2K57A

Solution nmr structure of putative lipoprotein from pseudomonas syringae gene locus pspto2350. northeast structural genomics target psr76a.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
MASPTVITLNDGREIQAVDTPKYDEESGFYEFKQLDGKQTRINKDQVRTVKDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Lipoprotein
publication title Solution NMR Structure of Putative Lipoprotein from Pseudomonas syringae Gene Locus PSPTO2350. Northeast Structural Genomics Target PsR76A.
rcsb
source organism Pseudomonas syringae pv. phaseolicola 1448a
molecule tags Structural genomics, unknown function
total genus 8
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k57A00
3HSBA 4M7AD 3JCMd 1X01A 3L2ZA 3PGGA 3V7SA 4C92E 4M77C 4RCCA 3VU3C 4C92D 3RKXA 3JCMX 4M75E 2VC8A 3V8JA 2DVEA 2QTXA 4M75D 3JCMg 2EAYA 3QUIA 3JCMJ 4M77F 1TH7A 1KQ2A 5GAOl 5LJ3f 4EMKA 4M7DF 1KQ1A 4XTZA 4J6YA 3JCMV 5GANe 5GANh 5GAN7 1N9RA 2JN0A 4M77B 5LJ5f 2FYKA 4C8QC 4M7DG 1LNXA 4PJOE 3BDUA 1I5LA 4M7DB 4M7AC 4PJOD 2CGHA 4OP0A 1MGQA 4QVDA 4HT8A 4M7DE 4N0AA 4NOYA 4C92C 4M7AF 3BW1A 3RESA 5LJ3d 5GAMe 4M75C 3JCMb 3JB9H 4C8QG 4XQ3A 1BIAA 2DZ9A 4C92F 1B34B 2FB7A 3V7CA 4C8QB 1N9SA 3BY7A 5LJ5d 4M7AG 1WPYA 4M75F 4M7AB 4V2SA 4JRIA 4M78A 5LJ3g 4C92G 4C8QE 4HA8A 5GMKe 4J6WA 3HFNA 2EJGA 4M75G 4C92B 4PJOC 5LJ5g 3EFRA 1WQ7A 4M75B 4RCBA 1H641 1M5Q1 2EWNA 2EJFA 4PJOF 2DXUA 3EFSA 4JLIA 5GMKj 3JCMP 3SWNC 4M77A 3GIBA 1M8VA 2YLCA 4C8QD 4PJOG 1JRIA 4EMGA 5GAN3 1Y96A 4PJOB 3QO3A 4HT9A 1BIBA 2I2LA 5LJ3j 1D3BA 4NL3A 3SWNB 4DQ2A 5GAOp 4XTXA 4C8QF 5LJ5j 1YCYA 1U1SA 2DJZA 4WF2A 4X9DA 4F7UA 3AHUA 3QSUA 5GAN2 5GAMh 4MMKA 3JCMW 4XU3A 4XU0A 3JCMe 5GAOm 1LOJA 4J6XA 3INZA 4XTVA 2YHTA 4XTUA 4A53A 2DKGA 4EMHA 5GMKh 5I21A 3JCMQ 4EMKC 5GANf 4M78D 3JB9J 1I81A 2DXTA 2E1HA 2VXFA 5GMKl 5GAN4 3V8KA 5GAN8 3HFOA 2RD1A 4M7AE 1I4K1 2DZCA 3FIFA 5GAOr 3JB9D 4M7DA 4JUVA 2E41A 4N0AC 5GAMf 4EMKB 4JRKA 5CAIA 5GANd 3RIRA 1U1TA 5LJ3e 5GMKi 5LJ3h 3QHSA 4X9CA 3L1AA 3V7RA 1B34A 5GANg 4C8QA 3JB9I 5LJ5e 4MMLA 4XTYA 5LJ5h 4M7AA 3RERA 5GAN5 2HNIA 4C92A 4F7UE 4QVCA 5GAN6 4M75A 4M78G 3JCMh 3SB2A 3V8LA 4M78B 5GAMg 5DY9A 4XU2A 3FB9A 1WNLA 4XU1A 2DTIA 4M78E 1WQWA 2DTHA 3JB9G 1LJOA 5GAOn 3RUXA 5GAOq 4PJOA 5GANj 2E65A 4M77G 1HXDA 2ZGWA 2K57A 4NL2A 3RKYA 3SWNA 1Y96B 4M77E 1I8FA 2RA2A 4J5YA 4M77D 4M7DC 3JB9F 3JCMf 4PNOA 2Y90A 4F7UF 4M7DD 2YLBA 5GAMj 1D3BB 4A54A 2DEQA 4Y91A 3BFMA 3M4GA 4M78C 4F7UG 1HK9A 2VXEA 4XTWA 4F7UB 2E64A 2RB6A 2E10A 2RM4A 4M78F 3RKWA 5GMKm 2DTOA 2EJ9A 5GAMd 3JCMc 3FJPA 1JBMA
chains in the Genus database with same CATH superfamily
2YT6A 5CQYA 4M77C 3VU3C 1VQ5T 4RTZA 5J3BA 2DFUA 2XMFA 2EW3A 2QQAA 2ZPFB 3JCMV 5GANe 1YI2Q 2YUOA 4CRIA 4J9DA 1UECA 1M9SA 3CCVQ 3A1PA 1XTDA 3RMQA 4HT8A 1YITT 2EKOA 4C92C 2ZPIB 3JCMb 2DO3A 3G6EA 2K2VA 3BY7A 5LJ3g 2EGAA 1PRMC 2MI6A 4DOVA 3VYHB 1UGVA 2DL4A 3E9GA 1W6XA 1M30A 2E6ZA 2ZPHB 5GAN3 3HRSA 1HSQA 4D8DA 3PTAA 4MZPA 1IGQA 3WXMB 1M2VA 3SHWA 2JOYA 3CC2A 3D7SB 3QSUA 3CCMA 3P8DA 2RHIA 1XOVA 5CK9A 1YWOA 3MEUA 4PLLA 1LOJA 2PTKA 4N4IA 1Y57A 5I21A 1T3SA 2CUDA 2K9GA 1TUDA 1Z9QA 5D6WA 1UGSB 2MCNA 4M7DA 3CD6Q 2OX7A 2FHDA 1G3YA 5CAIA 2HZYA 4LDXA 1RI0A 2PU9B 3HRTA 3NTKA 4OMLA 1GCQC 3CCRT 1QKWA 4M7AA 1K4US 1A0NB 1OX9A 2EYWA 4J83A 5M9OA 3CC4T 1WA7A 4JPBW 5GAOq 5GANj 5HY6A 3H0FA 2K5IA 5LL6S 2EPDA 2LVMA 3QJYA 3OYLA 1NYFA 1B7TA 2C0OA 1NLPC 1KIKA 4XTWA 3G4SQ 2GNCA 2AZVA 3KXTA 1DJ7B 1R77A 4OB0B 3ZBDA 3UA7A 5FU6C 1QW1A 3QZ9B 1OPKA 4WTOB 2RHXA 4PKCC 2P0QA 2D8JA 4R56A 4QW2A 3VS6A 1BKBA 5FRNA 1H3HA 3UPUA 3H0HA 4II1A 3FRNA 4PK4A 3OSSC 2XK0A 1NE8A 1NPRA 3THKA 2A0FB 4BY6C 4AG1C 2X4YA 4OB3B 2DL5A 3EFSA 5IHNA 4PJOG 5HK3A 2GTOA 4KGXB 1Q81U 2K3BA 4PJOB 1WJRA 1BIBA 1M1KU 3NPFA 2YRCA 3OYAA 3GNFB 1WZOA 2YWWA 4J7FA 2OTLA 3SD4A 4X9DA 3MEWA 3JSCA 5CR2A 4KUIA 5GAMh 4OMFB 2DBKA 3OYMA 1E6HA 1VQ9A 3J80E 1FXXA 4KULA 2JM8A 2DXTA 2CP6A 3MP6A 2E5KA 5GAN4 1G2BA 2L89A 4LDVA 3PVLA 3NGPA 3M59A 8ATCB 1KC8U 2HL3A 2JUFA 3RERA 2RHZA 4LN2A 4IUUA 3CMEA 2CZ1B 1Q82R 4XU2A 1G8XA 1GRIA 3RUXA 3OYNA 1VQOT 2LTOA 3WVDB 2RJDA 2ZGWA 1XQHA 1NLOC 3RKYA 1YIJT 4DBQA 3BFMA 2EYXA 3EHQA 2X4WA 2E64A 3RKWA 2DTOA 3RKXA 4M7AE 1K9MU 1SPKA 1X01A 1EIFA 3JCMX 2L3SA 4M75D 3QUIA 4M7DF 4XTZA 3FLGA 5CKEA 1JQQA 4IKFA 1RACB 1UHFA 3CC7T 1VQ6T 4IUPA 4M7AF 5LJ3d 2KY9A 4OMMA 3V7CA 1ZUYA 3EGDA 4V2SA 2B86A 4JDSA 1AWOA 4WCIA 2HKNA 2BIVA 3EGUA 1X27A 4XK8E 4FIBA 2EWNA 4QQ6A 2LMJA 4AFQC 1OI1A 3EG9B 1YCSB 1D1CA 5KYWA 3QO3A 2EQKA 3LX7A 2DRMA 4OMNA 4RTWA 3CMAQ 2B8AA 2CZ0B 4LNPA 1QWFA 1QWEA 1VQKA 1JO8A 1VQ9Q 1B07A 3PIPA 3H41A 3QBYA 3JCMQ 1ZBJA 4OGCA 4EMKC 2LJ3A 4JRQA 4O6JA 4AG2C 1NEBA 2QA4T 1W2BP 2RD1A 4PJMA 2E70A 1G3SA 2DILA 2LQWA 4PLIA 1QVFA 3VS3A 2EGEA 4FYWB 2J05A 4E47A 5LJ5e 4CC2A 3LGFA 3CMEQ 2E5QA 3MP1A 2ABLA 4A4EA 2KXCA 3SB2A 1M3BA 4BACA 3VYGA 4M78E 3O5ZA 1V76A 5GAOn 2RQTA 3CCUT 1JXMA 1HXDA 2M1HA 3QKJA 1EX4A 5KH6A 3M0TA 4M77D 1VQLA 1Q82C 4OMPA 2DEQA 1QVGP 4RG8A 1UGPB 2CSQA 1M90R 2QG9B 4M78F 4HXJA 1M3CA 3M0SA 4FU6A 1VQMQ 3HSBA 3RMSA 4C92D 1ZSZB 1PC0A 3HL8A 1QVFS 3JCMg 4J7IA 1N27A 2XICA 5LJ3f 2AIRB 3HPWA 2KEAA 1MGQA 1WJSA 2XU8A 3RBBB 2AK5A 1K0XA 4C8QG 1VA7A 4C0DB 1B34B 1M2VB 2XDPA 3EH1A 4C8QB 3HRUA 3JRZA 1VQNA 2EQIA 1IREB 1NBEB 4Z02A 2M51A 2HQXA 2LDMA 1ZLMA 1BI0A 2ZAEA 2O9SA 2LT4A 1GBRA 3SWNC 4ZGJB 3X24B 2HCKA 2OTJT 2JTFA 3A8MB 1YJWQ 3OYBA 1KK7A 2ECZA 4FW1A 5LJ5j 2R58A 5KYNA 3OMCA 1U5SA 5HCKA 4R55A 3TQ7P 4XTVA 3I55T 3S3MA 4BI8B 2YUPA 1K73R 3O8VA 2JNGA 4M78D 1I5OB 2KXDA 1G3TA 2CREA 3PFSA 4PFOA 3FDRA 4DEYA 2D0NA 2YRVA 1H92A 1YIJQ 1YBYA 5IT9E 5GANg 1ZHIA 4AMCA 2DL8A 3CBOA 1WI7A 5AT1B 1IRXA 2QDYB 1YJNT 1S1NA 1Z9ZA 2MMPA 5FWBA 3OW2A 1S72T 4PJOA 4M77G 3CCJT 1VQLQ 1VQ6Q 1M4ZA 4HVVA 3I5RA 1PSFA 3A8GB 2CYZB 5FRMA 1OU9A 1WYXA 1WHLA 3JCMc 1RLQC 1WGSA 4FW2A 3CCLA 3PIOA 5CKFA 3TSWA 5IHKA 1MMGA 2ATCB 2MWPA 1RAAB 5KE3A 3CCQT 4VUBA 2ENMA 1M90C 2FEIA 5FU7B 4K11A 1LNXA 1X43A 5GAMe 1YJ9T 2CP3A 3GNGA 2ROLA 1ZUKA 2QI2A 2J06A 4CI0C 3OW2S 2A7YA 4BDYA 3EFRA 4RCBA 1WXBA 2DNUA 2XKOC 7AT1B 5FWCA 5I2SA 4EMGA 3UWNA 1N5ZA 1WX6A 1YHQA 1YI2A 1NEGA 3OYYA 4E7IA 1U8RA 4J8OA 2RQWA 2AHJB 3MP8A 4C5HA 3OYHA 4DBHA 2KMTA 2P0PA 2RMOA 1VYVA 4FCYA 1UUEA 3J7AF 1QQJA 2PUOB 4X1VA 1GL5A 1IHWA 1RAEB 1N8RU 4FT2A 2JTEA 2EQJA 4ME7A 2DIGA 2NUPA 3RIRA 2X51A 5LJ3h 3QHSA 1K73C 4ZGEB 3OYGA 2FVUA 2X35A 3NHNA 4XTYA 1RLPC 2QDLA 4F16A 2HNIA 2IG0A 1MNEA 3GOXA 4XAXB 2E4HA 2DLPA 1I0CA 2DEUA 1SEMA 3EG9A 3M0PA 2KROA 2E65A 2JVVA 3RDVA 2HAXA 3G6ET 5FU6B 3CD6A 4E6RA 2FZGB 4JRPA 5GAMj 3UDCA 4F7UG 2L0AA 3R6OA 4F7UB 2H8HA 2EYYA 2D8HA 1JBMA 3JCMd 3OYKA 4RMOA 5AYFA 4M7DC 4BI4A 2EKHA 3M55A 1UJ0A 3CC2T 4PJOE 3CCMT 1I5LA 4M7AC 2CGHA 2IPOB 1X6OA 4N0AA 3OYIA 3J81E 3RESA 4ZNXA 3VUBA 4XQ3A 1RL2A 1C6VX 5DM7R 2P4RA 