2K5BB

Human cdc37-hsp90 docking model based on nmr
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
129
structure length
129
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The human Cdc37.Hsp90 complex studied by heteronuclear NMR spectroscopy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock protein HSP 90-alpha
total genus 53
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k5bB00
2W0GA 2K5BB 1US7B
chains in the Genus database with same CATH superfamily
2CHNA 3QB5K 3O4XE 4DV5T 5FL1A 4AI6A 2JJ9A 2D0TA 5J0ZA 2D2SA 4G2AA 2NTXA 5CB4E 2QYWA 1N34T 5FMNA 1UX5A 3HKEE 5BR8T 2CWOA 3TLSA 5HEGA 2FUPA 2K24A 2OV9A 4KHZF 3ZMZB 3GA8A 1CUNA 1UCUA 3UTKA 5JDMA 2LE8A 1IBLT 1BR1A 4UEMA 5DJQC 5EK4A 1XZYA 4JI5T 4CN1A 3KV9A 2LEHA 4UIGA 2X9XA 3ZN1B 4A98A 4P1NA 2E8IA 5IWAT 4OFZA 4LFCT 2PTFA 3OTOT 3RHWA 3M3ZB 3PU8A 3EUHA 5HXSA 2BG9A 4NXNT 2XQYA 3UU5A 4DV7T 2C5KT 3SFEA 2BG9C 2KXPB 2W66A 5LJMA 4I43B 4AIUA 1VOMA 2BVMA 2WU5A 3GMIA 3LBXA 2X66A 3UQ7A 3PUYF 3D0TA 4IE7A 4FI5A 2BVLA 4HGAA 4IDNA 1G8XA 3SOLA 4ADZA 4UELA 5L3EB 1HNZT 4U74A 1KF6A 2QRXA 3KBUA 2A9UA 4IL9A 2C5JA 2LSKA 4HWIB 5F8PA 4CXWA 1KNRA 3I1AA 5HAXA 4TWHA 3WI3A 4CXYA 4EGWA 2LKHA 3RLFF 2IIUA 3LK2B 4ILUA 4IL4A 4HWFA 3KVAA 4IE4A 4BJNA 1MIWA 3Q5XA 1MIYA 4PFPA 2C0SA 4DR1T 4OYKA 2LOPA 2PBIA 1HS7A 4JEUB 3HL6A 4YHJA 3TLTA 3T1HT 3AE3A 2YKSA 3C98B 4JI1T 1HX8A 2LSJA 4JI4T 2L9QA 4IT4A 3SRZA 4HE8A 2IW5B 3AA1B 3RRWA 4EB6E 5L3FB 5JREA 3PE0A 3O9XA 2YU1A 4PJLA 3AEAA 2ZMAA 3KINB 3PUAA 4AKLA 4LF6T 1Y01A 2D5UA 1QLBA 2R6GF 3E22E 4LMLA 4GYSA 1W0AA 3GN5B 5LHGB 4QX8B 4YT0A 4PAGA 3PUGA 4AKRB 4YSYA 4P0BA 2B76A 1IAPA 2XQAA 1XWMA 1HG2A 2EHOC 3EAMA 3L8RA 4PK4A 5C2TA 2XAQB 1KEYA 3U3IA 1ZP0A 1VCTA 3OPCA 4XZCA 5HYAA 5LGUB 2WMOA 3N9MA 2YDSA 3CMLA 5FXZA 2W62A 2PG8A 3B13A 4BA9A 4DR7T 4JYAT 4ZI2C 3LFMA 4MBQA 3PUSA 2XUEA 5L3DB 5LGNB 3NWIA 1WCRA 2CCQA 3IBPA 4IDQA 5FNVE 3JCFA 1IJ5A 1U4QA 2LRLA 2WWVA 3VU7H 4ZI2D 1OXZA 2BS3A 3RYCE 2MPKA 3ZLIA 1HX1B 4ISSA 2V6XA 3AE8A 2I59A 3PUQA 2UXNB 2BZBA 1SHZC 2H7VC 2WS3A 2XAHB 3HI2A 3RYIE 1XNQT 3IEEA 5TAOA 3HKDE 3JC6C 1AJ3A 1KFYA 2WP9A 1MMAA 3X1DA 2VVSA 3VKGA 4WW0A 3S4UA 3CK6A 5JDGA 2B1EA 3PUXF 1T72A 5JR9C 3O1JA 2J4GA 3AA6B 1T8BA 2WDRA 3ZT6A 2UUCT 2W4XA 3PURA 2V7IA 4DVDA 3NZQA 5AQPB 2XM2A 4YHHT 4ZI7E 3UU6A 3PU3A 5FY0A 2X0YA 2JRKA 2PJQA 5FXWA 5HXHA 5M4YA 4JI0T 4XBFB 1HNXT 4DV6T 2VB6A 3WAJA 2L3LA 2ZM8A 4H9PC 5FYMA 2XQ5A 1VRBA 2E9XC 2Q9QD 3GWHA 3O1IA 4QKNA 5HEHA 3I9YA 3ZMUB 1N36T 3UUNA 2XSBA 4YTPA 4QXBB 4YFSA 4AKIA 3FHNA 4KBMB 2QVAA 1T98A 2WU2A 4COFA 3BQLA 2XHEB 1IBKT 4YJ2E 5A1LA 4F6RC 3AE4A 5LXTE 1NENA 4HWCA 4EIWA 5HXRA 4L0RA 4PNIA 2HPJA 5FKYA 3CPZA 4YLHA 4Z8XA 4DIDB 3NBXX 3PTRB 4GK0E 4N78D 5L2LA 3M65A 5J2TE 3FBLA 3PJAA 2Q9QA 3RQWA 2CXLA 2MTQA 3CX7B 1WR0A 3NVOA 4CZZB 2ACXA 1OEDC 2CPTA 2LM9A 2WDQA 3ZJ2A 3N9LA 2Q9QB 3MA9A 5AFUL 1LRZA 1HF8A 2W67A 3ZMSB 2IHR1 3NRYA 4A97A 3T1YT 2VURA 2NTYA 4IE5A 3N2GE 1S35A 3LBXB 1M62A 1B7TA 4PK5A 4JBWF 4YXDA 5CA1E 3I9WA 4ZS3A 2XASB 2VASA 5HEUA 2WZHA 4CQIA 2OLTA 1YQ4A 3CQCB 4CN6A 3O1HA 1NWMX 4U7IA 4LFBT 4Z91A 4TWFA 1HFAA 4K0UA 2NR4A 2J47A 3RIUC 4BJMA 4CI3B 2UXCT 1D1BA 2NW7A 3L3PA 3MJXA 2WSSV 4HFIA 2K9AA 4J2CA 2IC6A 4OHFA 1YKEB 3J9X1 4NUUA 2J62A 1O3XA 3F2EA 1XDOA 3KV5A 3N9PA 2Y6XA 3UUXB 3UULA 4DBRA 4LF9T 4CXXA 3OKQA 2CLYC 4LMJA 2X51A 3JAFA 5F5WA 1SUMB 2JQQA 4O4IE 4JUYA 3PUWF 5DQVA 5FY1A 3VR9A 3MXZA 4ISTA 1SE7A 4X20E 3FBZA 2K48A 4EYUA 3AAAB 2BG9E 3B57A 1ZV4X 3EDUA 3FXEB 2DHRA 4QH5A 3RIUA 4P0AA 3OVUA 4QXCB 3E08A 3LDQB 1U5PA 4CI2B 4MALA 4EV6A 3ETUA 3ZT5A 5JDQA 3CQGB 3H3AA 3SFDA 4QXHB 3P4QA 3C4XA 3DTOA 4K0KT 3HR0A 4ILAA 4WBOA 5AQMB 3T8OA 5L3BB 1IBMT 2X68A 3N5LA 4WBNE 1XMQT 3P4WA 3EHZA 4U7YA 4AQGA 1HR0T 2N9DA 4YJ3E 5LP6E 4JV5T 3AA7B 2IC9A 2MBGA 3QC9A 3OYZA 2BS4A 2LRKA 1I94T 1J1JA 1QSDA 3E0ZA 5EK2A 3PJAJ 2K3WA 4IDOA 5AQVB 2CA5A 5LB7B 2NW8A 3V5SA 1T7SA 2W61A 5JVDE 3VHLA 4OX9T 1D1CA 2IUBA 3Q5EA 2VVNA 2WWUA 5JTGA 1ZHCA 3AEEA 4IDZA 1IJ6A 2FJBA 2YU2A 3H3MA 3P50A 4WYVA 3FZMB 3RGLA 3ONLC 1N32T 3TLWA 2V26A 4X66T 4L5GA 4X65T 2Q9QC 2E9XD 2HN2A 1US7B 2XQ6A 3N2OA 3QNUA 2D0UA 4YTNA 2XJ7A 2UXDT 2X0HA 4DNDA 2XQ3A 2C5IT 5AQJB 2NWBA 2CHOA 2YDRA 3Q5DA 3BK9A 3NRXA 5AQRB 2X0LB 1WFDA 2WZIA 3C64A 5LBMA 1M7KA 3VRAA 