2K5NA

Solution nmr structure of the n-terminal domain of protein eca1580 from erwinia carotovora, northeast structural genomics consortium target ewr156a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cold-shock protein
publication title NMR Structure of the Putative Cold Shock Protein from Erwinia carotovora: Northeast Structural Genomics Consortium Target EwR156a
rcsb
source organism Pectobacterium atrosepticum
molecule tags Structural genomics, unknown function
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5nA00
3OTOL 1G291 4KHZA 3GTQH 2GVAA 3SGIA 1E1OA 1GKHA 2YTXA 1B8AA 3HFZB 1LM0A 4UP7A 1PH9A 2HHHQ 1VQHA 1L1OB 1KAWA 4X6AH 2UXBQ 1JT8A 5BR8L 4K0KQ 2CWPA 4JI4Q 1E1TA 1VQDA 5IWAL 5IYCG 4LFCQ 2Y0SG 1N9WA 5C0XI 3G71A 5IYBH 2Q2UA 4A3LG 4GKJQ 1S40A 1C7YA 4JC0A 5C3EG 5EAYA 4GOPB 3W1GA 3HKSA 4GN5A 4A3BG 3BZKA 1R9TH 1MIUA 4LFBL 4X62Q 3K8AA 3RLOA 4Y52H 4LF6Q 2JA8H 4GNXB 4LUZA 2VY3A 4HIOA 1VQ4A 4B3ML 1Q12A 4L5RC 3BJUA 3CMAA 3CAMA 4JI3L 1PFSA 1HNZL 3HKZG 3CCVA 4OWWB 4JI1L 4IPCA 4YCVA 1E22A 4PZ8A 1ASZA 4NPSA 3J81c 1JJGA 3EIVA 5JJIA 2K5NA 3CP0A 4DR5Q 3GTJH 3TS0A 1NE3A 3G48A 4KHPL 3M9BA 5IP9H 4LF7L 1U0LA 1ASYA 3J80c 4A3CH 3HOWG 5JJLA 2K4KA 4QJFA 1IBKL 3S14H 5AJ3L 4A3IG 5M3MG 3AQQA 2JA5H 5FLMH 2UUBL 2R7FA 3RNUA 4DR3Q 3FHWA 3I55A 3H15A 1IBML 1QVFA 3JAMi 3GTGH 2R93H 1VQIA 4YHHQ 4JI7Q 1LYLA 1H95A 1C9OA 3D31A 4LWCA 4P74A 1EQRA 1FJGL 4JOIC 2VQFL 4JCVE 1XPUA 2FXQA 3S15H 3S2DH 2JA7G 4AQYL 4DV2L 3HOZG 4ALPA 1XMQQ 1N34L 2WFWA 1HNXQ 4AIMA 4HIKA 2KHIA 4DPGA 3F2BA 2Y0SE 1WCMH 2LXKA 1G51A 5LMUL 4DV7L 1YHQA 4NXMQ 2F4VL 1RIPA 4DUYQ 1U5KA 1Z47A 4DR1Q 1SFOH 2HHHL 2AKWB 4NXML 3PSIA 3GTMH 1RL2A 4JG2A 2OQ0A 2D0PA 2E5LL 1QVGA 3A0JA 2JEBI 2KENA 2QEXA 4A3JG 3I4NG 4GKJL 4JI8L 2ASBA 4L5QA 4B3TQ 3HKZE 1HZAA 5HY6A 3H3VI 4POGA 3CCQA 5IP7G 2UUCQ 3J7A5 1HR0L 1WJJA 4BBSH 4P73A 2WP8J 4LF6L 4OX9Q 2DUDA 2K52A 3I2ZA 5IYDH 1L2FA 3TS2A 3WWVA 2ALYB 3HOVG 1EWIA 2UXDL 2PNHA 1DGSA 1EFWA 1A63A 3HOUH 4AYBG 4IPDA 3KF6A 2E2IH 1VQLA 3PIOA 1N32Q 2RHQB 1VQGA 1VQAA 1S3OA 4MNOA 3I56A 1SMXA 4LF9L 3OW2A 4A3FG 2I0QA 2WB1G 1BBUA 1PYSB 3HOXH 2F52A 5HGQA 2JA6H 3F8TA 1N36Q 4C3JH 2ID0A 3RLNA 1GD7A 3CPFA 4KLKA 4X64L 3BU2A 4GN3B 4DR7L 2B29A 1OXVA 2N8NA 4C3HH 2R7ZG 1O7IA 4RMFA 4UPAA 2AHOB 4X66Q 4DV0Q 2K5VA 4WJ3M 1P16A 1TWHH 2NVYH 2OQKA 1YJNA 2OCEA 2VQEQ 4JI7L 5GROA 1PH3A 3HOYH 4EQ5A 3CCJA 1PH2A 3PO3G 3L2PA 3CCUA 4BY7H 4IO9A 2WAQG 1N33Q 5C4XG 4R1JA 2F3IA 4BXXH 2VL6A 4JBKA 1W3SA 4PG3A 4GLAC 1OXSC 4DV5Q 1VQCA 1W2BA 3CCSA 3STBD 2RHSB 3AFQA 3UDFA 4DR2Q 3PV0A 4DV1L 4A93H 1TWAH 2JJQA 3F2CA 1Y1WH 2UU9Q 4JBMA 4JI6L 1KRSA 4A3GH 2K75A 1BVSA 4X65L 1IZ6A 1CKNB 4J15A 1K73C 2VZAA 3U4ZA 3FKIH 5M5WH 1UE7A 2VS1A 4MZ9A 4O0AA 3CCMA 3ICEA 3W1BA 1XTDA 1C0AA 2JA8G 4QIWE 1D8LA 4JYAL 3T1HL 2ZTCA 1GM5A 4LF8L 5ELNA 3DM3A 2I5HA 1X56A 2A19A 2KCMA 1YEZA 1PV4A 3J81j 1Q86C 1CSPA 1FVIA 3L7ZC 4AYBE 1Y1VG 2Z0SA 1XMOL 4LF5Q 2ZJQA 2HIVA 4C3IH 4YY3Q 3RN2A 2UUAL 4GN4B 3F2DA 3K7AH 2E2JH 3KJPA 4P71A 2MO0A 3PGZA 2BH8A 2WB1E 2JE6I 3PUZA 1YHBA 3JAMc 4PZ6A 4B3SQ 1IL2A 3KDFB 5IP9G 1Q46A 2MQHA 3NENA 3CC4A 3S16H 4A3CG 3KJOA 2BA1A 4UP9A 2XGTA 4JV5L 3PO2H 1FL0A 1UEBA 3UDIA 5IT9c 2JA5G 5FLMG 1HNWQ 5M5YH 4DR4Q 4WJ4A 2K50A 1I94Q 1V1QA 4R4CA 1PH7A 3NEMA 1HZCA 2V1CC 1EIFA 1UE5A 3Q8DA 4QQBX 4HJ7A 4A3EG 4JI2L 4UY8C 3IRBA 2ATWA 3ZJYC 5GADC 3T1YQ 1T9HA 1VQJA 2CWAA 2C35B 1HZBA 2GVBA 2WAQE 1HH2P 3ULLA 4DV3Q 4X66L 1PYBA 4L5TA 4OONA 2NN6G 1TWFH 1UWVA 5C44G 4HJ8A 1QUQA 4OWXB 3JC66 1X3GA 4NXNL 2MFIA 2AWOA 1WCMG 3TQYA 2IHFA 3E0EA 3I7FA 4BA1I 3PF4A 2A1AA 4R4TA 4DV6L 4HIDA 1AH9A 2R92H 1CKMA 2CKZB 1N33L 2HT1A 1GO3E 1YJ9A 4QY7A 1LTLA 1KL9A 1GVPA 1NJIC 3GTLH 1VQ7A 2PMZE 2L15A 1SLJA 5LMNQ 4LFAL 1KRTA 2CQOA 2NN6I 3S17H 4BBRH 1A62A 1G6PA 1X54A 1JJCB 5LMNW 2UXCL 4O2DA 1I5FA 2JEAI 1XNQQ 2UXBL 4BBSG 4A3DH 4K0KL 4JI4L 4A75A 2HIXA 4LFCL 1IBLQ 2OTJA 4DKAC 3S1QH 4JBJA 4RG1A 1YVCA 2R7DA 4LF4Q 4P75A 1VQOA 4A3KG 3HOUG 1KHIA 2B63H 4GLXA 3S24A 5JEAJ 4X62L 5JJKA 3OYYA 4A3MG 4DR6Q 2DGYA 1VQKA 1CKOA 1Q1EA 4APVA 1KC8C 2VUMG 1MKHA 5K36G 1MJCA 4HJ9A 4B3SL 4YWKA 2Q2HA 3K80C 4BY1G 4LUVA 2JA7H 3KF8B 5BR8Q 3G4SA 1Q81C 2I5MX 3H0GH 1EYGA 3PUYA 5M3FH 5IWAQ 2GN5A 3ULJA 1HNWL 3E9HA 4DAMA 3H3VH 2XTIA 1WFQA 1I94L 1HZ9A 4DR5L 4IFDJ 1KXLA 2ZTEA 4LFBQ 3CQZH 3S1NH 1IXRA 1TWGH 5FJ8H 3HOYG 2PQAA 3A74A 3ERSX 3M4QA 3J7ZC 4BY7G 4DAYB 1PVOA 1BBWA 4DV3L 3UDGA 1XJVA 1EOVA 3GD7A 3U4VA 4TQUS 4B3MQ 4BXXG 3AFPA 1PH6A 3GTPH 4DR3L 4JI3Q 4A93G 1L1OA 2NZHA 4R4OA 4XIGS 1M90C 3CCLA 3LGJA 5JEAG 4YHHL 3MEFA 1YJWA 2OWOA 2QA4A 1VQ8A 4A3GG 3RZOH 1SROA 1X9NA 4IJHA 4IOAA 3U58A 2KBNA 4GOPA 2NVTH 4B3RQ 3FKIG 3AYHB 1EQQA 2AWNA 3ULPA 3RR5A 4OO1G 1HNXL 1XMQL 3D0FA 4H02A 3STBC 4LF7Q 1P8LA 4GNXA 2EQSA 3FP9A 2Z6KC 3I4MH 3MXNB 5AJ3Q 4DUYL 1JMCA 2VNUD 4DK3C 1NTGA 2KCTA 4P72A 2ZM6Q 4DR1L 1XPOA 1V43A 1Q82C 2UUBQ 4IFDG 1IBMQ 3M4PA 4OO1I 2D62A 3EBEA 1FJGQ 3A5UA 1NMFA 2R7ZH 3CF5A 4B3TL 1A0IA 3AEVA 2VQFQ 1WOCA 3K7UC 1XNRQ 2K5HA 2Q2TA 4IOCA 4IJLA 3M7NA 4AQYQ 3G6EA 4DV2Q 2UUCL 3F1ZA 4KI0A 1UE1A 1S72A 1Q8KA 4NB3A 3TEHB 4OX9L 1EUJA 3TRZA 5GQOA 4DV7Q 2F4VQ 2Z6KA 4GLVB 2NVXH 1PH8A 4IFDI 1D7QA 1J5EQ 3PO3H 1YIJA 2OTLA 2NZOA 5C4XH 1VQ5A 2IY5B 2VW9A 3KLWA 1VS0A 3CPWA 3BZCA 4OXPA 1VQMA 2JK8A 2E5LQ 3GO5A 4PZ7A 5C4JH 2AMCB 1N32L 2BH2A 1K83H 4JI8Q 5FLXc 5GAEC 4UP8A 1YI2A 2YU9H 4MTNA 1CSQA 5IYBG 1N36L 2R93G 3W5OA 