1UGQB 4CC7A 4L5GA 2A08A 1U06A 2EQMA 1WHHA 3G4SA 4FT4A 2LX9A 4PJOF 3MJXA 3GIBA 1UEBA 2YUNA 4HCBA 1LPLA 1YHQQ 2BE9B 2HBPA 1MNDA 1SG5A 2F1LA 1NJIU 3M56A 4PL6A 4NL3A 1Q81R 4JZ3A 1M1KR 3NFCA 4OMOA 2ROTA 1ZSZA 1X2KA 1I1JA 3DLMA 1BB9A 4OF1A 3JB9J 1T0HA 3EFOA 2E1HA 2OJ2A 1YJNQ 2VXFA 1CKBA 3A8OB 3V8KA 3HFOA 4AFSC 1S72Q 2VV5A 3OBWA 2CP7A 1WHJA 2RI5A 5GANd 1RAHB 3DB3A 3A8LB 4J9GA 1M3AA 2QEXA 1B34A 4C8QA 3L42A 1KC8R 5GAN5 1K8AU 4QVCA 2KRMA 1PSEA 1MHNA 3WVEB 2CSIA 1VQ8T 2V8JA 2G3RA 2JM9A 4QT7A 2VGNA 1WFWA 1Y96B 2FZKB 3JCMf 4PNOA 2Y90A 4ORZA 2YLBA 4A54A 1JJ2P 4M78C 5FLXE 2KK4A 2F5KA 4RTTA 3JAME 2RH2A 2E10A 2W0ZA 1VQ7Q 1NYGA 2RI2A 1BCMA 1M1GA 2RJFA 4ANJA 3JB9F 1TH7A 4RTUA 1VQ5A 5KYUB 5GAN7 3GP8A 1KG1A 1PNJA 3UT1A 3G1JA 3JB9H 3CPWP 2HQHA 1YITA 3PVQA 4QQDA 2KQWA 3M9QA 2BKDN 4JJBA 3HFNA 2EBPA 5LJ5g 2RO0A 1UB4A 2KVQG 2KDSA 5IXBA 1M5Q1 5EC7A 2MAMA 2VKNA 3EGXB 4JJDA 4M77A 2O4XB 4HT9A 2DRKA 2KYBA 3M57A 1TTHB 2DL3A 5C6SA 3HP9A 3C95A 4XU0A 1KD1U 4A53A 5GANf 3TVTA 3EG3A 3OYDA 5I22A 1Q81C 3VRZA 1M1KC 5GMKl 2GF7A 1R8OB 2A28A 2PQWA 3JB9D 5HK0A 2K5FA 2LX7A 2VB6A 2QEXQ 1U1TA 1K76A 4JS4A 3L1AA 2HSEB 4QVZA 2FPDA 3CMAA 2J6KA 1PKTA 3TSZA 3CCRA 3L2RA 1U3OA 4C0ZA 2RQRA 3P8BB 3FB9A 4XU1A 1H3ZA 2RN8A 5FW9A 1QCFA 3OYJA 1KC8C 2K2MA 2K79A 1VQ4T 4IIMA 2IVWA 1IHVA 3HHTB 4HCCA 3LWHA 2RA2A 4RUGA 1O9SA 1YP5A 3OS5A 1VQPQ 5A0DA 2QASA 1D0XA 2EJ9A 4C0FA 2L8DA 4A4KA 1VQ5Q 2DVEA 1KQ2A 2CDTA 3M54A 2F2XA 2RHUA 2YDLA 5KYXB 1RUWA 4KUDK 2E3HA 1UHCA 1Y07A 3P8HA 1VQKT 1K0SA 3M0UA 2FZCB 4M7DE 4NOYA 3MKDA 2H3EB 1YITQ 3CPFA 2FPEA 1PWTA 3QYHB 2QQSA 4BE1A 1D0ZA 4J6WA 4FYXB 2ED0A 2L3QA 1XJWB 1D0YA 1NM7A 5CKDA 1VQMA 1HYOA 2KGTA 3VV0A 3L2VA 5FROA 3LH0A 1JRIA 1QLYA 1QCOA 1D1AA 2K6DA 2BTTA 1T0JA 2O01E 5I2MA 2O2OA 2A37A 2HSPA 2DL7A 1YCYA 2KAFA 2NUPB 2DJZA 4F7UA 5DLQE 3R6NA 1OPLA 2PVDB 2ZZDA 2PNIA 4XTUA 1NG2A 2DKGA 4C5EA 3M4YA 2EYZA 4E7LA 1K1ZA 1VOMA 2RNAA 2X3WD 3CCST 1VQ8Q 1OEBA 1IB8A 2X9HA 4JUVA 2VVKA 3A8HB 2K4YA 4R0KA 3OA6A 1YJWA 2X4XA 3AT1B 1EFNA 4GBQA 2VWFA 3CCRQ 2KRNA 2DERA 3X26B 3G71T 1C1AA 5KYYB 3SFMA 4BUGA 5GAMg 4KGZB 1B3QA 3CC4Q 4P5NA 2DTIA 1WQWA 2ZCFB 1W2BA 2JT4A 2GQVA 4OMQA 2DYIA 1GFDA 4GLKA 3CCET 2FRYA 3NTIA 4BB7A 1MMNA 1X69A 4J9FA 4CC4B 4M7DD 4DBFA 3KUFA 1YFNA 2CZ7B 1YIJA 1VQNT 3URGA 2VASA 4OB2B 4HVUA 1QP3A 2EVRA 4M7AD 4ZGDB 3PGGA 1OX8A 1SSHA 2QTXA 3L2QA 1AD5A 4Z89A 2HKQB 5GANh 1N9RA 2F5TX 2KT8A 2KI7A 2DD5A 3BDUA 4KH0B 4ZN3A 1JXOA 1VQ6A 2FB7A 2DM1A 5LJ5d 1W2BS 2FL7A 2XIDA 3EAEA 4LE9A 4M75G 4PJOC 1OV3A 4M75B 2QK0A 1WHMA 4JLIA 3VS5A 5CO7A 2F2WA 3GLXA 1BBZA 3EFOB 3QYGB 1TU0B 1Y96A 2PZ1A 1TG0A 2CT3A 4A63B 3Q1JA 1ACMB 5GAOp 3TREA 2LP5A 1VIFA 3QXEB 2MWOA 3JCMW 1QP2A 2FG0A 3ASKA 5IHIA 2HDAA 2ZPBB 2LJ0A 4L6V5 1LCKA 2NYSA 1SF9A 2RJCA 3A98A 1PKSA 2H3JA 5KYUA 2HEQA 4DEXA 4EDUA 1N8RR 3BDLA 1LVKA 4IIOA 4JRKA 3OB9A 3TU4K 1WHGA 4LUEA 2V26A 3X25B 1Q7YU 1FMVA 2HL5C 4MMLA 1KHCA 3CCLT 2DE0X 2HQEA 2SRCA 1WHKA 2DX1A 3I56T 4F7UE 5GAN6 1HJDA 3EGXA 2KE9A 2FPFA 2O4XA 3N5BB 1VYTA 1VQOQ 4BE0A 2X4JA 2E12A 4MZMA 5CKHA 1WXUA 1WJQA 4F7UF 1D3BB 4IUTA 2GFUA 2J6OA 4ESRA 2GGRA 2RM4A 3MHXA 4PJLA 2CZ6B 1TUGB 1M2OA 1RAFB 4DOWA 2VGMA 4ELYC 2FO0A 3CXCP 5C0MA 5GAOl 2JW4A 3C4SA 1J3TA 2WSFE 2JN0A 4M77B 5LJ5f 3CCVT 2D1XA 1RAIB 2SEMA 1QCNA 2MPXC 3CC7Q 2E3IA 1BI1A 1OULA 4RKUE 1KQSP 4C92G 1SHGA 4M4ZA 4C92B 2K7AA 3I35A 3MPUB 2DXUA 3PE0A 1Q86U 2WACA 3VS7A 2LNVA 2C0TA 1UG1A 4O5VA 1NJIR 3E19A 1UTIA 4A4GA 4J6XA 1PD0A 2JXBA 4EMHA 5GMKh 3I55A 3VS0A 4KBMB 5KYXA 3S3NA 4OB1B 3T9NA 1FMWA 4B6MA 4N4HA 2QA4Q 3CD6T 2R5MA 3QPHA 4N0AC 1ZUUA 3QG1A 1IGUA 2X3XD 2Y4YA 3LH5A 5GMKi 4TVRA 1G3WA 1V1CA 1Y7XA 3KBGA 3GF5A 3TEEA 3OMGA 1N8RC 3MEVA 1AWWA 4M78G 4M78B 4Z8AA 5CVIA 1K8AR 2DTHA 2L3RA 2OI3A 3JV3A 3DLLA 3CCUQ 3KFVA 1YJNA 1S72A 1I8FA 4J5YA 2JS2A 3E2UA 4FM4B 1R0CB 1ZSZC 3G4ST 2KRSA 2RB6A 5GMKm 4FYYB 3H0IA 1NZ9A 3FJPA 2BUDA 4IURA 2I0NA 2EAYA 4OVAA 1E6GA 1KQ1A 4J6YA 4JZ4A 2JTMA 3OBYA 4C0DC 4C8QC 3CCQA 5ECAA 2QYZA 5KYYA 5GJVB 1WPYA 2EGCA 3IQLA 2DJQA 3HKSA 2KT1A 4A4FA 2QAZA 1VQ7A 3M0RA 1XNIA 2CP5A 3QWXX 2KR3A 1OOTA 1FWZA 4E2FB 2OTJQ 4BY6B 2LCLA 1BK2A 2D0QB 3H8ZA 3VRYA 5L23A 3OYEA 4J9BA 4EPCA 2DA9A 4D6WA 3VS4A 3INZA 3U23A 3C94A 2GTJA 3I55Q 3CQTA 3NMZC 4ELZC 1KD1R 1FYNA 1N6AA 2L2PA 1NJIC 1ZX6A 2E41A 1OZ2A 5GAMf 1AWJA 2QXFA 4AT1B 1FX7A 2DF6A 4X9CA 5A0GA 1Y0MA 2RQVA 5LJ5h 1SRLA 4E7JA 4LD9K 2ZPEB 4JJNK 4M75A 2QQRA 3V8LA 1PD1A 2NWMA 2MK5A 3OS1A 1LJOA 2DD4A 1W4SA 2R5AA 1NPPA 1Q95G 1SHFA 3CCJQ 2KNBB 1RAGB 2CP2A 1K8AC 3FEOA 3A5ZB 1ZQ1A 3PMTA 2XI9A 3BE3A 4JLGA 2DYBA 3EHRA 5FU7C 1TXQA 3E1SA 3CCQQ 2HBWA 3VKIA 2BZ8A 1M1FA 2RHYA 5IN1A 4PJOD 2V8IA 4OP0A 1JJ2A 4LDWA 1PHTA 1TUCA 2DXBA 3OSVA 4Y28E 3BW1A 3OY9A 1N9SA 1YJ9Q 1VQPA 1ZSGA 2M16A 4ZN1A 3L2WA 4PJNA 1BI2A 1MV0B 1QKXA 1K9MR 2J7IA 3MO8A 4PFZA 2XG8D 2COYA 2OTLT 1D3BA 3CMAT 5I11A 1SSFA 1VIEA 2P4TA 3E9FA 3CPWA 1MMDA 4LD6A 1VQ9T 1GBQA 1PG5B 2XD0A 2L3PA 2YHTA 3LYIA 4MZTA 4RG2A 1OZ3A 2VUBA 5GAN8 1IO6A 1JJ2S 1KJWA 4X34A 5KCOA 2E6NA 5CQXA 2OAUA 4EMKB 4AFUC 1VYUA 1WXTA 2P84A 1SKUB 1O75A 1KSWA 1KD1C 1JU5C 3CMET 2CS7A 2GFAA 1MMAA 1EZZB 4C92A 3F70A 3QWYA 3MEAA 1UE9A 2RI3A 2V1RA 2RPNA 2PUKB 3CPWS 1VQ8A 2AT1B 3G6EQ 2LZ6B 5J26A 5IAYA 4NS5A 2K3XA 3ZFJA 5CCAA 1VQMT 2QTVA 5GJWB 3L2ZA 3ME9A 4M75E 3V8JA 1IZ6A 1RABB 3CC4A 1CKAA 2M9UA 2XDBA 3CC2Q 2PVOB 3CCMQ 1UDLA 2RQUA 4M75F 4BI3A 4C0GA 4JRIA 4M78A 1HD3A 1X6BA 2CT4A 1GCQA 4HA8A 3QIIA 4C8QE 5GMKe 3EG1A 1OQKA 4ZTJA 1WQ7A 2Y4XA 2C0IA 3C0CA 4HCZA 5J39A 2WSCE 4LDYA 2DPPB 1AVZC 3JCMP 2YLCA 2XHCA 1YJWT 2AZSA 2I2LA 5KCHA 4QQGA 3SWNB 6AT1B 4XTXA 4C8QF 1ABQA 1U1SA 3PT9A 2EFIA 4WF2A 3AHUA 5GAN2 1K9MC 4MMKA 3HTRA 8AT1B 1BU1A 1PM3A 5GAOm 1CSKA 1K9AA 2JJ9A 3EH2A 3UF4A 1I4K1 5GAOr 4BD3A 3TCJA 2GBQA 4CC3A 5LJ3e 4C5IA 3JB9I 3M58A 1Q7YR 1TWBA 2NLUA 2EIFA 5HKCA 3JCMh 2W10A 1P92A 2COZA 5DY9A 1D1BA 4Q5WA 3JB9G 2CH4A 3H9NA 2P0KA 1BYMA 2M0YA 3OS2A 2OAWA 1VQLT 3NTHA 3VS2A 4M77E 1Y71A 1VQ4A 2KSSA 1TOVA 1ZA2B 3QZ5B 1YN8A 3ULRB 3ZEHA 5KE2A 2F69A 5GMKj 2RK2A 4C8QD 1OYXA 4KRTA 4B9XA 4C92E 1RI9A 4RCCA 2EYQA 3JCMJ 4M77F 1AZEA 2FYKA 2Z0WA 1VQOA 3LGLA 2OTLQ 2JMAA 1SRMA 5CKBA 2NUTB 3SEMA 5IXFA 5CIUA 3L2UA 1BIAA 2DZ9A 2EQUA 4C92F 1UFFA 4IUVA 1AWXA 2DMOA 1GXIE 4IUQA 2LQNA 2RK1A 2V1QA 2QGGA 1M8VA 2COWA 4F04B 4FYVB 2QGFB 4RTXA 4BDZA 3PMIA 3RNJA 5LJ3j 2NUZA 1Q86R 1QVFP 4BE2A 3X20B 4DQ2A 2A3LA 1QVGA 4YTLA 3CC7A 3UATA 2YXYA 2LT1A 3GBQA 3VUZA 4E7HA 3M0QA 4C5GA 2ZPGB 1G5VA 1WDXA 4PJJA 5A0LA 2DZCA 3FIFA 3CCSA 2D9TA 2JMCA 5L8RE 3REBB 3DKMA 4J9CA 1D09B 4J9IA 1Q82U 1TS9A 3G71A 3S3OA 4HCKA 4N4GA 2LCCA 3S6WA 1AZGB 1Q7YC 4QKUA 1QVGS 3DB4A 1MUZA 4GY5A 4NL2A 4EIKA 1VQ4Q 2DIQA 2QA4A 3CCEA 2LQ8A 1TSFA 1HK9A 1X75C 3LLRA 2MIOA 1T3LA 4KGVB 1GFCA 4J9EA 2ED1A 1OU8A 1GCPA 1M8MA 2WSEE 4EMKA 