3ZYMA 1FMWA 3AEDA 3HKBE 3KBTA 2Y48B 3P7IA 5F3JA 2V6YA 4IGUA 3ZC0A 1XDPA 2N1GA 2M67A 1MMNA 2DWGA 3AEGA 3ZJ1A 3VKHA 3ZSTA 2F4VT 5ETWA 4A5XA 1JNRA 3UFEA 5C8YE 4UV8B 5KXJA 3ZT7A 4U3CA 3CWZB 3ZSSA 2YEVC 2WY2A 5LOVE 2V5CA 1I6ZA 2IAKA 5JR9A 2XQ7A 4OK0A 2RA1A 2SPCA 2DCFA 3LK42 3G06A 1V9DA 2LSYA 3QB5A 5E0OA 5JDLA 5LHIB 4HEAA 3I0OA 4HTEA 3RQUA 4I0UA 2V7MA 5LHHB 2LSIA 1ZOYA 5ABEA 2ZM6T 2CE7A 3ANWA 5CJ5A 2J1DG 2WBLA 5AQUB 4H63V 3KDSE 5AQQB 3VRBA 1WYBA 4X62T 1XNRT 3RPUA 4E7SA 1NAFA 1BR2A 2XAFB 2ZM0A 3NZPA 4AXPA 3LSVA 5KMGP 4B3ST 2A72A 5LA6E 2LM2A 4DMWA 1FJGT 2YDQA 5FXXA 3RKOA 2VKHA 3ESLA 2LSGA 1J5ET 3N9NA 1YXRA 3CX8B 2NW9A 2CBIA 5FP3A 2V1DB 2YINA 3C51A 1YQ3A 4GOUA 1MIVA 4ASKA 4DV1T 1EZ3A 2ES0A 4O2BE 4E7ZA 2VL8A 5FL0A 4YSZA 4AKHA 2W63A 4U31A 4MLKA 3F57A 3EDVA 3BQIA 3P4PA 3AEBA 2XQ4A 1WYCA 3FZHB 4MFRA 4GYRA 5AQLB 2EHOD 4I4TE 4CN4A 4EEBA 3HKCE 4DV3T 3FXDB 4G63A 3EABA 4H9NC 4ILCA 1WLXA 4U33A 2NP9A 2BBHA 2YK0A 5ABGA 5JH7E 2H7OA 3N9OA 2XAJB 2RPAA 3ZCJA 3LJCA 2WMNA 3CX6B 3N2KE 3MK7C 3PV0F 5AQOB 3RI5A 4JEHB 4AISA 4ZZBA 2W00A 4M1PA 4TWDA 5LMNT 2CEAA 2JMHA 5IHYA 3TKLB 2XQ8A 4DO0A 4YSXA 1KNZA 4B6XA 5GONE 4DV2T 1QUUA 2XSAA 3L09A 4B3RT 3KFWX 4O2AE 4PFOA 4CI1B 3RC3A 4O4LE 4TZ4C 4IDPA 2IMLA 5C3JA 2A2FX 3CIRA 5HWXA 3AECA 2VQFT 4UV9B 4V1Av 2PFVA 3OJAA 1LVFA 2V5DA 2D9DA 3AVSA 4EOZB 1E7PA 2E9XB 3CQXC 2YOEA 4UVAB 4C91A 4B3TT 5IUXA 2OA5A 5CFBA 2VL0A 3TLVA 4GKJT 2ZM2A 5AQIB 1MMGA 2ODUA 2E5VA 5HCJA 5HXCA 2UXXB 3IHRA 3ZC1A 5AQGB 5IYZE 3ZPOA 4JI8T 3ONXA 3TLUA 4LF4T 1S94A 1FEWA 4Q25A 4UF0B 4X5TA 2E2AA 2UU9T 2CLYB 3K8PC 4KMCA 5JDHA 3NKZA 4DV4T 4P09A 2N2NA 2V7KA 3H37A 3FZLB 1CHUA 5ABFB 4DR2T 4ILBA 1R8IA 4HKAA 5HWYA 4IHJE 2LOSA 2MOZA 2IDOB 5ABFA 2HH7A 2DWKA 5DQWA 5FY7A 5J1GA 4DR4T 4GKKT 5L4EA 2YN6A 2XM1A 3F31A 4QX7B 3VR8A 2V8SV 5KDMC 4HFHA 4QH1A 3WAKA 2DL1A 3HA4A 3RRCA 4DUYT 2XY8B 4I50E 2LHRA 2CM0A 2CBJA 2KINB 5HCMA 3C4WA 3MZKB 4HFEA 3KV6A 1YKHB 3K1SA 3MACA 3RH3A 4ZEYA 4LMKA 4PK6A 5H6RB 5CGMA 2X9HA 2FJAA 4NPPA 4LF8T 3UU4A 2X9WA 4DMVA 4OYJA 3IA3A 4HWHA 3RC8A 2XZEA 2A3DA 2KSRA 3AE7A 5AQHB 3ZYKA 5JQGE 4DUZT 3GN5A 4DR5T 1H7CA 2KNDA 3BQKA 4KP3C 2ODVA 4XAXB 4UVCB 5JDNA 5AQKB 4EEDA 5H6QB 4EYYR 3ZEFB 5LMUT 4TUYE 3ZMVB 2NOXA 3ZYLA 3SWHA 2QGSA 3CKDA 5AQSB 3ZMTB 4ZS2A 4JI6T 2KWIB 2L8KA 2BKOA 2WB5A 3RIAA 3UU8A 1Z8UA 1BR4A 1FMVA 2MAWA 4FJOA 4L9IA 5AQFB 5LG3A 2X9YA 4AQYT 4JI3T 1D0YA 3Q5WA 3IF8B 1KK7A 3MKDA 2BDEA 2CXFA 2VKDA 4H9QC 3OYXA 1HCIA 1YW0A 4JI2T 1E2AA 3RIFA 5LCYA 1HG5A 3RX6A 2JQKA 3RYHE 2JQHA 2KWHA 1WRDA 2VWAA 4NUVA 5JR9B 3C50A 3CVRA 1OEDB 2JPFA 4GK5E 4O4JE 5FVLA 3UFGA 4B3MT 4BAYB 2WDVA 3FB2A 5BMVE 2XAGB 1DU2A 1UUSA 2AE9A 5L3GB 3K3NA 4ANJA 1IZNB 4WZXA 2WCAA 2K5BB 4Z90A 4ZI3D 4DR3T 2ACZA 4ZOLE 4YY3T 1D0ZA 3ZN0B 3PUZF 5FVKA 4HWDA 3QK6A 2V6YB 5HEOA 3UT5E 5LYJE 2CRBA 1D0XA 1LKXA 3L39A 4I55E 2JIWA 1D1AA 4NIQA 4U2YA 5JRCA 4X1IE 5KX5E 4EZ4A 3AE9A 5CA0E 1UURA 1SA0E 2CXDA 1W0BA 2RP4A 3JAEA 3LK3B 4GIWA 5HXEA 4NXMT 5DABA 2BKPA 2VKOA 1WR6A 3AE6A 2DLRA 5EK3A 3W15B 3ONJA 4UF0A 1MNDA 2DNXA 4ZZCA 3QOFA 1X9BA 4O4HE 3RKGA 4DR6T 4KHPT 2G0UA 3UUBA 5LGTB 1OEDA 2P9BA 5L4HA 2E5LT 3AXJB 5L3CB 2X67A 1Y64B 1UX4A 3K3QC 2QA7A 5ADXL 4QWNB 1LVKA 1NEKA 1KNPA 3EI0A 3PUVF 4H63H 5JDFA 5HEJA 2JQ9A 4IE0A 4WNKA 4ERRA 1BR0A 3AA0B 1L0VA 3QUJA 2HHHT 3SS1A 3JADA 3OBVE 4UR9A 4A56A 3AB3B 4IIJE 2BBJA 5AQTB 4H9OC 2MYSA 5LG4A 1ZKEA 3P4RA 2H88A 4MHCA 2EHOB 2I0MA 3R6NA 4LFAT 2M6IA 2Z6EA 3AEFA 1UK5A 2CMRA 1OWAA 2V7JA 3PDYA 4HFDA 4HFCA 1VCSA 4JI7T 2E9XA 3C4ZA 3AAEB 4TV9E 4ZI3C 4LF7T 3ETVA 2VK9A 3RYFE 3AAIA 2ZLYA 3AE1A 2WM9A 3LG7A 3Q2MA 4UVBB 4X1KE 3J7Yq 2UUBT 2GK9A 1HTJF 4LF5T 4TN7B 3U78A 1E1HB 3R84B 2Y8DA 5LBQB 4AKGA 5J2UE 2W2UA 4UXNB 1J5WA 4PJJA 4PW8A 3AXJA 4X1YE 4F8HA 2V7LA 4KUMB 4HFBA 4H9SE 1UGOA 3A8YC 3AE5A 3V5UA 1OEDE 3JC6D 2VQET 1MMDA 2BS2A 5LJNA 3AE2A 1HNWT 2BG9B 2KLQA 5LNKA 3RF1A 2BKNA 3UU3A 2WQYA 4AQFA 5JRCB 2UXBT 3K3OA 3KV4A 1MNEA 4TNWA 3A7MA 3ABVA 3ZCIA 2XTLA 2FJEA 4ZXLA 2LJLA 2KMFA 3FZFB 4HFVA 4U72A 1JNZA 4YTMA 4KI0F 3UUMA 1X79A 4KX6A 1FIOA 3EVYA 3P8CD 4DBQA 4EXTA 3N9QA 4TX5A 4DV0T 4QHOA 1Z0PA 4PJNA 1XMOT 2LLYA 2LKGA 4AQFC 3ANWB 5L47A 1GQEA 2I6HA 2JMKA 4IE6A 2KZ7B 3ZKRA 2FJDA 5EZYE 4EZHA 3KVBA 2H89A 3DJBA 3AVRA 2XPKA 2W0GA 5FXVA 1W09A 5AQNB 4C90A 3P4SA 1W9RA 2VKJA 4O8SA 2UUAT 2AXDS 2HPLA 3UQ4A 2LHNA 2KT9A 3I0QA 3FZKB 1G73A 3B5MA 4HN9A 1ZEEA 1YD8G 4U2ZA 2CWYA 2H3RA 4JLEA 4EAHA 4TV8E 2DI4A 3A5XA 2FBWA 2LT3A 2M6BA 3Q9DA 4H9RC 4QH4A 2HN1A 4TNVA 4PJMA 5ABHA 4X64T 1N33T 2XQ9A 2EHOA 4ZHQE 3DP7A 4IREA 2WAUA
