A 3HRSA 5GAMf 2JVVA 3CC7Q 3WVDB 2DXTA 5LJ3h 4M78F 3CPWP 4A4HA 2KT8A 1OI1A 4R55A 2CKKA 3L42A 3HTRA 2GFUA 1YI2Q 5AT1B 4EDUA 2L3QA 3VRZA 3IQLA 2ZPBB 1ZUKA 1KFZA 2O4XA 1N9SA 2RO0A 1BIAA 3CC2T 1KQ2A 1TXQA 3C94A 2DTHA 2DTOA 2PQWA 1AEYA 1K73U 2KK4A 1NJIR 4JRPA 1HD3A 2MIOA 3E2UA 5FRNA 1JRIA 2E70A 2CP0A 1BI0A 1HK9A 1U1SA 2X4JA 2EJFA 3OBWA 3OY9A 5GMKh 4C0GA 3X26B 4ORZA 1GL5A 3V8JA 3CCEA 2JTFA 3L2WA 5CKFA 3VS6A 3FRNA 4Z89A 4ATOA 4MDWA 1OULA 5GAOn 3CPFA 2AKLA 3CC4Q 4HCZA 2EJ9A 2KRNA 3EFSA 4J7IA 3CC2A 4OMMA 4HCCA 1ZLMA 2E12A 1GFCA 4JJNK 4MDXA 3H6ZA 4KUDK 3OW2A 4JDSA 2HSEB 3SEMA 3RIRA 4N0AC 4M75F 1YITA 2QTXA 3DB3A 2FG0A 2DVJA 1WA7A 5D6XA 2EYYA 2CP5A 2DVEA 3G1JA 5LJ5d 3M0RA 5LJ5j 4RTTA 1EX4A 2K3YA 1YJNT 3VUZA 1RAIB 4LDWA 1NYGA 4RTWA 4ME7A 2RPNA 4OMLA 4HVUA 3T9NA 3EHRA 4FIBA 4J6WA 3SB2A 1Y71A 4JLIA 1UDLA 2OI3A 2ZCFB 1VQNQ 1MNDA 2JT4A 4C92B 3LX7A 3OYIA 2K79A 1Z9QA 3VS2A 5GAN3 1U3OA 1WHLA 4D8DA 2R5AA 2VWFA 1YJNA 2CUBA 5IHIA 2RHXA 1WJQA 5GAMg 2MK5A 1E6HA 1U1TA 1SHGA 2JW4A 3SWNC 4M77B 2BE9B 1X6BA 3I5RA 2NUPA 1RI0A 3CC7T 4C0FA 5IN1A 3L2RA 1QVFS 1N9RA 3CCMQ 3MEUA 3BDLA 1A0NB 3JAME 1N8RU 3C12A 2YRCA 4M7DD 5IXBA 5LL6S 4E7KA 2EKHA 3GPLA 1YI2T 3RKXA 3OSVA 3SWNA 1QVPA 3GIBA 1H3HA 1Q81R 5FU7B 2OTJT 2YUOA 2EQJA 2JS2A 5IAYA 1RACB 1UHFA 2P4RA 1FMKA 3HL8A 1I81A 5KYYB 1LOJA 4RTUA 1N6AA 3V7RA 3HFNA 3CC7A 1CKBA 3NFCA 5I2MA 1TTHB 4M78E 2VGNA 3RMQA 2RJFA 2DJZA 4BI4A 3L2UA 1Y96B 1EFNA 4PKCC 2FPFA 3PGGA 4IUPA 1WIEA 1IGUA 2BE7D 3HFOA 3CC4T 1PKSA 2XK0A 2H3JA 4AT1B 3D7SB 1JEGA 1M8VA 3CEYA 5KYWB 2KMTA 2PUOB 3MEVA 2QEXQ 3M0SA 2LX7A 5I22A 2AZVA 2LCCA 2A08A 2DZ9A 4C8QA 4BE2A 2RA2A 1UGRB 2PVOB 3GLXA 3M55A 1WQWA 1JXOA 2JXBA 4AMCA 5GAN7 1QVGP 3N5BB 2EVRA 2X4WA 1NG2A 1RAEB 2GCXA 3HSBA 2NWMA 1ABQA 3CC4A 2F2XA 1X2QA 2BKDN 2G6FX 3LYIA 1CSKA 1B3QA 3TVTA 3J7AF 2YHTA 3A8MB 1VQNT 2RHYA 2HAXA 3C4SA 4BUGA 4M75E 1KG1A 2DNUA 3JB9I 1KC8U 1FYNA 1M3AA 4J9BA 3NMZC 2KAFA 1WX6A 2EGCA 4XU3A 4IIOA 2EJGA 2CSQA 2HL5C 1G3SA 1M5Q1 5HY6A 2YUPA 2YRVA 3E9FA 4ANJA 1SEMA 1BIBA 4J9CA 1F1BB 3OB9A 3MP1A 2YDLA 1RUWA 3CCLQ 1VQNA 2O4XB 2GTJA 1TG0A 4XU0A 4J5YA 2LTOA 1GFDA 3JCMJ 3CCMT 3BE3A 4TVRA 4HA8A 1RABB 5LJ3e 2D6FA 2CUDA 2F69A 2H3EB 2FVUA 3LW5E 4FYWB 2COZA 3M0QA 2CP2A 2EIFA 4ZGDB 1Y57A 2C0IA 1PG5B 1I5OB 3QXEB 1TS9A 1N5ZA 5GANf 2DIGA 3OS5A 2GTOA 4C5GA 4KH0B 2CH4A 4FM4B 4OGEA 2DERA 3CCMA 1OV3A 2D9TA 2QQAA 2MCNA 5GMKe 1B34B 5CO7A 5KCHA 1FMVA 1WI7A 2GGRA 3P8BB 3TU4K 5KE3A 2LJ1A 1NEBA 1AOJA 3Q1JA 8ATCB 3QWXX 1XTDA 4KT0E 2QK0A 1R0CB 1IREB 2QEXT 5CCAA 1WLPB 1T3LA 1M90C 5FWBA 1Q86R 2D1XA 3A5ZB 1QQJA 4F04B 2FL7A 3CCJQ 2LT1A 1LCKA 2WSFE 1ZBJA 4OB2B 2DETA 1PKTA 1YJ9Q 3NGPA 3THKA 4LDVA 4CRIA 4JUVA 4RTXA 1M1GA 1C0MA 3CMEQ 1YHQQ 3ZFJA 4P5NA 2OX7A 2LCSA 2LRQA 4A4FA 4LDUA 3LWIA 2VYTA 1VQPQ 1ABOA 3OA6A 2BZYA 2QEXA 4C92C 4NOYA 3I55Q 4QT7A 1K0XA 2LP5A 2K3BA 4HKEA 1AT1B 2GNCA 1JBMA 2WSEE 4GBQA 2VGMA 3FC3A 1SG5A 2NUPB 2V8KA 1NJIC 1ZX6A 2CS7A 5FU6C 1D1BA 1LVKA 3S6WA 1W6XA 3MO8A 4M75D 1JJ2A 4LXCA 2LQKA 4HVVA 4M77C 3CQTA 1RAGB 5DLOA 3RBBB 1NM7A 3CCLT 2E41A 4BDZA 2ZGWA 2E10A 2DIQA 4LUEA 2COYA 2QXFA 3TSZA 3CCEQ 5HK3A 3HRUA 3MP8A 4DOWA 3QZ9B 1TSFA 6AT1B 2KXCA 3NTIA 7AT1B 5GANg 2P0QA 4M77A 3JCMd 3ME9A 2XMFA 4X9DA 2HEQA 3M59A 2FEIA 5GMKl 1QP2A 1IXDA 2YWWA 1RL2A 3L2QA 3H41A 5FU7C 2DTIA 2A37A 2K5FA 3UWNA 1LPLA 4XAXB 4FW1A 2HSPA 2I2LA 2DXCA 2LMJA 1OU9A 1MNEA 4J6YA 2KGTA 2RD1A 1PD1A 2DEQA 1VOMA 1ZQ1A 3GOXA 2DL4A 5LJ5e 4KGXB 4C8QB 4J8OA 1G2BA 3LH5A 2HKNA 3INZA 1PHTA 1G8XA 3J80E 2ROLA 3FB9A 2RQUA 2LDMA 4A4KA 1Y96A 2KYMA 2L3PA 5CKDA 4RCCA 2COWA 4JRKA 2J6FA 1GRIA 3OYKA 3CCJT 1Z9ZA 3VKIA 2AIRB 1B07A 3CPWA 3CCQQ 4QVDA 1YJ9T 2YLBA 5KYWA 1AVZC 1UUEA 1XJWB 4XK8E 1OZ3A 4NL3A 5GAN5 3CMET 4J7FA 4CC7A 1YHQT 4OB1B 1SRLA 4J9DA 4M7AD 4JS4A 5M9OA 1JU5C 2L5QA 3PTAA 1VQPT 3OS2A 1OPKA 3VUBA 8AT1B 2FRYA 2IG0A 4CC3A 2EQKA 2FRWA 3EAEA 3HP9A 3I55T 2Y4XA 2E64A 1Q81C 5ECAA 3M5AA 3CCJA 4F17A 2ED0A 3JRZA 4QKUA 4XTWA 4DOVA 2KY9A 3MCAB 3JCMh 3VYGA 1QKWA 1K9MR 3JB9H 1MUZA 3OYBA 1Q7YC 5FWCA 3CMEA 1YHQA 2DAQA 2KT1A 2DEUA 4E6RA 4DA4A 4M7DA 2E5KA 1WHMA 1VQPA 1D1CA 3PVQA 2D8HA 3ER0A 3QWYA 1VUBA 2KRMA 5KE2A 5CVIA 1MMNA 3QO3A 3I55A 2A7YA 4KGZB 4LDXA 1UGSB 2EW3A 2EPDA 3H9NA 3CCET 1Y07A 2XKOC 3E1SA 3I56Q 4N4IA 4F7UA 4OVAA 2M0YA 1WDXA 2MPXC 5A0GA 5GAOm 2RI2A 3CCRA 1VQ7Q 2QDYB 1J3TA 1KJWA 3A8LB 1VA7A 2F2WA 3PIOA 2QI2A 2D8JA 3QYHB 1YITT 2ENMA 4QW2A 1UEBA 2DL5A 2BUDA 1BKBA 1X69A 2BIVA 1OX9A 3RDVA 5GAOr 2XU8A 4C5HA 3LH0A 2EBPA 2KR3A 1K8AU 2CT4A 3OW2S 3PVLA 1M90U 2M02A 5DM7R 1OPLA 1HJDA 5GAMd 1B7TA 5GAMj 3CXCP 2XDDA 3QHSA 4FT4A 2X4YA 4PJNA 1MMDA 3L2VA 4AG2C 1B34A 2EKOA 4FSXA 5GAN2 3OYHA 5D7UA 2W10A 4PJOD 3CCQT 4C92G 1WHKA 2MAMA 1E7OA 4FSSA 3EFOB 2DL3A 4RG8A 2A36A 1G3WA 1TOVA 3RERA 5EC7A 2LQNA 4LE9A 2DBKA 4PNOA 2HNIA 2VC8A 1NJIU 4OMFB 5CK9A 3EGDB 3OYJA 1FMWA 4OMQA 1EZZB 5CKBA 2CREA 4A54A 1PRMC 2AK5A 4KUIA 5KYNA 1ACMB 2RF0A 3FJ5A 3QDRB 4M77G 1UGPB 3VS0A 1JXMA 5CQYA 4CI0C 3CCQA 3NTKA 1KD1C 1IGQA 5FU6B 4LUDA 1W2BS 4XTVA 5CR2A 3S3MA 4Q5WA 2DMOA 1O75A 4DBRA 2RM4A 3DB4A 1SKUB 4ELYC 3MPUB 1BBZA 4HXJA 2E3HA 3BFMA 4GY5A 3TSWA 1QMCA 2CZ0B 2FZGB 4JZ3A 4JZ4A 2BZXA 2FYKA 3I56T 3QIIA 3M58A 2X4XA 3LGFA 1SRMA 5I2SA 3X25B 1Q86C 1QVGA 4XTYA 2QA4Q 4XQ3A 2MOXA 3EG9A 1VQ7T 4HVWA 2R58A 1MMGA 4CC2A 1QVFA 3VS4A 1E6GA 2QQ9A 3V8KA 1Q7YR 5LJ5h 4Z88A 2B86A 1I1JA 3JCMc 3I56A 1SSFA 1V76A 2J05A 4C8QC 3A98A 2CZ7B 2JMAA 5EG2A 4QVCA 2VVKA 3LLRA 1NEGA 4RMOA 2RI5A 2R5MA 2LNVA 1VQ7A 5L23A 2RN8A 1YBYA 4JJCA 1PRLC 2PVDB 4J9EA 5DLQE 1Y7XA 2QQSA 1W2BP 2VB6A 4IUTA 2K7AA 1NE8A 3A8HB 2AHJB 4ZNXA 1OZ2A 1W4SA 2ZZDA 4IURA 1W1FA 1NZ9A 2K5IA 4KH1B 2DM1A 3JB9J 1MGQA 1K9AA 3GP8A 2EQMA 2Y4YA 1QVFP 3JSCA 1X6OA 4VUBA 1Q81U 2O9VA 1U5SA 1NLOC 3TEEA 2LNHB 1YP5A 1X43A 2V8JA 1G5VA 4FL6A 4C92F 4C5IA 1BI1A 1M1KU 4M7DB 2XDPA 4FW2A 2O01E 3VV0A 1IZ6A 1KHIA 4M75A 5GMKi 3OYMA 4F7UG 3MJXA 4PFPA 3QJYA 1PD0A 3M0UA 1WXTA 3PNWC 2XD0A 2ATCB 3JCMe 3MEAA 2FZCB 2HBWA 3EH2A 3FJPA 4F7UB 5CQXA 1UGQB 4M77F 4AFUC 3WXMB 1D3BA 3SHWA 4RCBA 9ATCB 