1HR0Q 3PUWA 1BKBA 1TWCH 2E2HH 2R92G 1VCIA 5GAGC 1I3QH 2LSSA 5DLQE 4DNIA 3RLFA 3GDEA 5IYCH 1K0RA 1HR0W 4A3LH 3PUXA 4DV0L 3ER0A 4YCUA 2UXDQ 5C3EH 1PH1A 1PH4A 2JA9A 1JB7A 4A3BH 1FGUA 1Y1VH 4QL5A 2VQEL 4BBRG 2BA0A 2EIFA 2H5XA 4YCWA 3DLLA 2B3GA 2EXDA 1K9MC 1E3PA 2D0OA 3CC2A 4IPGA 4EX5A 1JJ2A 2A8VA 3U50C 4LF9Q 3K81C 4HJ5A 3GTOH 4B3RL 4DV5L 1CUKA 4DR2L 4A3DG 4R4QA 1SRUA 1OXUA 4YWMA 1VQNA 2UU9L 2ZJRA 2HQLA 4X64Q 4DR7Q 3CD6A 1SN8A 2PI2A 2YYZA 2ZM6L 3PCOB 4POFA 2B63G 3A5ZB 1I6HH 3NBHB 3PF5A 1YZ6A 3KYHC 4GKKQ 4DUZQ 4A4IA 4A3EH 1X65A 5IYDG 4A76A 2NVQH 3HOWH 2CFMA 2PI2E 4DV4Q 1Z9FA 3CW2C 1VQEA 4JBWA 3J81i 4A3IH 5M3MH 1XNRL 4JI5Q 4DK6C 1AE2A 1HJPA 5C44H 1KQSA 4Y7NH 1SE8A 4JI0Q 3RN5A 1LUZA 1YITA 4LF5L 4AH6A 4YY3L 3H0GG 1B7YB 4DV1Q 2UXCQ 1KIXA 5M3FG 1QZHA 1E7ZA 4OWTB 3CCEA 1K8GA 4JI6Q 1YHAA 2IHEA 3RZDH 4ME3A 3J80i 1J5EL 3TREA 1E24A 1X3FA 1NY4A 4X65Q 3M85A 1QVCA 3OTOQ 3HOXG 3B6YA 5ELOA 1VQFA 3KOJA 3PUVA 1I50H 1JE5A 5FJ8G 1EIYB 2JA6G 1QUQB 2E8GA 1L1OC 4FDBA 2CCZA 1NBWA 1YNXA 3HOZH 5M5XH 4JYAQ 3T1HQ 4JI0L 4LF8Q 4JOIA 4GS3A 5IE8A 2KHJA 4DR4L 1N8RC 4GOPC 1PH5A 3I4OA 1PA6A 1J6QA 2YTYA 3NELA 3CC7A 3CCRA 1XMOQ 2N49A 2YTVA 2UUAQ 1QZGA 1VQPA 3T1YL 1XPRA 1X3EA 3CXCA 2N78A 4GNXC 1PHJA 1VQBA 5H1SE 4A3JH 1VQ9A 4L5SA 3I4NH 3M3YH 3S2HH 1CKNA 2Q2IA 2YV5A 2QGQA 4R4IA 4TVAB 1SR3A 5C0XJ 3L0OA 4A3KH 1WYDA 1HNZQ 3KFUA 1L0WA 4LUOA 4JI1Q 1V9PA 1Y14B 1IYJB 1Y1WG 5IP7H 4JV5Q 4A3MH 3I4MG 2I5LX 1Q1BA 4HJAA 1Q7YC 2ZJPA 2RCNA 2VUMH 1OTCA 1X6OA 1VQ6A 1UE6A 4YWLA 3S1RH 4BA2I 2N3SA 2JQOA 1M1KC 3HOVH 2R6GA 3UE1A 4BY1H 4JI2Q 4KHPQ 5E7NA 5J3BA 5LMNL 1AE3A 3GTKH 1B70B 3CMEA 1K8AC 1IBKQ 3S1MH 4C2MH 1NMGA 1X55A 1A8VA 3EN2A 3K0XA 4A3FH 1OXXK 3KDFA 4LW1A 1YBYA 1KD1C 1XNQL 4GKKL 5GAHC 4DUZL 4NXNQ 3KF6B 2MO1A 2IX1A 4DV6Q 3VDYA 1TXYA 2IX0A 3PIPA 1IBLL 1K3RA 4DV4L 2RF4A 4XTCS 4LF4L 2ZTDA 4IPHA 3UE0A 4JI5L 1MJEA 2IT1A 3M4OH 2LXJA 5C0XG 3UDXA 4LNQA 1N34Q 2K14A 4PMWA 2ES2A 3PO2G 2PQAB 4DR6L 2MNAA 1OXTA 4LFAQ 5LMUQ 4HIMA 5IY0A 1WI5A 3E9IA 4QGUA
chains in the Genus database with same CATH superfamily
3I73A 2DJFC 1GKHA 2K01A 3HFZB 3SGIA 4NXMQ 4UP7A 4X6AH 1HTPA 4K0KQ 2CWPA 5EKLA 1VQDA 4A3LG 3I4NB 2Q2UA 5EAYA 4XYQA 2NB0A 1MIUA 3K8AA 1B3AA 4Y52H 3VYTA 4GNXB 1E2VA 1Q12A 1C48A 4FNFA 4HAEA 4KKUA 2AUKA 2B2YA 3GTKB 2GA4B 3BVZA 2A6EC 3A7LA 1ASZA 3J81c 5EPLA 1GJXA 3BYTB 2AQ2B 5A35A 4CKCA 1NE3A 5IP9H 3A55A 4LF7L 4A3CH 5JJLA 2L4NA 2K4KA 5ELCA 1WTHA 3S14H 5M3MG 3AQQA 4CKBA 1IBML 1F9SA 1VQIA 2DNCA 1LYLA 3D31A 4JW0A 1FJGL 1ESRA 1PRTB 4AQYL 3HOZG 1XMQQ 4EQNA 4BWGB 2G9HD 2Y0SE 2F4VL 1U5KA 1Z47A 2CH4A 3OIPA 4K5WA 5KRUA 1KNEA 2A5HA 1CI3M 3A8JE 3A0JA 2KENA 5KEEA 5C6AA 3I4NG 2ASBA 3HKZE 5HY6A 5IP7G 1HR0L 4R8NA 2WP8J 1EY8A 4OX9Q 2EYMA 2K52A 2X6LA 5FO9B 1YNJD 2ALYB 1STAA 5JPMC 2RHQB 1ILQA 2JA5B 4IURA 4LF9L 2PNRC 2F52A 3NWTA 4ZKCB 1TU2B 2K5QA 3F8TA 1N36Q 2ID0A 1GD7A 1Q8IA 4N9PA 3A8KE 3CHBD 4JK1C 4CJ0B 5KGUA 3EFXD 3S2DB 3S15B 4UPAA 5I6YA 4ILWA 3MZ5A 1K8MA 2OQKA 1YJNA 4XQQA 5IT9E 1WTRA 2VQEQ 5GROA 4ZRZA 3HOYH 4WRDA 3QOLA 3CCUA 1SFOB 4R1JA 2F3IA 2LKVA 1DD2A 4JI0L 1VQCA 4A93H 3J7AV 1RKNA 3TP5A 1Y1WH 5IIFA 4JBMA 1XX8A 2K75A 1BVSA 1IZ6A 1CKNB 1K73C 1GUSA 1RTNA 2VZAA 3OIQA 4IALA 2VS1A 3K5LA 4MZ9A 1R4PB 1XTDA 3W1BA 2KCNA 1C0AA 2ZTCA 1X56A 1BBXC 2KCMA 3VR2A 5T1GA 4ZKBB 2Z0SA 1A15A 3D3RA 4C3IH 3RN2A 3F2DA 3KJPA 4OEMB 2BH8A 1EOTA 2WB1E 3NTIA 2JE6I 1IL2A 2BDOA 2EPBA 1RODA 5COYA 1UEBA 3UDIA 5J22A 5IT9c 2JA5G 2AQ1B 1HNWQ 2E76C 1V1QA 3VYSA 1PH7A 1TWHB 2K7VA 3NEMA 2V1CC 4QQBX 4EVOA 1T9HA 2CQAA 1HZBA 3SVMA 4G7ZC 4OONA 4C56C 1MGSA 4Z9CB 1QUQA 4OWXB 1UAPA 4X3UA 3E0EA 3I7FA 5CC4A 2NTSA 4DV6L 1AH9A 2D2CC 4KD4A 2CKZB 3A8IE 1LTLA 1D1KA 3AMUA 3RD4A 2PMZE 1SEBD 3A56A 4G7OC 1SLJA 4LFAL 1KRTA 2CQOA 2NN6I 1G6PA 2SEBD 2RA4A 1TKWB 1Y8NB 2K28A 4IUPA 1XYIA 4A3DH 4JI4L 2E2JB 1NR2A 3IFDA 5D3DA 4LFCL 2LS01 3S1QH 4JBJA 4OIJA 4LF4Q 1LTTD 2EDGA 4GLXA 3S24A 4X62L 2O5JC 1VQKA 5C3XA 2WKDA 1PZKD 1KC8C 3H3VC 1MKHA 4XQNA 1HHVA 3K57A 2Z6BA 2Q2HA 3K80C 2DNEA 2JA7H 3E5SA 3D6CA 4B9WA 2V4DA 2F1MA 4FF4A 3KLSA 2EYLA 5DAUA 5KYLA 3M7GA 3C1EA 3E9HA 4DAMA 2XTIA 1WFQA 1I94L 5ISRA 1H9SB 1GXDC 2E2DC 1TWGH 3URYA 1TVXA 2R92B 1W6JA 2F0WA 1EOVA 3GD7A 2Z1CA 3GTPH 4DR3L 2F0DA 3LGJA 3MEFA 1STBA 4BBRB 2QILA 1X9NA 4IOAA 2KBNA 1X3QA 3A7AB 1LTGD 1RCVD 2NVTH 1QOHA 2O4XA 1WD0A 3CRKC 3H94A 3D0FA 4LF7Q 4GNXA 5KNDA 3QO2A 2KQ3A 2VNUD 1NTGA 4P72A 2B63B 1IBMQ 2J4XA 2F3WA 2NBFA 4KN4C 2ZXPA 1BCPF 3A54A 3M4PA 4OO1I 2RDGA 3EBEA 1FJGQ 3AEVA 2K5HA 3M7NA 4IJLA 4AQYQ 1EY6A 5M3FB 1Q8KA 3TRZA 5GQOA 2F4VQ 5ELBA 2NVXH 2RVLA 1YIJA 1VDZA 1PFMA 2NZOA 4QF4A 5C4XH 1VQ5A 3KLWA 3CPWA 3BZCA 4L6TB 4YIJA 4V190 1VQMA 4FYDA 2JK8A 5E4XA 2K5DA 1ENFA 3I70A 2B8GA 1LLRD 1JE4A 2CHBD 4ULLA 3HGBA 1HR0Q 3RZOB 1TWCH 3OWEB 2R92G 4QIWB 1I3QH 2LSSA 4KJNA 4DNIA 4A3LH 4QMGA 3PUXA 4DV0L 3NE5B 3HRZC 2EYFA 1CQVA 1HCZA 1VF7A 4J1MA 4QL5A 4F8MA 4BBRG 1A2TA 2BA0A 4YCWA 3I4MB 2B3GA 2EXDA 2A8VA 2D0OA 1CZGA 1EY5A 4LF9Q 4HJ5A 3OW7A 1O7ZA 2JYOA 1VQNA 2UU9L 1UUPA 2R7ZB 5JVH3 1AZPA 2K1BA 5EKKA 2ZM6L 2B63G 3A5ZB 2HQEA 3NBHB 3PF5A 5T1IA 3KYHC 3IAYA 2MJ8A 5DM73 4A3EH 3RUZA 1PDQA 1X65A 4A76A 4UDUC 1PZJD 3PO3B 1Y8OB 2KA7A 4XT3B 2WAQB 4JBWA 5M3MH 4JI5Q 1CQFA 5BN3A 5C44H 4JI0Q 4OELB 5DM63 4KY7A 4YY3L 3BS1A 1KIXA 5M3FG 1K83B 1E7ZA 4OWTB 3CCEA 1T5XD 2IHEA 3RZDH 4G4KA 3J80i 1J5EL 4O1NA 4HCSA 1NY4A 3M85A 5ELOA 1JOKA 