chains in the Genus database with same CATH topology
3O4XE 4AI6A 2JJ9A 2D0TA 2D2SA 4G2AA 2NTXA 5CB4E 5FMNA 1UX5A 3HKEE 2CWOA 2K24A 3ZMZB 5JDMA 3GA8A 1CUNA 1UCUA 3UTKA 2LE8A 1BR1A 4UEMA 5DJQC 5EK4A 3KV9A 2LEHA 4UIGA 2X9XA 3ZN1B 2E8IA 4OFZA 3PU8A 3EUHA 2XQYA 2C5KT 5LJMA 2KXPB 4I43B 1VOMA 2BVMA 3GMIA 3LBXA 2X66A 3D0TA 4IE7A 4FI5A 2BVLA 4HGAA 4ADZA 1G8XA 3SOLA 4UELA 5L3EB 4U74A 3KBUA 2C5JA 2LSKA 5F8PA 4CXWA 3I1AA 5HAXA 4CXYA 3WI3A 4ILUA 3LK2B 3KVAA 4IE4A 4BJNA 1MIWA 3Q5XA 1MIYA 4PFPA 2C0SA 4OYKA 2LOPA 2PBIA 1HS7A 4JEUB 3HL6A 4YHJA 3C98B 1HX8A 2LSJA 2L9QA 3SRZA 4HE8A 2IW5B 3AA1B 3RRWA 4EB6E 5L3FB 5JREA 3PE0A 3O9XA 2YU1A 4PJLA 2ZMAA 3KINB 3PUAA 2D5UA 3E22E 4GYSA 3GN5B 5LHGB 4QX8B 4PAGA 3PUGA 4AKRB 4P0BA 1IAPA 1HG2A 2EHOC 4PK4A 2XAQB 3U3IA 4XZCA 5HYAA 5LGUB 2WMOA 3N9MA 3CMLA 5FXZA 2W62A 2PG8A 3B13A 4BA9A 4ZI2C 3LFMA 4MBQA 3PUSA 2XUEA 5L3DB 5LGNB 2CCQA 3IBPA 5FNVE 1IJ5A 1U4QA 3VU7H 4ZI2D 1OXZA 3RYCE 3ZLIA 4ISSA 3PUQA 2I59A 2BZBA 2UXNB 1SHZC 2H7VC 2XAHB 3HI2A 3RYIE 3IEEA 5TAOA 3HKDE 3JC6C 1AJ3A 1MMAA 3VKGA 4WW0A 3S4UA 5JDGA 2B1EA 5JR9C 3O1JA 3AA6B 3PURA 2V7IA 4DVDA 3NZQA 4ZI7E 3PU3A 5FY0A 5M4YA 2JRKA 2PJQA 5FXWA 4XBFB 2VB6A 3WAJA 2L3LA 2ZM8A 4H9PC 5FYMA 3GWHA 1VRBA 2Q9QD 2E9XC 3O1IA 4QKNA 3ZMUB 3I9YA 3UUNA 4QXBB 4YFSA 4AKIA 3FHNA 4KBMB 1T98A 3BQLA 2XHEB 4YJ2E 5A1LA 4F6RC 5LXTE 4EIWA 5HXRA 4L0RA 4PNIA 2HPJA 3CPZA 4YLHA 4Z8XA 3NBXX 3PTRB 4GK0E 4N78D 5L2LA 3M65A 5J2TE 3FBLA 2Q9QA 4CZZB 2CXLA 2MTQA 3CX7B 2ACXA 2LM9A 3ZJ2A 3N9LA 2Q9QB 3MA9A 5AFUL 1LRZA 1HF8A 3ZMSB 3NRYA 2NTYA 4IE5A 3N2GE 1S35A 3LBXB 4PK5A 1B7TA 5CA1E 3I9WA 4ZS3A 2XASB 2VASA 4CQIA 3CQCB 3O1HA 1NWMX 1HFAA 4K0UA 4BJMA 4CI3B 1D1BA 2NW7A 3L3PA 3MJXA 2WSSV 2K9AA 4J2CA 2IC6A 4OHFA 1YKEB 3J9X1 4NUUA 1O3XA 3F2EA 3KV5A 3N9PA 3UUXB 2Y6XA 3UULA 4DBRA 4CXXA 3OKQA 2CLYC 2X51A 5FY1A 4AKLA 2JQQA 4O4IE 5DQVA 4JUYA 4EYUA 3MXZA 4ISTA 4X20E 3FBZA 2K48A 3AAAB 3B57A 1ZV4X 3EDUA 3FXEB 2DHRA 4P0AA 4QXCB 3E08A 1U5PA 4CI2B 4MALA 3ETUA 5JDQA 3CQGB 3H3AA 4QXHB 3C4XA 3DTOA 3HR0A 4WBOA 3T8OA 2X68A 3N5LA 4WBNE 4AQGA 2N9DA 4YJ3E 5LP6E 3AA7B 2IC9A 2MBGA 3QC9A 3OYZA 1QSDA 3E0ZA 5EK2A 2CA5A 3V5SA 2NW8A 2W61A 5JVDE 3VHLA 1D1CA 2WWUA 1ZHCA 4IDZA 1IJ6A 2YU2A 2V26A 4L5GA 2E9XD 2Q9QC 3N2OA 1US7B 2D0UA 4DNDA 2C5IT 2NWBA 3BK9A 3NRXA 3ZYMA 2X0LB 3C64A 5LBMA 5HXSA 1FMWA 3HKBE 3KBTA 5F3JA 2Y48B 3P7IA 3ZC0A 4IGUA 2N1GA 1MMNA 2DWGA 2M67A 3ZJ1A 3VKHA 5ETWA 5C8YE 3UFEA 4UV8B 3CWZB 2YEVC 5LOVE 2IAKA 5JR9A 4OK0A 2RA1A 2SPCA 2DCFA 3LK42 5JDLA 1V9DA 2LSYA 5E0OA 5LHIB 4HEAA 3I0OA 4HTEA 2V7MA 5LHHB 2LSIA 2CE7A 3ANWA 2J1DG 2WBLA 4H63V 3KDSE 1WYBA 3RPUA 4E7SA 1NAFA 1BR2A 2XAFB 2ZM0A 3NZPA 4AXPA 5KMGP 2A72A 5LA6E 4DMWA 5FXXA 3RKOA 2VKHA 3ESLA 2LSGA 3N9NA 3CX8B 2NW9A 5FP3A 2V1DB 2YINA 3C51A 4GOUA 4ASKA 1MIVA 4AKHA 1EZ3A 2ES0A 4O2BE 4E7ZA 2VL8A 2W63A 4MLKA 3F57A 3EDVA 3BQIA 4MFRA 4A56A 4BAYB 1WYCA 4GYRA 2EHOD 4I4TE 3HKCE 3FXDB 4G63A 4H9NC 5HXHA 1WLXA 2NP9A 2YK0A 5JH7E 2H7OA 3N9OA 2XAJB 3ZCJA 3LJCA 2WMNA 3CX6B 3N2KE 3MK7C 4JEHB 2W00A 4M1PA 2CEAA 2JMHA 5IHYA 3TKLB 4DO0A 1KNZA 4B6XA 5GONE 1QUUA 3L09A 3KFWX 4O2AE 4PFOA 4CI1B 3RC3A 4O4LE 4TZ4C 2A2FX 5HWXA 4UV9B 4V1Av 2PFVA 3OJAA 1LVFA 3AVSA 4EOZB 2E9XB 3CQXC 4UVAB 4C91A 2OA5A 2ZM2A 1MMGA 2ODUA 5HXCA 2UXXB 3IHRA 3ZC1A 3ZPOA 5IYZE 3ONXA 1S94A 1FEWA 4UF0B 2CLYB 3K8PC 4KMCA 5JDHA 4P09A 2N2NA 2V7KA 3H37A 4HKAA 5HWYA 4IHJE 2LOSA 2MOZA 2HH7A 2DWKA 5DQWA 5FY7A 5J1GA 3F31A 4QX7B 5KDMC 3WAKA 3HA4A 3RRCA 4I50E 2LHRA 2CM0A 2KINB 3C4WA 3MZKB 3RH3A 3KV6A 1YKHB 3MACA 5L3BB 4PK6A 5H6RB 2X9HA 4DMVA 2X9WA 4OYJA 3RC8A 3ZYKA 2A3DA 5JQGE 3GN5A 1H7CA 2KNDA 3BQKA 4KP3C 2ODVA 4XAXB 4UVCB 5JDNA 4EYYR 5H6QB 3ZEFB 4TUYE 3ZMVB 2NOXA 3ZYLA 3SWHA 2QGSA 3CKDA 3ZMTB 4ZS2A 2KWIB 2L8KA 1BR4A 1FMVA 4L9IA 4FJOA 2X9YA 1D0YA 3Q5WA 3IF8B 1KK7A 3MKDA 2BDEA 2CXFA 2VKDA 4H9QC 3OYXA 1HCIA 1YW0A 5LCYA 1HG5A 3RX6A 3RYHE 2KWHA 2VWAA 1WRDA 5JR9B 4NUVA 3C50A 3CVRA 2JPFA 4GK5E 4O4JE 3FB2A 5BMVE 2XAGB 5L3GB 