3G6EQ 3QPHA 3A1PA 3RUXA 2E65A 2E5QA 1HYOA 1WYXA 4JLGA 2KNBB 2DXUA 1PM3A 2X51A 3EGXA 2GF7A 2RI3A 1YNZA 3FIFA 3FEOA 2JS0A 2RHIA 2QA4T 3X24B 1R8OB 1YWPA 1T0JA 2K57A 3EFRA 1KD1R 3OMGA 3GNFB 1BCOA 5I21A 2K3XA 3JB9G 1H3ZA 3X20B 1TU0B 1I5LA 1X2KA 1ZSZC 1D0ZA 2M1HA 3QKJA 2P0KA 2L3RA 5KH6A 3CD6Q 1UTIA 1PSFA 4M7AC 1WXBA 4YTLA 2XHCA 1X75C 2JMCA 1FX7A 2QA4A 2ZPGB 4PJJA 1JQQA 2DL8A 1VYTA 2HQHA 2MMPA 2VASA 3SD4A 4M78D 4E2FB 1UJ0A 2AT1B 4C0DC 1ZSZA 1K9MC 4K11A 4NL2A 2X35A 3EG3A 2JTEA 3HHTB 2D0QB 4M7AA 2L0AA 3I9QA 1M1FA 1SPKA 2SRCA 5L8RE 2QASA 3V7SA 4ZN3A 2OAWA 3JCMX 1Q82R 2RQVA 2LVMA 3TQ7P 5GANd 5GJVB 1WXUA 3OBYA 5GANj 1KHCA 1ZA1B 2QAZA 4JPBW 3UPUA 2RK1A 2KRSA 4MZMA 2SEMA 4C5EA 2CT3A 3EG1A 1M3BA 3VRYA 2YXYA 1R77A 1KQSS 1M2OA 1BK2A 4M7DF 1ZHIA 3EFOA 4QQ6A 3M53A 5AYFA 2Y90A 2F5KA 5CAIA 4N4GA 4BACA 4L59A 4A4EA 3EG0A 3OYFA 1KQ1A 2K4YA 2LQ8A 3VS3A 1AD5A 2JJ9A 4HT8A 4MZPA 4KRTA 3EGDA 3CCRQ 1VQ8Q 4F7UF 1M4ZA 3M4GA 1IHVA 2RHZA 3TCJA 5KYXA 4C92E 1V1CA 5LJ3f 3G6ET 2DBMA 4HCKA 5IHKA 3EG9B 5J39A 4AFQC 2OTLA 1JO8A 2JM9A 2DX1A 1Q86U 4AFZC 4RKUE 2V1QA 3CCUQ 2KEAA 4AG1C 1VQMA 4OMPA 2VV5A 4J9GA 3PMTA 3C0CA 3RESA 2NUZA 2F1LA 3EH1A 4II1A 3E19A 3H0IA 4C8QG 3DLLA 4BB7A 5GAMe 4M77E 2LT4A 2QG9B 4J9FA 3JCMW 2YLCA 3G6EA 1WFWA 1VIFA 4BE0A 2EYQA 4A63B 2A28A 2DRMA 1H641 2WACA 2FZKB 1N8RC 4PJOC 1SF9A 1XOVA 2V8IA 1VQ9Q 3U23A 3OYGA 4QQGA 2K6DA 2QQRA 3HKSA 1AZGB 4N4HA 4Y28E 3CD6T 5IT9E 3RNJA 3URGA 1M3CA 3RR6A 3CBMA 1QKXA 1OEBA 4B9WA 1KQSP 3JB9F 1BYMA 4X1VA 5CKEA 2VXFA 4PJOA 3NTHA 3FDRA 2KDSA 5A2QE 4MMLA 1YFNA 3CPWS 1VYUA 3R6NA 2RJCA 3MP6A 3OYAA 1VYVA 4OF1A 4PFZA 2EYWA 3REBB 4MZTA 2KVQG 3CMAA 2R57A 3VS1A 4E47A 1QP3A 3H8ZA 5KCOA 1K76A 3CD6A 4M75B 4FU6A 2LJ0A 1M2VA 2EQIA 2EQUA 2DA9A 2RHUA 2RNAA 2I0NA 1K0SA 1WHGA 2FPDA 4J9IA 2KE9A 2DRKA 2YUNA 2IPOB 2DD5A 4A4GA 4ZN1A 3I35A 2P4TA 1WPYA 4OMNA 2V1RA 1AWOA 2AZSA 1VQOA 4Z02A 2QDLA 4M7DC 1TH7A 4BDYA 2L8DA 1PNJA 1D3BB 2CP6A 3X28B 3VS5A 1K73R 4EMGA 2ZPIB 2ED1A 2JUFA 3EGXB 3H0HA 5LJ3g 3JCMV 3CCRT 1VQ8T 1Q95G 1TUDA 2XIDA 2KYBA 4EMHA 1WQ7A 5GAN8 3KBGA 1M8MA 4V2SA 4D8KA 3AT1B 4JJBA 3CXCA 1KC8C 3M9QA 4M7DE 4J83A 3UF4A 3EGUA 1NBEB 3CCUT 2JNGA 4WCIA 1VQLA 4E7SA 1T3SA 4L6V5 5D6YA 3OYEA 5GAOq 1I0CA 4C92D 3CBOA 1OOTA 1VQ8A 4F7UE 3E9GA 4FYVB 5FW9A 1YN8A 1PCXA 3OSSC 5LJ5f 5GMKm 4XU1A 4M7AG 1QCFA 2RJDA 3QYGB 2CDTA 2NUTA 4ZTJA 2CYZB 2F5TX 2OTJQ 1VQ9T 1ZSZB 2NYSA 3CCUA 1MMAA 4C8QF 2RQWA 2QYZA 1YWOA 3REAB 1FXXA 4BI8B 1ZUYA 5DY9A 4M7AB 1WJRA 4M77D 1K9MU 4JJDA 2VXEA 4M4ZA 3VS7A 2FB7A 2KBTA 2O31A 1U8RA 2RQRA 2O88A 3NHNA 4C0DB 5GAOp 2L3SA 2JOYA 3HPWA 2K2MA 2PNIA 2K9GA 2ZAEA 4E7LA 1D09B 1T0HA 2CH4W 4HCBA 4ZGJB 2DFUA 4R0KA 1I8FA 1VQ9A 3PIPA 1FWZA 3G4SQ 1RLPC 2RMOA 1S1NA 1VQ5Q 4J9HA 3CCSQ 2OAUA 3LWHA 2L89A 2V26A 3V7CA 1N8RR 4Z8AA 1AWWA 1GXIE 4IKFA 2MWOA 4XU2A 2X3WD 1KK7A 1VQKQ 1IB8A 1X27A 1N27A 3KFVA 4N0AA 4C0ZA 3F70A 5KYXB 4JRQA 1K4US 3UT1A 2EYXA 4IUUA 4E7IA 4PL6A 2AKKA 4NS5A 3C95A 3KXTA 4FYXB 2EYZA 4DBHA 4E7HA 1QWEA 5D6WA 2RH2A 2KROA 1D1AA 1VIEA 1O9SA 1QLYA 3EHQA 2G3RA 2L2PA 3VU3C 3OW2P 1QCNA 3UATA 2QQBA 2D0NA 3H0FA 3DKMA 4RTZA 1QVGS 2A3LA 1XQHA 1W2BA 3GNGA 2M0OA 1MHNA 3NPFA 1H92A 1WHHA 1ZUUA 3G71Q 4GLMA 3OS0A 5LJ5g 5GAMh 4PJOG 4M78C 3QG1A 2DF6A 1NLPC 2GQIA 1HSQA 1SSHA 4DQ2A
chains in the Genus database with same CATH topology
4EDUA 1RL2A 3RKYA 3L2QA 4ELZC 5FU7C 2DTIA 2K57A 2K5FA 2ZPBB 3EFRA 2O4XA 1N9SA 2RO0A 4O5VA 3UWNA 1BIAA 4XAXB 1Q82C 2CGHA 3CC2T 1KQ2A 3C94A 2I2LA 4OB3B 2DXCA 2DTHA 4PJOB 3V8LA 2DTOA 5HK0A 2PQWA 3OMGA 3M57A 3GNFB 4J6YA 1K73U 5I21A 2KK4A 2RD1A 2K3XA 5CKHA 4M78A 4KULA 4JRPA 3JB9G 1H3ZA 2DEQA 5FRNA 1JRIA 1XNIA 1ZQ1A 2E70A 3J81E 3X20B 1BI0A 5CIUA 1I5LA 1HK9A 2M1HA 1U1SA 1ZBXA 2X4JA 2EJFA 3OBWA 3QKJA 3WVEB 3OY9A 3G7ZA 3GOXA 4M7AF 5GMKh 5LJ5e 2P0KA 2L3RA 3RKWA 3X26B 4BY6C 4J8OA 4C0GA 4C8QB 3V8JA 5KH6A 1PSFA 3CCEA 2MWPA 4M7AC 4YTLA 2JTFA 3QUIA 1WNLA 5GANe 3L2WA 2XHCA 5CKFA 1X75C 3FRNA 3M54A 2QA4A 1FX7A 3INZA 2ZPGB 4ATOA 4MDWA 4EMKC 5GAOn 3CPFA 2MMPA 3SD4A 4M78D 4HCZA 3J80E 2E6NA 1YI2A 2EJ9A 2RJEA 3EFSA 3FB9A 4J7IA 3CC2A 4C0DC 4HCCA 1K9MC 2LDMA 2E12A 4NL2A 4JJNK 4A4KA 2X35A 4MDXA 3H6ZA 4KUDK 3OW2A 4JDSA 1OYXA 1Y96A 4HT9A 4LDYA 3JCMP 4GLKA 3HHTB 2OTJA 2D0QB 5CKDA 4M7AA 4RCCA 2M16A 3RIRA 1M1FA 4L5GA 3MHXA 1M9SA 4JRKA 3P8DA 5L8RE 1JB0E 4N0AC 4M75F 4C8QE 3G4ST 1YITA 2QTXA 3DB3A 3V7SA 4ZN3A 3OYKA 5D6XA 3CCJT 3VKIA 1VQ5T 4EMKA 2DVEA 4M75C 2LCLA 4M7DG 2HBPA 1BI2A 4PLIA 3CCST 2LX9A 3CPWA 3JCMX 2EFIA 4QVDA 5LJ5d 1YJ9T 5LJ5j 2CZ6B 2YLBA 5FLXE 2LVMA 2K3YA 4XK8E 2ZPFB 5GANd 1YJNT 3VUZA 5GAN4 3OBYA 1OZ3A 4NL3A 5GAN5 4LDWA 5GANj 1KHCA 2LC4A 3CMET 4J7FA 1YHQT 4OB1B 3OYDA 3UPUA 4ME7A 3T9NA 4M7AD 2E6ZA 1VQKT 4JS4A 5M9OA 4FIBA 2RK1A 3SFMA 4MZMA 4C5EA 2L5QA 4J6WA 3PTAA 4RG2A 3SB2A 1Y71A 1VQPT 4JLIA 3OS2A 3A8OB 3VUBA 1Q7YU 2ZCFB 1KQSS 5FROA 4M7DF 2IG0A 2EQKA 1ZHIA 3EAEA 3HP9A 3I55T 4C92B 4QQ6A 3LX7A 2Y4XA 3ZBDA 3M53A 5AYFA 3OYNA 2E64A 1Q81C 2Y90A 3LGLA 2F5KA 3G4SA 3M5AA 2E1HA 5CAIA 3JB9D 3OYIA 4N4GA 4O6JA 3CCJA 4BACA 1VQ5A 2HQXA 4L59A 4A4EA 3JRZA 3CCSA 4XTWA 3OYFA 4DOVA 1KQ1A 2K4YA 5GAN3 2NLUA 2KY9A 2LQ8A 3MCAB 3JCMh 1V29B 3VYGA 2R5AA 3HRTA 4HT8A 4MZPA 3PFSA 1YJNA 3JB9H 3OYBA 1Q7YC 3CMEA 1YHQA 2DAQA 4F7UF 2RHXA 1M4ZA 3M4GA 1WJQA 5GAMg 4DA4A 2RHZA 3JCMb 3R6OA 3TCJA 4X9CA 1VQKA 4M7DA 1U1TA 4C92E 5LJ3f 3G6ET 1VQPA 1AHJB 2RK2A 3ER0A 2OTLA 3OMCA 3SDZA 1VUBA 5J39A 3CBPA 3SWNC 4M77B 5KE2A 5CVIA 1Q86U 3QO3A 4XTZA 3I55A 2A7YA 4RKUE 4LDXA 1UGSB 1RI0A 3CC7T 3CCET 1Y07A 2XKOC 2P0PA 3E1SA 5IN1A 1N9RA 4C0FA 3L2RA 1QVFS 3MEUA 3G71T 2K2VA 1VQMA 2PU9B 3BDLA 3BW1A 3JAME 1N8RU 3C12A 4N4IA 4M7DD 2VV5A 4OVAA 4F7UA 3PMTA 3KUFA 5LL6S 1YCYA 2XI9A 3RESA 4E7KA 3GPLA 1YI2T 4II1A 3RKXA 3OSVA 3SWNA 5A0GA 5GAOm 1QVPA 3E19A 3O8VA 2EWNA 4C8QG 3DLLA 4BB7A 5GAMe 2RI2A 4M77E 3CCRA 3GIBA 2QDYB 2LT4A 4XTUA 5FU7B 3JCMW 3OYCA 2OTJT 2YLCA 3G6EA 3PIOA 3A8LB 2EQJA 5IAYA 3PT9A 1VIFA 2DKGA 2EYQA 2QI2A 4PJOF 4BE0A 3QYHB 3HL8A 1I81A 4QW2A 1YITT 5C6SA 1UEBA 3OQ5A 1H641 2WACA 1N8RC 4BD3A 