2K5LA 5D6XA 2YSQA 4M7DG 3CCUA 4M7DB 4QVDA 3LWIA 1VQKQ 2R57A 4M7AG 2JZ2A 4FL6A 4M7AB 2PVGB 2EJGA 4Z88A 1QVPA 2HMAA 3CXCA 1QMCA 5A2QE 2CUBA 2BE7D 1F1BB 1E7OA 2FRWA 2DXCA 1YHQT 2AKLA 1YI2T 3ER0A 2G6FX 1AOJA 4PFPA 1V29B 1UGRB 4F14A 2M0OA 3LW5E 4JS5A 2CH4W 1KQSA 2RF0A 4AFZC 1ZBXA 4J9HA 2D6FA 3FJ5A 1Q86C 1I81A 3PNWC 1PRLC 1W1FA 2BZYA 3CBMA 3CCSQ 1MV3A 3OW2P 2LC4A 2O88A 1YWPA 1JB0E 2OTJA 2RJEA 3V7RA 3MCAB 2YUQA 2L5QA 2YRDA 3M5AA 4LXCA 4GLMA 3SDZA 3CXCS 4HKEA 3G71Q 2VYTA 1G83A 2DVJA 3I56A 3VJPA 1WNLA 1WIEA 2XDDA 3I9QA 4E7KA 1VUBA 3CBPA 1FMKA 3CEYA 1BI3A 3CCEQ 3SWNA 3QDRB 3ZL7C 1KQSS 2MYSA 1M90U 3OQ5A 2KYMA 4A4HA 1VQNQ 1VQ7T 1UJYA 5GAMd 4RTVA 4FSXA 1M27C 3M53A 2AKKA 4E7ZA 1YNZA 1AT1B 2KBTA 4L59A 3V7SA 2LQKA 3H6ZA 4OGEA 5D7UA 2A36A 1PCXA 4RTYA 4ZTFA 2VC8A 3QJ6A 1ARKA 1H8KA 4LDUA 1KHIA 4FSSA 2J6FA 3OYFA 3CCVA 1RADB 4M75C 3CCJA 1WLPB 3GPLA 4F17A 1H641 2DK3A 4UC4A 2EJFA 3RR6A 3QDFA 1W70A 4KH1B 3META 5IH2A 1JEGA 2CKKA 4E7SA 2LRQA 5DLOA 4XU3A 1K73U 2GQIA 2O9VA 3JCMe 2V8KA 2MF2A 4LUDA 1YJ9A 2LJ1A 4Y92A 4D8KA 3UA6A 4KT0E 4DBRA 4JJCA 2DBMA 1BCOA 2ESWA 2C06A 2CP0A 4DA4A 9ATCB 1ZA1B 3G7ZA 3REAB 2QEXT 2IIMA 2NUTA 1C0MA 1IXDA 2JS0A 2QQ9A 2LCSA 3CCLQ 2MOXA 3I56Q 3I5SA 2DAQA 3OS0A 3EGDB 3FC3A 3EG0A 1X6GA 4HVWA 5D6YA 3OYCA 1R0BG 2BZXA 4MDWA 1KFZA 5EG2A 3EG2A 2O31A 3C12A 1ABOA 2QQBA 2F2VA 2K57A 2GCXA 2LNHB 1I07A 5KYWB 1AHJB 2DETA 3X28B 2M02A 1VQPT 4MDXA 4Y91A 2K3YA 2HD0A 3M4GA 4ATOA 2VXEA 1AEYA 1X2QA 4B9WA 3VS1A
chains in the Genus database with same CATH topology
1WGSA 4M7AD 4ZGDB 3CCLA 3PIOA 3L2ZA 3PGGA 5CQYA 4M77C 3VU3C 1VQ5T 5CKFA 3ME9A 5J3BA 2MWPA 4M75E 3V8JA 2QTXA 1IZ6A 5KE3A 3L2QA 3CC4A 3CCQT 2QQAA 4VUBA 2M9UA 2ZPFB 3JCMV 5GANe 1M90C 4CRIA 5GANh 1N9RA 2F5TX 2XDBA 5FU7B 1LNXA 1M9SA 2DD5A 3BDUA 2PVOB 1XTDA 3RMQA 4HT8A 1YITT 2EKOA 4ZN3A 4C92C 2ZPIB 5GAMe 3JCMb 2DO3A 1YJ9T 1VQ6A 3G6EA 2K2VA 2FB7A 3BY7A 3GNGA 5LJ5d 4M75F 4BI3A 4C0GA 4JRIA 4M78A 5LJ3g 2QI2A 1W2BS 2FL7A 3QIIA 2XIDA 2MI6A 3EAEA 4HA8A 4C8QE 4CI0C 5GMKe 4M75G 3OW2S 2A7YA 4DOVA 4BDYA 3EFRA 3VYHB 4ZTJA 4PJOC 1WQ7A 2Y4XA 4M75B 4RCBA 2XKOC 4HCZA 5J39A 2WSCE 3E9GA 4LDYA 2DPPB 4JLIA 3JCMP 5CO7A 5I2SA 2E6ZA 2YLCA 2ZPHB 4EMGA 3GLXA 5GAN3 2XHCA 3QYGB 1Y96A 3HRSA 1YJWT 3UWNA 3OYHA 1YHQA 2I2LA 3PTAA 4MZPA 5KCHA 1YI2A 3WXMB 3OYYA 3Q1JA 4E7IA 4QQGA 3SWNB 1U8RA 4J8OA 3TREA 5GAOp 4XTXA 4C8QF 1VIFA 1U1SA 2AHJB 2JOYA 2EFIA 3MP8A 3PT9A 3QXEB 4WF2A 4C5HA 2MWOA 3P8DA 5GAN2 2KMTA 2RHIA 4MMKA 1QP2A 2P0PA 1XOVA 5CK9A 3JCMW 1K9MC 3MEUA 4PLLA 5GAOm 3ASKA 1LOJA 2ZPBB 4N4IA 3J7AF 2PUOB 4L6V5 5I21A 1N8RU 2RJCA 4FT2A 2H3JA 5D6WA 1UGSB 4EDUA 1I4K1 2EQJA 5GAOr 4M7DA 2FHDA 3BDLA 4JRKA 4ME7A 2DIGA 1G3YA 3OB9A 4BD3A 5CAIA 3TU4K 3X25B 3RIRA 3TCJA 1RI0A 2PU9B 4LDXA 3HRTA 5LJ3e 1Q7YU 5LJ3h 3NTKA 3QHSA 4C5IA 1K73C 3JB9I 4ZGEB 3OYGA 2FVUA 3M58A 2X35A 4MMLA 4XTYA 3CCRT 1KHCA 3CCLT 2HQEA 4M7AA 2NLUA 2EIFA 3QSUA 2HNIA 2IG0A 4J83A 5HKCA 3I56T 4F7UE 5GAN6 3GOXA 3JCMh 5M9OA 1P92A 4XAXB 3CC4T 5DY9A 4Q5WA 2O4XA 3JB9G 5GAOq 5GANj 3N5BB 2E65A 2P0KA 5HY6A 2JVVA 1BYMA 3OS2A 4BE0A 2X4JA 2K5IA 1VQLT 2E12A 5LL6S 3NTHA 4MZMA 4M77E 1Y71A 3G6ET 5FU6B 2HAXA 2LVMA 2KSSA 5CKHA 4JRPA 1WJQA 1VQ4A 3CD6A 4F7UF 1VQNT 5GAMj 1D3BB 4IUTA 2GFUA 3QJYA 3OYLA 3QZ5B 3UDCA 4F7UG 3ZEHA 4XTWA 3R6OA 4F7UB 5KE2A 2RM4A 2F69A 3MHXA 2RK2A 4C8QD 5GMKj 1JBMA 3KXTA 1OYXA 1DJ7B 2CZ6B 4OB0B 3JCMd 4B9XA 3ZBDA 4C92E 4RCCA 3OYKA 2EYQA 4RMOA 5AYFA 4DOWA 2VGMA 4ELYC 4M7DC 3JCMJ 4M77F 5FU6C 4BI4A 5C0MA 5GAOl 3C4SA 3M55A 1QW1A 3QZ9B 2WSFE 2JN0A 4M77B 5LJ5f 2FYKA 3CCVT 3CC2T 4PJOE 3CCMT 3LGLA 1VQOA 1I5LA 4M7AC 2RHXA 2CGHA 4PKCC 5CKBA 1X6OA 2P0QA 4N0AA 4R56A 4QW2A 3OYIA 1BKBA 3RESA 3J81E 5FRNA 3L2UA 5CIUA 1BI1A 3UPUA 3VUBA 4II1A 1BIAA 2DZ9A 1RL2A 2EQUA 4XQ3A 4C92F 3FRNA 5DM7R 4IUVA 3OSSC 1UGQB 4RKUE 2XK0A 1NE8A 4L5GA 4C92G 1NPRA 1GXIE 4C92B 2EQMA 3G4SA 4FT4A 4IUQA 4BY6C 2LX9A 4PJOF 2RK1A 2DXUA 2X4YA 3EFSA 4OB3B 3GIBA 1M8VA 1UEBA 4PJOG 2WACA 1Q86U 4HCBA 5HK3A 2HBPA 4PJOB 1Q81U 1WJRA 1BIBA 1M1KU 4BDZA 3PMIA 5LJ3j 1NJIU 3M56A 4PL6A 3OYAA 2LNVA 4BE2A 3GNFB 4NL3A 3X20B 4DQ2A 2A3LA 1QVGA 4J7FA 2OTLA 4O5VA 4X9DA 3MEWA 4YTLA 3JSCA 3NFCA 3SD4A 5CR2A 4KUIA 5GAMh 3CC7A 3E19A 4A4GA 2LT1A 4J6XA 4OMFB 3OYMA 1VQ9A 3VUZA 3J80E 4EMHA 1FXXA 5GMKh 4KULA 3DLMA 4OF1A 4E7HA 3JB9J 3I55A 4C5GA 2DXTA 2ZPGB 4KBMB 2E1HA 3S3NA 3MP6A 2VXFA 3A8OB 4OB1B 3T9NA 3V8KA 5GAN4 2L89A 3HFOA 1G5VA 4N4HA 4LDVA 3CD6T 2VV5A 5A0LA 3OBWA 2DZCA 3FIFA 3CCSA 2R5MA 3QPHA 4N0AC 2D9TA 2RI5A 3QG1A 5GANd 3DB3A 3M59A 3A8LB 1KC8U 2Y4YA 5GMKi 4TVRA 5L8RE 2QEXA 2JUFA 3CC2A 1B34A 4C8QA 1G3WA 3DKMA 1Y7XA 3KBGA 3L42A 3RERA 2RHZA 3GF5A 5GAN5 3TEEA 3OMGA 1Q82U 1K8AU 1N8RC 3MEVA 4IUUA 4QVCA 3CMEA 4M78G 2CZ1B 1PSEA 1MHNA 3G71A 4M78B 3S3OA 4N4GA 3WVEB 2LCCA 5CVIA 4XU2A 2DTHA 1VQ8T 3RUXA 2L3RA 3OYNA 1VQOT 2LTOA 3S6WA 3WVDB 2RJDA 2V8JA 3DLLA 2G3RA 1Q7YC 1QVGS 2ZGWA 3DB4A 4GY5A 4NL2A 1YJNA 2VGNA 1XQHA 1S72A 3RKYA 2DIQA 2QA4A 1Y96B 1YIJT 1I8FA 4J5YA 3JCMf 4PNOA 2Y90A 3CCEA 2YLBA 4FM4B 4A54A 2LQ8A 3BFMA 4M78C 5FLXE 2KK4A 1HK9A 1X75C 3LLRA 2F5KA 3G4ST 2X4WA 3JAME 2E64A 2RB6A 2E10A 2RH2A 3RKWA 5GMKm 2DTOA 1NZ9A 3FJPA 3RKXA 1K9MU 4M7AE 1X01A 2RI2A 1EIFA 2BUDA 1M1GA 2RJFA 3JCMX 4IURA 3JB9F 4M75D 2EAYA 3QUIA 1TH7A 4OVAA 1VQ5A 2WSEE 4M7DF 4EMKA 1KQ1A 2K5LA 3FLGA 4J6YA 4XTZA 5D6XA 5CKEA 2JTMA 5GAN7 3GP8A 1KG1A 3OBYA 4C0DC 4M7DG 4C8QC 4IKFA 3CCQA 3CCUA 4M7DB 3CC7T 1VQ6T 4QVDA 3LWIA 4IUPA 3UT1A 4M7AF 3JB9H 5LJ3d 2KY9A 2R57A 1YITA 4M7AG 3V7CA 2JZ2A 4FL6A 1WPYA 4M7AB 4V2SA 4JDSA 4QQDA 2KQWA 3M9QA 3HKSA 2PVGB 2BKDN 2BIVA 4A4FA 3HFNA 2EJGA 5LJ5g 2RO0A 1UB4A 2KVQG 1QVPA 2KDSA 4FIBA 4XK8E 1VQ7A 3CXCA 1M5Q1 2EWNA 4QQ6A 5A2QE 2MAMA 1XNIA 2DXCA 4M77A 1OI1A 1YHQT 2O4XB 1YI2T 1FWZA 3QO3A 2EQKA 3ER0A 4BY6B 3LX7A 4HT9A 2LCLA 2D0QB 1V29B 1UGRB 3H8ZA 3M57A 2B8AA 2CZ0B 2M0OA 3OYEA 4EPCA 5C6SA 3LW5E 3HP9A 4JS5A 4D6WA 1VQKA 3C95A 4XU0A 1KQSA 1KD1U 3INZA 3PIPA 1ZBXA 3C94A 4A53A 3QBYA 2D6FA 3JCMQ 4OGCA 4EMKC 5GANf 1Q86C 4JRQA 1I81A 3PNWC 4ELZC 3OYDA 4O6JA 1Q81C 1M1KC 5GMKl 1N6AA 2GF7A 3CBMA 1R8OB 2QA4T 2RD1A 1NJIC 2E70A 2PQWA 2LC4A 1G3SA 5HK0A 3JB9D 2E41A 1OZ2A 5GAMf 2K5FA 2QXFA 4PLIA 1QVFA 1U1TA 1JB0E 1FX7A 2OTJA 4X9CA 5A0GA 4JS4A 3L1AA 2RJEA 3V7RA 4E47A 3MCAB 4QVZA 5LJ5e 5LJ5h 2L5QA 3M5AA 3SDZA 3CMAA 3LGFA 3CXCS 4E7JA 4LD9K 2E5QA 4HKEA 3MP1A 2VYTA 3CCRA 2ZPEB 4A4EA 3L2RA 4M75A 4JJNK 4C0ZA 3SB2A 2QQRA 3V8LA 3P8BB 3I56A 3VJPA 3FB9A 1WNLA 4XU1A 3VYGA 4BACA 4M78E 1H3ZA 2XDDA 3OS1A 1LJOA 5GAOn 2DD4A 4E7KA 3CCUT 3OYJA 1VUBA 3CBPA 1KC8C 1W4SA 1HXDA 2R5AA 1VQ4T 2M1HA 3QKJA 3CEYA 2IVWA 1BI3A 3HHTB 1NPPA 3SWNA 5KH6A 3QDRB 3LWHA 2RA2A 4M77D 1KQSS 1O9SA 1M90U 1VQLA 3OQ5A 1Q82C 3OS5A 1K8AC 2DEQA 4A4HA 4RG8A 1UGPB 3FEOA 1VQ7T 3A5ZB 