3K3NA 4ANJA 1IZNB 4ZI3D 2K5BB 4ZOLE 1D0ZA 3ZN0B 3QK6A 3UT5E 5LYJE 1D0XA 1LKXA 4I55E 1D1AA 5JRCA 4X1IE 5KX5E 4EZ4A 5CA0E 1SA0E 2CXDA 2RP4A 3LK3B 4GIWA 5HXEA 5DABA 2VKOA 1WR6A 3W15B 2DLRA 5EK3A 4UF0A 1MNDA 2DNXA 4O4HE 2G0UA 5LGTB 2P9BA 5L3CB 2X67A 1Y64B 1UX4A 3K3QC 2QA7A 5ADXL 4QWNB 1LVKA 4H63H 5JDFA 4IE0A 1BR0A 4WNKA 4ERRA 3AA0B 3QUJA 3SS1A 3OBVE 3AB3B 4IIJE 4H9OC 2MYSA 5LG4A 1ZKEA 4MHCA 2EHOB 3R6NA 2Z6EA 4KUMB 2CMRA 1OWAA 2V7JA 3PDYA 2E9XA 3C4ZA 3AAEB 4TV9E 4ZI3C 3ETVA 2VK9A 3RYFE 3AAIA 2ZLYA 3Q2MA 2WM9A 3LG7A 4UVBB 4X1KE 3J7Yq 2GK9A 1HTJF 4TN7B 3U78A 1E1HB 2Y8DA 5LBQB 4AKGA 5J2UE 4UXNB 4PJJA 4PW8A 4X1YE 2V7LA 4H9SE 3V5UA 3JC6D 1MMDA 5LJNA 2KLQA 5LNKA 4AQFA 5JRCB 3K3OA 3KV4A 1MNEA 3ZCIA 2XTLA 2LJLA 2KMFA 4U72A 4HFVA 3UUMA 1X79A 4DBQA 1FIOA 3EVYA 3P8CD 4EXTA 3N9QA 4TX5A 4QHOA 1Z0PA 4PJNA 4AQFC 3ANWB 2JMKA 4IE6A 2KZ7B 5EZYE 4EZHA 3KVBA 3DJBA 3AVRA 5FXVA 2W0GA 4C90A 2VKJA 4O8SA 2HPLA 2LHNA 2KT9A 3I0QA 4HN9A 1G73A 1ZEEA 1YD8G 2CWYA 2H3RA 4JLEA 4EAHA 4TV8E 2DI4A 3A5XA 3Q9DA 2LT3A 4H9RC 3R84B 4PJMA 2EHOA 4ZHQE 3DP7A 2WAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0G A;  2K5B B;  1US7 B; 
#chains in the Genus database with same CATH topology
 2CHN A;  3QB5 K;  3O4X E;  4DV5 T;  5FL1 A;  4AI6 A;  2JJ9 A;  2D0T A;  5J0Z A;  2D2S A;  4G2A A;  2NTX A;  5CB4 E;  2QYW A;  1N34 T;  5FMN A;  1UX5 A;  3HKE E;  5BR8 T;  2CWO A;  3TLS A;  5HEG A;  2FUP A;  2K24 A;  2OV9 A;  4KHZ F;  3ZMZ B;  3GA8 A;  1CUN A;  1UCU A;  3UTK A;  5JDM A;  2LE8 A;  1IBL T;  1BR1 A;  4UEM A;  5DJQ C;  5EK4 A;  1XZY A;  4JI5 T;  4CN1 A;  3KV9 A;  2LEH A;  4UIG A;  2X9X A;  3ZN1 B;  4A98 A;  4P1N A;  2E8I A;  5IWA T;  4OFZ A;  4LFC T;  2PTF A;  3OTO T;  3RHW A;  3M3Z B;  3PU8 A;  3EUH A;  5HXS A;  2BG9 A;  4NXN T;  2XQY A;  3UU5 A;  4DV7 T;  2C5K T;  3SFE A;  2BG9 C;  2KXP B;  2W66 A;  5LJM A;  4I43 B;  4AIU A;  1VOM A;  2BVM A;  2WU5 A;  3GMI A;  3LBX A;  2X66 A;  3UQ7 A;  3PUY F;  3D0T A;  4IE7 A;  4FI5 A;  2BVL A;  4HGA A;  4IDN A;  1G8X A;  3SOL A;  4ADZ A;  4UEL A;  5L3E B;  1HNZ T;  4U74 A;  1KF6 A;  2QRX A;  3KBU A;  2A9U A;  4IL9 A;  2C5J A;  2LSK A;  4HWI B;  5F8P A;  4CXW A;  1KNR A;  3I1A A;  5HAX A;  4TWH A;  3WI3 A;  4CXY A;  4EGW A;  2LKH A;  3RLF F;  2IIU A;  3LK2 B;  4ILU A;  4IL4 A;  4HWF A;  3KVA A;  4IE4 A;  4BJN A;  1MIW A;  3Q5X A;  1MIY A;  4PFP A;  2C0S A;  4DR1 T;  4OYK A;  2LOP A;  2PBI A;  1HS7 A;  4JEU B;  3HL6 A;  4YHJ A;  3TLT A;  3T1H T;  3AE3 A;  2YKS A;  3C98 B;  4JI1 T;  1HX8 A;  2LSJ A;  4JI4 T;  2L9Q A;  4IT4 A;  3SRZ A;  4HE8 A;  2IW5 B;  3AA1 B;  3RRW A;  4EB6 E;  5L3F B;  5JRE A;  3PE0 A;  3O9X A;  2YU1 A;  4PJL A;  3AEA A;  2ZMA A;  3KIN B;  3PUA A;  4AKL A;  4LF6 T;  1Y01 A;  2D5U A;  1QLB A;  2R6G F;  3E22 E;  4LML A;  4GYS A;  1W0A A;  3GN5 B;  5LHG B;  4QX8 B;  4YT0 A;  4PAG A;  3PUG A;  4AKR B;  4YSY A;  4P0B A;  2B76 A;  1IAP A;  2XQA A;  1XWM A;  1HG2 A;  2EHO C;  3EAM A;  3L8R A;  4PK4 A;  5C2T A;  2XAQ B;  1KEY A;  3U3I A;  1ZP0 A;  1VCT A;  3OPC A;  4XZC A;  5HYA A;  5LGU B;  2WMO A;  3N9M A;  2YDS A;  3CML A;  5FXZ A;  2W62 A;  2PG8 A;  3B13 A;  4BA9 A;  4DR7 T;  4JYA T;  4ZI2 C;  3LFM A;  4MBQ A;  3PUS A;  2XUE A;  5L3D B;  5LGN B;  3NWI A;  1WCR A;  2CCQ A;  3IBP A;  4IDQ A;  5FNV E;  3JCF A;  1IJ5 A;  1U4Q A;  2LRL A;  2WWV A;  3VU7 H;  4ZI2 D;  1OXZ A;  2BS3 A;  3RYC E;  2MPK A;  3ZLI A;  1HX1 B;  4ISS A;  2V6X A;  3AE8 A;  2I59 A;  3PUQ A;  2UXN B;  2BZB A;  1SHZ C;  2H7V C;  2WS3 A;  2XAH B;  3HI2 A;  3RYI E;  1XNQ T;  3IEE A;  5TAO A;  3HKD E;  3JC6 C;  1AJ3 A;  1KFY A;  2WP9 A;  1MMA A;  3X1D A;  2VVS A;  3VKG A;  4WW0 A;  3S4U A;  3CK6 A;  5JDG A;  2B1E A;  3PUX F;  1T72 A;  5JR9 C;  3O1J A;  2J4G A;  3AA6 B;  1T8B A;  2WDR A;  3ZT6 A;  2UUC T;  2W4X A;  3PUR A;  2V7I A;  4DVD A;  3NZQ A;  5AQP B;  2XM2 A;  4YHH T;  4ZI7 E;  3UU6 A;  3PU3 A;  5FY0 A;  2X0Y A;  2JRK A;  2PJQ A;  5FXW A;  5HXH A;  5M4Y A;  4JI0 T;  4XBF B;  1HNX T;  4DV6 T;  2VB6 A;  3WAJ A;  2L3L A;  2ZM8 A;  4H9P C;  5FYM A;  2XQ5 A;  1VRB A;  2E9X C;  2Q9Q D;  3GWH A;  3O1I A;  4QKN A;  5HEH A;  3I9Y A;  3ZMU B;  1N36 T;  3UUN A;  2XSB A;  4YTP A;  4QXB B;  4YFS