2BUDA 1LOJA 1XOVA 4PJOC 1BKBA 2V8IA 1BI3A 1N6AA 3OYGA 3V7RA 3HFNA 4QQGA 2QQRA 3CC7A 2BIVA 3HKSA 2PUKB 3NFCA 5I2MA 4N4HA 4Y28E 4M78E 5GAOr 2VUBA 2XU8A 3G71A 2VGNA 3RMQA 3LH0A 4C5HA 3CD6T 5IT9E 3URGA 2RJFA 2DJZA 4BI4A 3L2UA 1Y96B 1K8AU 1K73C 4PKCC 3OW2S 3CBMA 4ZGEB 2WSCE 4B9WA 4JS5A 1M90U 3JB9F 3PGGA 4IUPA 4OP0A 4Y91A 1BYMA 2JZ2A 5CKEA 2VXFA 4X34A 3HFOA 5DM7R 3CC4T 4PJOA 3NTHA 2XK0A 2H3JA 5GAMd 2RB6A 3FDRA 2KDSA 5GAMj 5A2QE 2XDDA 3QHSA 4MMLA 4FT4A 1M8VA 2X4YA 1UB4A 3CPWS 3CEYA 2KMTA 2PUOB 3MEVA 3L2VA 3DLMA 1X01A 1B34A 2RJCA 5J3BA 3MP6A 5HKCA 1S72T 3OYAA 3AHUA 4OF1A 2EKOA 4FSXA 5GAN2 3FLGA 4MZTA 2KVQG 3OYHA 2R57A 3P8HA 2LCCA 4C8QA 2DZ9A 4E47A 3CMAA 4BE2A 4XTXA 2RA2A 1QP3A 1UGRB 2PVOB 3GLXA 3OS1A 3H8ZA 3M55A 4FT2A 1WQWA 4M7AE 5KCOA 4PJOD 3CD6A 4M75B 4FU6A 4C92G 3CCQT 5GAN7 2MAMA 3BDUA 2EQUA 2RHUA 4IUVA 3N5BB 2X4WA 4RG8A 2GCXA 1G3WA 3HSBA 3RERA 4QVZA 2DD5A 4A4GA 4ZN1A 3CC4A 5C0MA 1KD1U 2P4TA 1WPYA 2OTLT 4OGCA 2BKDN 3LYIA 4BI3A 4C8QD 4PNOA 2HNIA 1VQOA 4Z02A 3M4YA 3J7AF 2VC8A 4M7DC 1TH7A 2YHTA 3JCMf 4BDYA 1NJIU 4OMFB 2L8DA 3A8MB 5CK9A 1S72A 1VQNT 1D3BB 2RHYA 2KSSA 3OYJA 2HAXA 3C4SA 3META 1VQMT 3X28B 4BUGA 4M75E 5CKBA 1JJ2S 2XDBA 4A54A 1QW1A 1KG1A 3JB9I 1KC8U 4KUIA 4EMGA 2ZPIB 3QDRB 4M77G 1UGPB 2KAFA 3S3OA 4XU3A 3ASKA 3ZEHA 5CQYA 3CCQA 2JUFA 4OB0B 3NTKA 5A0DA 5FU6B 4CI0C 1KD1C 5FRMA 5LJ3g 2HQEA 1W2BS 4XTVA 2EJGA 5CR2A 4LD9K 3JCMV 3GF5A 3QBYA 3CCRT 4BE1A 1G3SA 1M5Q1 2DPPB 4Q5WA 3S3MA 1VQ8T 5HY6A 4EPCA 2YRVA 4UC4A 1KQSA 1O75A 3E9FA 2RM4A 2XIDA 3DB4A 1LJOA 4EMHA 1WQ7A 5GAN8 3KBGA 4V2SA 3QSUA 1NPPA 4D6WA 1BIBA 3MEWA 4IUQA 4ELYC 4M78G 3CCVT 4C92A 3OB9A 3CXCA 3M9QA 3S3NA 3MP1A 1KC8C 4A53A 4M7DE 4J83A 1VQNA 2O4XB 3BFMA 4GY5A 2DXBA 3SWNB 4XU0A 2K5LA 4J5YA 2CZ0B 4QQDA 3CCUT 2LTOA 2JNGA 3JCMJ 2FYKA 3I56T 3QIIA 3M58A 3CCMT 1VQLA 2X4XA 3LGFA 4TVRA 4M78B 1Q82U 4L6V5 4HA8A 5D6YA 5I2SA 4J6XA 3X25B 2FHDA 3OYEA 5LJ3e 5GAOq 2D6FA 5GAOl 2F69A 1Q86C 2FVUA 3LW5E 1QVGA 4C92D 1YIJT 3CBOA 1VQ8A 2GQVA 4XTYA 3L2ZA 4XQ3A 4F7UE 3E9GA 3QZ5B 2EIFA 1YJWT 1VQ7T 4ZGDB 1K8AC 3OSSC 2EAYA 5LJ5f 1VQ4T 3QXEB 4XU1A 5GMKm 3CCVA 4M7AG 3UDCA 2R58A 5GAN6 2RJDA 1I4K1 3CMAT 1QVFA 3QYGB 5GANf 2DIGA 3OS5A 4C5GA 2JTMA 4ZTJA 2GFAA 2QQ9A 3V8KA 5LJ5h 2CYZB 2F5TX 1VQ9T 3CCUA 4B9XA 1G3TA 2CZ1B 3RMSA 3CCLA 4FM4B 4C8QF 5GANh 3JCMc 4ZTFA 4OGEA 4BY6B 1FXXA 3I56A 3CCMA 1SSFA 4BI8B 3QJ6A 4C8QC 5DY9A 4M7AB 2D9TA 2QQAA 1WJRA 3OYLA 2CZ7B 2DZCA 2ZPEB 4M77D 1K9MU 5GMKe 1B34B 1EIFA 2VXEA 5CO7A 5EG2A 5LJ3d 5A0LA 4QVCA 1PSEA 5KCHA 4EMKB 5LJ3j 3LLRA 1YIJA 1U8RA 2FB7A 3A8GB 2KQWA 4RMOA 2RI5A 2R5MA 2LNVA 1VQOT 3P8BB 4M75G 2DD4A 3TU4K 3BY7A 5KE3A 1YJWA 1DJ7B 1VQ7A 4C0DB 3Q1JA 5GAOp 2JOYA 2XICA 3HPWA 1VQ4A 2JN0A 1XTDA 4E7LA 4KT0E 4PJOE 1YBYA 4HCBA 1IREB 4ZGJB 2QEXT 2PVDB 5CCAA 5DLQE 2DK3A 1Y7XA 2HD0A 2QQSA 1M90C 3OYYA 1I8FA 1VQ9A 3PIPA 5J26A 4IUTA 1FWZA 3A5ZB 1NE8A 3M56A 3A8HB 2PVGB 2AHJB 2FL7A 3VJPA 1LNXA 2LT1A 1OZ2A 2WSFE 1W4SA 1WJSA 2ZZDA 4IURA 2OAUA 4OB2B 3LWHA 1NZ9A 2L89A 2K5IA 3JB9J 1MGQA 3L1AA 3V7CA 4CRIA 3JCMg 4LDVA 4MMKA 4IKFA 4JUVA 5GMKj 3GP8A 1GXIE 1M1GA 2MWOA 2ZPHB 2EQMA 2Y4YA 4XU2A 2MF2A 4R56A 2C06A 3JSCA 1X6OA 4VUBA 4P5NA 3ZFJA 1Q81U 1VQ6T 1WGSA 3TEEA 2LRQA 4PLLA 4LDUA 4A4FA 3LWIA 2V8JA 2XG8D 3TREA 1G5VA 2M9UA 2VYTA 4FL6A 4C92F 3VYHB 4C5IA 1N27A 2B8AA 1BI1A 3OA6A 1M1KU 2QEXA 4KBMB 4N0AA 4C92C 2XDPA 4C0ZA 1P92A 3F70A 1VQLT 4M7DB 2O01E 4JRQA 1HXDA 4NOYA 3JCMQ 3VV0A 1IZ6A 1KHIA 4M75A 3UT1A 5GMKi 3OYMA 2DO3A 4F7UG 4HKEA 4IUUA 1JBMA 3QJYA 4E7IA 2MI6A 2WSEE 4PL6A 2VGMA 4NS5A 3FC3A 3C95A 3KXTA 4LD6A 2V8KA 4E7JA 4E7HA 3PNWC 3CXCS 4JRIA 1NJIC 2XD0A 1G3YA 5D6WA 3JCMe 2IVWA 2CS7A 3MEAA 5FU6C 2RH2A 3S6WA 1M1KC 1VIEA 1YJ9A 1VQ6A 3FJPA 4F7UB 3MO8A 5CQXA 1O9SA 1UGQB 4M77F 4M75D 3WXMB 1D3BA 1JJ2A 2G3RA 2LQKA 4RCBA 3VU3C 3QPHA 4M77C 3RUXA 2E65A 2E5QA 5DLOA 1NPRA 2QQBA 3CCLT 2E41A 3PMIA 3DKMA 4JLGA 4BDZA 4WF2A 1QVGS 2ZGWA 2A3LA 2DXUA 2E10A 1XQHA 3HRSA 1W2BA 5GAMf 2DIQA 3GNGA 2GF7A 2QXFA 2M0OA 2JVVA 1MHNA 2RI3A 3WVDB 5HK3A 3HRUA 2DXTA 3MP8A 3FIFA 3FEOA 5LJ3h 4M78F 4DOWA 3QZ9B 3OS0A 4A4HA 5LJ5g 5GAMh 1OI1A 4PJOG 2CKKA 4R55A 4M78C 3QG1A 3NTIA 5GANg 3L42A 2RHIA 2P0QA 4M77A 3JCMd 3ME9A 3X24B 2QA4T 1R8OB 4X9DA 3M59A 2GFUA 5GMKl 4DQ2A 1QP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  3RKY A;  3BY7 A;  4F7U F;  3M4G A;  1WPY A;  5GAM g;  2DTI A;  2K57 A;  3JCM b;  4X9C A;  5GAO p;  4M7D A;  3EFR A;  1N9S A;  4PNO A;  1U1T A;  4C8Q D;  1BIA A;  2HNI A;  2JN0 A;  4C92 E;  2CGH A;  5LJ3 f;  1KQ2 A;  4PJO E;  2I2L A;  2VC8 A;  4M7A G;  2DTH A;  1TH7 A;  2YHT A;  2DTO A;  3JCM f;  3V8L A;  4M7D C;  3SWN C;  4M77 B;  4J6Y A;  5I21 A;  1D3B B;  2RD1 A;  3QO3 A;  4XTZ A;  3JB9 G;  4M78 A;  1I8F A;  2DEQ A;  4M75 E;  1JRI A;  4A54 A;  3JB9 I;  1I5L A;  1HK9 A;  4EMG A;  1U1S A;  1N9R A;  2EJF A;  4M77 G;  1LNX A;  4M7A F;  4XU3 A;  5GMK h;  5LJ5 e;  3RKW A;  3BW1 A;  4C8Q B;  3V8J A;  4M7D D;  5LJ3 g;  4M7A C;  4F7U A;  4XTV A;  1MGQ A;  2EJG A;  3QUI A;  1WNL A;  3L1A A;  1YCY A;  3JCM V;  3V7C A;  5GAN e;  3JCM g;  3RES A;  1M5Q 1;  4MMK A;  3RER A;  4JUV A;  5GMK j;  3INZ A;  3RKX A;  3SWN A;  4EMK C;  5GAO n;  5GAO m;  4XU2 A;  2RM4 A;  2EWN A;  4C8Q G;  1LJO A;  4EMH A;  5GAM e;  1WQ7 A;  5GAN 8;  4M77 E;  3GIB A;  4M78 D;  4V2S A;  3QSU A;  1BIB A;  2EJ9 A;  3EFS A;  3FB9 A;  4M78 G;  4XTU A;  3JCM W;  2YLC A;  4C92 A;  4C92 F;  4NL2 A;  4PJO F;  2DKG A;  4A53 A;  4M7D E;  1I81 A;  1Y96 A;  4HT9 A;  4N0A A;  4C92 C;  4M7D B;  1H64 1;  3JCM P;  3BFM A;  4PJO C;  3SWN B;  1LOJ A;  4M7A A;  4RCC A;  4XU0 A;  1HXD A;  4J5Y A;  4NOY A;  3RIR A;  3JCM Q;  4C8Q E;  4JRK A;  4M75 A;  3V7R A;  5GMK i;  3HFN A;  4N0A C;  4M75 F;  4F7U G;  2QTX A;  3V7S A;  3JCM J;  2FYK A;  1JBM A;  4EMK A;  4M78 E;  2DVE A;  4M75 C;  5GAO r;  4M7D G;  4M78 B;  4HA8 A;  4J6X A;  3JCM X;  2DJZ A;  4QVD A;  5LJ3 e;  5LJ5 d;  4JRI A;  1Y96 B;  5GAO q;  5GAO l;  5LJ5 j;  3JCM e;  2YLB A;  4C92 D;  5GAN d;  5GAN 4;  4XTY A;  