1ZQ1A 4M78F 5GAMd 3PMTA 2EJ9A 2XI9A 3M53A 4FU6A 4FSXA 4C0FA 3HSBA 4JLGA 2L8DA 4L59A 3V7SA 2LQKA 3H6ZA 4OGEA 5FU7C 3RMSA 4ZTFA 4C92D 3E1SA 4A4KA 3HL8A 2VC8A 2DVEA 1KQ2A 1QVFS 3JCMg 3QJ6A 4J7IA 1N27A 2XICA 4LDUA 3M54A 5LJ3f 1KHIA 4HCCA 2RHUA 3VKIA 1M1FA 2RHYA 4KUDK 3HPWA 5IN1A 3OYFA 4PJOD 1Y07A 2V8IA 4OP0A 3P8HA 1MGQA 1VQKT 1JJ2A 1WJSA 4LDWA 4M7DE 3CCVA 2DXBA 2XU8A 3OSVA 4NOYA 4Y28E 3BW1A 4M75C 3CPFA 3CCJA 4C8QG 3OY9A 4C0DB 1B34B 2XDPA 3QYHB 4C8QB 1N9SA 3GPLA 3HRUA 1VQPA 3CCMA 3JRZA 2QQSA 2M16A 4BE1A 1VQNA 4J6WA 1IREB 4ZN1A 4Z02A 3L2WA 2HQXA 5CKDA 2LDMA 1H641 1VQMA 2DK3A 4UC4A 1BI2A 3VV0A 1BI0A 2EJFA 3L2VA 2LT4A 3SWNC 5FROA 4ZGJB 3X24B 3LH0A 1JRIA 2OTJT 3MO8A 2JTFA 3A8MB 2XG8D 2O01E 5I2MA 3OYBA 3META 2OTLT 1D3BA 3CMAT 2CKKA 1SSFA 1VIEA 5LJ5j 2R58A 1YCYA 2KAFA 3OMCA 2DJZA 2LRQA 2P4TA 3E9FA 5DLQE 4F7UA 3CPWA 4LD6A 1VQ9T 5DLOA 4R55A 4XU3A 2PVDB 1K73U 3JCMe 2ZZDA 2XD0A 2V8KA 2MF2A 4XTVA 2YHTA 4XTUA 3LYIA 4BI8B 3I55T 3S3MA 2DKGA 1YJ9A 4MZTA 4RG2A 4C5EA 3M4YA 3O8VA 2JNGA 4M78D 1OZ3A 2VUBA 4KT0E 4E7LA 3CCST 1G3TA 5GAN8 1JJ2S 2C06A 3PFSA 3AHUA 4X34A 5KCOA 4DA4A 2E6NA 4JUVA 3FDRA 3G7ZA 5CQXA 2OAUA 3A8HB 2K4YA 4EMKB 2QEXT 2YRVA 1YBYA 3OA6A 1O75A 1YJWA 2X4XA 5IT9E 5GANg 1KD1C 1ZHIA 3CMET 2CS7A 2QQ9A 3X26B 2GFAA 3G71T 4C92A 3SFMA 3F70A 4BUGA 2DAQA 3OS0A 3CBOA 3MEAA 2RI3A 5GAMg 3FC3A 5D6YA 3OYCA 4P5NA 4MDWA 2DTIA 1WQWA 5EG2A 2QDYB 2ZCFB 1W2BA 1YJNT 2GQVA 2MMPA 1S72T 3C12A 3OW2A 4PJOA 4M77G 2QQBA 4GLKA 2K57A 3CCET 2PUKB 3CPWS 1VQ8A 2GCXA 3NTIA 3CCJT 1AHJB 4BB7A 3X28B 1M4ZA 4M7DD 1VQPT 5J26A 5IAYA 3KUFA 4NS5A 4Y91A 4MDXA 2K3XA 2CZ7B 2HD0A 2K3YA 3M4GA 1YIJA 3URGA 1PSFA 3ZFJA 5CCAA 4ATOA 3A8GB 2VXEA 2CYZB 5FRMA 4OB2B 1VQMT 1QP3A 4B9WA 5A0DA 3JCMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSB A;  4M7A D;  3JCM d;  1X01 A;  3L2Z A;  3PGG A;  3V7S A;  4C92 E;  4M77 C;  4RCC A;  3VU3 C;  4C92 D;  3RKX A;  3JCM X;  4M75 E;  2VC8 A;  3V8J A;  2DVE A;  2QTX A;  4M75 D;  3JCM g;  2EAY A;  3QUI A;  3JCM J;  4M77 F;  1TH7 A;  1KQ2 A;  5GAO l;  5LJ3 f;  4EMK A;  4M7D F;  1KQ1 A;  4XTZ A;  4J6Y A;  3JCM V;  5GAN e;  5GAN h;  5GAN 7;  1N9R A;  2JN0 A;  4M77 B;  5LJ5 f;  2FYK A;  4C8Q C;  4M7D G;  1LNX A;  4PJO E;  3BDU A;  1I5L A;  4M7D B;  4M7A C;  4PJO D;  2CGH A;  4OP0 A;  1MGQ A;  4QVD A;  4HT8 A;  4M7D E;  4N0A A;  4NOY A;  4C92 C;  4M7A F;  3BW1 A;  3RES A;  5LJ3 d;  5GAM e;  4M75 C;  3JCM b;  3JB9 H;  4C8Q G;  4XQ3 A;  1BIA A;  2DZ9 A;  4C92 F;  1B34 B;  2FB7 A;  3V7C A;  4C8Q B;  1N9S A;  3BY7 A;  5LJ5 d;  4M7A G;  1WPY A;  4M75 F;  4M7A B;  4V2S A;  4JRI A;  4M78 A;  5LJ3 g;  4C92 G;  4C8Q E;  4HA8 A;  5GMK e;  4J6W A;  3HFN A;  2EJG A;  4M75 G;  4C92 B;  4PJO C;  5LJ5 g;  3EFR A;  1WQ7 A;  4M75 B;  4RCB A;  1H64 1;  1M5Q 1;  2EWN A;  2EJF A;  4PJO F;  2DXU A;  3EFS A;  4JLI A;  5GMK j;  3JCM P;  3SWN C;  4M77 A;  3GIB A;  1M8V A;  2YLC A;  4C8Q D;  4PJO G;  1JRI A;  4EMG A;  5GAN 3;  1Y96 A;  4PJO B;  3QO3 A;  4HT9 A;  1BIB A;  2I2L A;  5LJ3 j;  1D3B A;  4NL3 A;  3SWN B;  4DQ2 A;  5GAO p;  4XTX A;  4C8Q F;  5LJ5 j;  1YCY A;  1U1S A;  2DJZ A;  4WF2 A;  4X9D A;  4F7U A;  3AHU A;  3QSU A;  5GAN 2;  5GAM h;  4MMK A;  3JCM W;  4XU3 A;  4XU0 A;  3JCM e;  5GAO m;  1LOJ A;  4J6X A;  3INZ A;  4XTV A;  2YHT A;  4XTU A;  4A53 A;  2DKG A;  4EMH A;  5GMK h;  5I21 A;  3JCM Q;  4EMK C;  5GAN f;  4M78 D;  3JB9 J;  1I81 A;  2DXT A;  2E1H A;  2VXF A;  5GMK l;  5GAN 4;  3V8K A;  5GAN 8;  3HFO A;  2RD1 A;  4M7A E;  1I4K 1;  2DZC A;  3FIF A;  5GAO r;  3JB9 D;  4M7D A;  4JUV A;  2E41 A;  4N0A C;  5GAM f;  4EMK B;  4JRK A;  5CAI A;  5GAN d;  3RIR A;  1U1T A;  5LJ3 e;  5GMK i;  5LJ3 h;  3QHS A;  4X9C A;  3L1A A;  3V7R A;  1B34 A;  5GAN g;  4C8Q A;  3JB9 I;  5LJ5 e;  4MML A;  4XTY A;  5LJ5 h;  4M7A A;  3RER A;  5GAN 5;  2HNI A;  4C92 A;  4F7U E;  4QVC A;  5GAN 6;  4M75 A;  4M78 G;  3JCM h;  3SB2 A;  3V8L A;  4M78 B;  5GAM g;  5DY9 A;  4XU2 A;  3FB9 A;  1WNL A;  4XU1 A;  2DTI A;  4M78 E;  1WQW A;  2DTH A;  3JB9 G;  1LJO A;  5GAO n;  3RUX A;  5GAO q;  4PJO A;  5GAN j;  2E65 A;  4M77 G;  1HXD A;  2ZGW A;  2K57 A;  4NL2 A;  3RKY A;  3SWN A;  1Y96 B;  4M77 E;  1I8F A;  2RA2 A;  4J5Y A;  4M77 D;  4M7D C;  3JB9 F;  3JCM f;  4PNO A;  2Y90 A;  4F7U F;  4M7D D;  2YLB A;  5GAM j;  1D3B B;  4A54 A;  2DEQ A;  4Y91 A;  3BFM A;  3M4G A;  4M78 C;  4F7U G;  1HK9 A;  2VXE A;  4XTW A;  4F7U B;  2E64 A;  2RB6 A;  2E10 A;  2RM4 A;  4M78 F;  3RKW A;  5GMK m;  2DTO A;  2EJ9 A;  5GAM d;  3JCM c;  3FJP A;  1JBM A; 
#chains in the Genus database with same CATH topology
 2YT6 A;  5CQY A;  4M77 C;  3VU3 C;  1VQ5 T;  4RTZ A;  5J3B A;  2DFU A;  2XMF A;  2EW3 A;  2QQA A;  2ZPF B;  3JCM V;  5GAN e;  1YI2 Q;  2YUO A;  4CRI A;  4J9D A;  1UEC A;  1M9S A;  3CCV Q;  3A1P A;  1XTD A;  3RMQ A;  4HT8 A;  1YIT T;  2EKO A;  4C92 C;  2ZPI B;  3JCM b;  2DO3 A;  3G6E A;  2K2V A;  3BY7 A;  5LJ3 g;  2EGA A;  1PRM C;  2MI6 A;  4DOV A;  3VYH B;  1UGV A;  2DL4 A;  3E9G A;  1W6X A;  1M30 A;  2E6Z A;  2ZPH B;  5GAN 3;  3HRS A;  1HSQ A;  4D8D A;  3PTA A;  4MZP A;  1IGQ A;  3WXM B;  1M2V A;  3SHW A;  2JOY A;  3CC2 A;  3D7S B;  3QSU A;  3CCM A;  3P8D A;  2RHI A;  1XOV A;  5CK9 A;  1YWO A;  3MEU A;  4PLL A;  1LOJ A;  2PTK A;  4N4I A;  1Y57 A;  5I21 A;  1T3S A;  2CUD A;  2K9G A;  1TUD A;  1Z9Q A;  5D6W A;  1UGS B;  2MCN A;  4M7D A;  3CD6 Q;  2OX7 A;  2FHD A;  1G3Y A;  5CAI A;  2HZY A;  4LDX A;  1RI0 A;  2PU9 B;  3HRT A;  3NTK A;  4OML A;  1GCQ C;  3CCR T;  1QKW A;  4M7A A;  1K4U S;  1A0N B;  1OX9 A;  2EYW A;  4J83 A;  5M9O A;  3CC4 T;  1WA7 A;  4JPB W;  5GAO q;  5GAN j;  5HY6 A;  3H0F A;  2K5I A;  5LL6 S;  2EPD A;  2LVM A;  3QJY A;  3OYL A;  1NYF A;  1B7T A;  2C0O A;  1NLP C;  1KIK A;  4XTW A;  3G4S Q;  2GNC A;  2AZV A;  3KXT A;  1DJ7 B;  1R77 A;  4OB0 B;  3ZBD A;  3UA7 A;  5FU6 C;  1QW1 A;  3QZ9 B;  1OPK A;  4WTO B;  2RHX A;  4PKC C;  2P0Q A;  2D8J A;  4R56 A;  4QW2 A;  3VS6 A;  1BKB A;  5FRN A;  1H3H A;  3UPU A;  3H0H A;  4II1 A;  3FRN A;  4PK4 A;  3OSS C;  2XK0 A;  1NE8 A;  1NPR A;  3THK A;  2A0F B;  4BY6 C;  4AG1 C;  2X4Y A;  4OB3 B;  2DL5 A;  3EFS A;  5IHN A;  4PJO G;  5HK3 A;  2GTO A;  4KGX B;  1Q81 U;  2K3B A;  4PJO B;  1WJR A;  1BIB A;  1M1K U;  3NPF A;  2YRC A;  3OYA A;  3GNF B;  1WZO A;  2YWW A;  4J7F A;  2OTL A;  3SD4 A;  4X9D A;  3MEW A;  3JSC A;  5CR2 A;  4KUI A;  5GAM h;  4OMF B;  2DBK A;  3OYM A;  1E6H A;  1VQ9 A;  3J80 E;  1FXX A;  4KUL A;  2JM8 A;  2DXT A;  2CP6 A;  3MP6 A;  2E5K A;  5GAN 4;  1G2B A;  2L89 A;  4LDV A;  3PVL A;  3NGP A;  3M59 A;  8ATC B;  1KC8 U;  2HL3 A;  2JUF A;  3RER A;  2RHZ A;  4LN2 A;  4IUU A;  3CME A;  2CZ1 B;  1Q82 R;  