4PV1C 1JE5A 3X3MA 2B8FA 1L1OC 3HOZH 1NBWA 2E2HB 2VB3X 2OT2A 4JOIA 5F2DA 1IHZA 1I4HA 5C3EB 4GOPC 1Y8PB 1EWHA 1PH5A 4RKBA 3I4OA 1JOOA 3NELA 1K28A 2RBMA 2YTVA 1F9QA 2SOBA 3TDQA 1VQ9A 1X3EA 3CXCA 3MXNA 1EY9A 5H1SE 3I4NH 5G3LF 4K2LA 1CKNA 3H09A 2YV5A 4R4IA 3L0OA 3KFUA 1HNZQ 1QNUA 4LUOA 4JI1Q 1V9PA 1Y14B 1S5FD 1Y1WG 5IP7H 3I4MG 3K5OA 4Q0FA 2RCNA 2NZ1D 1BCPC 4XT1B 2EJMA 1ET6A 1UE6A 2KJXA 4BA2I 1YNNC 3SDZA 3UE1A 3L3OC 5J3BA 5LMNL 3GTKH 3HOWB 3OHXC 3D4WA 1B70B 3CMEA 3VR3A 5EPJA 1K8AC 1C8CA 1DONA 1X55A 4Y7NB 1AP0A 2CVRA 4GKKL 4RHRA 5CV6A 1B50A 4IUUA 2IX1A 1PTOF 4DV6Q 1IBLL 2RF4A 4XTCS 5JJZA 3UE0A 1I50B 3PIP3 2IT1A 5C0XG 4KMUC 1N34Q 2K14A 3NUCA 5M5XB 2PQAB 3SEBA 1OXTA 4LFAQ 5JEAH 1TS2A 5LMUQ 2B2UA 3E9IA 2XIWA 4KHZA 1ESFA 2YTXA 1JT8A 2B2YC 4F87A 2QKIC 4JI4Q 3S2HB 4LFCQ 1NSNS 3G71A 4ZAIA 3MA2B 1S40A 1C7YA 5C3EG 4DAPA 4LFBL 1Q3LA 4X62Q 1LTAD 3EJIA 1TT2A 4DA2A 2VUMB 4LUZA 4HIOA 1VQ4A 4B3ML 1ZKOA 1STHA 3CMAA 3HOVB 2HCIA 2M2LA 3CCVA 4OWWB 4IPCA 2F0UA 4PZ8A 3S1MB 1EEID 1SXTA 1JCKB 3VR6A 4G57A 4ME5A 4DK1A 4KHPL 2EOTA 1D1IA 4QCLA 2RSNA 1U0LA 1ASYA 3HOWG 1Z6HA 2OXPA 1QNKA 2JA5H 2R7FA 4DR3Q 4JPBW 4MHEA 3H15A 2FFKB 2PZWA 1KDCA 3DWQA 5EBDA 1H95A 4Q5VA 4DXGA 3GTQB 2VQFL 4JCVE 3S17B 3S2DH 1H9SA 3S15H 2JA7G 1EYAA 3R93A 4ALPA 2F0MA 4AIMA 1B2TA 4H7BA 1LABA 2LXKA 3MXPA 3IL8A 1GHJA 4RAUC 1SFOH 2HHHL 3PSIA 3Q24A 4JG2A 2G5DA 2JA8B 1K8OA 3IFTA 3P75A 4GKJL 3VYRA 2BDNA 4V0BA 1HZAA 3H3VI 1HA6A 1U9RA 3J7A5 3OSOA 4P73A 1LTSD 4LF6L 1DXMA 4I7ZC 5IYDH 1L2FA 3TS2A 2XNAC 3WWVA 1HQRD 1D5MC 3HOVG 1FGBD 1LTRD 2PNHA 1DGSA 2K03A 2LY7A 4IPDA 3KF6A 3NBIA 4FXDA 1G91A 1S3OA 1ICWA 2R61A 3I91A 1PTOC 1BBUA 3D4RA 3RLNA 5FOBB 4X64L 4HSVA 1J8IA 2A6HC 2AHOB 4DV0Q 4WJ3M 5FLXL 1P16A 1TWHH 1J9OA 2A69D 1V1PB 1WCMB 4JI7L 4K2KA 4EQ5A 1EY4A 1MSHA 2KHSA 5C4XG 4J6HA 1W3SA 4PG3A 4JBKA 1QWYA 3STBD 1D5ZC 2RHSB 3PV0A 2X6GA 3F2CA 2UU9Q 1M4VA 3C46A 1KRSA 5BN4A 5CGKA 1F2ZA 2HUGA 4X65L 1RD9D 5EPKA 2H1EA 2EY1A 3ICEA 4BBSB 3KK7A 2JA8G 1D8LA 2F0OA 3T1HL 4XQJA 1HTLD 1SJED 1YEZA 1PV4A 2QF7A 3J81j 3HOUB 1ET9A 1CSPA 1FVIA 3ERQA 4CKEA 1II3A 4YY3Q 2E2JH 1JR0D 2MO0A 1H9RA 3HOXB 4HR7B 3NBHA 4XXEA 1Q46A 3NENA 4JV5L 4UP9A 4C3HB 5I6WA 1FL0A 4RGTA 4R4CA 3Q8DA 1D2BA 4A3EG 4UY8C 3IRBA 3ZJYC 1EY7A 1D6EC 5GADC 4BY7B 2C35B 2RCFA 1IL8A 4DV3Q 1F77A 4X66L 2B2TC 5C44G 2DY8A 2F0KA 2XRSD 1C4QA 2QW7A 3I4LA 2F0TA 2AWOA 1WCMG 3AU7A 3BDCA 3EVQA 3TQYA 2A1AA 2R92H 1N33L 3VA7A 1KDAA 5M5WB 3FKIB 4MN3A 1FR3A 4HMJA 1R4QB 2CW0D 1NJIC 4KKSA 2SNSA 5LMNQ 4BBRH 1X54A 2IWHA 3QR8A 3T4AC 2LMCB 2RDFA 4L8JA 3BVMA 2UXCL 4O2DA 3SR1A 3FEWX 1HPCA 4BBSG 1KTKA 3K7AB 5I2XA 2F03A 3TZUA 1QJOA 1IBLQ 2OTJA 3TN2A 1YVCA 1H9JA 1BO0A 1I6VC 4P75A 3HOUG 2B63H 3FRPB 5DEHA 2HCCA 1KNAA 3FPPA 5JJKA 3WOEA 2DGYA 1CKOA 1Q1EA 4APVA 1KAAA 4KN7C 1DOKA 2A68C 1QE6A 3J7AF 4CGYB 4B3SL 5IGEA 1Q81C 3PMFA 2I5MX 1O80A 3G6JB 1S4ZA 4C3HG 2WINB 5M3FH 1EYGA 5C5MA 2Y0SB 3ND9A 2EJGC 3F2UA 2PZUA 3PIO3 4DR5L 1ZYRD 4IFDJ 2ZTEA 4LFBQ 1GUGA 1A6XA 1MI2A 1IW7C 2PQAA 3A74A 3R2IA 1WVLA 4BY7G 4IN3A 3MXUA 3T51B 3MVVA 4B3MQ 4BXXG 5J39A 1PH6A 3QIAA 1TR5A 2NZHA 2F0GA 3CCLA 2Q8TA 5JEAG 5C3WA 4YHHL 2FJ2A 5FLXE 2D5DA 1VQ8A 3RZOH 1SROA 1PTOD 3WDNA 4ABNA 3U58A 4FF3A 4DNTB 3SK5A 5CBEE 3FKIG 3AYHB 2AWNA 3RR5A 1HNXL 1EU4A 2L55A 4H13C 1HQMC 1IYVA 3I4MH 1I4QA 3MXNB 4CDFC 1JMCA 4DK3C 2KCTA 1Z7TA 5CV8A 1Q82C 1V43A 1X3PA 4CDDC 2L0CA 4KHVA 3V05A 2D62A 2R7ZH 1OO9B 5IGCA 4B3TL 2VQFQ 1XNRQ 4DN4M 2ZXOA 2UUCL 3F1ZA 1UE1A 3Q6SA 2Z6KA 1PH8A 4IFDI 1D7QA 3PO3H 2OTLA 2IY5B 3CQZB 2HDLA 5C0XH 1F2LA 3GO5A 1N32L 3QWNA 1K83H 1I4PA 2KCCA 2CH4W 2F0JA 5FLXc 4MTNA 1XXGA 1WTQA 1BKBA 2E2HH 1MD2D 3GDEA 2D9UA 4K5VA 2F0PA 2IL8A 1STNA 5C3EH 3BDOA 2I46A 1PH4A 2A6ED 1PZID 1K9MC 5D14A 1JJ2A 4B3RL 5FO7B 4IUNA 2N88A 1DYQA 1SNDA 4DV5L 3Q0AA 4DR2L 1OXUA 3V2TA 2ZJRA 2HQLA 4X64Q 4RCOA 3Q22A 1SN8A 2YYZA 4U68A 2F4IA 4HCEA 2FHTA 1S5CD 3O13A 3KF8A 4DUZQ 4A4IA 1K0SA 5IYDG 1SYFA 3HOWH 2CFMA 2PI2E 4DV4Q 3CW2C 3MXGA 4DK6C 1AE2A 1HJPA 3NK9A 4LF5L 2NN6H 4Y7NH 3RN5A 1LUZA 3I72A 3KUPA 1K8GA 2K6AA 3ND8A 4ME3A 3TREA 1X3FA 4X65Q 1QVCA 3B6YA 3TSSA 3P20A 1I50H 4RGOS 1BDOA 1V1PA 2EYJA 2NTTA 1EEFD 2J7ZA 5M5XH 5C5LA 3T1HQ 5KNBA 3GV6A 4MTKA 2KHJA 4DR4L 4X3SA 1PA6A 1Y1VB 1J6QA 4JVZA 1QZGA 1VQPA 3SK8A 1XPRA 4DNRB 1PHJA 3S2HH 3GTOB 4OHJA 2KVMA 1SE2A 2Q2IA 1EIHA 1SR3A 1IYUA 2C9OA 5M9OA 1WYDA 1JQYD 2EXZA 1IYJB 4JV5Q 1JWMD 4HJAA 1Q7YC 2ZJPA 2VUMH 1I6HB 2PYKA 1X6OA 4YWLA 1CM9A 5K36H 2N3SA 1M1KC 1IW7D 3HOVH 1VF5C 2PW5A 1I4RA 3NQTA 5JOBA 5LHY1 1EWCA 2DY7A 3JAME 3S1MH 1ZXTA 2J0TD 1GOZA 3DEOA 5E4WC 1IKMA 4LW1A 4WORA 1AFPA 1T5EA 2L1BA 1XNQL 5D65A 3EQLC 1A2UA 2ZXRA 5GAHC 3K5MA 3KF6B 1SYEA 4ZUJA 2VB2X 4IPHA 1MJEA 3J80E 1RF2D 2RKSA 1G2SA 2BOSA 3UDXA 2MNAA 5IY0A 1WI5A 4QGUA 3OTOL 3GTQH 2UXCQ 2GVAA 1SE3A 1ILPA 3S17H 1B8AA 4OIKA 1L1OB 2MUYA 2SDFA 2K5WA 2L11A 2B2WC 5IWAL 5IYCG 4A3JB 1N9WA 2EYHA 3M3YB 2Z9HA 4GOPB 4A3KB 3W1GA 3HKSA 4GN5A 1TY2A 4A3MB 2F0EA 5EGTA 3RLOA 2JA8H 2ZT9C 2VY3A 1TS5A 4L5RC 3S1RB 3BJUA 3CAMA 1PFSA 4TSSA 1EYDA 4AYBB 1PFNA 1E22A 3X3NA 3NXWA 3DXJC 3EIVA 2K5NA 1WTWA 4DR5Q 1CHQD 2MGSA 3WOFA 1LT5D 3M9BA 4QB4A 2RDHA 3VR4A 2L9HA 3J80c 3BDLA 1IBKL 4S3SA 4RH6A 4KD3A 5AJ3L 1MSGA 4KY6A 4LK1C 3FHWA 3I55A 1QVFA 1H9MA 1KLGD 3JAMi 1CHPD 3DMUA 4DXFA 4YHHQ 5JAVA 1E2WA 4RCNA 5E1FA 3LNNA 3R3OA 1SMYC 5J1ZA 1HNXQ 4WFN3 1EIGA 2KHIA 4DPGA 3F2BA 1WCMH 1G51A 