4NL3 A;  3PGG A;  3L2Z A;  5GAN 5;  5GAN j;  4OP0 A;  3JB9 F;  4Y91 A;  4XQ3 A;  4F7U E;  4PJO A;  2VXF A;  3FJP A;  3HFO A;  4F7U B;  4M7A D;  5GAM d;  2RB6 A;  2EAY A;  4M77 F;  4M75 D;  5LJ5 f;  1D3B A;  5GMK m;  4XU1 A;  5GAM j;  3QHS A;  4J6W A;  4MML A;  4RCB A;  3JB9 J;  3SB2 A;  5GAN 6;  4JLI A;  1M8V A;  3VU3 C;  1I4K 1;  4M77 C;  3RUX A;  2E65 A;  5GAN f;  2E41 A;  1X01 A;  1B34 A;  4M7D F;  3AHU A;  3V8K A;  4WF2 A;  5LJ5 h;  2ZGW A;  5GAN 2;  2DXU A;  4C92 B;  2E10 A;  4C8Q A;  5GAM f;  2DZ9 A;  2E64 A;  2Y90 A;  4XTX A;  4C8Q F;  3JCM c;  2RA2 A;  2E1H A;  5CAI A;  5GAN h;  3JB9 D;  1WQW A;  4M7A E;  2DXT A;  4C8Q C;  3FIF A;  5DY9 A;  4M7A B;  5LJ3 h;  4M78 F;  4XTW A;  4PJO D;  1KQ1 A;  4M75 B;  5GAN 3;  4C92 G;  2DZC A;  5LJ5 g;  3JCM h;  5GAM h;  3BDU A;  4M77 D;  4PJO G;  5GAN 7;  5GMK e;  1B34 B;  2VXE A;  4M78 C;  5LJ3 d;  4QVC A;  5GAN g;  4EMK B;  4HT8 A;  5LJ3 j;  3JB9 H;  4M77 A;  3JCM d;  4PJO B;  2FB7 A;  4X9D A;  5GMK l;  4DQ2 A;  3HSB A; 
#chains in the Genus database with same CATH topology
 1M27 C;  3RKY A;  3ZL7 C;  4ELZ C;  2W0Z A;  4O5V A;  4E7Z A;  1Q82 C;  2CGH A;  1W70 A;  3O5Z A;  4PJO B;  4OB3 B;  3V8L A;  5HK0 A;  4KGV B;  2DE0 X;  4PFO A;  3M57 A;  2E3I A;  1GCQ C;  5CKH A;  4M78 A;  4KUL A;  1XNI A;  3J81 E;  5CIU A;  1ZBX A;  3WVE B;  1M1K R;  3G7Z A;  4M7A F;  1KC8 R;  3RKW A;  4BY6 C;  2BZ8 A;  2MWP A;  3QUI A;  5GAN e;  1WNL A;  3M54 A;  1QWF A;  1GBR A;  4EMK C;  2IIM A;  1GCQ A;  1M2V B;  4DBF A;  1QCO A;  2HCK A;  2E6N A;  1TUG B;  1YI2 A;  2RJE A;  2HZY A;  2J06 A;  1OYX A;  4HT9 A;  4LDY A;  3JCM P;  1S72 Q;  4GLK A;  2OTJ A;  4RTY A;  1SHF A;  2M16 A;  4L5G A;  3MHX A;  1M9S A;  4C8Q E;  3P8D A;  1JB0 E;  2HL3 A;  3G4S T;  1VQ5 T;  1IO6 A;  4EMK A;  4M75 C;  2LCL A;  2LZ6 B;  2HBP A;  4AFS C;  1BI2 A;  4PLI A;  3CCS T;  4M7D G;  2LX9 A;  3I5S A;  1RAH B;  2EFI A;  2CZ6 B;  5FLX E;  2QGG A;  1U06 A;  2ZPF B;  5GAN 4;  4PJM A;  2LC4 A;  3OYD A;  3QDF A;  1UGV A;  5IH2 A;  2E6Z A;  2OTL Q;  1VQK T;  3SFM A;  4RG2 A;  1MV3 A;  4Y92 A;  3A8O B;  1Q7Y U;  2CP7 A;  5FRO A;  2PZ1 A;  2VKN A;  1RAF B;  4CC4 B;  3ZBD A;  3OYN A;  1VQM Q;  3LGL A;  3G4S A;  2E1H A;  4F16 A;  3JB9 D;  4O6J A;  1VQ5 A;  2HQX A;  5KYU A;  3CCS A;  2NLU A;  2EGE A;  1V29 B;  3HRT A;  3PFS A;  2C0T A;  1PWT A;  1UFF A;  1M30 A;  2PTK A;  4IIM A;  3JCM b;  3R6O A;  1VQK A;  4X9C A;  1KSW A;  1ZA2 B;  3CCV Q;  1AHJ B;  2RK2 A;  3OMC A;  3SDZ A;  4DBQ A;  4B6M A;  2YT6 A;  3CBP A;  2CSI A;  4RUG A;  2FPE A;  2ESW A;  4XTZ A;  1BCM A;  2NUT B;  2P0P A;  5IXF A;  3G71 T;  2K2V A;  2PU9 B;  2DJQ A;  3BW1 A;  2H8H A;  1IRX A;  3KUF A;  1YCY A;  2XI9 A;  1YIJ Q;  2FO0 A;  1K1Z A;  3O8V A;  2EWN A;  1UE9 A;  4EIK A;  1AZE A;  1YJW Q;  3MKD A;  1UG1 A;  4XTU A;  3OYC A;  1VQ4 Q;  5I11 A;  1H8K A;  3PT9 A;  3M0T A;  4PJO F;  2DKG A;  3CMA Q;  3PE0 A;  5C6S A;  3OQ5 A;  4BD3 A;  1BI3 A;  2P84 A;  2PUK B;  2HKQ B;  2VUB A;  3G71 A;  4LN2 A;  1UJY A;  1K73 C;  2LQW A;  4DEX A;  4ZGE B;  2HMA A;  2WSC E;  4LNP A;  4JS5 A;  2CP3 A;  4OP0 A;  4Y91 A;  2JZ2 A;  3JV3 A;  1VQO Q;  4X34 A;  1C1A A;  2KI7 A;  2RB6 A;  4FCY A;  4OMO A;  2Z0W A;  4F14 A;  1UB4 A;  1C6V X;  1UEC A;  3DLM A;  1X01 A;  1S72 T;  5J3B A;  2J7I A;  5HKC A;  3AHU A;  3FLG A;  1K8A C;  3P8H A;  4XTX A;  5GJW B;  2X9H A;  5HCK A;  2DLP A;  3OS1 A;  4FT2 A;  4M7A E;  1RAA B;  1UHC A;  3BDU A;  4IUV A;  2QTV A;  4QVZ A;  2E4H A;  2EGA A;  1YCS B;  5C0M A;  1KD1 U;  1VQ6 Q;  2OTL T;  4OGC A;  3EG2 A;  4BI3 A;  2O2O A;  4C8Q D;  3M4Y A;  3JCM f;  1BB9 A;  1S72 A;  2JM8 A;  2KSS A;  1VQL Q;  3MET A;  1VQM T;  2ECZ A;  4ESR A;  1JJ2 S;  2XDB A;  1QW1 A;  3S3O A;  1R0B G;  3ASK A;  3ZEH A;  5FRM A;  4OB0 B;  5A0D A;  2C0O A;  2HQE A;  4LD9 K;  1I07 A;  3GF5 A;  1Y0M A;  2X3X D;  2ABL A;  3QBY A;  2DPP B;  1TUC A;  4BE1 A;  4EPC A;  4UC4 A;  1KQS A;  1LJO A;  3QSU A;  1NPP A;  4D6W A;  3MEW A;  4IUQ A;  2BTT A;  4M78 G;  2OJ2 A;  3CCV T;  4C92 A;  3S3N A;  1RI9 A;  4A53 A;  1GBQ A;  2DXB A;  1ZSG A;  3SWN B;  2K5L A;  4QQD A;  3ULR B;  1IHW A;  1X6G A;  4M78 B;  1Q82 U;  4J6X A;  2FHD A;  1D0X A;  2DYB A;  5GAO l;  1NYF A;  2YSQ A;  1YIJ T;  2GQV A;  3L2Z A;  3QZ5 B;  1YJW T;  4FYY B;  2MYS A;  2EAY A;  1VQ4 T;  3CCV A;  4RTV A;  2O9S A;  3UDC A;  5GAN 6;  3CC2 Q;  1I4K 1;  3CMA T;  1OX8 A;  2A0F B;  1PC0 A;  1G83 A;  2JTM A;  2GFA A;  2DYI A;  2M51 A;  1CKA A;  4B9X A;  1G3T A;  2CZ1 B;  2RQT A;  3RMS A;  2J6K A;  5GAN h;  4ZTF A;  3CCL A;  1KIK A;  1YIT Q;  4BY6 B;  4PK4 A;  3M0P A;  3QJ6 A;  3OYL A;  1AWJ A;  2DZC A;  2ZPE B;  1EIF A;  3GBQ A;  5LJ3 d;  5A0L A;  4WTO B;  1PSE A;  4EMK B;  1RLQ C;  4DEY A;  5LJ3 j;  1YIJ A;  2J6O A;  3A8G B;  2KQW A;  1VQO T;  4M75 G;  1ARK A;  2DD4 A;  3BY7 A;  1YJW A;  1DJ7 B;  5IHN A;  1JJ2 P;  2XIC A;  5KYY A;  1VQ4 A;  2JN0 A;  4PJO E;  2KXD A;  2DK3 A;  2HD0 A;  3OYY A;  2ROT A;  2DL7 A;  2YRD A;  5J26 A;  3M56 A;  2PVG B;  1RAD B;  3VJP A;  3UA7 A;  2YUQ A;  1LNX A;  1WJS A;  3L1A A;  5KYU B;  2GBQ A;  3JCM g;  4MMK A;  5GMK j;  1YJN Q;  4PJL A;  2ZPH B;  2HDA A;  4R56 A;  2MF2 A;  2C06 A;  1VQ6 T;  1TWB A;  1MV0 B;  1WGS A;  4PLL A;  2XG8 D;  3TRE A;  2DIL A;  2M9U A;  3VYH B;  2B8A A;  1WZO A;  4KBM B;  1P92 A;  1VQL T;  1HXD A;  3JCM Q;  2DO3 A;  1BU1 A;  2LJ3 A;  1AWX A;  2MI6 A;  4LD6 A;  3UA6 A;  4E7J A;  3CXC S;  4JRI A;  1GCP A;  1G3Y A;  2IVW A;  1OU8 A;  1K8A R;  1M1K C;  1D0Y A;  1YJ9 A;  1VQ6 A;  1M90 R;  1OQK A;  2QGF B;  2F2V A;  1NPR A;  1WHJ A;  3PMI A;  4WF2 A;  3HRS A;  5GAM f;  2JVV A;  3CC7 Q;  3WVD B;  2DXT A;  5LJ3 h;  4M78 F;  3CPW P;  4A4H A;  2KT8 A;  1OI1 A;  4R55 A;  2CKK A;  3L42 A;  3HTR A;  2GFU A;  1YI2 Q;  5AT1 B;  4EDU A;  2L3Q A;  3VRZ A;  3IQL A;  2ZPB B;  1ZUK A;  1KFZ A;  2O4X A;  1N9S A;  2RO0 A;  1BIA A;  3CC2 T;  1KQ2 A;  1TXQ A;  3C94 A;  2DTH A;  2DTO A;  2PQW A;  