4XU2 A;  1G8X A;  1GRI A;  3RUX A;  3OYN A;  1VQO T;  2LTO A;  3WVD B;  2RJD A;  2ZGW A;  1XQH A;  1NLO C;  3RKY A;  1YIJ T;  4DBQ A;  3BFM A;  2EYX A;  3EHQ A;  2X4W A;  2E64 A;  3RKW A;  2DTO A;  3RKX A;  4M7A E;  1K9M U;  1SPK A;  1X01 A;  1EIF A;  3JCM X;  2L3S A;  4M75 D;  3QUI A;  4M7D F;  4XTZ A;  3FLG A;  5CKE A;  1JQQ A;  4IKF A;  1RAC B;  1UHF A;  3CC7 T;  1VQ6 T;  4IUP A;  4M7A F;  5LJ3 d;  2KY9 A;  4OMM A;  3V7C A;  1ZUY A;  3EGD A;  4V2S A;  2B86 A;  4JDS A;  1AWO A;  4WCI A;  2HKN A;  2BIV A;  3EGU A;  1X27 A;  4XK8 E;  4FIB A;  2EWN A;  4QQ6 A;  2LMJ A;  4AFQ C;  1OI1 A;  3EG9 B;  1YCS B;  1D1C A;  5KYW A;  3QO3 A;  2EQK A;  3LX7 A;  2DRM A;  4OMN A;  4RTW A;  3CMA Q;  2B8A A;  2CZ0 B;  4LNP A;  1QWF A;  1QWE A;  1VQK A;  1JO8 A;  1VQ9 Q;  1B07 A;  3PIP A;  3H41 A;  3QBY A;  3JCM Q;  1ZBJ A;  4OGC A;  4EMK C;  2LJ3 A;  4JRQ A;  4O6J A;  4AG2 C;  1NEB A;  2QA4 T;  1W2B P;  2RD1 A;  4PJM A;  2E70 A;  1G3S A;  2DIL A;  2LQW A;  4PLI A;  1QVF A;  3VS3 A;  2EGE A;  4FYW B;  2J05 A;  4E47 A;  5LJ5 e;  4CC2 A;  3LGF A;  3CME Q;  2E5Q A;  3MP1 A;  2ABL A;  4A4E A;  2KXC A;  3SB2 A;  1M3B A;  4BAC A;  3VYG A;  4M78 E;  3O5Z A;  1V76 A;  5GAO n;  2RQT A;  3CCU T;  1JXM A;  1HXD A;  2M1H A;  3QKJ A;  1EX4 A;  5KH6 A;  3M0T A;  4M77 D;  1VQL A;  1Q82 C;  4OMP A;  2DEQ A;  1QVG P;  4RG8 A;  1UGP B;  2CSQ A;  1M90 R;  2QG9 B;  4M78 F;  4HXJ A;  1M3C A;  3M0S A;  4FU6 A;  1VQM Q;  3HSB A;  3RMS A;  4C92 D;  1ZSZ B;  1PC0 A;  3HL8 A;  1QVF S;  3JCM g;  4J7I A;  1N27 A;  2XIC A;  5LJ3 f;  2AIR B;  3HPW A;  2KEA A;  1MGQ A;  1WJS A;  2XU8 A;  3RBB B;  2AK5 A;  1K0X A;  4C8Q G;  1VA7 A;  4C0D B;  1B34 B;  1M2V B;  2XDP A;  3EH1 A;  4C8Q B;  3HRU A;  3JRZ A;  1VQN A;  2EQI A;  1IRE B;  1NBE B;  4Z02 A;  2M51 A;  2HQX A;  2LDM A;  1ZLM A;  1BI0 A;  2ZAE A;  2O9S A;  2LT4 A;  1GBR A;  3SWN C;  4ZGJ B;  3X24 B;  2HCK A;  2OTJ T;  2JTF A;  3A8M B;  1YJW Q;  3OYB A;  1KK7 A;  2ECZ A;  4FW1 A;  5LJ5 j;  2R58 A;  5KYN A;  3OMC A;  1U5S A;  5HCK A;  4R55 A;  3TQ7 P;  4XTV A;  3I55 T;  3S3M A;  4BI8 B;  2YUP A;  1K73 R;  3O8V A;  2JNG A;  4M78 D;  1I5O B;  2KXD A;  1G3T A;  2CRE A;  3PFS A;  4PFO A;  3FDR A;  4DEY A;  2D0N A;  2YRV A;  1H92 A;  1YIJ Q;  1YBY A;  5IT9 E;  5GAN g;  1ZHI A;  4AMC A;  2DL8 A;  3CBO A;  1WI7 A;  5AT1 B;  1IRX A;  2QDY B;  1YJN T;  1S1N A;  1Z9Z A;  2MMP A;  5FWB A;  3OW2 A;  1S72 T;  4PJO A;  4M77 G;  3CCJ T;  1VQL Q;  1VQ6 Q;  1M4Z A;  4HVV A;  3I5R A;  1PSF A;  3A8G B;  2CYZ B;  5FRM A;  1OU9 A;  1WYX A;  1WHL A;  3JCM c;  1RLQ C;  1WGS A;  4FW2 A;  3CCL A;  3PIO A;  5CKF A;  3TSW A;  5IHK A;  1MMG A;  2ATC B;  2MWP A;  1RAA B;  5KE3 A;  3CCQ T;  4VUB A;  2ENM A;  1M90 C;  2FEI A;  5FU7 B;  4K11 A;  1LNX A;  1X43 A;  5GAM e;  1YJ9 T;  2CP3 A;  3GNG A;  2ROL A;  1ZUK A;  2QI2 A;  2J06 A;  4CI0 C;  3OW2 S;  2A7Y A;  4BDY A;  3EFR A;  4RCB A;  1WXB A;  2DNU A;  2XKO C;  7AT1 B;  5FWC A;  5I2S A;  4EMG A;  3UWN A;  1N5Z A;  1WX6 A;  1YHQ A;  1YI2 A;  1NEG A;  3OYY A;  4E7I A;  1U8R A;  4J8O A;  2RQW A;  2AHJ B;  3MP8 A;  4C5H A;  3OYH A;  4DBH A;  2KMT A;  2P0P A;  2RMO A;  1VYV A;  4FCY A;  1UUE A;  3J7A F;  1QQJ A;  2PUO B;  4X1V A;  1GL5 A;  1IHW A;  1RAE B;  1N8R U;  4FT2 A;  2JTE A;  2EQJ A;  4ME7 A;  2DIG A;  2NUP A;  3RIR A;  2X51 A;  5LJ3 h;  3QHS A;  1K73 C;  4ZGE B;  3OYG A;  2FVU A;  2X35 A;  3NHN A;  4XTY A;  1RLP C;  2QDL A;  4F16 A;  2HNI A;  2IG0 A;  1MNE A;  3GOX A;  4XAX B;  2E4H A;  2DLP A;  1I0C A;  2DEU A;  1SEM A;  3EG9 A;  3M0P A;  2KRO A;  2E65 A;  2JVV A;  3RDV A;  2HAX A;  3G6E T;  5FU6 B;  3CD6 A;  4E6R A;  2FZG B;  4JRP A;  5GAM j;  3UDC A;  4F7U G;  2L0A A;  3R6O A;  4F7U B;  2H8H A;  2EYY A;  2D8H A;  1JBM A;  3JCM d;  3OYK A;  4RMO A;  5AYF A;  4M7D C;  4BI4 A;  2EKH A;  3M55 A;  1UJ0 A;  3CC2 T;  4PJO E;  3CCM T;  1I5L A;  4M7A C;  2CGH A;  2IPO B;  1X6O A;  4N0A A;  3OYI A;  3J81 E;  3RES A;  4ZNX A;  3VUB A;  4XQ3 A;  1RL2 A;  1C6V X;  5DM7 R;  2P4R A;  1UGQ B;  4CC7 A;  4L5G A;  2A08 A;  1U06 A;  2EQM A;  1WHH A;  3G4S A;  4FT4 A;  2LX9 A;  4PJO F;  3MJX A;  3GIB A;  1UEB A;  2YUN A;  4HCB A;  1LPL A;  1YHQ Q;  2BE9 B;  2HBP A;  1MND A;  1SG5 A;  2F1L A;  1NJI U;  3M56 A;  4PL6 A;  4NL3 A;  1Q81 R;  4JZ3 A;  1M1K R;  3NFC A;  4OMO A;  2ROT A;  1ZSZ A;  1X2K A;  1I1J A;  3DLM A;  1BB9 A;  4OF1 A;  3JB9 J;  1T0H A;  3EFO A;  2E1H A;  2OJ2 A;  1YJN Q;  2VXF A;  1CKB A;  3A8O B;  3V8K A;  3HFO A;  4AFS C;  1S72 Q;  2VV5 A;  3OBW A;  2CP7 A;  1WHJ A;  2RI5 A;  5GAN d;  1RAH B;  3DB3 A;  3A8L B;  4J9G A;  1M3A A;  2QEX A;  1B34 A;  4C8Q A;  3L42 A;  1KC8 R;  5GAN 5;  1K8A U;  4QVC A;  2KRM A;  1PSE A;  1MHN A;  3WVE B;  2CSI A;  1VQ8 T;  2V8J A;  2G3R A;  2JM9 A;  4QT7 A;  2VGN A;  1WFW A;  1Y96 B;  2FZK B;  3JCM f;  4PNO A;  2Y90 A;  4ORZ A;  2YLB A;  4A54 A;  1JJ2 P;  4M78 C;  5FLX E;  2KK4 A;  2F5K A;  4RTT A;  3JAM E;  2RH2 A;  2E10 A;  2W0Z A;  1VQ7 Q;  1NYG A;  2RI2 A;  1BCM A;  1M1G A;  2RJF A;  4ANJ A;  3JB9 F;  1TH7 A;  4RTU A;  1VQ5 A;  5KYU B;  5GAN 7;  3GP8 A;  1KG1 A;  1PNJ A;  3UT1 A;  3G1J A;  3JB9 H;  3CPW P;  2HQH A;  1YIT A;  3PVQ A;  4QQD A;  2KQW A;  3M9Q A;  2BKD N;  4JJB A;  3HFN A;  2EBP A;  5LJ5 g;  2RO0 A;  1UB4 A;  2KVQ G;  2KDS A;  5IXB A;  1M5Q 1;  5EC7 A;  2MAM A;  2VKN A;  3EGX B;  4JJD A;  4M77 A;  2O4X B;  4HT9 A;  2DRK A;  2KYB A;  3M57 A;  1TTH B;  2DL3 A;  5C6S A;  3HP9 A;  3C95 A;  4XU0 A;  1KD1 U;  4A53 A;  5GAN f;  3TVT A;  3EG3 A;  3OYD A;  5I22 A;  1Q81 C;  3VRZ A;  1M1K C;  5GMK l;  2GF7 A;  1R8O B;  2A28 A;  2PQW A;  3JB9 D;  5HK0 A;  2K5F A;  2LX7 A;  2VB6 A;  2QEX Q;  1U1T A;  1K76 A;  4JS4 A;  3L1A A;  2HSE B;  4QVZ A;  2FPD A;  3CMA A;  2J6K A;  1PKT A;  3TSZ A;  3CCR A;  3L2R A;  1U3O A;  4C0Z A;  2RQR A;  3P8B B;  3FB9 A;  4XU1 A;  1H3Z A;  2RN8 A;  5FW9 A;  1QCF A;  3OYJ A;  1KC8 C;  2K2M A;  2K79 A;  1VQ4 T;  4IIM A;  2IVW A;  1IHV A;  3HHT B;  4HCC A;  3LWH A;  2RA2 A;  4RUG A;  1O9S A;  1YP5 A;  3OS5 A;  1VQP Q;  5A0D A;  2QAS A;  1D0X A;  2EJ9 A;  4C0F A;  2L8D A;  4A4K A;  1VQ5 Q;  2DVE A;  1KQ2 A;  2CDT A;  3M54 A;  2F2X A;  2RHU A;  2YDL A;  5KYX B;  1RUW A;  4KUD K;  2E3H A;  1UHC A;  1Y07 A;  3P8H A;  1VQK T;  1K0S A;  3M0U A;  2FZC B;  4M7D E;  4NOY A;  3MKD A;  2H3E B;  1YIT Q;  3CPF A;  2FPE A;  1PWT A;  3QYH B;  2QQS A;  4BE1 A;  1D0Z A;  4J6W A;  4FYX B;  2ED0 A;  2L3Q A;  1XJW B;  1D0Y A;  1NM7 A;  5CKD A;  1VQM A;  1HYO A;  2KGT A;  3VV0 A;  3L2V A;  5FRO A;  3LH0 A;  1JRI A;  1QLY A;  1QCO A;  1D1A A;  2K6D A;  2BTT A;  1T0J A;  2O01 E;  5I2M A;  2O2O A;  2A37 