3D8GA 1KLUD 2AKWB 4OL7A 1R9TB 4NXML 4PMCA 2D0PA 3E3XA 4M1UB 4X3KA 2QEXA 4A3JG 1SYCA 1GUOA 4L5QA 4B3TQ 2EVBA 3W3AA 3CCQA 2UUCQ 1WJJA 4BBSH 2B39A 1KABA 3E0JA 4K6DA 3GTJB 1ML0D 1EWIA 4FO2A 1EFWA 1A63A 3HOUH 1D5XC 4AYBG 4XDXA 3CU7A 2EZVA 5IODA 3T53B 1N32Q 1VQGA 1VQAA 2O2LD 2M9VA 3I56A 3OW2A 2I0QA 3HOXH 3NQIA 3GTGB 2R93B 5EBCA 3KLSX 3CPFA 3LX0A 4GN3B 2B29A 2N8NA 4C3HH 2R7ZG 5C4ZA 2KUMA 2K5VA 2B2VA 1WTOA 5LL6X 1X32A 3V96A 1B53A 3FVQA 1PH3A 1PH2A 3PO3G 3L2PA 1PLFA 3BVGA 4BY7H 2WAQG 5EKIA 4DAVA 3GTMB 4BXXH 4DV5Q 1DZ1A 1HRJA 3UDFA 3AFQA 4DR2Q 4B08A 4F88A 4DV1L 4JI6L 2XWBB 1HA5A 2X69A 4U673 3K59A 3D4DA 5IGFA 2P5ZX 5M5WH 3FKIH 1UE7A 2AQ3B 4HEDA 2RQXA 1GM5A 5ELNA 3DM3A 2I5HA 2A19A 4E6IA 1EZ8A 2OF1A 2PQEA 1Q86C 2XSCA 3L7ZC 4LF5Q 1WTVA 1XMOL 1PXUA 2E2IB 2HIVA 3DEPA 2UUAL 4GN4B 3K7AH 4P71A 1SYBA 3PGZA 2F0SA 1YHBA 3KDFB 4C3JB 3H6MA 2F0QA 2MQHA 3BZDB 4DGZA 3CC4A 2BA1A 3PO2H 4R8IA 3NP8A 5FLMG 1DOLA 1PTOB 4O42A 4DR4Q 4WJ4A 2K50A 1JC7A 1I94Q 4CJ2C 1PFBA 2NVYB 2DN8A 1EIFA 1UE5A 1FNUA 2CWAA 2PZTA 4J8QA 4NP5A 1STYA 3TP8A 1PYBA 2NN6G 1UWVA 3HEJA 2AUJD 4B9XA 1UEAB 1TWAB 2QEJC 3JC66 4NXNL 2MFIA 2IHFA 3PF4A 2XWJB 4A3GB 3KBGA 4HIDA 1CKMA 2HT1A 4QY7A 1V8QA 2WKCA 3PQIA 1VQ7A 1WD1A 2EYOA 1IKLA 1SDFA 1A62A 3DWPA 2G9DA 1JJCB 1F9RA 1I5FA 2JEAI 4ZLTF 1XNQQ 2XRQD 2UXBL 4A75A 5K5PA 3MFYA 2HIXA 1STGA 1LT6D 4DKAC 3T56B 2R7DA 2BCOA 1VQOA 3FDTA 3P1HA 4RA8A 1QILA 3S16B 3OYYA 2WACA 4LAAA 4CDCC 5A2QE 2VUMG 5M5YB 2XN9C 2E75C 1YNJC 5K36G 3CKIB 3S9WA 4C3JG 3KF8B 3G4SA 1NCVA 5IWAQ 2GN5A 2O5IC 1HNWL 3H3VH 1HZ9A 1S5ED 4EQPA 2QDBA 3CQZH 1CZWA 1IXRA 1UNSA 1BBWA 3UDGA 2EJFC 2QCPX 4TQUS 3LWEA 3GTLB 3J7YW 2FMCA 1L1OA 4XIGS 1M90C 1A3TA 1BQQT 3MAQA 1YJWA 2QA4A 4A3GG 1BCPD 1NUCA 4IJHA 4GOPA 1DOMA 1YNND 4CHTB 4ZQ3A 4OO1G 4H02A 3DHQA 2OEOA 1O7LA 2EQSA 3FP9A 2Z6KC 5AJ3Q 4DUYL 1SSOA 2ZM6Q 4DR1L 2TSSA 1EFID 1O7YA 3J81E 1DJRD 1LT3D 4NDXA 1MHWC 2XVSA 1CFMA 3RMHA 3NTHA 1NMFA 3A5UA 3CF5A 4IOCA 2F0VA 2PCFB 4KI0A 3H0GB 4NB3A 3TEHB 3G7LA 4ZK9B 1NAPA 5FK9C 2DJGC 3HZXA 1J5EQ 2PPBC 3S1NB 1VS0A 2F0NA 4G7HC 1B1ZA 2F0FA 1XTCD 4PZ7A 1AZQA 2AMCB 2BH2A 3AB9A 3K0YA 1PRTF 5GAEC 2Q8RE 1S5BD 1B9MA 4X3TA 5IYBG 3ITPA 1E0BA 5GAGC 1ZEQX 3RLFA 5IYCH 1HR0W 1K0RA 1LTID 4DK0A 1CA5A 3N52A 4YCUA 1PH1A 1SNMA 1JB7A 2EY6A 5NUCA 1Y1VH 1RDPD 3C1FA 2EIFA 3DLLA 1CA6A 1E3PA 3U50C 3GTOH 4N9TA 1BNZA 3D6WA 2NYZD 1VMPA 4R4QA 1SRUA 1B4OA 1HUMA 4I7AA 4FF1A 1I6HH 1YZ6A 4GKKQ 3T13A 3KBXA 1QCBD 2L12A 3SE0A 1Z9FA 3J81i 1QB5D 3HG9A 1M8AA 4OGQC 3H0GG 5C4JB 4DV1Q 3PO2B 1TS4A 4MIUA 1QZHA 4JI6Q 2L5TA 2IJ0A 4DAYA 1YHAA 3DUZA 1E24A 1DM0B 1A3VA 3HOXG 2YU9B 5G3LD 4EQOA 1VQFA 3PUVA 5FJ8G 4FDBA 2CCZA 3DWAA 1YNXA 4IUQA 2F0LA 3SK4A 4GS3A 5IE8A 1N8RC 1SJHD 2Z4IA 4A3BB 1F2MA 3GP7A 4WJWA 2YTYA 3MEHA 3CC7A 3CCRA 1XMOQ 2N49A 2UUAQ 3T1YL 4DF7A 4GNXC 3FPUB 4QUFA 1VQBA 3UI2A 3K58A 4A3JH 3M3YH 4C1NI 4TVAB 5C0XJ 3OOCA 4A3KH 3HKZB 1L0WA 1H9KA 3R8BA 2E74C 1LACA 4A3MH 1HUNA 1EZ6A 5DNFA 3NWSA 4FXGC 1OTCA 4RGMA 1HFGA 3S1RH 2JQOA 4H0LC 4CBVA 3JAML 4BY1H 4KHPQ 5E7NA 2NVQB 1AE3A 4PNYA 4XYOA 2A6HD 4A3IB 4PQXA 3EN2A 3N6RA 4KJOA 3K0XA 1OXXK 2KEEA 3KDFA 1I4GA 1YBYA 1AW7A 4GZYC 4NXNQ 2MO1A 3J80L 2Z8LA 2EY5A 2WIIB 1KDBA 1G2TA 4JI5L 1PRTC 1TQOA 4PMWA 2ES2A 1G6ZA 3PO2G 1SE4A 4DR6L 3EA6A 3I90A 1G291 2HHHQ 1E1OA 1LM0A 1PH9A 1VQHA 1KAWA 2UXBQ 4FP5D 5BR8L 1E1TA 5EQ0A 2Y0SG 5C0XI 4GKJQ 2A73B 4ZCKA 4JC0A 1JOQA 4A3BG 3BZKA 1R9TH 4R9WA 3MFGA 4IFDH 4LF6Q 4UAIA 1A3UA 1B44D 2K32A 2R3ZA 4HN7A 4JI3L 1HNZL 2MHVA 3HKZG 2FINB 4JI1L 4YCVA 3I3CA 4NPSA 4C2MB 1JJGA 1S5DD 4IUTA 5JJIA 4A3FB 3R2TA 4FXKC 3CP0A 2WB1B 5EJWA 3GTJH 2PW7A 3QOJA 1U4LA 3G48A 1V1OA 4IZ8A 5HGTA 3TS0A 2ICEC 1HXYD 4QJFA 4A3IG 5FLMH 2UUBL 3M4OB 3RNUA 4CJ1B 2IPKD 1GUTA 3QJYA 3GTGH 2R93H 4JI7Q 1SYDA 1C9OA 4LWCA 2BE5C 4P74A 3T16A 1EQRA 4JOIC 1XPUA 2FXQA 4KKTA 1LO5D 5JVG3 4DV2L 1N34L 2WFWA 1ENAA 4HIKA 3MTSA 1F9PA 5LMUL 4DV7L 1YHQA 1RIPA 5CV5A 1B3QA 4DUYQ 2B2TA 4DR1Q 3GTMH 1RL2A 1TY0A 2OQ0A 3L9AX 2E5LL 2ENBA 1HFNA 2PMZB 1QVGA 2JEBI 2SNMA 2JXMB 4JI8L 2RSOA 3E6ZX 3I8ZA 3M4YA 2FMMA 4POGA 3Q23A 3HS0C 3U9SA 2VXWA 2DUDA 1JWSD 1SNCA 3I2ZA 2A68D 3MHBA 1B9NA 2UXDL 2B2VC 4I65A 1RJTA 1FNWA 2E2IH 1VQLA 3PIOA 4KK7A 3S14B 4MNOA 1TIID 5ELEA 1SMXA 4A3FG 3VA5A 2WB1G 1PYSB 5HGQA 2JA6H 1MBYA 2QDLA 4C3JH 4FF2A 2Z4HA 5I9PA 4DR7L 4KLKA 3BU2A 1OXVA 4ODGA 1O7IA 4RMFA 2B2UC 4X66Q 1PTOH 1PYWD 3GQBA 2NVYH 4F7XA 5CV9A 2OCEA 2NUCA 3CCJA 4IUVA 4IO9A 2Q8IB 2JN4A 1STEA 1N33Q 1O78A 2VL6A 1W2BA 4GLAC 1OXSC 3SXHA 3CCSA 1E2ZA 4K14A 1TWAH 2JJQA 4EGVA 3NSWA 5CMDA 4A3GH 1AN8A 4J15A 3U4ZA 4O0AA 3CCMA 4OO1H 5ELDA 4QIWE 1VMCA 4JYAL 4LF8L 1LT4D 2IW3A 2KECA 1PRTD 4AYBE 1Y1VG 1EQVA 2ZJQA 1I4XA 4CDEC 4RGNA 5IGBA 2A74C 3PUZA 4B3SQ 3JAMc 4PZ6A 3LWUA 1L0YB 4UHVA 5IP9G 2N55A 4BY1B 2HD3A 4K8IA 3S16H 4A3CG 3KJOA 2C5CA 2XGTA 1JICA 2ICIA 4NMZA 3K5NA 3C2PA 1BXTA 1BCPB 5M5YH 1SBBB 5I9OA 4DU9A 4KTAA 1HZCA 3SHLA 5KYIA 1JORA 4HJ7A 4JI2L 3FMCA 2ATWA 3VR5A 3HOYB 3ONAB 2EYPA 1G8ZD 3ZYYX 3T1YQ 1VQJA 2I07B 4H44C 2GVBA 2WAQE 1HH2P 3ULLA 1SAPA 1EQTA 4L5TA 1TWFH 4HJ8A 4A93B 4K8JA 1X3GA 3TP7A 5IYBH 1Y1WB 1LV9A 4BA1I 4R4TA 4RWSC 3SK6A 1GO3E 4HMIA 1YJ9A 1NNXA 1KL9A 1GVPA 2KOLA 1CK1A 3GTLH 2F0HA 5BN5A 2L15A 3MC0B 1Q90A 5LMNW 4C3IB 4K0KL 3TP6A 2BE5D 1DCZA 4RG1A 3U9OA 4A3KG 5I4DA 1KHIA 3OPOA 5A2QL 5JEAJ 1XWEA 4TRDA 1BUVT 4A3MG 1U4MA 4DR6Q 1L0XB 3W2DA 4P2CB 5L37A 