1AEY A;  1K73 U;  2KK4 A;  1NJI R;  4JRP A;  1HD3 A;  2MIO A;  3E2U A;  5FRN A;  1JRI A;  2E70 A;  2CP0 A;  1BI0 A;  1HK9 A;  1U1S A;  2X4J A;  2EJF A;  3OBW A;  3OY9 A;  5GMK h;  4C0G A;  3X26 B;  4ORZ A;  1GL5 A;  3V8J A;  3CCE A;  2JTF A;  3L2W A;  5CKF A;  3VS6 A;  3FRN A;  4Z89 A;  4ATO A;  4MDW A;  1OUL A;  5GAO n;  3CPF A;  2AKL A;  3CC4 Q;  4HCZ A;  2EJ9 A;  2KRN A;  3EFS A;  4J7I A;  3CC2 A;  4OMM A;  4HCC A;  1ZLM A;  2E12 A;  1GFC A;  4JJN K;  4MDX A;  3H6Z A;  4KUD K;  3OW2 A;  4JDS A;  2HSE B;  3SEM A;  3RIR A;  4N0A C;  4M75 F;  1YIT A;  2QTX A;  3DB3 A;  2FG0 A;  2DVJ A;  1WA7 A;  5D6X A;  2EYY A;  2CP5 A;  2DVE A;  3G1J A;  5LJ5 d;  3M0R A;  5LJ5 j;  4RTT A;  1EX4 A;  2K3Y A;  1YJN T;  3VUZ A;  1RAI B;  4LDW A;  1NYG A;  4RTW A;  4ME7 A;  2RPN A;  4OML A;  4HVU A;  3T9N A;  3EHR A;  4FIB A;  4J6W A;  3SB2 A;  1Y71 A;  4JLI A;  1UDL A;  2OI3 A;  2ZCF B;  1VQN Q;  1MND A;  2JT4 A;  4C92 B;  3LX7 A;  3OYI A;  2K79 A;  1Z9Q A;  3VS2 A;  5GAN 3;  1U3O A;  1WHL A;  4D8D A;  2R5A A;  2VWF A;  1YJN A;  2CUB A;  5IHI A;  2RHX A;  1WJQ A;  5GAM g;  2MK5 A;  1E6H A;  1U1T A;  1SHG A;  2JW4 A;  3SWN C;  4M77 B;  2BE9 B;  1X6B A;  3I5R A;  2NUP A;  1RI0 A;  3CC7 T;  4C0F A;  5IN1 A;  3L2R A;  1QVF S;  1N9R A;  3CCM Q;  3MEU A;  3BDL A;  1A0N B;  3JAM E;  1N8R U;  3C12 A;  2YRC A;  4M7D D;  5IXB A;  5LL6 S;  4E7K A;  2EKH A;  3GPL A;  1YI2 T;  3RKX A;  3OSV A;  3SWN A;  1QVP A;  3GIB A;  1H3H A;  1Q81 R;  5FU7 B;  2OTJ T;  2YUO A;  2EQJ A;  2JS2 A;  5IAY A;  1RAC B;  1UHF A;  2P4R A;  1FMK A;  3HL8 A;  1I81 A;  5KYY B;  1LOJ A;  4RTU A;  1N6A A;  3V7R A;  3HFN A;  3CC7 A;  1CKB A;  3NFC A;  5I2M A;  1TTH B;  4M78 E;  2VGN A;  3RMQ A;  2RJF A;  2DJZ A;  4BI4 A;  3L2U A;  1Y96 B;  1EFN A;  4PKC C;  2FPF A;  3PGG A;  4IUP A;  1WIE A;  1IGU A;  2BE7 D;  3HFO A;  3CC4 T;  1PKS A;  2XK0 A;  2H3J A;  4AT1 B;  3D7S B;  1JEG A;  1M8V A;  3CEY A;  5KYW B;  2KMT A;  2PUO B;  3MEV A;  2QEX Q;  3M0S A;  2LX7 A;  5I22 A;  2AZV A;  2LCC A;  2A08 A;  2DZ9 A;  4C8Q A;  4BE2 A;  2RA2 A;  1UGR B;  2PVO B;  3GLX A;  3M55 A;  1WQW A;  1JXO A;  2JXB A;  4AMC A;  5GAN 7;  1QVG P;  3N5B B;  2EVR A;  2X4W A;  1NG2 A;  1RAE B;  2GCX A;  3HSB A;  2NWM A;  1ABQ A;  3CC4 A;  2F2X A;  1X2Q A;  2BKD N;  2G6F X;  3LYI A;  1CSK A;  1B3Q A;  3TVT A;  3J7A F;  2YHT A;  3A8M B;  1VQN T;  2RHY A;  2HAX A;  3C4S A;  4BUG A;  4M75 E;  1KG1 A;  2DNU A;  3JB9 I;  1KC8 U;  1FYN A;  1M3A A;  4J9B A;  3NMZ C;  2KAF A;  1WX6 A;  2EGC A;  4XU3 A;  4IIO A;  2EJG A;  2CSQ A;  2HL5 C;  1G3S A;  1M5Q 1;  5HY6 A;  2YUP A;  2YRV A;  3E9F A;  4ANJ A;  1SEM A;  1BIB A;  4J9C A;  1F1B B;  3OB9 A;  3MP1 A;  2YDL A;  1RUW A;  3CCL Q;  1VQN A;  2O4X B;  2GTJ A;  1TG0 A;  4XU0 A;  4J5Y A;  2LTO A;  1GFD A;  3JCM J;  3CCM T;  3BE3 A;  4TVR A;  4HA8 A;  1RAB B;  5LJ3 e;  2D6F A;  2CUD A;  2F69 A;  2H3E B;  2FVU A;  3LW5 E;  4FYW B;  2COZ A;  3M0Q A;  2CP2 A;  2EIF A;  4ZGD B;  1Y57 A;  2C0I A;  1PG5 B;  1I5O B;  3QXE B;  1TS9 A;  1N5Z A;  5GAN f;  2DIG A;  3OS5 A;  2GTO A;  4C5G A;  4KH0 B;  2CH4 A;  4FM4 B;  4OGE A;  2DER A;  3CCM A;  1OV3 A;  2D9T A;  2QQA A;  2MCN A;  5GMK e;  1B34 B;  5CO7 A;  5KCH A;  1FMV A;  1WI7 A;  2GGR A;  3P8B B;  3TU4 K;  5KE3 A;  2LJ1 A;  1NEB A;  1AOJ A;  3Q1J A;  8ATC B;  3QWX X;  1XTD A;  4KT0 E;  2QK0 A;  1R0C B;  1IRE B;  2QEX T;  5CCA A;  1WLP B;  1T3L A;  1M90 C;  5FWB A;  1Q86 R;  2D1X A;  3A5Z B;  1QQJ A;  4F04 B;  2FL7 A;  3CCJ Q;  2LT1 A;  1LCK A;  2WSF E;  1ZBJ A;  4OB2 B;  2DET A;  1PKT A;  1YJ9 Q;  3NGP A;  3THK A;  4LDV A;  4CRI A;  4JUV A;  4RTX A;  1M1G A;  1C0M A;  3CME Q;  1YHQ Q;  3ZFJ A;  4P5N A;  2OX7 A;  2LCS A;  2LRQ A;  4A4F A;  4LDU A;  3LWI A;  2VYT A;  1VQP Q;  1ABO A;  3OA6 A;  2BZY A;  2QEX A;  4C92 C;  4NOY A;  3I55 Q;  4QT7 A;  1K0X A;  2LP5 A;  2K3B A;  4HKE A;  1AT1 B;  2GNC A;  1JBM A;  2WSE E;  4GBQ A;  2VGM A;  3FC3 A;  1SG5 A;  2NUP B;  2V8K A;  1NJI C;  1ZX6 A;  2CS7 A;  5FU6 C;  1D1B A;  1LVK A;  3S6W A;  1W6X A;  3MO8 A;  4M75 D;  1JJ2 A;  4LXC A;  2LQK A;  4HVV A;  4M77 C;  3CQT A;  1RAG B;  5DLO A;  3RBB B;  1NM7 A;  3CCL T;  2E41 A;  4BDZ A;  2ZGW A;  2E10 A;  2DIQ A;  4LUE A;  2COY A;  2QXF A;  3TSZ A;  3CCE Q;  5HK3 A;  3HRU A;  3MP8 A;  4DOW A;  3QZ9 B;  1TSF A;  6AT1 B;  2KXC A;  3NTI A;  7AT1 B;  5GAN g;  2P0Q A;  4M77 A;  3JCM d;  3ME9 A;  2XMF A;  4X9D A;  2HEQ A;  3M59 A;  2FEI A;  5GMK l;  1QP2 A;  1IXD A;  2YWW A;  1RL2 A;  3L2Q A;  3H41 A;  5FU7 C;  2DTI A;  2A37 A;  2K5F A;  3UWN A;  1LPL A;  4XAX B;  4FW1 A;  2HSP A;  2I2L A;  2DXC A;  2LMJ A;  1OU9 A;  1MNE A;  4J6Y A;  2KGT A;  2RD1 A;  1PD1 A;  2DEQ A;  1VOM A;  1ZQ1 A;  3GOX A;  2DL4 A;  5LJ5 e;  4KGX B;  4C8Q B;  4J8O A;  1G2B A;  3LH5 A;  2HKN A;  3INZ A;  1PHT A;  1G8X A;  3J80 E;  2ROL A;  3FB9 A;  2RQU A;  2LDM A;  4A4K A;  1Y96 A;  2KYM A;  2L3P A;  5CKD A;  4RCC A;  2COW A;  4JRK A;  2J6F A;  1GRI A;  3OYK A;  3CCJ T;  1Z9Z A;  3VKI A;  2AIR B;  1B07 A;  3CPW A;  3CCQ Q;  4QVD A;  1YJ9 T;  2YLB A;  5KYW A;  1AVZ C;  1UUE A;  1XJW B;  4XK8 E;  1OZ3 A;  4NL3 A;  5GAN 5;  3CME T;  4J7F A;  4CC7 A;  1YHQ T;  4OB1 B;  1SRL A;  4J9D A;  4M7A D;  4JS4 A;  5M9O A;  1JU5 C;  2L5Q A;  3PTA A;  1VQP T;  3OS2 A;  1OPK A;  3VUB A;  8AT1 B;  2FRY A;  2IG0 A;  4CC3 A;  2EQK A;  2FRW A;  3EAE A;  3HP9 A;  3I55 T;  2Y4X A;  2E64 A;  1Q81 C;  5ECA A;  3M5A A;  3CCJ A;  4F17 A;  2ED0 A;  3JRZ A;  4QKU A;  4XTW A;  4DOV A;  2KY9 A;  3MCA B;  3JCM h;  3VYG A;  1QKW A;  1K9M R;  3JB9 H;  1MUZ A;  3OYB A;  1Q7Y C;  5FWC A;  3CME A;  1YHQ A;  2DAQ A;  2KT1 A;  2DEU A;  4E6R A;  4DA4 A;  4M7D A;  2E5K A;  1WHM A;  1VQP A;  1D1C A;  3PVQ A;  2D8H A;  3ER0 A;  3QWY A;  1VUB A;  2KRM A;  5KE2 A;  5CVI A;  1MMN A;  3QO3 A;  3I55 A;  2A7Y A;  4KGZ B;  4LDX A;  1UGS B;  2EW3 A;  2EPD A;  3H9N A;  3CCE T;  1Y07 A;  2XKO C;  3E1S A;  3I56 Q;  4N4I