A;  2HSP A;  2DL7 A;  1YCY A;  2KAF A;  2NUP B;  2DJZ A;  4F7U A;  5DLQ E;  3R6N A;  1OPL A;  2PVD B;  2ZZD A;  2PNI A;  4XTU A;  1NG2 A;  2DKG A;  4C5E A;  3M4Y A;  2EYZ A;  4E7L A;  1K1Z A;  1VOM A;  2RNA A;  2X3W D;  3CCS T;  1VQ8 Q;  1OEB A;  1IB8 A;  2X9H A;  4JUV A;  2VVK A;  3A8H B;  2K4Y A;  4R0K A;  3OA6 A;  1YJW A;  2X4X A;  3AT1 B;  1EFN A;  4GBQ A;  2VWF A;  3CCR Q;  2KRN A;  2DER A;  3X26 B;  3G71 T;  1C1A A;  5KYY B;  3SFM A;  4BUG A;  5GAM g;  4KGZ B;  1B3Q A;  3CC4 Q;  4P5N A;  2DTI A;  1WQW A;  2ZCF B;  1W2B A;  2JT4 A;  2GQV A;  4OMQ A;  2DYI A;  1GFD A;  4GLK A;  3CCE T;  2FRY A;  3NTI A;  4BB7 A;  1MMN A;  1X69 A;  4J9F A;  4CC4 B;  4M7D D;  4DBF A;  3KUF A;  1YFN A;  2CZ7 B;  1YIJ A;  1VQN T;  3URG A;  2VAS A;  4OB2 B;  4HVU A;  1QP3 A;  2EVR A;  4M7A D;  4ZGD B;  3PGG A;  1OX8 A;  1SSH A;  2QTX A;  3L2Q A;  1AD5 A;  4Z89 A;  2HKQ B;  5GAN h;  1N9R A;  2F5T X;  2KT8 A;  2KI7 A;  2DD5 A;  3BDU A;  4KH0 B;  4ZN3 A;  1JXO A;  1VQ6 A;  2FB7 A;  2DM1 A;  5LJ5 d;  1W2B S;  2FL7 A;  2XID A;  3EAE A;  4LE9 A;  4M75 G;  4PJO C;  1OV3 A;  4M75 B;  2QK0 A;  1WHM A;  4JLI A;  3VS5 A;  5CO7 A;  2F2W A;  3GLX A;  1BBZ A;  3EFO B;  3QYG B;  1TU0 B;  1Y96 A;  2PZ1 A;  1TG0 A;  2CT3 A;  4A63 B;  3Q1J A;  1ACM B;  5GAO p;  3TRE A;  2LP5 A;  1VIF A;  3QXE B;  2MWO A;  3JCM W;  1QP2 A;  2FG0 A;  3ASK A;  5IHI A;  2HDA A;  2ZPB B;  2LJ0 A;  4L6V 5;  1LCK A;  2NYS A;  1SF9 A;  2RJC A;  3A98 A;  1PKS A;  2H3J A;  5KYU A;  2HEQ A;  4DEX A;  4EDU A;  1N8R R;  3BDL A;  1LVK A;  4IIO A;  4JRK A;  3OB9 A;  3TU4 K;  1WHG A;  4LUE A;  2V26 A;  3X25 B;  1Q7Y U;  1FMV A;  2HL5 C;  4MML A;  1KHC A;  3CCL T;  2DE0 X;  2HQE A;  2SRC A;  1WHK A;  2DX1 A;  3I56 T;  4F7U E;  5GAN 6;  1HJD A;  3EGX A;  2KE9 A;  2FPF A;  2O4X A;  3N5B B;  1VYT A;  1VQO Q;  4BE0 A;  2X4J A;  2E12 A;  4MZM A;  5CKH A;  1WXU A;  1WJQ A;  4F7U F;  1D3B B;  4IUT A;  2GFU A;  2J6O A;  4ESR A;  2GGR A;  2RM4 A;  3MHX A;  4PJL A;  2CZ6 B;  1TUG B;  1M2O A;  1RAF B;  4DOW A;  2VGM A;  4ELY C;  2FO0 A;  3CXC P;  5C0M A;  5GAO l;  2JW4 A;  3C4S A;  1J3T A;  2WSF E;  2JN0 A;  4M77 B;  5LJ5 f;  3CCV T;  2D1X A;  1RAI B;  2SEM A;  1QCN A;  2MPX C;  3CC7 Q;  2E3I A;  1BI1 A;  1OUL A;  4RKU E;  1KQS P;  4C92 G;  1SHG A;  4M4Z A;  4C92 B;  2K7A A;  3I35 A;  3MPU B;  2DXU A;  3PE0 A;  1Q86 U;  2WAC A;  3VS7 A;  2LNV A;  2C0T A;  1UG1 A;  4O5V A;  1NJI R;  3E19 A;  1UTI A;  4A4G A;  4J6X A;  1PD0 A;  2JXB A;  4EMH A;  5GMK h;  3I55 A;  3VS0 A;  4KBM B;  5KYX A;  3S3N A;  4OB1 B;  3T9N A;  1FMW A;  4B6M A;  4N4H A;  2QA4 Q;  3CD6 T;  2R5M A;  3QPH A;  4N0A C;  1ZUU A;  3QG1 A;  1IGU A;  2X3X D;  2Y4Y A;  3LH5 A;  5GMK i;  4TVR A;  1G3W A;  1V1C A;  1Y7X A;  3KBG A;  3GF5 A;  3TEE A;  3OMG A;  1N8R C;  3MEV A;  1AWW A;  4M78 G;  4M78 B;  4Z8A A;  5CVI A;  1K8A R;  2DTH A;  2L3R A;  2OI3 A;  3JV3 A;  3DLL A;  3CCU Q;  3KFV A;  1YJN A;  1S72 A;  1I8F A;  4J5Y A;  2JS2 A;  3E2U A;  4FM4 B;  1R0C B;  1ZSZ C;  3G4S T;  2KRS A;  2RB6 A;  5GMK m;  4FYY B;  3H0I A;  1NZ9 A;  3FJP A;  2BUD A;  4IUR A;  2I0N A;  2EAY A;  4OVA A;  1E6G A;  1KQ1 A;  4J6Y A;  4JZ4 A;  2JTM A;  3OBY A;  4C0D C;  4C8Q C;  3CCQ A;  5ECA A;  2QYZ A;  5KYY A;  5GJV B;  1WPY A;  2EGC A;  3IQL A;  2DJQ A;  3HKS A;  2KT1 A;  4A4F A;  2QAZ A;  1VQ7 A;  3M0R A;  1XNI A;  2CP5 A;  3QWX X;  2KR3 A;  1OOT A;  1FWZ A;  4E2F B;  2OTJ Q;  4BY6 B;  2LCL A;  1BK2 A;  2D0Q B;  3H8Z A;  3VRY A;  5L23 A;  3OYE A;  4J9B A;  4EPC A;  2DA9 A;  4D6W A;  3VS4 A;  3INZ A;  3U23 A;  3C94 A;  2GTJ A;  3I55 Q;  3CQT A;  3NMZ C;  4ELZ C;  1KD1 R;  1FYN A;  1N6A A;  2L2P A;  1NJI C;  1ZX6 A;  2E41 A;  1OZ2 A;  5GAM f;  1AWJ A;  2QXF A;  4AT1 B;  1FX7 A;  2DF6 A;  4X9C A;  5A0G A;  1Y0M A;  2RQV A;  5LJ5 h;  1SRL A;  4E7J A;  4LD9 K;  2ZPE B;  4JJN K;  4M75 A;  2QQR A;  3V8L A;  1PD1 A;  2NWM A;  2MK5 A;  3OS1 A;  1LJO A;  2DD4 A;  1W4S A;  2R5A A;  1NPP A;  1Q95 G;  1SHF A;  3CCJ Q;  2KNB B;  1RAG B;  2CP2 A;  1K8A C;  3FEO A;  3A5Z B;  1ZQ1 A;  3PMT A;  2XI9 A;  3BE3 A;  4JLG A;  2DYB A;  3EHR A;  5FU7 C;  1TXQ A;  3E1S A;  3CCQ Q;  2HBW A;  3VKI A;  2BZ8 A;  1M1F A;  2RHY A;  5IN1 A;  4PJO D;  2V8I A;  4OP0 A;  1JJ2 A;  4LDW A;  1PHT A;  1TUC A;  2DXB A;  3OSV A;  4Y28 E;  3BW1 A;  3OY9 A;  1N9S A;  1YJ9 Q;  1VQP A;  1ZSG A;  2M16 A;  4ZN1 A;  3L2W A;  4PJN A;  1BI2 A;  1MV0 B;  1QKX A;  1K9M R;  2J7I A;  3MO8 A;  4PFZ A;  2XG8 D;  2COY A;  2OTL T;  1D3B A;  3CMA T;  5I11 A;  1SSF A;  1VIE A;  2P4T A;  3E9F A;  3CPW A;  1MMD A;  4LD6 A;  1VQ9 T;  1GBQ A;  1PG5 B;  2XD0 A;  2L3P A;  2YHT A;  3LYI A;  4MZT A;  4RG2 A;  1OZ3 A;  2VUB A;  5GAN 8;  1IO6 A;  1JJ2 S;  1KJW A;  4X34 A;  5KCO A;  2E6N A;  5CQX A;  2OAU A;  4EMK B;  4AFU C;  1VYU A;  1WXT A;  2P84 A;  1SKU B;  1O75 A;  1KSW A;  1KD1 C;  1JU5 C;  3CME T;  2CS7 A;  2GFA A;  1MMA A;  1EZZ B;  4C92 A;  3F70 A;  3QWY A;  3MEA A;  1UE9 A;  2RI3 A;  2V1R A;  2RPN A;  2PUK B;  3CPW S;  1VQ8 A;  2AT1 B;  3G6E Q;  2LZ6 B;  5J26 A;  5IAY A;  4NS5 A;  2K3X A;  3ZFJ A;  5CCA A;  1VQM T;  2QTV A;  5GJW B;  3L2Z A;  3ME9 A;  4M75 E;  3V8J A;  1IZ6 A;  1RAB B;  3CC4 A;  1CKA A;  2M9U A;  2XDB A;  3CC2 Q;  2PVO B;  3CCM Q;  1UDL A;  2RQU A;  4M75 F;  4BI3 A;  4C0G A;  4JRI A;  4M78 A;  1HD3 A;  1X6B A;  2CT4 A;  1GCQ A;  4HA8 A;  3QII A;  4C8Q E;  5GMK e;  3EG1 A;  1OQK A;  4ZTJ A;  1WQ7 A;  2Y4X A;  2C0I A;  3C0C A;  4HCZ A;  5J39 A;  2WSC E;  4LDY A;  2DPP B;  1AVZ C;  3JCM P;  2YLC A;  2XHC A;  1YJW T;  2AZS A;  2I2L A;  5KCH A;  4QQG A;  3SWN B;  6AT1 B;  4XTX A;  4C8Q F;  1ABQ A;  1U1S A;  3PT9 A;  2EFI A;  4WF2 A;  3AHU A;  5GAN 2;  1K9M C;  4MMK A;  3HTR A;  8AT1 B;  1BU1 A;  1PM3 A;  5GAO m;  1CSK A;  1K9A A;  2JJ9 A;  3EH2 A;  3UF4 A;  1I4K 1;  5GAO r;  4BD3 A;  3TCJ A;  2GBQ A;  4CC3 A;  5LJ3 e;  4C5I A;  3JB9 I;  3M58 A;  1Q7Y R;  1TWB A;  2NLU A;  2EIF A;  5HKC A;  3JCM h;  2W10 A;  1P92 A;  2COZ A;  5DY9 A;  1D1B A;  4Q5W A;  3JB9 G;  2CH4 A;  3H9N A;  2P0K A;  1BYM A;  2M0Y A;  3OS2 A;  2OAW A;  1VQL T;  3NTH A;  3VS2 A;  4M77 E;  1Y71 A;  1VQ4 A;  2KSS A;  1TOV A;  1ZA2 B;  3QZ5 B;  1YN8 A;  3ULR B;  3ZEH A;  5KE2 A;  2F69 A;  5GMK j;  2RK2 A;  4C8Q D;  1OYX A;  4KRT A;  4B9X A;  4C92 E;  1RI9 A;  4RCC A;  2EYQ A;  3JCM J;  4M77 F;  1AZE A;  2FYK A;  2Z0W A;  1VQO A;  3LGL A;  2OTL Q;  2JMA A;  1SRM A;  5CKB A;  2NUT B;  3SEM A;  5IXF A;  5CIU A;  3L2U A;  1BIA A;  2DZ9 A;  2EQU A;  4C92 F;  1UFF A;  4IUV A;  1AWX A;  2DMO A;  1GXI E;  4IUQ A;  2LQN A;  2RK1 A;  2V1Q A;  2QGG A;  1M8V A;  2COW A;  4F04 B;  4FYV B;  2QGF B;  4RTX