1MJCA 5C4HA 4HJ9A 4YWKA 4BY1G 4LUVA 5BR8Q 3H0GH 3PUYA 3OWFA 4N8X1 5I2YA 3ULJA 4PMBA 3C3LA 3BYYB 1ONLA 1KXLA 3NPPA 2WV6D 3S1NH 2M00A 5FJ8H 3HOYG 3M4QA 3ERSX 3J7ZC 1PVOA 1CTMA 1EY0A 4DAYB 4RHSA 5IOCA 4DV3L 1XJVA 2JP1A 3U4VA 3AFPA 4JI3Q 3KLRA 4A93G 4R4OA 2A69C 1SNOA 2OWOA 5AFWA 4LMQD 4RFBA 4ZUIA 1F2YA 1CT1D 1AEXA 4B3RQ 3QB3A 1EQQA 3ULPA 1XMQL 4A3DB 3STBC 1P8LA 1SYGA 5KNCA 1JB3A 3S1QB 1WTXA 3J81L 2UUBQ 1XPOA 5CBAE 2F0IA 4C3IG 4IFDG 3NTKA 5CV4A 4RKLA 3HP3A 5CORA 1A0IA 4ID6A 1WOCA 3K7UC 4FVMA 2Q2TA 2JA7B 3TZDA 3G6EA 4DV2Q 2HDMA 1GHKA 4KY5A 5FO8B 1S72A 2MPMA 4OX9L 1EUJA 4NW2A 4DV7Q 5FKAC 2PO4A 4GLVB 1U4PA 5KIXA 3P7JA 2VW9A 1K3BC 3IKJA 4K6LA 2JA6B 1TWGB 4OXPA 4N8FA 1FYCA 2K04A 2E5LQ 4K5XA 5C4JH 1LTBD 4JI8Q 3GTPB 4HTHA 4UP8A 2EE1A 1YI2A 2YU9H 1EYCA 5CV7A 1CSQA 2R93G 4QUCA 1N36L 3W5OA 2MP1A 3PUWA 1VCIA 1GUWA 5DLQE 4IQZA 2NVTB 1BR9A 2NWGA 3ER0A 2UXDQ 2JA9A 4A3BH 3MWYW 1FGUA 2F3VA 2VQEL 2B2WA 2H5XA 2K33A 3TMEA 2JSOA 1NR4A 3CC2A 4IPGA 4EX5A 3K81C 4C1NK 3EROA 3NHHA 1CUKA 1U4RA 4A3DG 2CW0C 1QG7A 2K05A 4YWMA 3OMCA 5ELFA 4DR7Q 3H91A 3CD6A 5TSSA 2PI2A 1SNQA 1BOSA 3PCOB 4POFA 1EL0A 1FNVA 1ICFB 4KV6A 2NVXB 2NVQH 5C4XB 1SMYD 1VQEA 1XNRL 4A3IH 1PMRA 1KQSA 1SE8A 4NKLA 1YITA 3GV3A 1GUNA 4AH6A 1BF4A 1B7YB 5LL6S 5HURA 4BS9A 4HSPA 1SNPA 3OTOQ 5CR3A 3TBIB 2JA6G 3KOJA 3CRLC 3QG1A 1EIYB 1QUQB 2E8GA 1TWCB 1I3QB 4JYAQ 4LF8Q 1Y69U 1TWFB 4DFAA 1ZYRC 2KEDA 5E3FA 2TMPA 2EY2A 5D3IB 2N78A 4L5SA 4M8AA 1WTPA 4ZYSA 5IGGA 1FD7D 2QGQA 2LFNA 2IX3A 5JPNC 3VYUA 1EU3A 1Q1BA 2I5LX 1VQ6A 4L63B 3DM1A 2R6GA 3OMGA 4JI2Q 4A3EB 1W6KA 4TKOB 1RTOA 1TS3A 1RHPA 1IBKQ 4LJZC 4C2MH 1NMGA 5M3MB 5IT9L 1A8VA 5C44B 4A3FH 2H4OA 1KD1C 1JWUD 4DUZL 3RZDB 3VDYA 1TXYA 2IX0A 3PIPA 1ENCA 1K3RA 3K6OA 4DV4L 5CYUA 4LF4L 2ZTDA 3M4OH 2LXJA 3HOZB 4LNQA 5IGDA 4HIMA 3BG3A
chains in the Genus database with same CATH topology
3OTOL 1G291 4KHZA 3GTQH 2GVAA 3SGIA 1E1OA 1GKHA 2YTXA 1B8AA 3HFZB 1LM0A 4UP7A 1PH9A 2HHHQ 1VQHA 1L1OB 1KAWA 4X6AH 2UXBQ 1JT8A 5BR8L 4K0KQ 2CWPA 4JI4Q 1E1TA 1VQDA 5IWAL 5IYCG 4LFCQ 2Y0SG 1N9WA 5C0XI 3G71A 5IYBH 2Q2UA 4A3LG 4GKJQ 1S40A 1C7YA 4JC0A 5C3EG 5EAYA 4GOPB 3W1GA 3HKSA 4GN5A 4A3BG 3BZKA 1R9TH 1MIUA 4LFBL 4X62Q 3K8AA 3RLOA 4Y52H 4LF6Q 2JA8H 4GNXB 4LUZA 2VY3A 4HIOA 1VQ4A 4B3ML 1Q12A 4L5RC 3BJUA 3CMAA 3CAMA 4JI3L 1PFSA 1HNZL 3HKZG 3CCVA 4OWWB 4JI1L 4IPCA 4YCVA 1E22A 4PZ8A 1ASZA 4NPSA 3J81c 1JJGA 3EIVA 5JJIA 2K5NA 3CP0A 4DR5Q 3GTJH 3TS0A 1NE3A 3G48A 4KHPL 3M9BA 5IP9H 4LF7L 1U0LA 1ASYA 3J80c 4A3CH 3HOWG 5JJLA 2K4KA 4QJFA 1IBKL 3S14H 5AJ3L 4A3IG 5M3MG 3AQQA 2JA5H 5FLMH 2UUBL 2R7FA 3RNUA 4DR3Q 3FHWA 3I55A 3H15A 1IBML 1QVFA 3JAMi 3GTGH 2R93H 1VQIA 4YHHQ 4JI7Q 1LYLA 1H95A 1C9OA 3D31A 4LWCA 4P74A 1EQRA 1FJGL 4JOIC 2VQFL 4JCVE 1XPUA 2FXQA 3S15H 3S2DH 2JA7G 4AQYL 4DV2L 3HOZG 4ALPA 1XMQQ 1N34L 2WFWA 1HNXQ 4AIMA 4HIKA 2KHIA 4DPGA 3F2BA 2Y0SE 1WCMH 2LXKA 1G51A 5LMUL 4DV7L 1YHQA 4NXMQ 2F4VL 1RIPA 4DUYQ 1U5KA 1Z47A 4DR1Q 1SFOH 2HHHL 2AKWB 4NXML 3PSIA 3GTMH 1RL2A 4JG2A 2OQ0A 2D0PA 2E5LL 1QVGA 3A0JA 2JEBI 2KENA 2QEXA 4A3JG 3I4NG 4GKJL 4JI8L 2ASBA 4L5QA 4B3TQ 3HKZE 1HZAA 5HY6A 3H3VI 4POGA 3CCQA 5IP7G 2UUCQ 3J7A5 1HR0L 1WJJA 4BBSH 4P73A 2WP8J 4LF6L 4OX9Q 2DUDA 2K52A 3I2ZA 5IYDH 1L2FA 3TS2A 3WWVA 2ALYB 3HOVG 1EWIA 2UXDL 2PNHA 1DGSA 1EFWA 1A63A 3HOUH 4AYBG 4IPDA 3KF6A 2E2IH 1VQLA 3PIOA 1N32Q 2RHQB 1VQGA 1VQAA 1S3OA 4MNOA 3I56A 1SMXA 4LF9L 3OW2A 4A3FG 2I0QA 2WB1G 1BBUA 1PYSB 3HOXH 2F52A 5HGQA 2JA6H 3F8TA 1N36Q 4C3JH 2ID0A 3RLNA 1GD7A 3CPFA 4KLKA 4X64L 3BU2A 4GN3B 4DR7L 2B29A 1OXVA 2N8NA 4C3HH 2R7ZG 1O7IA 4RMFA 4UPAA 2AHOB 4X66Q 4DV0Q 2K5VA 4WJ3M 1P16A 1TWHH 2NVYH 2OQKA 1YJNA 2OCEA 2VQEQ 4JI7L 5GROA 1PH3A 3HOYH 4EQ5A 3CCJA 1PH2A 3PO3G 3L2PA 3CCUA 4BY7H 4IO9A 2WAQG 1N33Q 5C4XG 4R1JA 2F3IA 4BXXH 2VL6A 4JBKA 1W3SA 4PG3A 4GLAC 1OXSC 4DV5Q 1VQCA 1W2BA 3CCSA 3STBD 2RHSB 3AFQA 3UDFA 4DR2Q 3PV0A 4DV1L 4A93H 1TWAH 2JJQA 3F2CA 1Y1WH 2UU9Q 4JBMA 4JI6L 1KRSA 4A3GH 2K75A 1BVSA 4X65L 1IZ6A 1CKNB 4J15A 1K73C 2VZAA 3U4ZA 3FKIH 5M5WH 1UE7A 2VS1A 4MZ9A 4O0AA 3CCMA 3ICEA 3W1BA 1XTDA 1C0AA 2JA8G 4QIWE 1D8LA 4JYAL 3T1HL 2ZTCA 1GM5A 4LF8L 5ELNA 3DM3A 2I5HA 1X56A 2A19A 2KCMA 1YEZA 1PV4A 3J81j 1Q86C 1CSPA 1FVIA 3L7ZC 4AYBE 1Y1VG 2Z0SA 1XMOL 4LF5Q 2ZJQA 2HIVA 4C3IH 4YY3Q 3RN2A 2UUAL 4GN4B 3F2DA 3K7AH 2E2JH 3KJPA 4P71A 2MO0A 3PGZA 2BH8A 2WB1E 2JE6I 3PUZA 1YHBA 3JAMc 4PZ6A 4B3SQ 1IL2A 3KDFB 5IP9G 1Q46A 2MQHA 3NENA 3CC4A 3S16H 4A3CG 3KJOA 2BA1A 4UP9A 2XGTA 4JV5L 3PO2H 1FL0A 1UEBA 3UDIA 5IT9c 2JA5G 5FLMG 1HNWQ 5M5YH 4DR4Q 4WJ4A 2K50A 1I94Q 1V1QA 4R4CA 1PH7A 3NEMA 1HZCA 2V1CC 1EIFA 1UE5A 3Q8DA 4QQBX 4HJ7A 4A3EG 4JI2L 4UY8C 3IRBA 2ATWA 3ZJYC 5GADC 3T1YQ 1T9HA 1VQJA 2CWAA 2C35B 1HZBA 2GVBA 2WAQE 1HH2P 3ULLA 4DV3Q 4X66L 1PYBA 4L5TA 4OONA 2NN6G 1TWFH 1UWVA 5C44G 4HJ8A 1QUQA 4OWXB 3JC66 1X3GA 4NXNL 2MFIA 2AWOA 1WCMG 3TQYA 2IHFA 3E0EA 3I7FA 4BA1I 3PF4A 2A1AA 4R4TA 4DV6L 4HIDA 1AH9A 2R92H 1CKMA 2CKZB 1N33L 2HT1A 1GO3E 1YJ9A 4QY7A 1LTLA 1KL9A 1GVPA 1NJIC 3GTLH 1VQ7A 2PMZE 2L15A 1SLJA 5LMNQ 4LFAL 1KRTA 2CQOA 2NN6I 3S17H 4BBRH 1A62A 1G6PA 1X54A 1JJCB 5LMNW 2UXCL 4O2DA 1I5FA 2JEAI 1XNQQ 2UXBL 4BBSG 4A3DH 4K0KL 4JI4L 4A75A 2HIXA 4LFCL 1IBLQ 2OTJA 4DKAC 3S1QH 4JBJA 4RG1A 1YVCA 2R7DA 4LF4Q 4P75A 1VQOA 4A3KG 3HOUG 1KHIA 2B63H 4GLXA 3S24A 5JEAJ 4X62L 5JJKA 3OYYA 4A3MG 4DR6Q 2DGYA 1VQKA 1CKOA 1Q1EA 4APVA 1KC8C 2VUMG 