A;  4F7U A;  4OVA A;  2M0Y A;  1WDX A;  2MPX C;  5A0G A;  5GAO m;  2RI2 A;  3CCR A;  1VQ7 Q;  2QDY B;  1J3T A;  1KJW A;  3A8L B;  1VA7 A;  2F2W A;  3PIO A;  2QI2 A;  2D8J A;  3QYH B;  1YIT T;  2ENM A;  4QW2 A;  1UEB A;  2DL5 A;  2BUD A;  1BKB A;  1X69 A;  2BIV A;  1OX9 A;  3RDV A;  5GAO r;  2XU8 A;  4C5H A;  3LH0 A;  2EBP A;  2KR3 A;  1K8A U;  2CT4 A;  3OW2 S;  3PVL A;  1M90 U;  2M02 A;  5DM7 R;  1OPL A;  1HJD A;  5GAM d;  1B7T A;  5GAM j;  3CXC P;  2XDD A;  3QHS A;  4FT4 A;  2X4Y A;  4PJN A;  1MMD A;  3L2V A;  4AG2 C;  1B34 A;  2EKO A;  4FSX A;  5GAN 2;  3OYH A;  5D7U A;  2W10 A;  4PJO D;  3CCQ T;  4C92 G;  1WHK A;  2MAM A;  1E7O A;  4FSS A;  3EFO B;  2DL3 A;  4RG8 A;  2A36 A;  1G3W A;  1TOV A;  3RER A;  5EC7 A;  2LQN A;  4LE9 A;  2DBK A;  4PNO A;  2HNI A;  2VC8 A;  1NJI U;  4OMF B;  5CK9 A;  3EGD B;  3OYJ A;  1FMW A;  4OMQ A;  1EZZ B;  5CKB A;  2CRE A;  4A54 A;  1PRM C;  2AK5 A;  4KUI A;  5KYN A;  1ACM B;  2RF0 A;  3FJ5 A;  3QDR B;  4M77 G;  1UGP B;  3VS0 A;  1JXM A;  5CQY A;  4CI0 C;  3CCQ A;  3NTK A;  1KD1 C;  1IGQ A;  5FU6 B;  4LUD A;  1W2B S;  4XTV A;  5CR2 A;  3S3M A;  4Q5W A;  2DMO A;  1O75 A;  4DBR A;  2RM4 A;  3DB4 A;  1SKU B;  4ELY C;  3MPU B;  1BBZ A;  4HXJ A;  2E3H A;  3BFM A;  4GY5 A;  3TSW A;  1QMC A;  2CZ0 B;  2FZG B;  4JZ3 A;  4JZ4 A;  2BZX A;  2FYK A;  3I56 T;  3QII A;  3M58 A;  2X4X A;  3LGF A;  1SRM A;  5I2S A;  3X25 B;  1Q86 C;  1QVG A;  4XTY A;  2QA4 Q;  4XQ3 A;  2MOX A;  3EG9 A;  1VQ7 T;  4HVW A;  2R58 A;  1MMG A;  4CC2 A;  1QVF A;  3VS4 A;  1E6G A;  2QQ9 A;  3V8K A;  1Q7Y R;  5LJ5 h;  4Z88 A;  2B86 A;  1I1J A;  3JCM c;  3I56 A;  1SSF A;  1V76 A;  2J05 A;  4C8Q C;  3A98 A;  2CZ7 B;  2JMA A;  5EG2 A;  4QVC A;  2VVK A;  3LLR A;  1NEG A;  4RMO A;  2RI5 A;  2R5M A;  2LNV A;  1VQ7 A;  5L23 A;  2RN8 A;  1YBY A;  4JJC A;  1PRL C;  2PVD B;  4J9E A;  5DLQ E;  1Y7X A;  2QQS A;  1W2B P;  2VB6 A;  4IUT A;  2K7A A;  1NE8 A;  3A8H B;  2AHJ B;  4ZNX A;  1OZ2 A;  1W4S A;  2ZZD A;  4IUR A;  1W1F A;  1NZ9 A;  2K5I A;  4KH1 B;  2DM1 A;  3JB9 J;  1MGQ A;  1K9A A;  3GP8 A;  2EQM A;  2Y4Y A;  1QVF P;  3JSC A;  1X6O A;  4VUB A;  1Q81 U;  2O9V A;  1U5S A;  1NLO C;  3TEE A;  2LNH B;  1YP5 A;  1X43 A;  2V8J A;  1G5V A;  4FL6 A;  4C92 F;  4C5I A;  1BI1 A;  1M1K U;  4M7D B;  2XDP A;  4FW2 A;  2O01 E;  3VV0 A;  1IZ6 A;  1KHI A;  4M75 A;  5GMK i;  3OYM A;  4F7U G;  3MJX A;  4PFP A;  3QJY A;  1PD0 A;  3M0U A;  1WXT A;  3PNW C;  2XD0 A;  2ATC B;  3JCM e;  3MEA A;  2FZC B;  2HBW A;  3EH2 A;  3FJP A;  4F7U B;  5CQX A;  1UGQ B;  4M77 F;  4AFU C;  3WXM B;  1D3B A;  3SHW A;  4RCB A;  9ATC B;  3G6E Q;  3QPH A;  3A1P A;  3RUX A;  2E65 A;  2E5Q A;  1HYO A;  1WYX A;  4JLG A;  2KNB B;  2DXU A;  1PM3 A;  2X51 A;  3EGX A;  2GF7 A;  2RI3 A;  1YNZ A;  3FIF A;  3FEO A;  2JS0 A;  2RHI A;  2QA4 T;  3X24 B;  1R8O B;  1YWP A;  1T0J A;  2K57 A;  3EFR A;  1KD1 R;  3OMG A;  3GNF B;  1BCO A;  5I21 A;  2K3X A;  3JB9 G;  1H3Z A;  3X20 B;  1TU0 B;  1I5L A;  1X2K A;  1ZSZ C;  1D0Z A;  2M1H A;  3QKJ A;  2P0K A;  2L3R A;  5KH6 A;  3CD6 Q;  1UTI A;  1PSF A;  4M7A C;  1WXB A;  4YTL A;  2XHC A;  1X75 C;  2JMC A;  1FX7 A;  2QA4 A;  2ZPG B;  4PJJ A;  1JQQ A;  2DL8 A;  1VYT A;  2HQH A;  2MMP A;  2VAS A;  3SD4 A;  4M78 D;  4E2F B;  1UJ0 A;  2AT1 B;  4C0D C;  1ZSZ A;  1K9M C;  4K11 A;  4NL2 A;  2X35 A;  3EG3 A;  2JTE A;  3HHT B;  2D0Q B;  4M7A A;  2L0A A;  3I9Q A;  1M1F A;  1SPK A;  2SRC A;  5L8R E;  2QAS A;  3V7S A;  4ZN3 A;  2OAW A;  3JCM X;  1Q82 R;  2RQV A;  2LVM A;  3TQ7 P;  5GAN d;  5GJV B;  1WXU A;  3OBY A;  5GAN j;  1KHC A;  1ZA1 B;  2QAZ A;  4JPB W;  3UPU A;  2RK1 A;  2KRS A;  4MZM A;  2SEM A;  4C5E A;  2CT3 A;  3EG1 A;  1M3B A;  3VRY A;  2YXY A;  1R77 A;  1KQS S;  1M2O A;  1BK2 A;  4M7D F;  1ZHI A;  3EFO A;  4QQ6 A;  3M53 A;  5AYF A;  2Y90 A;  2F5K A;  5CAI A;  4N4G A;  4BAC A;  4L59 A;  4A4E A;  3EG0 A;  3OYF A;  1KQ1 A;  2K4Y A;  2LQ8 A;  3VS3 A;  1AD5 A;  2JJ9 A;  4HT8 A;  4MZP A;  4KRT A;  3EGD A;  3CCR Q;  1VQ8 Q;  4F7U F;  1M4Z A;  3M4G A;  1IHV A;  2RHZ A;  3TCJ A;  5KYX A;  4C92 E;  1V1C A;  5LJ3 f;  3G6E T;  2DBM A;  4HCK A;  5IHK A;  3EG9 B;  5J39 A;  4AFQ C;  2OTL A;  1JO8 A;  2JM9 A;  2DX1 A;  1Q86 U;  4AFZ C;  4RKU E;  2V1Q A;  3CCU Q;  2KEA A;  4AG1 C;  1VQM A;  4OMP A;  2VV5 A;  4J9G A;  3PMT A;  3C0C A;  3RES A;  2NUZ A;  2F1L A;  3EH1 A;  4II1 A;  3E19 A;  3H0I A;  4C8Q G;  3DLL A;  4BB7 A;  5GAM e;  4M77 E;  2LT4 A;  2QG9 B;  4J9F A;  3JCM W;  2YLC A;  3G6E A;  1WFW A;  1VIF A;  4BE0 A;  2EYQ A;  4A63 B;  2A28 A;  2DRM A;  1H64 1;  2WAC A;  2FZK B;  1N8R C;  4PJO C;  1SF9 A;  1XOV A;  2V8I A;  1VQ9 Q;  3U23 A;  3OYG A;  4QQG A;  2K6D A;  2QQR A;  3HKS A;  1AZG B;  4N4H A;  4Y28 E;  3CD6 T;  5IT9 E;  3RNJ A;  3URG A;  1M3C A;  3RR6 A;  3CBM A;  1QKX A;  1OEB A;  4B9W A;  1KQS P;  3JB9 F;  1BYM A;  4X1V A;  5CKE A;  2VXF A;  4PJO A;  3NTH A;  3FDR A;  2KDS A;  5A2Q E;  4MML A;  1YFN A;  3CPW S;  1VYU A;  3R6N A;  2RJC A;  3MP6 A;  3OYA A;  1VYV A;  4OF1 A;  4PFZ A;  2EYW A;  3REB B;  4MZT A;  2KVQ G;  3CMA A;  2R57 A;  3VS1 A;  4E47 A;  1QP3 A;  3H8Z A;  5KCO A;  1K76 A;  3CD6 A;  4M75 B;  4FU6 A;  2LJ0 A;  1M2V A;  2EQI A;  2EQU A;  2DA9 A;  2RHU A;  2RNA A;  2I0N A;  1K0S A;  1WHG A;  2FPD A;  4J9I A;  2KE9 A;  2DRK A;  2YUN A;  2IPO B;  2DD5 A;  4A4G A;  4ZN1 A;  3I35 A;  2P4T A;  1WPY A;  4OMN A;  2V1R A;  1AWO A;  2AZS A;  1VQO A;  4Z02 A;  2QDL A;  4M7D C;  1TH7 A;  4BDY A;  2L8D A;  1PNJ A;  1D3B B;  2CP6 A;  3X28 B;  3VS5 A;  1K73 R;  4EMG A;  2ZPI B;  2ED1 A;  2JUF A;  3EGX B;  3H0H A;  5LJ3 g;  3JCM V;  3CCR T;  1VQ8 T;  1Q95 G;  1TUD A;  2XID A;  2KYB A;  4EMH A;  1WQ7 A;  5GAN 8;  3KBG A;  1M8M A;  4V2S A;  4D8K A;  3AT1 B;  4JJB A;  3CXC A;  1KC8 C;  3M9Q A;  4M7D E;  4J83 A;  3UF4 A;  3EGU A;  1NBE B;  3CCU T;  2JNG A;  4WCI A;  1VQL A;  4E7S A;  1T3S A;  4L6V 5;  5D6Y A;  3OYE A;  5GAO q;  1I0C A;  4C92 D;  3CBO