A;  4BDZ A;  3PMI A;  3RNJ A;  5LJ3 j;  2NUZ A;  1Q86 R;  1QVF P;  4BE2 A;  3X20 B;  4DQ2 A;  2A3L A;  1QVG A;  4YTL A;  3CC7 A;  3UAT A;  2YXY A;  2LT1 A;  3GBQ A;  3VUZ A;  4E7H A;  3M0Q A;  4C5G A;  2ZPG B;  1G5V A;  1WDX A;  4PJJ A;  5A0L A;  2DZC A;  3FIF A;  3CCS A;  2D9T A;  2JMC A;  5L8R E;  3REB B;  3DKM A;  4J9C A;  1D09 B;  4J9I A;  1Q82 U;  1TS9 A;  3G71 A;  3S3O A;  4HCK A;  4N4G A;  2LCC A;  3S6W A;  1AZG B;  1Q7Y C;  4QKU A;  1QVG S;  3DB4 A;  1MUZ A;  4GY5 A;  4NL2 A;  4EIK A;  1VQ4 Q;  2DIQ A;  2QA4 A;  3CCE A;  2LQ8 A;  1TSF A;  1HK9 A;  1X75 C;  3LLR A;  2MIO A;  1T3L A;  4KGV B;  1GFC A;  4J9E A;  2ED1 A;  1OU8 A;  1GCP A;  1M8M A;  2WSE E;  4EMK A;  2K5L A;  5D6X A;  2YSQ A;  4M7D G;  3CCU A;  4M7D B;  4QVD A;  3LWI A;  1VQK Q;  2R57 A;  4M7A G;  2JZ2 A;  4FL6 A;  4M7A B;  2PVG B;  2EJG A;  4Z88 A;  1QVP A;  2HMA A;  3CXC A;  1QMC A;  5A2Q E;  2CUB A;  2BE7 D;  1F1B B;  1E7O A;  2FRW A;  2DXC A;  1YHQ T;  2AKL A;  1YI2 T;  3ER0 A;  2G6F X;  1AOJ A;  4PFP A;  1V29 B;  1UGR B;  4F14 A;  2M0O A;  3LW5 E;  4JS5 A;  2CH4 W;  1KQS A;  2RF0 A;  4AFZ C;  1ZBX A;  4J9H A;  2D6F A;  3FJ5 A;  1Q86 C;  1I81 A;  3PNW C;  1PRL C;  1W1F A;  2BZY A;  3CBM A;  3CCS Q;  1MV3 A;  3OW2 P;  2LC4 A;  2O88 A;  1YWP A;  1JB0 E;  2OTJ A;  2RJE A;  3V7R A;  3MCA B;  2YUQ A;  2L5Q A;  2YRD A;  3M5A A;  4LXC A;  4GLM A;  3SDZ A;  3CXC S;  4HKE A;  3G71 Q;  2VYT A;  1G83 A;  2DVJ A;  3I56 A;  3VJP A;  1WNL A;  1WIE A;  2XDD A;  3I9Q A;  4E7K A;  1VUB A;  3CBP A;  1FMK A;  3CEY A;  1BI3 A;  3CCE Q;  3SWN A;  3QDR B;  3ZL7 C;  1KQS S;  2MYS A;  1M90 U;  3OQ5 A;  2KYM A;  4A4H A;  1VQN Q;  1VQ7 T;  1UJY A;  5GAM d;  4RTV A;  4FSX A;  1M27 C;  3M53 A;  2AKK A;  4E7Z A;  1YNZ A;  1AT1 B;  2KBT A;  4L59 A;  3V7S A;  2LQK A;  3H6Z A;  4OGE A;  5D7U A;  2A36 A;  1PCX A;  4RTY A;  4ZTF A;  2VC8 A;  3QJ6 A;  1ARK A;  1H8K A;  4LDU A;  1KHI A;  4FSS A;  2J6F A;  3OYF A;  3CCV A;  1RAD B;  4M75 C;  3CCJ A;  1WLP B;  3GPL A;  4F17 A;  1H64 1;  2DK3 A;  4UC4 A;  2EJF A;  3RR6 A;  3QDF A;  1W70 A;  4KH1 B;  3MET A;  5IH2 A;  1JEG A;  2CKK A;  4E7S A;  2LRQ A;  5DLO A;  4XU3 A;  1K73 U;  2GQI A;  2O9V A;  3JCM e;  2V8K A;  2MF2 A;  4LUD A;  1YJ9 A;  2LJ1 A;  4Y92 A;  4D8K A;  3UA6 A;  4KT0 E;  4DBR A;  4JJC A;  2DBM A;  1BCO A;  2ESW A;  2C06 A;  2CP0 A;  4DA4 A;  9ATC B;  1ZA1 B;  3G7Z A;  3REA B;  2QEX T;  2IIM A;  2NUT A;  1C0M A;  1IXD A;  2JS0 A;  2QQ9 A;  2LCS A;  3CCL Q;  2MOX A;  3I56 Q;  3I5S A;  2DAQ A;  3OS0 A;  3EGD B;  3FC3 A;  3EG0 A;  1X6G A;  4HVW A;  5D6Y A;  3OYC A;  1R0B G;  2BZX A;  4MDW A;  1KFZ A;  5EG2 A;  3EG2 A;  2O31 A;  3C12 A;  1ABO A;  2QQB A;  2F2V A;  2K57 A;  2GCX A;  2LNH B;  1I07 A;  5KYW B;  1AHJ B;  2DET A;  3X28 B;  2M02 A;  1VQP T;  4MDX A;  4Y91 A;  2K3Y A;  2HD0 A;  3M4G A;  4ATO A;  2VXE A;  1AEY A;  1X2Q A;  4B9W A;  3VS1 A; 
#chains in the Genus database with same CATH homology
 1WGS A;  4M7A D;  4ZGD B;  3CCL A;  3PIO A;  3L2Z A;  3PGG A;  5CQY A;  4M77 C;  3VU3 C;  1VQ5 T;  5CKF A;  3ME9 A;  5J3B A;  2MWP A;  4M75 E;  3V8J A;  2QTX A;  1IZ6 A;  5KE3 A;  3L2Q A;  3CC4 A;  3CCQ T;  2QQA A;  4VUB A;  2M9U A;  2ZPF B;  3JCM V;  5GAN e;  1M90 C;  4CRI A;  5GAN h;  1N9R A;  2F5T X;  2XDB A;  5FU7 B;  1LNX A;  1M9S A;  2DD5 A;  3BDU A;  2PVO B;  1XTD A;  3RMQ A;  4HT8 A;  1YIT T;  2EKO A;  4ZN3 A;  4C92 C;  2ZPI B;  5GAM e;  3JCM b;  2DO3 A;  1YJ9 T;  1VQ6 A;  3G6E A;  2K2V A;  2FB7 A;  3BY7 A;  3GNG A;  5LJ5 d;  4M75 F;  4BI3 A;  4C0G A;  4JRI A;  4M78 A;  5LJ3 g;  2QI2 A;  1W2B S;  2FL7 A;  3QII A;  2XID A;  2MI6 A;  3EAE A;  4HA8 A;  4C8Q E;  4CI0 C;  5GMK e;  4M75 G;  3OW2 S;  2A7Y A;  4DOV A;  4BDY A;  3EFR A;  3VYH B;  4ZTJ A;  4PJO C;  1WQ7 A;  2Y4X A;  4M75 B;  4RCB A;  2XKO C;  4HCZ A;  5J39 A;  2WSC E;  3E9G A;  4LDY A;  2DPP B;  4JLI A;  3JCM P;  5CO7 A;  5I2S A;  2E6Z A;  2YLC A;  2ZPH B;  4EMG A;  3GLX A;  5GAN 3;  2XHC A;  3QYG B;  1Y96 A;  3HRS A;  1YJW T;  3UWN A;  3OYH A;  1YHQ A;  2I2L A;  3PTA A;  4MZP A;  5KCH A;  1YI2 A;  3WXM B;  3OYY A;  3Q1J A;  4E7I A;  4QQG A;  3SWN B;  1U8R A;  4J8O A;  3TRE A;  5GAO p;  4XTX A;  4C8Q F;  1VIF A;  1U1S A;  2AHJ B;  2JOY A;  2EFI A;  3MP8 A;  3PT9 A;  3QXE B;  4WF2 A;  4C5H A;  2MWO A;  3P8D A;  5GAN 2;  2KMT A;  2RHI A;  4MMK A;  1QP2 A;  2P0P A;  1XOV A;  5CK9 A;  3JCM W;  1K9M C;  3MEU A;  4PLL A;  5GAO m;  3ASK A;  1LOJ A;  2ZPB B;  4N4I A;  3J7A F;  2PUO B;  4L6V 5;  5I21 A;  1N8R U;  2RJC A;  4FT2 A;  2H3J A;  5D6W A;  1UGS B;  4EDU A;  1I4K 1;  2EQJ A;  5GAO r;  4M7D A;  2FHD A;  3BDL A;  4JRK A;  4ME7 A;  2DIG A;  1G3Y A;  3OB9 A;  4BD3 A;  5CAI A;  3TU4 K;  3X25 B;  3RIR A;  3TCJ A;  1RI0 A;  2PU9 B;  4LDX A;  3HRT A;  5LJ3 e;  1Q7Y U;  5LJ3 h;  3NTK A;  3QHS A;  4C5I A;  1K73 C;  3JB9 I;  4ZGE B;  3OYG A;  2FVU A;  3M58 A;  2X35 A;  4MML A;  4XTY A;  3CCR T;  1KHC A;  3CCL T;  2HQE A;  4M7A A;  2NLU A;  2EIF A;  3QSU A;  2HNI A;  2IG0 A;  4J83 A;  5HKC A;  3I56 T;  4F7U E;  5GAN 6;  3GOX A;  3JCM h;  5M9O A;  1P92 A;  4XAX B;  3CC4 T;  5DY9 A;  4Q5W A;  2O4X A;  3JB9 G;  5GAO q;  5GAN j;  3N5B B;  2E65 A;  2P0K A;  5HY6 A;  2JVV A;  1BYM A;  3OS2 A;  4BE0 A;  2X4J A;  2K5I A;  1VQL T;  2E12 A;  5LL6 S;  3NTH A;  4MZM A;  4M77 E;  1Y71 A;  3G6E T;  5FU6 B;  2HAX A;  2LVM A;  2KSS A;  5CKH A;  4JRP A;  1WJQ A;  1VQ4 A;  3CD6 A;  4F7U F;  1VQN T;  5GAM j;  1D3B B;  4IUT A;  2GFU A;  3QJY A;  3OYL A;  3QZ5 B;  3UDC A;  4F7U G;  3ZEH A;  4XTW A;  3R6O A;  4F7U B;  5KE2 A;  2RM4 A;  2F69 A;  3MHX A;  2RK2 A;  4C8Q D;  5GMK j;  1JBM A;  3KXT A;  1OYX A;  1DJ7 B;  2CZ6 B;  4OB0 B;  3JCM d;  4B9X A;  3ZBD A;  4C92 E;  4RCC A;  3OYK A;  2EYQ A;  4RMO A;  5AYF A;  4DOW A;  2VGM A;  4ELY C;  4M7D C;  3JCM J;  4M77 F;  5FU6 C;  4BI4 A;  5C0M A;  5GAO l;  3C4S A;  3M55 A;  1QW1 A;  3QZ9 B;  2WSF E;  2JN0 A;  4M77 B;  5LJ5 f;  2FYK A;  3CCV T;  3CC2 T;  4PJO E;  3CCM T;  3LGL A;  1VQO A;  1I5L A;  4M7A C;  2RHX A;  2CGH A;  4PKC C;  5CKB A;  1X6O A;  2P0Q A;  4N0A A;  4R56 A;  4QW2 A;  3OYI A;  1BKB A;  3RES A;  3J81 E;  5FRN A;  3L2U A;  5CIU A;  1BI1 A;  3UPU A;  3VUB A;  4II1 A;  1BIA A;  2DZ9 A;  1RL2 A;  2EQU A;  4XQ3 A;  4C92 F;  3FRN A;  5DM7 R;  4IUV A;  3OSS C;  1UGQ B;  4RKU E;  2XK0 A;  1NE8 A;  4L5G A;  4C92 G;  1NPR A;  1GXI E;  4C92 B;  2EQM A;  3G4S A;  4FT4 A;  4IUQ A;  4BY6 C;  2LX9 A;  4PJO F;  2RK1 A;  2DXU A;  2X4Y A;  3EFS A;  4OB3 B;  3GIB A;  1M8V A;  1UEB A;  4PJO G;  2WAC A;  1Q86 U;  4HCB A;  5HK3 A;  2HBP A;  4PJO B;  1Q81 U;  1WJR A;  1BIB A;  1M1K U;  4BDZ A;  3PMI A;  