1MKHA 5K36G 1MJCA 4HJ9A 4B3SL 4YWKA 2Q2HA 3K80C 4BY1G 4LUVA 2JA7H 3KF8B 5BR8Q 3G4SA 1Q81C 2I5MX 3H0GH 1EYGA 3PUYA 5M3FH 5IWAQ 2GN5A 3ULJA 1HNWL 3E9HA 4DAMA 3H3VH 2XTIA 1WFQA 1I94L 1HZ9A 4DR5L 4IFDJ 1KXLA 2ZTEA 4LFBQ 3CQZH 3S1NH 1IXRA 1TWGH 5FJ8H 3HOYG 2PQAA 3A74A 3ERSX 3M4QA 3J7ZC 4BY7G 4DAYB 1PVOA 1BBWA 4DV3L 3UDGA 1XJVA 1EOVA 3GD7A 3U4VA 4TQUS 4B3MQ 4BXXG 3AFPA 1PH6A 3GTPH 4DR3L 4JI3Q 4A93G 1L1OA 2NZHA 4R4OA 4XIGS 1M90C 3CCLA 3LGJA 5JEAG 4YHHL 3MEFA 1YJWA 2OWOA 2QA4A 1VQ8A 4A3GG 3RZOH 1SROA 1X9NA 4IJHA 4IOAA 3U58A 2KBNA 4GOPA 2NVTH 4B3RQ 3FKIG 3AYHB 1EQQA 2AWNA 3ULPA 3RR5A 4OO1G 1HNXL 1XMQL 3D0FA 4H02A 3STBC 4LF7Q 1P8LA 4GNXA 2EQSA 3FP9A 2Z6KC 3I4MH 3MXNB 5AJ3Q 4DUYL 1JMCA 2VNUD 4DK3C 1NTGA 2KCTA 4P72A 2ZM6Q 4DR1L 1XPOA 1V43A 1Q82C 2UUBQ 4IFDG 1IBMQ 3M4PA 4OO1I 2D62A 3EBEA 1FJGQ 3A5UA 1NMFA 2R7ZH 3CF5A 4B3TL 1A0IA 3AEVA 2VQFQ 1WOCA 3K7UC 1XNRQ 2K5HA 2Q2TA 4IOCA 4IJLA 3M7NA 4AQYQ 3G6EA 4DV2Q 2UUCL 3F1ZA 4KI0A 1UE1A 1S72A 1Q8KA 4NB3A 3TEHB 4OX9L 1EUJA 3TRZA 5GQOA 4DV7Q 2F4VQ 2Z6KA 4GLVB 2NVXH 1PH8A 4IFDI 1D7QA 1J5EQ 3PO3H 1YIJA 2OTLA 2NZOA 5C4XH 1VQ5A 2IY5B 2VW9A 3KLWA 1VS0A 3CPWA 3BZCA 4OXPA 1VQMA 2JK8A 2E5LQ 3GO5A 4PZ7A 5C4JH 2AMCB 1N32L 2BH2A 1K83H 4JI8Q 5FLXc 5GAEC 4UP8A 1YI2A 2YU9H 4MTNA 1CSQA 5IYBG 1N36L 2R93G 3W5OA 1HR0Q 3PUWA 1BKBA 1TWCH 2E2HH 2R92G 1VCIA 5GAGC 1I3QH 2LSSA 5DLQE 4DNIA 3RLFA 3GDEA 5IYCH 1K0RA 1HR0W 4A3LH 3PUXA 4DV0L 3ER0A 4YCUA 2UXDQ 5C3EH 1PH1A 1PH4A 2JA9A 1JB7A 4A3BH 1FGUA 1Y1VH 4QL5A 2VQEL 4BBRG 2BA0A 2EIFA 2H5XA 4YCWA 3DLLA 2B3GA 2EXDA 1K9MC 1E3PA 2D0OA 3CC2A 4IPGA 4EX5A 1JJ2A 2A8VA 3U50C 4LF9Q 3K81C 4HJ5A 3GTOH 4B3RL 4DV5L 1CUKA 4DR2L 4A3DG 4R4QA 1SRUA 1OXUA 4YWMA 1VQNA 2UU9L 2ZJRA 2HQLA 4X64Q 4DR7Q 3CD6A 1SN8A 2PI2A 2YYZA 2ZM6L 3PCOB 4POFA 2B63G 3A5ZB 1I6HH 3NBHB 3PF5A 1YZ6A 3KYHC 4GKKQ 4DUZQ 4A4IA 4A3EH 1X65A 5IYDG 4A76A 2NVQH 3HOWH 2CFMA 2PI2E 4DV4Q 1Z9FA 3CW2C 1VQEA 4JBWA 3J81i 4A3IH 5M3MH 1XNRL 4JI5Q 4DK6C 1AE2A 1HJPA 5C44H 1KQSA 4Y7NH 1SE8A 4JI0Q 3RN5A 1LUZA 1YITA 4LF5L 4AH6A 4YY3L 3H0GG 1B7YB 4DV1Q 2UXCQ 1KIXA 5M3FG 1QZHA 1E7ZA 4OWTB 3CCEA 1K8GA 4JI6Q 1YHAA 2IHEA 3RZDH 4ME3A 3J80i 1J5EL 3TREA 1E24A 1X3FA 1NY4A 4X65Q 3M85A 1QVCA 3OTOQ 3HOXG 3B6YA 5ELOA 1VQFA 3KOJA 3PUVA 1I50H 1JE5A 5FJ8G 1EIYB 2JA6G 1QUQB 2E8GA 1L1OC 4FDBA 2CCZA 1NBWA 1YNXA 3HOZH 5M5XH 4JYAQ 3T1HQ 4JI0L 4LF8Q 4JOIA 4GS3A 5IE8A 2KHJA 4DR4L 1N8RC 4GOPC 1PH5A 3I4OA 1PA6A 1J6QA 2YTYA 3NELA 3CC7A 3CCRA 1XMOQ 2N49A 2YTVA 2UUAQ 1QZGA 1VQPA 3T1YL 1XPRA 1X3EA 3CXCA 2N78A 4GNXC 1PHJA 1VQBA 5H1SE 4A3JH 1VQ9A 4L5SA 3I4NH 3M3YH 3S2HH 1CKNA 2Q2IA 2YV5A 2QGQA 4R4IA 4TVAB 1SR3A 5C0XJ 3L0OA 4A3KH 1WYDA 1HNZQ 3KFUA 1L0WA 4LUOA 4JI1Q 1V9PA 1Y14B 1IYJB 1Y1WG 5IP7H 4JV5Q 4A3MH 3I4MG 2I5LX 1Q1BA 4HJAA 1Q7YC 2ZJPA 2RCNA 2VUMH 1OTCA 1X6OA 1VQ6A 1UE6A 4YWLA 3S1RH 4BA2I 2N3SA 2JQOA 1M1KC 3HOVH 2R6GA 3UE1A 4BY1H 4JI2Q 4KHPQ 5E7NA 5J3BA 5LMNL 1AE3A 3GTKH 1B70B 3CMEA 1K8AC 1IBKQ 3S1MH 4C2MH 1NMGA 1X55A 1A8VA 3EN2A 3K0XA 4A3FH 1OXXK 3KDFA 4LW1A 1YBYA 1KD1C 1XNQL 4GKKL 5GAHC 4DUZL 4NXNQ 3KF6B 2MO1A 2IX1A 4DV6Q 3VDYA 1TXYA 2IX0A 3PIPA 1IBLL 1K3RA 4DV4L 2RF4A 4XTCS 4LF4L 2ZTDA 4IPHA 3UE0A 4JI5L 1MJEA 2IT1A 3M4OH 2LXJA 5C0XG 3UDXA 4LNQA 1N34Q 2K14A 4PMWA 2ES2A 3PO2G 2PQAB 4DR6L 2MNAA 1OXTA 4LFAQ 5LMUQ 4HIMA 5IY0A 1WI5A 3E9IA 4QGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO L;  1G29 1;  4KHZ A;  3GTQ H;  2GVA A;  3SGI A;  1E1O A;  1GKH A;  2YTX A;  1B8A A;  3HFZ B;  1LM0 A;  4UP7 A;  1PH9 A;  2HHH Q;  1VQH A;  1L1O B;  1KAW A;  4X6A H;  2UXB Q;  1JT8 A;  5BR8 L;  4K0K Q;  2CWP A;  4JI4 Q;  1E1T A;  1VQD A;  5IWA L;  5IYC G;  4LFC Q;  2Y0S G;  1N9W A;  5C0X I;  3G71 A;  5IYB H;  2Q2U A;  4A3L G;  4GKJ Q;  1S40 A;  1C7Y A;  4JC0 A;  5C3E G;  5EAY A;  4GOP B;  3W1G A;  3HKS A;  4GN5 A;  4A3B G;  3BZK A;  1R9T H;  1MIU A;  4LFB L;  4X62 Q;  3K8A A;  3RLO A;  4Y52 H;  4LF6 Q;  2JA8 H;  4GNX B;  4LUZ A;  2VY3 A;  4HIO A;  1VQ4 A;  4B3M L;  1Q12 A;  4L5R C;  3BJU A;  3CMA A;  3CAM A;  4JI3 L;  1PFS A;  1HNZ L;  3HKZ G;  3CCV A;  4OWW B;  4JI1 L;  4IPC A;  4YCV A;  1E22 A;  4PZ8 A;  1ASZ A;  4NPS A;  3J81 c;  1JJG A;  3EIV A;  5JJI A;  2K5N A;  3CP0 A;  4DR5 Q;  3GTJ H;  3TS0 A;  1NE3 A;  3G48 A;  4KHP L;  3M9B A;  5IP9 H;  4LF7 L;  1U0L A;  1ASY A;  3J80 c;  4A3C H;  3HOW G;  5JJL A;  2K4K A;  4QJF A;  1IBK L;  3S14 H;  5AJ3 L;  4A3I G;  5M3M G;  3AQQ A;  2JA5 H;  5FLM H;  2UUB L;  2R7F A;  3RNU A;  4DR3 Q;  3FHW A;  3I55 A;  3H15 A;  1IBM L;  1QVF A;  3JAM i;  3GTG H;  2R93 H;  1VQI A;  4YHH Q;  4JI7 Q;  1LYL A;  1H95 A;  1C9O A;  3D31 A;  4LWC A;  4P74 A;  1EQR A;  1FJG L;  4JOI C;  2VQF L;  4JCV E;  1XPU A;  2FXQ A;  3S15 H;  3S2D H;  2JA7 G;  4AQY L;  4DV2 L;  3HOZ G;  4ALP A;  1XMQ Q;  1N34 L;  2WFW A;  1HNX Q;  4AIM A;  4HIK A;  2KHI A;  4DPG A;  3F2B A;  2Y0S E;  1WCM H;  2LXK A;  1G51 A;  5LMU L;  4DV7 L;  1YHQ A;  4NXM Q;  2F4V L;  1RIP A;  4DUY Q;  1U5K A;  1Z47 A;  4DR1 Q;  1SFO H;  2HHH L;  2AKW B;  4NXM L;  3PSI A;  3GTM H;  1RL2 A;  4JG2 A;  2OQ0 A;  2D0P A;  2E5L L;  1QVG A;  3A0J A;  2JEB I;  2KEN A;  2QEX A;  4A3J G;  3I4N G;  4GKJ L;  4JI8 L;  2ASB A;  4L5Q A;  4B3T Q;  3HKZ E;  1HZA A;  5HY6 A;  3H3V I;  4POG A;  3CCQ A;  5IP7 G;  2UUC Q;  3J7A 5;  1HR0 L;  1WJJ A;  4BBS H;  4P73 A;  2WP8 J;  4LF6 L;  4OX9 