A;  1OOT A;  1VQ8 A;  4F7U E;  3E9G A;  4FYV B;  5FW9 A;  1YN8 A;  1PCX A;  3OSS C;  5LJ5 f;  5GMK m;  4XU1 A;  4M7A G;  1QCF A;  2RJD A;  3QYG B;  2CDT A;  2NUT A;  4ZTJ A;  2CYZ B;  2F5T X;  2OTJ Q;  1VQ9 T;  1ZSZ B;  2NYS A;  3CCU A;  1MMA A;  4C8Q F;  2RQW A;  2QYZ A;  1YWO A;  3REA B;  1FXX A;  4BI8 B;  1ZUY A;  5DY9 A;  4M7A B;  1WJR A;  4M77 D;  1K9M U;  4JJD A;  2VXE A;  4M4Z A;  3VS7 A;  2FB7 A;  2KBT A;  2O31 A;  1U8R A;  2RQR A;  2O88 A;  3NHN A;  4C0D B;  5GAO p;  2L3S A;  2JOY A;  3HPW A;  2K2M A;  2PNI A;  2K9G A;  2ZAE A;  4E7L A;  1D09 B;  1T0H A;  2CH4 W;  4HCB A;  4ZGJ B;  2DFU A;  4R0K A;  1I8F A;  1VQ9 A;  3PIP A;  1FWZ A;  3G4S Q;  1RLP C;  2RMO A;  1S1N A;  1VQ5 Q;  4J9H A;  3CCS Q;  2OAU A;  3LWH A;  2L89 A;  2V26 A;  3V7C A;  1N8R R;  4Z8A A;  1AWW A;  1GXI E;  4IKF A;  2MWO A;  4XU2 A;  2X3W D;  1KK7 A;  1VQK Q;  1IB8 A;  1X27 A;  1N27 A;  3KFV A;  4N0A A;  4C0Z A;  3F70 A;  5KYX B;  4JRQ A;  1K4U S;  3UT1 A;  2EYX A;  4IUU A;  4E7I A;  4PL6 A;  2AKK A;  4NS5 A;  3C95 A;  3KXT A;  4FYX B;  2EYZ A;  4DBH A;  4E7H A;  1QWE A;  5D6W A;  2RH2 A;  2KRO A;  1D1A A;  1VIE A;  1O9S A;  1QLY A;  3EHQ A;  2G3R A;  2L2P A;  3VU3 C;  3OW2 P;  1QCN A;  3UAT A;  2QQB A;  2D0N A;  3H0F A;  3DKM A;  4RTZ A;  1QVG S;  2A3L A;  1XQH A;  1W2B A;  3GNG A;  2M0O A;  1MHN A;  3NPF A;  1H92 A;  1WHH A;  1ZUU A;  3G71 Q;  4GLM A;  3OS0 A;  5LJ5 g;  5GAM h;  4PJO G;  4M78 C;  3QG1 A;  2DF6 A;  1NLP C;  2GQI A;  1HSQ A;  1SSH A;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 4EDU A;  1RL2 A;  3RKY A;  3L2Q A;  4ELZ C;  5FU7 C;  2DTI A;  2K57 A;  2K5F A;  2ZPB B;  3EFR A;  2O4X A;  1N9S A;  2RO0 A;  4O5V A;  3UWN A;  1BIA A;  4XAX B;  1Q82 C;  2CGH A;  3CC2 T;  1KQ2 A;  3C94 A;  2I2L A;  4OB3 B;  2DXC A;  2DTH A;  4PJO B;  3V8L A;  2DTO A;  5HK0 A;  2PQW A;  3OMG A;  3M57 A;  3GNF B;  4J6Y A;  1K73 U;  5I21 A;  2KK4 A;  2RD1 A;  2K3X A;  5CKH A;  4M78 A;  4KUL A;  4JRP A;  3JB9 G;  1H3Z A;  2DEQ A;  5FRN A;  1JRI A;  1XNI A;  1ZQ1 A;  2E70 A;  3J81 E;  3X20 B;  1BI0 A;  5CIU A;  1I5L A;  1HK9 A;  2M1H A;  1U1S A;  1ZBX A;  2X4J A;  2EJF A;  3OBW A;  3QKJ A;  3WVE B;  3OY9 A;  3G7Z A;  3GOX A;  4M7A F;  5GMK h;  5LJ5 e;  2P0K A;  2L3R A;  3RKW A;  3X26 B;  4BY6 C;  4J8O A;  4C0G A;  4C8Q B;  3V8J A;  5KH6 A;  1PSF A;  3CCE A;  2MWP A;  4M7A C;  4YTL A;  2JTF A;  3QUI A;  1WNL A;  5GAN e;  3L2W A;  2XHC A;  5CKF A;  1X75 C;  3FRN A;  3M54 A;  2QA4 A;  1FX7 A;  3INZ A;  2ZPG B;  4ATO A;  4MDW A;  4EMK C;  5GAO n;  3CPF A;  2MMP A;  3SD4 A;  4M78 D;  4HCZ A;  3J80 E;  2E6N A;  1YI2 A;  2EJ9 A;  2RJE A;  3EFS A;  3FB9 A;  4J7I A;  3CC2 A;  4C0D C;  4HCC A;  1K9M C;  2LDM A;  2E12 A;  4NL2 A;  4JJN K;  4A4K A;  2X35 A;  4MDX A;  3H6Z A;  4KUD K;  3OW2 A;  4JDS A;  1OYX A;  1Y96 A;  4HT9 A;  4LDY A;  3JCM P;  4GLK A;  3HHT B;  2OTJ A;  2D0Q B;  5CKD A;  4M7A A;  4RCC A;  2M16 A;  3RIR A;  1M1F A;  4L5G A;  3MHX A;  1M9S A;  4JRK A;  3P8D A;  5L8R E;  1JB0 E;  4N0A C;  4M75 F;  4C8Q E;  3G4S T;  1YIT A;  2QTX A;  3DB3 A;  3V7S A;  4ZN3 A;  3OYK A;  5D6X A;  3CCJ T;  3VKI A;  1VQ5 T;  4EMK A;  2DVE A;  4M75 C;  2LCL A;  4M7D G;  2HBP A;  1BI2 A;  4PLI A;  3CCS T;  2LX9 A;  3CPW A;  3JCM X;  2EFI A;  4QVD A;  5LJ5 d;  1YJ9 T;  5LJ5 j;  2CZ6 B;  2YLB A;  5FLX E;  2LVM A;  2K3Y A;  4XK8 E;  2ZPF B;  5GAN d;  1YJN T;  3VUZ A;  5GAN 4;  3OBY A;  1OZ3 A;  4NL3 A;  5GAN 5;  4LDW A;  5GAN j;  1KHC A;  2LC4 A;  3CME T;  4J7F A;  1YHQ T;  4OB1 B;  3OYD A;  3UPU A;  4ME7 A;  3T9N A;  4M7A D;  2E6Z A;  1VQK T;  4JS4 A;  5M9O A;  4FIB A;  2RK1 A;  3SFM A;  4MZM A;  4C5E A;  2L5Q A;  4J6W A;  3PTA A;  4RG2 A;  3SB2 A;  1Y71 A;  1VQP T;  4JLI A;  3OS2 A;  3A8O B;  3VUB A;  1Q7Y U;  2ZCF B;  1KQS S;  5FRO A;  4M7D F;  2IG0 A;  2EQK A;  1ZHI A;  3EAE A;  3HP9 A;  3I55 T;  4C92 B;  4QQ6 A;  3LX7 A;  2Y4X A;  3ZBD A;  3M53 A;  5AYF A;  3OYN A;  2E64 A;  1Q81 C;  2Y90 A;  3LGL A;  2F5K A;  3G4S A;  3M5A A;  2E1H A;  5CAI A;  3JB9 D;  3OYI A;  4N4G A;  4O6J A;  3CCJ A;  4BAC A;  1VQ5 A;  2HQX A;  4L59 A;  4A4E A;  3JRZ A;  3CCS A;  4XTW A;  3OYF A;  4DOV A;  1KQ1 A;  2K4Y A;  5GAN 3;  2NLU A;  2KY9 A;  2LQ8 A;  3MCA B;  3JCM h;  1V29 B;  3VYG A;  2R5A A;  3HRT A;  4HT8 A;  4MZP A;  3PFS A;  1YJN A;  3JB9 H;  3OYB A;  1Q7Y C;  3CME A;  1YHQ A;  2DAQ A;  4F7U F;  2RHX A;  1M4Z A;  3M4G A;  1WJQ A;  5GAM g;  4DA4 A;  2RHZ A;  3JCM b;  3R6O A;  3TCJ A;  4X9C A;  1VQK A;  4M7D A;  1U1T A;  4C92 E;  5LJ3 f;  3G6E T;  1VQP A;  1AHJ B;  2RK2 A;  3ER0 A;  2OTL A;  3OMC A;  3SDZ A;  1VUB A;  5J39 A;  3CBP A;  3SWN C;  4M77 B;  5KE2 A;  5CVI A;  1Q86 U;  3QO3 A;  4XTZ A;  3I55 A;  2A7Y A;  4RKU E;  4LDX A;  1UGS B;  1RI0 A;  3CC7 T;  3CCE T;  1Y07 A;  2XKO C;  2P0P A;  3E1S A;  5IN1 A;  1N9R A;  4C0F A;  3L2R A;  1QVF S;  3MEU A;  3G71 T;  2K2V A;  1VQM A;  2PU9 B;  3BDL A;  3BW1 A;  3JAM E;  1N8R U;  3C12 A;  4N4I A;  4M7D D;  2VV5 A;  4OVA A;  4F7U A;  3PMT A;  3KUF A;  5LL6 S;  1YCY A;  2XI9 A;  3RES A;  4E7K A;  3GPL A;  1YI2 T;  4II1 A;  3RKX A;  3OSV A;  3SWN A;  5A0G A;  5GAO m;  1QVP A;  3E19 A;  3O8V A;  2EWN A;  4C8Q G;  3DLL A;  4BB7 A;  5GAM e;  2RI2 A;  4M77 E;  3CCR A;  3GIB A;  2QDY B;  2LT4 A;  4XTU A;  5FU7 B;  3JCM W;  3OYC A;  2OTJ T;  2YLC A;  3G6E A;  3PIO A;  3A8L B;  2EQJ A;  5IAY A;  3PT9 A;  1VIF A;  2DKG A;  2EYQ A;  2QI2 A;  4PJO F;  4BE0 A;  3QYH B;  3HL8 A;  1I81 A;  4QW2 A;  1YIT T;  5C6S A;  1UEB A;  3OQ5 A;  1H64 1;  2WAC A;  1N8R C;  4BD3 A;  2BUD A;  1LOJ A;  1XOV A;  4PJO C;  1BKB A;  2V8I A;  1BI3 A;  1N6A A;  3OYG A;  3V7R A;  3HFN A;  4QQG A;  2QQR A;  3CC7 A;  2BIV A;  3HKS A;  2PUK B;  3NFC A;  5I2M A;  4N4H A;  4Y28 E;  4M78 E;  5GAO r;  2VUB A;  2XU8 A;  3G71 A;  2VGN A;  3RMQ A;  3LH0 A;  4C5H A;  3CD6 T;  5IT9 E;  3URG A;  2RJF A;  2DJZ A;  4BI4 A;  3L2U A;  1Y96 B;  1K8A U;  1K73 C;  4PKC C;  3OW2 