5LJ3 j;  1NJI U;  3M56 A;  4PL6 A;  3OYA A;  2LNV A;  4BE2 A;  3GNF B;  4NL3 A;  3X20 B;  4DQ2 A;  2A3L A;  1QVG A;  4J7F A;  2OTL A;  4O5V A;  4X9D A;  3MEW A;  4YTL A;  3JSC A;  3NFC A;  3SD4 A;  5CR2 A;  4KUI A;  5GAM h;  3CC7 A;  3E19 A;  4A4G A;  2LT1 A;  4J6X A;  4OMF B;  3OYM A;  1VQ9 A;  3VUZ A;  3J80 E;  4EMH A;  1FXX A;  5GMK h;  4KUL A;  3DLM A;  4OF1 A;  4E7H A;  3JB9 J;  3I55 A;  4C5G A;  2DXT A;  2ZPG B;  4KBM B;  2E1H A;  3S3N A;  3MP6 A;  2VXF A;  3A8O B;  4OB1 B;  3T9N A;  3V8K A;  5GAN 4;  2L89 A;  3HFO A;  1G5V A;  4N4H A;  4LDV A;  3CD6 T;  2VV5 A;  5A0L A;  3OBW A;  2DZC A;  3FIF A;  3CCS A;  2R5M A;  3QPH A;  4N0A C;  2D9T A;  2RI5 A;  3QG1 A;  5GAN d;  3DB3 A;  3M59 A;  3A8L B;  1KC8 U;  2Y4Y A;  5GMK i;  4TVR A;  5L8R E;  2QEX A;  2JUF A;  3CC2 A;  1B34 A;  4C8Q A;  1G3W A;  3DKM A;  1Y7X A;  3KBG A;  3L42 A;  3RER A;  2RHZ A;  3GF5 A;  5GAN 5;  3TEE A;  3OMG A;  1Q82 U;  1K8A U;  1N8R C;  3MEV A;  4IUU A;  4QVC A;  3CME A;  4M78 G;  2CZ1 B;  1PSE A;  1MHN A;  3G71 A;  4M78 B;  3S3O A;  4N4G A;  3WVE B;  2LCC A;  5CVI A;  4XU2 A;  2DTH A;  1VQ8 T;  3RUX A;  2L3R A;  3OYN A;  1VQO T;  2LTO A;  3S6W A;  3WVD B;  2RJD A;  2V8J A;  3DLL A;  2G3R A;  1Q7Y C;  1QVG S;  2ZGW A;  3DB4 A;  4GY5 A;  4NL2 A;  1YJN A;  2VGN A;  1XQH A;  1S72 A;  3RKY A;  2DIQ A;  2QA4 A;  1Y96 B;  1YIJ T;  1I8F A;  4J5Y A;  3JCM f;  4PNO A;  2Y90 A;  3CCE A;  2YLB A;  4FM4 B;  4A54 A;  2LQ8 A;  3BFM A;  4M78 C;  5FLX E;  2KK4 A;  1HK9 A;  1X75 C;  3LLR A;  2F5K A;  3G4S T;  2X4W A;  3JAM E;  2E64 A;  2RB6 A;  2E10 A;  2RH2 A;  3RKW A;  5GMK m;  2DTO A;  1NZ9 A;  3FJP A;  3RKX A;  1K9M U;  4M7A E;  1X01 A;  2RI2 A;  1EIF A;  2BUD A;  1M1G A;  2RJF A;  3JCM X;  4IUR A;  3JB9 F;  4M75 D;  2EAY A;  3QUI A;  1TH7 A;  4OVA A;  1VQ5 A;  2WSE E;  4M7D F;  4EMK A;  1KQ1 A;  2K5L A;  3FLG A;  4J6Y A;  4XTZ A;  5D6X A;  5CKE A;  2JTM A;  5GAN 7;  3GP8 A;  1KG1 A;  3OBY A;  4C0D C;  4M7D G;  4C8Q C;  4IKF A;  3CCQ A;  3CCU A;  4M7D B;  3CC7 T;  1VQ6 T;  4QVD A;  3LWI A;  4IUP A;  3UT1 A;  4M7A F;  3JB9 H;  5LJ3 d;  2KY9 A;  2R57 A;  1YIT A;  4M7A G;  3V7C A;  2JZ2 A;  4FL6 A;  1WPY A;  4M7A B;  4V2S A;  4JDS A;  4QQD A;  2KQW A;  3M9Q A;  3HKS A;  2PVG B;  2BKD N;  2BIV A;  4A4F A;  3HFN A;  2EJG A;  5LJ5 g;  2RO0 A;  1UB4 A;  2KVQ G;  1QVP A;  2KDS A;  4FIB A;  4XK8 E;  1VQ7 A;  3CXC A;  1M5Q 1;  2EWN A;  4QQ6 A;  5A2Q E;  2MAM A;  1XNI A;  2DXC A;  4M77 A;  1OI1 A;  1YHQ T;  2O4X B;  1YI2 T;  1FWZ A;  3QO3 A;  2EQK A;  3ER0 A;  4BY6 B;  3LX7 A;  4HT9 A;  2LCL A;  2D0Q B;  1V29 B;  1UGR B;  3H8Z A;  3M57 A;  2B8A A;  2CZ0 B;  2M0O A;  3OYE A;  4EPC A;  5C6S A;  3LW5 E;  3HP9 A;  4JS5 A;  4D6W A;  1VQK A;  3C95 A;  4XU0 A;  1KQS A;  1KD1 U;  3INZ A;  3PIP A;  1ZBX A;  3C94 A;  4A53 A;  3QBY A;  2D6F A;  3JCM Q;  4OGC A;  4EMK C;  5GAN f;  1Q86 C;  4JRQ A;  1I81 A;  3PNW C;  4ELZ C;  3OYD A;  4O6J A;  1Q81 C;  1M1K C;  5GMK l;  1N6A A;  2GF7 A;  3CBM A;  1R8O B;  2QA4 T;  2RD1 A;  1NJI C;  2E70 A;  2PQW A;  2LC4 A;  1G3S A;  5HK0 A;  3JB9 D;  2E41 A;  1OZ2 A;  5GAM f;  2K5F A;  2QXF A;  4PLI A;  1QVF A;  1U1T A;  1JB0 E;  1FX7 A;  2OTJ A;  4X9C A;  5A0G A;  4JS4 A;  3L1A A;  2RJE A;  3V7R A;  4E47 A;  3MCA B;  4QVZ A;  5LJ5 e;  5LJ5 h;  2L5Q A;  3M5A A;  3SDZ A;  3CMA A;  3LGF A;  3CXC S;  4E7J A;  4LD9 K;  2E5Q A;  4HKE A;  3MP1 A;  2VYT A;  3CCR A;  2ZPE B;  4A4E A;  3L2R A;  4M75 A;  4JJN K;  4C0Z A;  3SB2 A;  2QQR A;  3V8L A;  3P8B B;  3I56 A;  3VJP A;  3FB9 A;  1WNL A;  4XU1 A;  3VYG A;  4BAC A;  4M78 E;  1H3Z A;  2XDD A;  3OS1 A;  1LJO A;  5GAO n;  2DD4 A;  4E7K A;  3CCU T;  3OYJ A;  1VUB A;  3CBP A;  1KC8 C;  1W4S A;  1HXD A;  2R5A A;  1VQ4 T;  2M1H A;  3QKJ A;  3CEY A;  2IVW A;  1BI3 A;  3HHT B;  1NPP A;  3SWN A;  5KH6 A;  3QDR B;  3LWH A;  2RA2 A;  4M77 D;  1KQS S;  1O9S A;  1M90 U;  1VQL A;  3OQ5 A;  1Q82 C;  3OS5 A;  1K8A C;  2DEQ A;  4A4H A;  4RG8 A;  1UGP B;  3FEO A;  1VQ7 T;  3A5Z B;  1ZQ1 A;  4M78 F;  5GAM d;  3PMT A;  2EJ9 A;  2XI9 A;  3M53 A;  4FU6 A;  4FSX A;  4C0F A;  3HSB A;  4JLG A;  2L8D A;  4L59 A;  3V7S A;  2LQK A;  3H6Z A;  4OGE A;  5FU7 C;  3RMS A;  4ZTF A;  4C92 D;  3E1S A;  4A4K A;  3HL8 A;  2VC8 A;  2DVE A;  1KQ2 A;  1QVF S;  3JCM g;  3QJ6 A;  4J7I A;  1N27 A;  2XIC A;  4LDU A;  3M54 A;  5LJ3 f;  1KHI A;  4HCC A;  2RHU A;  3VKI A;  1M1F A;  2RHY A;  4KUD K;  3HPW A;  5IN1 A;  3OYF A;  4PJO D;  1Y07 A;  2V8I A;  4OP0 A;  3P8H A;  1MGQ A;  1VQK T;  1JJ2 A;  1WJS A;  4LDW A;  4M7D E;  3CCV A;  2DXB A;  2XU8 A;  3OSV A;  4NOY A;  4Y28 E;  3BW1 A;  4M75 C;  3CPF A;  3CCJ A;  4C8Q G;  3OY9 A;  4C0D B;  1B34 B;  2XDP A;  3QYH B;  4C8Q B;  1N9S A;  3GPL A;  3HRU A;  1VQP A;  3CCM A;  3JRZ A;  2QQS A;  2M16 A;  4BE1 A;  1VQN A;  4J6W A;  1IRE B;  4ZN1 A;  4Z02 A;  3L2W A;  2HQX A;  5CKD A;  2LDM A;  1H64 1;  1VQM A;  2DK3 A;  4UC4 A;  1BI2 A;  3VV0 A;  1BI0 A;  2EJF A;  3L2V A;  2LT4 A;  3SWN C;  5FRO A;  4ZGJ B;  3X24 B;  3LH0 A;  1JRI A;  2OTJ T;  3MO8 A;  2JTF A;  3A8M B;  2XG8 D;  2O01 E;  5I2M A;  3OYB A;  3MET A;  2OTL T;  1D3B A;  3CMA T;  2CKK A;  1SSF A;  1VIE A;  5LJ5 j;  2R58 A;  1YCY A;  2KAF A;  3OMC A;  2DJZ A;  2LRQ A;  2P4T A;  3E9F A;  5DLQ E;  4F7U A;  3CPW A;  4LD6 A;  1VQ9 T;  5DLO A;  4R55 A;  4XU3 A;  2PVD B;  1K73 U;  3JCM e;  2ZZD A;  2XD0 A;  2V8K A;  2MF2 A;  4XTV A;  2YHT A;  4XTU A;  3LYI A;  4BI8 B;  3I55 T;  3S3M A;  2DKG A;  1YJ9 A;  4MZT A;  4RG2 A;  4C5E A;  3M4Y A;  3O8V A;  2JNG A;  4M78 D;  1OZ3 A;  2VUB A;  4KT0 E;  4E7L A;  3CCS T;  1G3T A;  5GAN 8;  1JJ2 S;  2C06 A;  3PFS A;  3AHU A;  4X34 A;  5KCO A;  4DA4 A;  2E6N A;  4JUV A;  3FDR A;  3G7Z A;  5CQX A;  2OAU A;  3A8H B;  2K4Y A;  4EMK B;  2QEX T;  2YRV A;  1YBY A;  3OA6 A;  1O75 A;  1YJW A;  2X4X A;  5IT9 E;  5GAN g;  1KD1 C;  1ZHI A;  3CME T;  2CS7 A;  2QQ9 A;  3X26 B;  2GFA A;  3G71 T;  4C92 A;  3SFM A;  3F70 A;  4BUG A;  2DAQ A;  3OS0 A;  3CBO A;  3MEA A;  2RI3 A;  5GAM g;  3FC3 A;  5D6Y A;  3OYC A;  4P5N A;  4MDW A;  2DTI A;  1WQW A;  5EG2 A;  2QDY B;  2ZCF B;  1W2B A;  1YJN T;  2GQV A;  2MMP A;  1S72 T;  3C12 A;  3OW2 A;  4PJO A;  4M77 G;  2QQB A;  4GLK A;  2K57 A;  3CCE T;  2PUK B;  3CPW S;  1VQ8 A;  2GCX A;  3NTI A;  3CCJ T;  1AHJ B;  4BB7 A;  3X28 B;  1M4Z A;  4M7D D;  1VQP T;  5J26 A;  5IAY A;  3KUF A;  4NS5 A;  4Y91 A;  4MDX A;  2K3X A;  2CZ7 B;  2HD0 A;  2K3Y A;  3M4G A;  1YIJ A;  3URG A;  1PSF A;  3ZFJ A;  5CCA A;  4ATO A;  3A8G B;  2VXE A;  2CYZ B;  5FRM A;  4OB2 B;  1VQM T;  1QP3 A;  4B9W A;  5A0D A;  3JCM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...