Q;  2DUD A;  2K52 A;  3I2Z A;  5IYD H;  1L2F A;  3TS2 A;  3WWV A;  2ALY B;  3HOV G;  1EWI A;  2UXD L;  2PNH A;  1DGS A;  1EFW A;  1A63 A;  3HOU H;  4AYB G;  4IPD A;  3KF6 A;  2E2I H;  1VQL A;  3PIO A;  1N32 Q;  2RHQ B;  1VQG A;  1VQA A;  1S3O A;  4MNO A;  3I56 A;  1SMX A;  4LF9 L;  3OW2 A;  4A3F G;  2I0Q A;  2WB1 G;  1BBU A;  1PYS B;  3HOX H;  2F52 A;  5HGQ A;  2JA6 H;  3F8T A;  1N36 Q;  4C3J H;  2ID0 A;  3RLN A;  1GD7 A;  3CPF A;  4KLK A;  4X64 L;  3BU2 A;  4GN3 B;  4DR7 L;  2B29 A;  1OXV A;  2N8N A;  4C3H H;  2R7Z G;  1O7I A;  4RMF A;  4UPA A;  2AHO B;  4X66 Q;  4DV0 Q;  2K5V A;  4WJ3 M;  1P16 A;  1TWH H;  2NVY H;  2OQK A;  1YJN A;  2OCE A;  2VQE Q;  4JI7 L;  5GRO A;  1PH3 A;  3HOY H;  4EQ5 A;  3CCJ A;  1PH2 A;  3PO3 G;  3L2P A;  3CCU A;  4BY7 H;  4IO9 A;  2WAQ G;  1N33 Q;  5C4X G;  4R1J A;  2F3I A;  4BXX H;  2VL6 A;  4JBK A;  1W3S A;  4PG3 A;  4GLA C;  1OXS C;  4DV5 Q;  1VQC A;  1W2B A;  3CCS A;  3STB D;  2RHS B;  3AFQ A;  3UDF A;  4DR2 Q;  3PV0 A;  4DV1 L;  4A93 H;  1TWA H;  2JJQ A;  3F2C A;  1Y1W H;  2UU9 Q;  4JBM A;  4JI6 L;  1KRS A;  4A3G H;  2K75 A;  1BVS A;  4X65 L;  1IZ6 A;  1CKN B;  4J15 A;  1K73 C;  2VZA A;  3U4Z A;  3FKI H;  5M5W H;  1UE7 A;  2VS1 A;  4MZ9 A;  4O0A A;  3CCM A;  3ICE A;  3W1B A;  1XTD A;  1C0A A;  2JA8 G;  4QIW E;  1D8L A;  4JYA L;  3T1H L;  2ZTC A;  1GM5 A;  4LF8 L;  5ELN A;  3DM3 A;  2I5H A;  1X56 A;  2A19 A;  2KCM A;  1YEZ A;  1PV4 A;  3J81 j;  1Q86 C;  1CSP A;  1FVI A;  3L7Z C;  4AYB E;  1Y1V G;  2Z0S A;  1XMO L;  4LF5 Q;  2ZJQ A;  2HIV A;  4C3I H;  4YY3 Q;  3RN2 A;  2UUA L;  4GN4 B;  3F2D A;  3K7A H;  2E2J H;  3KJP A;  4P71 A;  2MO0 A;  3PGZ A;  2BH8 A;  2WB1 E;  2JE6 I;  3PUZ A;  1YHB A;  3JAM c;  4PZ6 A;  4B3S Q;  1IL2 A;  3KDF B;  5IP9 G;  1Q46 A;  2MQH A;  3NEN A;  3CC4 A;  3S16 H;  4A3C G;  3KJO A;  2BA1 A;  4UP9 A;  2XGT A;  4JV5 L;  3PO2 H;  1FL0 A;  1UEB A;  3UDI A;  5IT9 c;  2JA5 G;  5FLM G;  1HNW Q;  5M5Y H;  4DR4 Q;  4WJ4 A;  2K50 A;  1I94 Q;  1V1Q A;  4R4C A;  1PH7 A;  3NEM A;  1HZC A;  2V1C C;  1EIF A;  1UE5 A;  3Q8D A;  4QQB X;  4HJ7 A;  4A3E G;  4JI2 L;  4UY8 C;  3IRB A;  2ATW A;  3ZJY C;  5GAD C;  3T1Y Q;  1T9H A;  1VQJ A;  2CWA A;  2C35 B;  1HZB A;  2GVB A;  2WAQ E;  1HH2 P;  3ULL A;  4DV3 Q;  4X66 L;  1PYB A;  4L5T A;  4OON A;  2NN6 G;  1TWF H;  1UWV A;  5C44 G;  4HJ8 A;  1QUQ A;  4OWX B;  3JC6 6;  1X3G A;  4NXN L;  2MFI A;  2AWO A;  1WCM G;  3TQY A;  2IHF A;  3E0E A;  3I7F A;  4BA1 I;  3PF4 A;  2A1A A;  4R4T A;  4DV6 L;  4HID A;  1AH9 A;  2R92 H;  1CKM A;  2CKZ B;  1N33 L;  2HT1 A;  1GO3 E;  1YJ9 A;  4QY7 A;  1LTL A;  1KL9 A;  1GVP A;  1NJI C;  3GTL H;  1VQ7 A;  2PMZ E;  2L15 A;  1SLJ A;  5LMN Q;  4LFA L;  1KRT A;  2CQO A;  2NN6 I;  3S17 H;  4BBR H;  1A62 A;  1G6P A;  1X54 A;  1JJC B;  5LMN W;  2UXC L;  4O2D A;  1I5F A;  2JEA I;  1XNQ Q;  2UXB L;  4BBS G;  4A3D H;  4K0K L;  4JI4 L;  4A75 A;  2HIX A;  4LFC L;  1IBL Q;  2OTJ A;  4DKA C;  3S1Q H;  4JBJ A;  4RG1 A;  1YVC A;  2R7D A;  4LF4 Q;  4P75 A;  1VQO A;  4A3K G;  3HOU G;  1KHI A;  2B63 H;  4GLX A;  3S24 A;  5JEA J;  4X62 L;  5JJK A;  3OYY A;  4A3M G;  4DR6 Q;  2DGY A;  1VQK A;  1CKO A;  1Q1E A;  4APV A;  1KC8 C;  2VUM G;  1MKH A;  5K36 G;  1MJC A;  4HJ9 A;  4B3S L;  4YWK A;  2Q2H A;  3K80 C;  4BY1 G;  4LUV A;  2JA7 H;  3KF8 B;  5BR8 Q;  3G4S A;  1Q81 C;  2I5M X;  3H0G H;  1EYG A;  3PUY A;  5M3F H;  5IWA Q;  2GN5 A;  3ULJ A;  1HNW L;  3E9H A;  4DAM A;  3H3V H;  2XTI A;  1WFQ A;  1I94 L;  1HZ9 A;  4DR5 L;  4IFD J;  1KXL A;  2ZTE A;  4LFB Q;  3CQZ H;  3S1N H;  1IXR A;  1TWG H;  5FJ8 H;  3HOY G;  2PQA A;  3A74 A;  3ERS X;  3M4Q A;  3J7Z C;  4BY7 G;  4DAY B;  1PVO A;  1BBW A;  4DV3 L;  3UDG A;  1XJV A;  1EOV A;  3GD7 A;  3U4V A;  4TQU S;  4B3M Q;  4BXX G;  3AFP A;  1PH6 A;  3GTP H;  4DR3 L;  4JI3 Q;  4A93 G;  1L1O A;  2NZH A;  4R4O A;  4XIG S;  1M90 C;  3CCL A;  3LGJ A;  5JEA G;  4YHH L;  3MEF A;  1YJW A;  2OWO A;  2QA4 A;  1VQ8 A;  4A3G G;  3RZO H;  1SRO A;  1X9N A;  4IJH A;  4IOA A;  3U58 A;  2KBN A;  4GOP A;  2NVT H;  4B3R Q;  3FKI G;  3AYH B;  1EQQ A;  2AWN A;  3ULP A;  3RR5 A;  4OO1 G;  1HNX L;  1XMQ L;  3D0F A;  4H02 A;  3STB C;  4LF7 Q;  1P8L A;  4GNX A;  2EQS A;  3FP9 A;  2Z6K C;  3I4M H;  3MXN B;  5AJ3 Q;  4DUY L;  1JMC A;  2VNU D;  4DK3 C;  1NTG A;  2KCT A;  4P72 A;  2ZM6 Q;  4DR1 L;  1XPO A;  1V43 A;  1Q82 C;  2UUB Q;  4IFD G;  1IBM Q;  3M4P A;  4OO1 I;  2D62 A;  3EBE A;  1FJG Q;  3A5U A;  1NMF A;  2R7Z H;  3CF5 A;  4B3T L;  1A0I A;  3AEV A;  2VQF Q;  1WOC A;  3K7U C;  1XNR Q;  2K5H A;  2Q2T A;  4IOC A;  4IJL A;  3M7N A;  4AQY Q;  3G6E A;  4DV2 Q;  2UUC L;  3F1Z A;  4KI0 A;  1UE1 A;  1S72 A;  1Q8K A;  4NB3 A;  3TEH B;  4OX9 L;  1EUJ A;  3TRZ A;  5GQO A;  4DV7 Q;  2F4V Q;  2Z6K A;  4GLV B;  2NVX H;  1PH8 A;  4IFD I;  1D7Q A;  1J5E Q;  3PO3 H;  1YIJ A;  2OTL A;  2NZO A;  5C4X H;  1VQ5 A;  2IY5 B;  2VW9 A;  3KLW A;  1VS0 A;  3CPW A;  3BZC A;  4OXP A;  1VQM A;  2JK8 A;  2E5L Q;  3GO5 A;  4PZ7 A;  5C4J H;  2AMC B;  1N32 L;  2BH2 A;  1K83 H;  4JI8 Q;  5FLX c;  5GAE C;  4UP8 A;  1YI2 A;  2YU9 H;  4MTN A;  1CSQ A;  5IYB G;  1N36 L;  2R93 G;  3W5O A;  1HR0 Q;  3PUW A;  1BKB A;  1TWC H;  2E2H H;  2R92 G;  1VCI A;  5GAG C;  1I3Q H;  2LSS A;  5DLQ E;  4DNI A;  3RLF A;  3GDE A;  5IYC H;  1K0R