A;  4AKI A;  3FHN A;  4KBM B;  2QVA A;  1T98 A;  2WU2 A;  4COF A;  3BQL A;  2XHE B;  1IBK T;  4YJ2 E;  5A1L A;  4F6R C;  3AE4 A;  5LXT E;  1NEN A;  4HWC A;  4EIW A;  5HXR A;  4L0R A;  4PNI A;  2HPJ A;  5FKY A;  3CPZ A;  4YLH A;  4Z8X A;  4DID B;  3NBX X;  3PTR B;  4GK0 E;  4N78 D;  5L2L A;  3M65 A;  5J2T E;  3FBL A;  3PJA A;  2Q9Q A;  3RQW A;  2CXL A;  2MTQ A;  3CX7 B;  1WR0 A;  3NVO A;  4CZZ B;  2ACX A;  1OED C;  2CPT A;  2LM9 A;  2WDQ A;  3ZJ2 A;  3N9L A;  2Q9Q B;  3MA9 A;  5AFU L;  1LRZ A;  1HF8 A;  2W67 A;  3ZMS B;  2IHR 1;  3NRY A;  4A97 A;  3T1Y T;  2VUR A;  2NTY A;  4IE5 A;  3N2G E;  1S35 A;  3LBX B;  1M62 A;  1B7T A;  4PK5 A;  4JBW F;  4YXD A;  5CA1 E;  3I9W A;  4ZS3 A;  2XAS B;  2VAS A;  5HEU A;  2WZH A;  4CQI A;  2OLT A;  1YQ4 A;  3CQC B;  4CN6 A;  3O1H A;  1NWM X;  4U7I A;  4LFB T;  4Z91 A;  4TWF A;  1HFA A;  4K0U A;  2NR4 A;  2J47 A;  3RIU C;  4BJM A;  4CI3 B;  2UXC T;  1D1B A;  2NW7 A;  3L3P A;  3MJX A;  2WSS V;  4HFI A;  2K9A A;  4J2C A;  2IC6 A;  4OHF A;  1YKE B;  3J9X 1;  4NUU A;  2J62 A;  1O3X A;  3F2E A;  1XDO A;  3KV5 A;  3N9P A;  2Y6X A;  3UUX B;  3UUL A;  4DBR A;  4LF9 T;  4CXX A;  3OKQ A;  2CLY C;  4LMJ A;  2X51 A;  3JAF A;  5F5W A;  1SUM B;  2JQQ A;  4O4I E;  4JUY A;  3PUW F;  5DQV A;  5FY1 A;  3VR9 A;  3MXZ A;  4IST A;  1SE7 A;  4X20 E;  3FBZ A;  2K48 A;  4EYU A;  3AAA B;  2BG9 E;  3B57 A;  1ZV4 X;  3EDU A;  3FXE B;  2DHR A;  4QH5 A;  3RIU A;  4P0A A;  3OVU A;  4QXC B;  3E08 A;  3LDQ B;  1U5P A;  4CI2 B;  4MAL A;  4EV6 A;  3ETU A;  3ZT5 A;  5JDQ A;  3CQG B;  3H3A A;  3SFD A;  4QXH B;  3P4Q A;  3C4X A;  3DTO A;  4K0K T;  3HR0 A;  4ILA A;  4WBO A;  5AQM B;  3T8O A;  5L3B B;  1IBM T;  2X68 A;  3N5L A;  4WBN E;  1XMQ T;  3P4W A;  3EHZ A;  4U7Y A;  4AQG A;  1HR0 T;  2N9D A;  4YJ3 E;  5LP6 E;  4JV5 T;  3AA7 B;  2IC9 A;  2MBG A;  3QC9 A;  3OYZ A;  2BS4 A;  2LRK A;  1I94 T;  1J1J A;  1QSD A;  3E0Z A;  5EK2 A;  3PJA J;  2K3W A;  4IDO A;  5AQV B;  2CA5 A;  5LB7 B;  2NW8 A;  3V5S A;  1T7S A;  2W61 A;  5JVD E;  3VHL A;  4OX9 T;  1D1C A;  2IUB A;  3Q5E A;  2VVN A;  2WWU A;  5JTG A;  1ZHC A;  3AEE A;  4IDZ A;  1IJ6 A;  2FJB A;  2YU2 A;  3H3M A;  3P50 A;  4WYV A;  3FZM B;  3RGL A;  3ONL C;  1N32 T;  3TLW A;  2V26 A;  4X66 T;  4L5G A;  4X65 T;  2Q9Q C;  2E9X D;  2HN2 A;  1US7 B;  2XQ6 A;  3N2O A;  3QNU A;  2D0U A;  4YTN A;  2XJ7 A;  2UXD T;  2X0H A;  4DND A;  2XQ3 A;  2C5I T;  5AQJ B;  2NWB A;  2CHO A;  2YDR A;  3Q5D A;  3BK9 A;  3NRX A;  5AQR B;  2X0L B;  1WFD A;  2WZI A;  3C64 A;  5LBM A;  1M7K A;  3VRA A;  3ZYM A;  1FMW A;  3AED A;  3HKB E;  3KBT A;  2Y48 B;  3P7I A;  5F3J A;  2V6Y A;  4IGU A;  3ZC0 A;  1XDP A;  2N1G A;  2M67 A;  1MMN A;  2DWG A;  3AEG A;  3ZJ1 A;  3VKH A;  3ZST A;  2F4V T;  5ETW A;  4A5X A;  1JNR A;  3UFE A;  5C8Y E;  4UV8 B;  5KXJ A;  3ZT7 A;  4U3C A;  3CWZ B;  3ZSS A;  2YEV C;  2WY2 A;  5LOV E;  2V5C A;  1I6Z A;  2IAK A;  5JR9 A;  2XQ7 A;  4OK0 A;  2RA1 A;  2SPC A;  2DCF A;  3LK4 2;  3G06 A;  1V9D A;  2LSY A;  3QB5 A;  5E0O A;  5JDL A;  5LHI B;  4HEA A;  3I0O A;  4HTE A;  3RQU A;  4I0U A;  2V7M A;  5LHH B;  2LSI A;  1ZOY A;  5ABE A;  2ZM6 T;  2CE7 A;  3ANW A;  5CJ5 A;  2J1D G;  2WBL A;  5AQU B;  4H63 V;  3KDS E;  5AQQ B;  3VRB A;  1WYB A;  4X62 T;  1XNR T;  3RPU A;  4E7S A;  1NAF A;  1BR2 A;  2XAF B;  2ZM0 A;  3NZP A;  4AXP A;  3LSV A;  5KMG P;  4B3S T;  2A72 A;  5LA6 E;  2LM2 A;  4DMW A;  1FJG T;  2YDQ A;  5FXX A;  3RKO A;  2VKH A;  3ESL A;  2LSG A;  1J5E T;  3N9N A;  1YXR A;  3CX8 B;  2NW9 A;  2CBI A;  5FP3 A;  2V1D B;  2YIN A;  3C51 A;  1YQ3 A;  4GOU A;  1MIV A;  4ASK A;  4DV1 T;  1EZ3 A;  2ES0 A;  4O2B E;  4E7Z A;  2VL8 A;  5FL0 A;  4YSZ A;  4AKH A;  2W63 A;  4U31 A;  4MLK A;  3F57 A;  3EDV A;  3BQI A;  3P4P A;  3AEB A;  2XQ4 A;  1WYC A;  3FZH B;  4MFR A;  4GYR A;  5AQL B;  2EHO D;  4I4T E;  4CN4 A;  4EEB A;  3HKC E;  4DV3 T;  3FXD B;  4G63 A;  3EAB A;  4H9N C;  4ILC A;  1WLX A;  4U33 A;  2NP9 A;  2BBH A;  2YK0 A;  5ABG A;  5JH7 E;  2H7O A;  3N9O A;  2XAJ B;  2RPA A;  3ZCJ A;  3LJC A;  2WMN A;  3CX6 B;  3N2K E;  3MK7 C;  3PV0 F;  5AQO B;  3RI5 A;  4JEH B;  4AIS A;  4ZZB A;  2W00 A;  4M1P A;  4TWD A;  5LMN T;  2CEA A;  2JMH