S;  3CBM A;  4ZGE B;  2WSC E;  4B9W A;  4JS5 A;  1M90 U;  3JB9 F;  3PGG A;  4IUP A;  4OP0 A;  4Y91 A;  1BYM A;  2JZ2 A;  5CKE A;  2VXF A;  4X34 A;  3HFO A;  5DM7 R;  3CC4 T;  4PJO A;  3NTH A;  2XK0 A;  2H3J A;  5GAM d;  2RB6 A;  3FDR A;  2KDS A;  5GAM j;  5A2Q E;  2XDD A;  3QHS A;  4MML A;  4FT4 A;  1M8V A;  2X4Y A;  1UB4 A;  3CPW S;  3CEY A;  2KMT A;  2PUO B;  3MEV A;  3L2V A;  3DLM A;  1X01 A;  1B34 A;  2RJC A;  5J3B A;  3MP6 A;  5HKC A;  1S72 T;  3OYA A;  3AHU A;  4OF1 A;  2EKO A;  4FSX A;  5GAN 2;  3FLG A;  4MZT A;  2KVQ G;  3OYH A;  2R57 A;  3P8H A;  2LCC A;  4C8Q A;  2DZ9 A;  4E47 A;  3CMA A;  4BE2 A;  4XTX A;  2RA2 A;  1QP3 A;  1UGR B;  2PVO B;  3GLX A;  3OS1 A;  3H8Z A;  3M55 A;  4FT2 A;  1WQW A;  4M7A E;  5KCO A;  4PJO D;  3CD6 A;  4M75 B;  4FU6 A;  4C92 G;  3CCQ T;  5GAN 7;  2MAM A;  3BDU A;  2EQU A;  2RHU A;  4IUV A;  3N5B B;  2X4W A;  4RG8 A;  2GCX A;  1G3W A;  3HSB A;  3RER A;  4QVZ A;  2DD5 A;  4A4G A;  4ZN1 A;  3CC4 A;  5C0M A;  1KD1 U;  2P4T A;  1WPY A;  2OTL T;  4OGC A;  2BKD N;  3LYI A;  4BI3 A;  4C8Q D;  4PNO A;  2HNI A;  1VQO A;  4Z02 A;  3M4Y A;  3J7A F;  2VC8 A;  4M7D C;  1TH7 A;  2YHT A;  3JCM f;  4BDY A;  1NJI U;  4OMF B;  2L8D A;  3A8M B;  5CK9 A;  1S72 A;  1VQN T;  1D3B B;  2RHY A;  2KSS A;  3OYJ A;  2HAX A;  3C4S A;  3MET A;  1VQM T;  3X28 B;  4BUG A;  4M75 E;  5CKB A;  1JJ2 S;  2XDB A;  4A54 A;  1QW1 A;  1KG1 A;  3JB9 I;  1KC8 U;  4KUI A;  4EMG A;  2ZPI B;  3QDR B;  4M77 G;  1UGP B;  2KAF A;  3S3O A;  4XU3 A;  3ASK A;  3ZEH A;  5CQY A;  3CCQ A;  2JUF A;  4OB0 B;  3NTK A;  5A0D A;  5FU6 B;  4CI0 C;  1KD1 C;  5FRM A;  5LJ3 g;  2HQE A;  1W2B S;  4XTV A;  2EJG A;  5CR2 A;  4LD9 K;  3JCM V;  3GF5 A;  3QBY A;  3CCR T;  4BE1 A;  1G3S A;  1M5Q 1;  2DPP B;  4Q5W A;  3S3M A;  1VQ8 T;  5HY6 A;  4EPC A;  2YRV A;  4UC4 A;  1KQS A;  1O75 A;  3E9F A;  2RM4 A;  2XID A;  3DB4 A;  1LJO A;  4EMH A;  1WQ7 A;  5GAN 8;  3KBG A;  4V2S A;  3QSU A;  1NPP A;  4D6W A;  1BIB A;  3MEW A;  4IUQ A;  4ELY C;  4M78 G;  3CCV T;  4C92 A;  3OB9 A;  3CXC A;  3M9Q A;  3S3N A;  3MP1 A;  1KC8 C;  4A53 A;  4M7D E;  4J83 A;  1VQN A;  2O4X B;  3BFM A;  4GY5 A;  2DXB A;  3SWN B;  4XU0 A;  2K5L A;  4J5Y A;  2CZ0 B;  4QQD A;  3CCU T;  2LTO A;  2JNG A;  3JCM J;  2FYK A;  3I56 T;  3QII A;  3M58 A;  3CCM T;  1VQL A;  2X4X A;  3LGF A;  4TVR A;  4M78 B;  1Q82 U;  4L6V 5;  4HA8 A;  5D6Y A;  5I2S A;  4J6X A;  3X25 B;  2FHD A;  3OYE A;  5LJ3 e;  5GAO q;  2D6F A;  5GAO l;  2F69 A;  1Q86 C;  2FVU A;  3LW5 E;  1QVG A;  4C92 D;  1YIJ T;  3CBO A;  1VQ8 A;  2GQV A;  4XTY A;  3L2Z A;  4XQ3 A;  4F7U E;  3E9G A;  3QZ5 B;  2EIF A;  1YJW T;  1VQ7 T;  4ZGD B;  1K8A C;  3OSS C;  2EAY A;  5LJ5 f;  1VQ4 T;  3QXE B;  4XU1 A;  5GMK m;  3CCV A;  4M7A G;  3UDC A;  2R58 A;  5GAN 6;  2RJD A;  1I4K 1;  3CMA T;  1QVF A;  3QYG B;  5GAN f;  2DIG A;  3OS5 A;  4C5G A;  2JTM A;  4ZTJ A;  2GFA A;  2QQ9 A;  3V8K A;  5LJ5 h;  2CYZ B;  2F5T X;  1VQ9 T;  3CCU A;  4B9X A;  1G3T A;  2CZ1 B;  3RMS A;  3CCL A;  4FM4 B;  4C8Q F;  5GAN h;  3JCM c;  4ZTF A;  4OGE A;  4BY6 B;  1FXX A;  3I56 A;  3CCM A;  1SSF A;  4BI8 B;  3QJ6 A;  4C8Q C;  5DY9 A;  4M7A B;  2D9T A;  2QQA A;  1WJR A;  3OYL A;  2CZ7 B;  2DZC A;  2ZPE B;  4M77 D;  1K9M U;  5GMK e;  1B34 B;  1EIF A;  2VXE A;  5CO7 A;  5EG2 A;  5LJ3 d;  5A0L A;  4QVC A;  1PSE A;  5KCH A;  4EMK B;  5LJ3 j;  3LLR A;  1YIJ A;  1U8R A;  2FB7 A;  3A8G B;  2KQW A;  4RMO A;  2RI5 A;  2R5M A;  2LNV A;  1VQO T;  3P8B B;  4M75 G;  2DD4 A;  3TU4 K;  3BY7 A;  5KE3 A;  1YJW A;  1DJ7 B;  1VQ7 A;  4C0D B;  3Q1J A;  5GAO p;  2JOY A;  2XIC A;  3HPW A;  1VQ4 A;  2JN0 A;  1XTD A;  4E7L A;  4KT0 E;  4PJO E;  1YBY A;  4HCB A;  1IRE B;  4ZGJ B;  2QEX T;  2PVD B;  5CCA A;  5DLQ E;  2DK3 A;  1Y7X A;  2HD0 A;  2QQS A;  1M90 C;  3OYY A;  1I8F A;  1VQ9 A;  3PIP A;  5J26 A;  4IUT A;  1FWZ A;  3A5Z B;  1NE8 A;  3M56 A;  3A8H B;  2PVG B;  2AHJ B;  2FL7 A;  3VJP A;  1LNX A;  2LT1 A;  1OZ2 A;  2WSF E;  1W4S A;  1WJS A;  2ZZD A;  4IUR A;  2OAU A;  4OB2 B;  3LWH A;  1NZ9 A;  2L89 A;  2K5I A;  3JB9 J;  1MGQ A;  3L1A A;  3V7C A;  4CRI A;  3JCM g;  4LDV A;  4MMK A;  4IKF A;  4JUV A;  5GMK j;  3GP8 A;  1GXI E;  1M1G A;  2MWO A;  2ZPH B;  2EQM A;  2Y4Y A;  4XU2 A;  2MF2 A;  4R56 A;  2C06 A;  3JSC A;  1X6O A;  4VUB A;  4P5N A;  3ZFJ A;  1Q81 U;  1VQ6 T;  1WGS A;  3TEE A;  2LRQ A;  4PLL A;  4LDU A;  4A4F A;  3LWI A;  2V8J A;  2XG8 D;  3TRE A;  1G5V A;  2M9U A;  2VYT A;  4FL6 A;  4C92 F;  3VYH B;  4C5I A;  1N27 A;  2B8A A;  1BI1 A;  3OA6 A;  1M1K U;  2QEX A;  4KBM B;  4N0A A;  4C92 C;  2XDP A;  4C0Z A;  1P92 A;  3F70 A;  1VQL T;  4M7D B;  2O01 E;  4JRQ A;  1HXD A;  4NOY A;  3JCM Q;  3VV0 A;  1IZ6 A;  1KHI A;  4M75 A;  3UT1 A;  5GMK i;  3OYM A;  2DO3 A;  4F7U G;  4HKE A;  4IUU A;  1JBM A;  3QJY A;  4E7I A;  2MI6 A;  2WSE E;  4PL6 A;  2VGM A;  4NS5 A;  3FC3 A;  3C95 A;  3KXT A;  4LD6 A;  2V8K A;  4E7J A;  4E7H A;  3PNW C;  3CXC S;  4JRI A;  1NJI C;  2XD0 A;  1G3Y A;  5D6W A;  3JCM e;  2IVW A;  2CS7 A;  3MEA A;  5FU6 C;  2RH2 A;  3S6W A;  1M1K C;  1VIE A;  1YJ9 A;  1VQ6 A;  3FJP A;  4F7U B;  3MO8 A;  5CQX A;  1O9S A;  1UGQ B;  4M77 F;  4M75 D;  3WXM B;  1D3B A;  1JJ2 A;  2G3R A;  2LQK A;  4RCB A;  3VU3 C;  3QPH A;  4M77 C;  3RUX A;  2E65 A;  2E5Q A;  5DLO A;  1NPR A;  2QQB A;  3CCL T;  2E41 A;  3PMI A;  3DKM A;  4JLG A;  4BDZ A;  4WF2 A;  1QVG S;  2ZGW A;  2A3L A;  2DXU A;  2E10 A;  1XQH A;  3HRS A;  1W2B A;  5GAM f;  2DIQ A;  3GNG A;  2GF7 A;  2QXF A;  2M0O A;  2JVV A;  1MHN A;  2RI3 A;  3WVD B;  5HK3 A;  3HRU A;  2DXT A;  3MP8 A;  3FIF A;  3FEO A;  5LJ3 h;  4M78 F;  4DOW A;  3QZ9 B;  3OS0 A;  4A4H A;  5LJ5 g;  5GAM h;  1OI1 A;  4PJO G;  2CKK A;  4R55 A;  4M78 C;  3QG1 A;  3NTI A;  5GAN g;  3L42 A;  2RHI A;  2P0Q A;  4M77 A;  3JCM d;  3ME9 A;  3X24 B;  2QA4 T;  1R8O B;  4X9D A;  3M59 A;  2GFU A;  5GMK l;  4DQ2 A;  1QP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...