A;  5IHY A;  3TKL B;  2XQ8 A;  4DO0 A;  4YSX A;  1KNZ A;  4B6X A;  5GON E;  4DV2 T;  1QUU A;  2XSA A;  3L09 A;  4B3R T;  3KFW X;  4O2A E;  4PFO A;  4CI1 B;  3RC3 A;  4O4L E;  4TZ4 C;  4IDP A;  2IML A;  5C3J A;  2A2F X;  3CIR A;  5HWX A;  3AEC A;  2VQF T;  4UV9 B;  4V1A v;  2PFV A;  3OJA A;  1LVF A;  2V5D A;  2D9D A;  3AVS A;  4EOZ B;  1E7P A;  2E9X B;  3CQX C;  2YOE A;  4UVA B;  4C91 A;  4B3T T;  5IUX A;  2OA5 A;  5CFB A;  2VL0 A;  3TLV A;  4GKJ T;  2ZM2 A;  5AQI B;  1MMG A;  2ODU A;  2E5V A;  5HCJ A;  5HXC A;  2UXX B;  3IHR A;  3ZC1 A;  5AQG B;  5IYZ E;  3ZPO A;  4JI8 T;  3ONX A;  3TLU A;  4LF4 T;  1S94 A;  1FEW A;  4Q25 A;  4UF0 B;  4X5T A;  2E2A A;  2UU9 T;  2CLY B;  3K8P C;  4KMC A;  5JDH A;  3NKZ A;  4DV4 T;  4P09 A;  2N2N A;  2V7K A;  3H37 A;  3FZL B;  1CHU A;  5ABF B;  4DR2 T;  4ILB A;  1R8I A;  4HKA A;  5HWY A;  4IHJ E;  2LOS A;  2MOZ A;  2IDO B;  5ABF A;  2HH7 A;  2DWK A;  5DQW A;  5FY7 A;  5J1G A;  4DR4 T;  4GKK T;  5L4E A;  2YN6 A;  2XM1 A;  3F31 A;  4QX7 B;  3VR8 A;  2V8S V;  5KDM C;  4HFH A;  4QH1 A;  3WAK A;  2DL1 A;  3HA4 A;  3RRC A;  4DUY T;  2XY8 B;  4I50 E;  2LHR A;  2CM0 A;  2CBJ A;  2KIN B;  5HCM A;  3C4W A;  3MZK B;  4HFE A;  3KV6 A;  1YKH B;  3K1S A;  3MAC A;  3RH3 A;  4ZEY A;  4LMK A;  4PK6 A;  5H6R B;  5CGM A;  2X9H A;  2FJA A;  4NPP A;  4LF8 T;  3UU4 A;  2X9W A;  4DMV A;  4OYJ A;  3IA3 A;  4HWH A;  3RC8 A;  2XZE A;  2A3D A;  2KSR A;  3AE7 A;  5AQH B;  3ZYK A;  5JQG E;  4DUZ T;  3GN5 A;  4DR5 T;  1H7C A;  2KND A;  3BQK A;  4KP3 C;  2ODV A;  4XAX B;  4UVC B;  5JDN A;  5AQK B;  4EED A;  5H6Q B;  4EYY R;  3ZEF B;  5LMU T;  4TUY E;  3ZMV B;  2NOX A;  3ZYL A;  3SWH A;  2QGS A;  3CKD A;  5AQS B;  3ZMT B;  4ZS2 A;  4JI6 T;  2KWI B;  2L8K A;  2BKO A;  2WB5 A;  3RIA A;  3UU8 A;  1Z8U A;  1BR4 A;  1FMV A;  2MAW A;  4FJO A;  4L9I A;  5AQF B;  5LG3 A;  2X9Y A;  4AQY T;  4JI3 T;  1D0Y A;  3Q5W A;  3IF8 B;  1KK7 A;  3MKD A;  2BDE A;  2CXF A;  2VKD A;  4H9Q C;  3OYX A;  1HCI A;  1YW0 A;  4JI2 T;  1E2A A;  3RIF A;  5LCY A;  1HG5 A;  3RX6 A;  2JQK A;  3RYH E;  2JQH A;  2KWH A;  1WRD A;  2VWA A;  4NUV A;  5JR9 B;  3C50 A;  3CVR A;  1OED B;  2JPF A;  4GK5 E;  4O4J E;  5FVL A;  3UFG A;  4B3M T;  4BAY B;  2WDV A;  3FB2 A;  5BMV E;  2XAG B;  1DU2 A;  1UUS A;  2AE9 A;  5L3G B;  3K3N A;  4ANJ A;  1IZN B;  4WZX A;  2WCA A;  2K5B B;  4Z90 A;  4ZI3 D;  4DR3 T;  2ACZ A;  4ZOL E;  4YY3 T;  1D0Z A;  3ZN0 B;  3PUZ F;  5FVK A;  4HWD A;  3QK6 A;  2V6Y B;  5HEO A;  3UT5 E;  5LYJ E;  2CRB A;  1D0X A;  1LKX A;  3L39 A;  4I55 E;  2JIW A;  1D1A A;  4NIQ A;  4U2Y A;  5JRC A;  4X1I E;  5KX5 E;  4EZ4 A;  3AE9 A;  5CA0 E;  1UUR A;  1SA0 E;  2CXD A;  1W0B A;  2RP4 A;  3JAE A;  3LK3 B;  4GIW A;  5HXE A;  4NXM T;  5DAB A;  2BKP A;  2VKO A;  1WR6 A;  3AE6 A;  2DLR A;  5EK3 A;  3W15 B;  3ONJ A;  4UF0 A;  1MND A;  2DNX A;  4ZZC A;  3QOF A;  1X9B A;  4O4H E;  3RKG A;  4DR6 T;  4KHP T;  2G0U A;  3UUB A;  5LGT B;  1OED A;  2P9B A;  5L4H A;  2E5L T;  3AXJ B;  5L3C B;  2X67 A;  1Y64 B;  1UX4 A;  3K3Q C;  2QA7 A;  5ADX L;  4QWN B;  1LVK A;  1NEK A;  1KNP A;  3EI0 A;  3PUV F;  4H63 H;  5JDF A;  5HEJ A;  2JQ9 A;  4IE0 A;  4WNK A;  4ERR A;  1BR0 A;  3AA0 B;  1L0V A;  3QUJ A;  2HHH T;  3SS1 A;  3JAD A;  3OBV E;  4UR9 A;  4A56 A;  3AB3 B;  4IIJ E;  2BBJ A;  5AQT B;  4H9O C;  2MYS A;  5LG4 A;  1ZKE A;  3P4R A;  2H88 A;  4MHC A;  2EHO B;  2I0M A;  3R6N A;  4LFA T;  2M6I A;  2Z6E A;  3AEF A;  1UK5 A;  2CMR A;  1OWA A;  2V7J A;  3PDY A;  4HFD A;  4HFC A;  1VCS A;  4JI7 T;  2E9X A;  3C4Z A;  3AAE B;  4TV9 E;  4ZI3 C;  4LF7 T;  3ETV A;  2VK9 A;  3RYF E;  3AAI A;  2ZLY A;  3AE1 A;  2WM9 A;  3LG7 A;  3Q2M A;  4UVB B;  4X1K E;  3J7Y q;  2UUB T;  2GK9 A;  1HTJ F;  4LF5 T;  4TN7 B;  3U78 A;  1E1H B;  3R84 B;  2Y8D A;  5LBQ B;  4AKG A;  5J2U E;  2W2U A;  4UXN B;  1J5W A;  4PJJ A;  4PW8 A;  3AXJ A;  4X1Y E;  4F8H A;  2V7L A;  4KUM B;  4HFB A;  4H9S E;  1UGO A;  3A8Y C;  3AE5 A;  3V5U A;  1OED E;  3JC6 D;  2VQE T;  1MMD A;  2BS2 A;  5LJN A;  3AE2 A;  1HNW T;  2BG9 B;  2KLQ A;  5LNK A;  3RF1 A;  2BKN A;  3UU3 A;  2WQY A;  4AQF A;  5JRC B;  2UXB T;  3K3O A;  3KV4 A;  1MNE A;  4TNW A;  3A7M A;  3ABV A;  3ZCI A;  2XTL A;  2FJE A;  4ZXL A;  2LJL A;  2KMF A;  3FZF B;  4HFV A;  4U72 A;  1JNZ A;  4YTM A;  4KI0 F;  3UUM A;  1X79 A;  4KX6 A;  1FIO A;  3EVY A;  3P8C D;  4DBQ A;  4EXT A;  3N9Q A;  4TX5 A;  4DV0 T;  4QHO A;  1Z0P A;  4PJN A;  1XMO T;  2LLY A;  2LKG A;  4AQF C;  3ANW B;  5L47 A;  1GQE A;  2I6H A;  2JMK A;  4IE6 A;  2KZ7 B;  3ZKR A;  2FJD A;  5EZY E;  4EZH A;  3KVB A;  2H89 A;  3DJB A;  3AVR A;  2XPK A;  2W0G A;  5FXV A;  1W09 A;  5AQN B;  4C90 A;  3P4S A;  1W9R A;  2VKJ A;  4O8S A;  2UUA T;  2AXD S;  2HPL A;  3UQ4 A;  2LHN A;  2KT9 A;  3I0Q A;  3FZK B;  1G73 A;  3B5M A;  4HN9 A;  1ZEE A;  1YD8 G;  4U2Z A;  2CWY A;  2H3R A;  4JLE A;  4EAH A;  4TV8 E;  2DI4 A;  3A5X A;  2FBW A;  2LT3 A;  2M6B A;  3Q9D A;  4H9R C;  4QH4 A;  2HN1 A;  4TNV A;  4PJM A;  5ABH A;  4X64 T;  1N33 T;  2XQ9 A;  2EHO A;  4ZHQ E;  3DP7 A;  4IRE A;  2WAU A; 
#chains in the Genus database with same CATH homology
 3O4X E;  4AI6 A;  2JJ9 A;  2D0T A;  2D2S A;  4G2A A;  2NTX A;  5CB4 E;  5FMN A;  1UX5 A;  3HKE E;  2CWO A;  2K24 A;  3ZMZ B;  5JDM A;  3GA8 A;  1CUN A;  1UCU A;  3UTK A;  2LE8 A;  1BR1 A;  4UEM A;  5DJQ C;  5EK4 A;  3KV9 A;  2LEH A;  4UIG A;  2X9X A;  3ZN1 B;  2E8I A;  4OFZ A;  3PU8 A;  3EUH A;  2XQY A;  2C5K T;  5LJM A;  2KXP B;  4I43 B;  1VOM A;  2BVM A;  3GMI A;  3LBX A;  2X66 A;  3D0T A;  4IE7 A;  4FI5 A;  2BVL A;  4HGA A;  4ADZ A;  1G8X A;  3SOL A;  4UEL A;  5L3E B;  4U74 A;  3KBU A;  2C5J A;  2LSK A;  5F8P A;  4CXW A;  3I1A A;  5HAX A;  4CXY A;  3WI3 A;  4ILU A;  3LK2 B;  3KVA A;  4IE4 A;  4BJN A;  1MIW A;  3Q5X A;  1MIY A;  4PFP A;  2C0S A;  4OYK A;  2LOP A;  2PBI A;  1HS7 A;  4JEU B;  3HL6 A;  4YHJ A;  3C98 B;  1HX8 A;  2LSJ A;  2L9Q A;  3SRZ A;  4HE8 A;  2IW5 B;  3AA1 B;  3RRW A;  4EB6 E;  5L3F B;  5JRE A;  3PE0 A;  3O9X A;  2YU1 A;  4PJL A;  2ZMA A;  3KIN B;  3PUA A;  2D5U A;  3E22 E;  4GYS A;  3GN5 B;  5LHG B;  4QX8 B;  4PAG A;  3PUG A;  4AKR B;  4P0B A;  1IAP A;  1HG2 A;  2EHO C;  4PK4 A;  2XAQ B;  3U3I A;  4XZC A;  5HYA A;  5LGU B;  2WMO A;  3N9M A;  3CML A;  5FXZ A;  2W62 A;  2PG8 A;  3B13 A;  4BA9 A;  4ZI2 C;  3LFM A;  4MBQ A;  3PUS A;  2XUE A;  5L3D B;  5LGN B;  2CCQ A;  3IBP A;  5FNV E;  1IJ5 A;  1U4Q A;  3VU7 H;  4ZI2 D;  1OXZ A;  3RYC E;  3ZLI A;  4ISS A;  3PUQ A;  2I59 A;  2BZB A;  2UXN B;  1SHZ C;  2H7V C;  2XAH B;  3HI2 A;  3RYI E;  3IEE A;  5TAO A;  3HKD E;  3JC6 C;  1AJ3 A;  1MMA A;  3VKG A;  4WW0 A;  3S4U A;  5JDG A;  2B1E A;  5JR9 C;  3O1J A;  3AA6 B;  3PUR A;  2V7I A;  4DVD A;  3NZQ A;  4ZI7 E;  3PU3 A;  5FY0 A;  5M4Y A;  2JRK A;  2PJQ A;  5FXW A;  4XBF B;  2VB6 A;  3WAJ A;  2L3L A;  2ZM8 A;  4H9P C;  5FYM A;  3GWH A;  1VRB A;  2Q9Q D;  2E9X C;  3O1I A;  4QKN A;  3ZMU B;  3I9Y A;  3UUN A;  4QXB B;  4YFS A;  4AKI A;  3FHN A;  4KBM B;  1T98 A;  3BQL A;  2XHE B;  4YJ2 E;  5A1L A;  4F6R C;  5LXT E;  4EIW A;  5HXR A;  4L0R A;  4PNI A;  2HPJ A;  3CPZ A;  4YLH A;  4Z8X A;  3NBX X;  3PTR B;  4GK0 E;  4N78 D;  5L2L A;  3M65 A;  5J2T E;  3FBL A;  2Q9Q A;  4CZZ B;  2CXL A;  2MTQ A;  3CX7 B;  2ACX A;  2LM9 A;  3ZJ2 A;  3N9L A;  2Q9Q B;  3MA9 A;  5AFU L;  1LRZ A;  1HF8 A;  3ZMS B;  3NRY A;  2NTY A;  4IE5 A;  3N2G E;  1S35 A;  3LBX B;  4PK5 A;  1B7T A;  5CA1 E;  3I9W A;  4ZS3 A;  2XAS B;  2VAS A;  4CQI A;  3CQC B;  3O1H A;  1NWM X;  1HFA A;  4K0U A;  4BJM A;  4CI3 B;  1D1B A;  2NW7 A;  3L3P A;  3MJX A;  2WSS V;  2K9A A;  4J2C A;  2IC6 A;  4OHF A;  1YKE B;  3J9X 1;  4NUU A;  1O3X A;  3F2E A;  3KV5 A;  3N9P A;  3UUX B;  2Y6X A;  3UUL A;  4DBR A;  4CXX A;  3OKQ A;  2CLY C;  2X51 A;  5FY1 A;  4AKL A;  2JQQ A;  4O4I E;  5DQV A;  4JUY A;  4EYU A;  3MXZ A;  4IST A;  4X20 E;  3FBZ A;  2K48 A;  3AAA B;  3B57 A;  1ZV4 X;  3EDU A;  3FXE B;  2DHR A;  4P0A A;  4QXC B;  3E08 A;  1U5P A;  4CI2 B;  4MAL A;  3ETU A;  5JDQ A;  3CQG B;  3H3A A;  4QXH B;  3C4X A;  3DTO A;  3HR0 A;  4WBO A;  3T8O A;  2X68 A;  3N5L A;  4WBN E;  4AQG A;  2N9D A;  4YJ3 E;  5LP6 E;  3AA7 B;  2IC9 A;  2MBG A;  3QC9 A;  3OYZ A;  1QSD A;  3E0Z A;  5EK2 A;  2CA5 A;  3V5S A;  2NW8 A;  2W61 A;  5JVD E;  3VHL A;  1D1C A;  2WWU A;  1ZHC A;  4IDZ A;  1IJ6 A;  2YU2 A;  2V26 A;  4L5G A;  2E9X D;  2Q9Q C;  3N2O A;  1US7 B;  2D0U A;  4DND A;  2C5I T;  2NWB A;  3BK9 A;  3NRX A;  3ZYM A;  2X0L B;  3C64 A;  5LBM A;  5HXS A;  1FMW A;  3HKB E;  3KBT A;  5F3J A;  2Y48 B;  3P7I A;  3ZC0 A;  4IGU A;  2N1G A;  1MMN A;  2DWG A;  2M67 A;  3ZJ1 A;  3VKH A;  5ETW A;  5C8Y E;  3UFE A;  4UV8 B;  3CWZ B;  2YEV C;  5LOV E;  2IAK A;  5JR9 A;  4OK0 A;  2RA1 A;  2SPC A;  2DCF A;  3LK4 2;  5JDL A;  1V9D A;  2LSY A;  5E0O A;  5LHI B;  4HEA A;  3I0O A;  4HTE A;  2V7M A;  5LHH B;  2LSI A;  2CE7 A;  3ANW A;  2J1D G;  2WBL A;  4H63 V;  3KDS E;  1WYB A;  3RPU A;  4E7S A;  1NAF A;  1BR2 A;  2XAF B;  2ZM0 A;  3NZP A;  4AXP A;  5KMG P;  2A72 A;  5LA6 E;  4DMW A;  5FXX A;  3RKO A;  2VKH A;  3ESL A;  2LSG A;  3N9N A;  3CX8 B;  2NW9 A;  5FP3 A;  2V1D B;  2YIN A;  3C51 A;  4GOU A;  4ASK A;  1MIV A;  4AKH A;  1EZ3 A;  2ES0 A;  4O2B E;  4E7Z A;  2VL8 A;  2W63 A;  4MLK A;  3F57 A;  3EDV A;  3BQI A;  4MFR A;  4A56 A;  4BAY B;  1WYC A;  4GYR A;  2EHO D;  4I4T E;  3HKC E;  3FXD B;  4G63 A;  4H9N C;  5HXH A;  1WLX A;  2NP9 A;  2YK0 A;  5JH7 E;  2H7O A;  3N9O A;  2XAJ B;  3ZCJ A;  3LJC A;  2WMN A;  3CX6 B;  3N2K E;  3MK7 C;  4JEH B;  2W00 A;  4M1P A;  2CEA A;  2JMH A;  5IHY A;  3TKL B;  4DO0 A;  1KNZ A;  4B6X A;  5GON E;  1QUU A;  3L09 A;  3KFW X;  4O2A E;  4PFO A;  4CI1 B;  3RC3 A;  4O4L E;  4TZ4 C;  2A2F X;  5HWX A;  4UV9 B;  4V1A v;  2PFV A;  3OJA A;  1LVF A;  3AVS A;  4EOZ B;  2E9X B;  3CQX C;  4UVA B;  4C91 A;  2OA5 A;  2ZM2 A;  1MMG A;  2ODU A;  5HXC A;  2UXX B;  3IHR A;  3ZC1 A;  3ZPO A;  5IYZ E;  3ONX A;  1S94 A;  1FEW A;  4UF0 B;  2CLY B;  3K8P C;  4KMC A;  5JDH A;  4P09 A;  2N2N A;  2V7K A;  3H37 A;  4HKA A;  5HWY A;  4IHJ E;  2LOS A;  2MOZ A;  2HH7 A;  2DWK A;  5DQW A;  5FY7 A;  5J1G A;  3F31 A;  4QX7 B;  5KDM C;  3WAK A;  3HA4 A;  3RRC A;  4I50 E;  2LHR A;  2CM0 A;  2KIN B;  3C4W A;  3MZK B;  3RH3 A;  3KV6 A;  1YKH B;  3MAC A;  5L3B B;  4PK6 A;  5H6R B;  2X9H A;  4DMV A;  2X9W A;  4OYJ A;  3RC8 A;  3ZYK A;  2A3D A;  5JQG E;  3GN5 A;  1H7C A;  2KND A;  3BQK A;  4KP3 C;  2ODV A;  4XAX B;  4UVC B;  5JDN A;  4EYY R;  5H6Q B;  3ZEF B;  4TUY E;  3ZMV B;  2NOX A;  3ZYL A;  3SWH A;  2QGS A;  3CKD A;  3ZMT B;  4ZS2 A;  2KWI B;  2L8K A;  1BR4 A;  1FMV A;  4L9I A;  4FJO A;  2X9Y A;  1D0Y A;  3Q5W A;  3IF8 B;  1KK7 A;  3MKD A;  2BDE A;  2CXF A;  2VKD A;  4H9Q C;  3OYX A;  1HCI A;  1YW0 A;  5LCY A;  1HG5 A;  3RX6 A;  3RYH E;  2KWH A;  2VWA A;  1WRD A;  5JR9 B;  4NUV A;  3C50 A;  3CVR A;  2JPF A;  4GK5 E;  4O4J E;  3FB2 A;  5BMV E;  2XAG B;  5L3G B;  3K3N A;  4ANJ A;  1IZN B;  4ZI3 D;  2K5B B;  4ZOL E;  1D0Z A;  3ZN0 B;  3QK6 A;  3UT5 E;  5LYJ E;  1D0X A;  1LKX A;  4I55 E;  1D1A A;  5JRC A;  4X1I E;  5KX5 E;  4EZ4 A;  5CA0 E;  1SA0 E;  2CXD A;  2RP4 A;  3LK3 B;  4GIW A;  5HXE A;  5DAB A;  2VKO A;  1WR6 A;  3W15 B;  2DLR A;  5EK3 A;  4UF0 A;  1MND A;  2DNX A;  4O4H E;  2G0U A;  5LGT B;  2P9B A;  5L3C B;  2X67 A;  1Y64 B;  1UX4 A;  3K3Q C;  2QA7 A;  5ADX L;  4QWN B;  1LVK A;  4H63 H;  5JDF A;  4IE0 A;  1BR0 A;  4WNK A;  4ERR A;  3AA0 B;  3QUJ A;  3SS1 A;  3OBV E;  3AB3 B;  4IIJ E;  4H9O C;  2MYS A;  5LG4 A;  1ZKE A;  4MHC A;  2EHO B;  3R6N A;  2Z6E A;  4KUM B;  2CMR A;  1OWA A;  2V7J A;  3PDY A;  2E9X A;  3C4Z A;  3AAE B;  4TV9 E;  4ZI3 C;  3ETV A;  2VK9 A;  3RYF E;  3AAI A;  2ZLY A;  3Q2M A;  2WM9 A;  3LG7 A;  4UVB B;  4X1K E;  3J7Y q;  2GK9 A;  1HTJ F;  4TN7 B;  3U78 A;  1E1H B;  2Y8D A;  5LBQ B;  4AKG A;  5J2U E;  4UXN B;  4PJJ A;  4PW8 A;  4X1Y E;  2V7L A;  4H9S E;  3V5U A;  3JC6 D;  1MMD A;  5LJN A;  2KLQ A;  5LNK A;  4AQF A;  5JRC B;  3K3O A;  3KV4 A;  1MNE A;  3ZCI A;  2XTL A;  2LJL A;  2KMF A;  4U72 A;  4HFV A;  3UUM A;  1X79 A;  4DBQ A;  1FIO A;  3EVY A;  3P8C D;  4EXT A;  3N9Q A;  4TX5 A;  4QHO A;  1Z0P A;  4PJN A;  4AQF C;  3ANW B;  2JMK A;  4IE6 A;  2KZ7 B;  5EZY E;  4EZH A;  3KVB A;  3DJB A;  3AVR A;  5FXV A;  2W0G A;  4C90 A;  2VKJ A;  4O8S A;  2HPL A;  2LHN A;  2KT9 A;  3I0Q A;  4HN9 A;  1G73 A;  1ZEE A;  1YD8 G;  2CWY A;  2H3R A;  4JLE A;  4EAH A;  4TV8 E;  2DI4 A;  3A5X A;  3Q9D A;  2LT3 A;  4H9R C;  3R84 B;  4PJM A;  2EHO A;  4ZHQ E;  3DP7 A;  2WAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...