A;  1HR0 W;  4A3L H;  3PUX A;  4DV0 L;  3ER0 A;  4YCU A;  2UXD Q;  5C3E H;  1PH1 A;  1PH4 A;  2JA9 A;  1JB7 A;  4A3B H;  1FGU A;  1Y1V H;  4QL5 A;  2VQE L;  4BBR G;  2BA0 A;  2EIF A;  2H5X A;  4YCW A;  3DLL A;  2B3G A;  2EXD A;  1K9M C;  1E3P A;  2D0O A;  3CC2 A;  4IPG A;  4EX5 A;  1JJ2 A;  2A8V A;  3U50 C;  4LF9 Q;  3K81 C;  4HJ5 A;  3GTO H;  4B3R L;  4DV5 L;  1CUK A;  4DR2 L;  4A3D G;  4R4Q A;  1SRU A;  1OXU A;  4YWM A;  1VQN A;  2UU9 L;  2ZJR A;  2HQL A;  4X64 Q;  4DR7 Q;  3CD6 A;  1SN8 A;  2PI2 A;  2YYZ A;  2ZM6 L;  3PCO B;  4POF A;  2B63 G;  3A5Z B;  1I6H H;  3NBH B;  3PF5 A;  1YZ6 A;  3KYH C;  4GKK Q;  4DUZ Q;  4A4I A;  4A3E H;  1X65 A;  5IYD G;  4A76 A;  2NVQ H;  3HOW H;  2CFM A;  2PI2 E;  4DV4 Q;  1Z9F A;  3CW2 C;  1VQE A;  4JBW A;  3J81 i;  4A3I H;  5M3M H;  1XNR L;  4JI5 Q;  4DK6 C;  1AE2 A;  1HJP A;  5C44 H;  1KQS A;  4Y7N H;  1SE8 A;  4JI0 Q;  3RN5 A;  1LUZ A;  1YIT A;  4LF5 L;  4AH6 A;  4YY3 L;  3H0G G;  1B7Y B;  4DV1 Q;  2UXC Q;  1KIX A;  5M3F G;  1QZH A;  1E7Z A;  4OWT B;  3CCE A;  1K8G A;  4JI6 Q;  1YHA A;  2IHE A;  3RZD H;  4ME3 A;  3J80 i;  1J5E L;  3TRE A;  1E24 A;  1X3F A;  1NY4 A;  4X65 Q;  3M85 A;  1QVC A;  3OTO Q;  3HOX G;  3B6Y A;  5ELO A;  1VQF A;  3KOJ A;  3PUV A;  1I50 H;  1JE5 A;  5FJ8 G;  1EIY B;  2JA6 G;  1QUQ B;  2E8G A;  1L1O C;  4FDB A;  2CCZ A;  1NBW A;  1YNX A;  3HOZ H;  5M5X H;  4JYA Q;  3T1H Q;  4JI0 L;  4LF8 Q;  4JOI A;  4GS3 A;  5IE8 A;  2KHJ A;  4DR4 L;  1N8R C;  4GOP C;  1PH5 A;  3I4O A;  1PA6 A;  1J6Q A;  2YTY A;  3NEL A;  3CC7 A;  3CCR A;  1XMO Q;  2N49 A;  2YTV A;  2UUA Q;  1QZG A;  1VQP A;  3T1Y L;  1XPR A;  1X3E A;  3CXC A;  2N78 A;  4GNX C;  1PHJ A;  1VQB A;  5H1S E;  4A3J H;  1VQ9 A;  4L5S A;  3I4N H;  3M3Y H;  3S2H H;  1CKN A;  2Q2I A;  2YV5 A;  2QGQ A;  4R4I A;  4TVA B;  1SR3 A;  5C0X J;  3L0O A;  4A3K H;  1WYD A;  1HNZ Q;  3KFU A;  1L0W A;  4LUO A;  4JI1 Q;  1V9P A;  1Y14 B;  1IYJ B;  1Y1W G;  5IP7 H;  4JV5 Q;  4A3M H;  3I4M G;  2I5L X;  1Q1B A;  4HJA A;  1Q7Y C;  2ZJP A;  2RCN A;  2VUM H;  1OTC A;  1X6O A;  1VQ6 A;  1UE6 A;  4YWL A;  3S1R H;  4BA2 I;  2N3S A;  2JQO A;  1M1K C;  3HOV H;  2R6G A;  3UE1 A;  4BY1 H;  4JI2 Q;  4KHP Q;  5E7N A;  5J3B A;  5LMN L;  1AE3 A;  3GTK H;  1B70 B;  3CME A;  1K8A C;  1IBK Q;  3S1M H;  4C2M H;  1NMG A;  1X55 A;  1A8V A;  3EN2 A;  3K0X A;  4A3F H;  1OXX K;  3KDF A;  4LW1 A;  1YBY A;  1KD1 C;  1XNQ L;  4GKK L;  5GAH C;  4DUZ L;  4NXN Q;  3KF6 B;  2MO1 A;  2IX1 A;  4DV6 Q;  3VDY A;  1TXY A;  2IX0 A;  3PIP A;  1IBL L;  1K3R A;  4DV4 L;  2RF4 A;  4XTC S;  4LF4 L;  2ZTD A;  4IPH A;  3UE0 A;  4JI5 L;  1MJE A;  2IT1 A;  3M4O H;  2LXJ A;  5C0X G;  3UDX A;  4LNQ A;  1N34 Q;  2K14 A;  4PMW A;  2ES2 A;  3PO2 G;  2PQA B;  4DR6 L;  2MNA A;  1OXT A;  4LFA Q;  5LMU Q;  4HIM A;  5IY0 A;  1WI5 A;  3E9I A;  4QGU A; 
#chains in the Genus database with same CATH topology
 3I73 A;  2DJF C;  1GKH A;  2K01 A;  3HFZ B;  3SGI A;  4NXM Q;  4UP7 A;  4X6A H;  1HTP A;  4K0K Q;  2CWP A;  5EKL A;  1VQD A;  4A3L G;  3I4N B;  2Q2U A;  5EAY A;  4XYQ A;  2NB0 A;  1MIU A;  3K8A A;  1B3A A;  4Y52 H;  3VYT A;  4GNX B;  1E2V A;  1Q12 A;  1C48 A;  4FNF A;  4HAE A;  4KKU A;  2AUK A;  2B2Y A;  3GTK B;  2GA4 B;  3BVZ A;  2A6E C;  3A7L A;  1ASZ A;  3J81 c;  5EPL A;  1GJX A;  3BYT B;  2AQ2 B;  5A35 A;  4CKC A;  1NE3 A;  5IP9 H;  3A55 A;  4LF7 L;  4A3C H;  5JJL A;  2L4N A;  2K4K A;  5ELC A;  1WTH A;  3S14 H;  5M3M G;  3AQQ A;  4CKB A;  1IBM L;  1F9S A;  1VQI A;  2DNC A;  1LYL A;  3D31 A;  4JW0 A;  1FJG L;  1ESR A;  1PRT B;  4AQY L;  3HOZ G;  1XMQ Q;  4EQN A;  4BWG B;  2G9H D;  2Y0S E;  2F4V L;  1U5K A;  1Z47 A;  2CH4 A;  3OIP A;  4K5W A;  5KRU A;  1KNE A;  2A5H A;  1CI3 M;  3A8J E;  3A0J A;  2KEN A;  5KEE A;  5C6A A;  3I4N G;  2ASB A;  3HKZ E;  5HY6 A;  5IP7 G;  1HR0 L;  4R8N A;  2WP8 J;  1EY8 A;  4OX9 Q;  2EYM A;  2K52 A;  2X6L A;  5FO9 B;  1YNJ D;  2ALY B;  1STA A;  5JPM C;  2RHQ B;  1ILQ A;  2JA5 B;  4IUR A;  4LF9 L;  2PNR C;  2F52 A;  3NWT A;  4ZKC B;  1TU2 B;  2K5Q A;  3F8T A;  1N36 Q;  2ID0 A;  1GD7 A;  1Q8I A;  4N9P A;  3A8K E;  3CHB D;  4JK1 C;  4CJ0 B;  5KGU A;  3EFX D;  3S2D B;  3S15 B;  4UPA A;  5I6Y A;  4ILW A;  3MZ5 A;  1K8M A;  2OQK A;  1YJN A;  4XQQ A;  5IT9 E;  1WTR A;  2VQE Q;  5GRO A;  4ZRZ A;  3HOY H;  4WRD A;  3QOL A;  3CCU A;  1SFO B;  4R1J A;  2F3I A;  2LKV A;  1DD2 A;  4JI0 L;  1VQC A;  4A93 H;  3J7A V;  1RKN A;  3TP5 A;  1Y1W H;  5IIF A;  4JBM A;  1XX8 A;  2K75 A;  1BVS A;  1IZ6 A;  1CKN B;  1K73 C;  1GUS A;  1RTN A;  2VZA A;  3OIQ A;  4IAL A;  2VS1 A;  3K5L A;  4MZ9 A;  1R4P B;  1XTD A;  3W1B A;  2KCN A;  1C0A A;  2ZTC A;  1X56 A;  1BBX C;  2KCM A;  3VR2 A;  5T1G A;  4ZKB B;  2Z0S A;  1A15 A;  3D3R A;  4C3I H;  3RN2 A;  3F2D A;  3KJP A;  4OEM B;  2BH8 A;  1EOT A;  2WB1 E;  3NTI A;  2JE6 I;  1IL2 A;  2BDO A;  2EPB A;  1ROD A;  5COY A;  1UEB A;  3UDI A;  5J22 A;  5IT9 c;  2JA5 G;  2AQ1 B;  1HNW Q;  2E76 C;  1V1Q A;  3VYS A;  1PH7 A;  1TWH B;  2K7V A;  3NEM A;  2V1C C;  4QQB X;  4EVO A;  1T9H A;  2CQA A;  1HZB A;  3SVM A;  4G7Z C;  4OON A;  4C56 C;  1MGS A;  4Z9C B;  1QUQ A;  4OWX B;  1UAP A;  4X3U A;  3E0E A;  3I7F A;  5CC4 A;  2NTS A;  4DV6 L;  1AH9 A;  2D2C C;  4KD4 A;  2CKZ B;  3A8I E;  1LTL A;  1D1K A;  3AMU A;  3RD4 A;  2PMZ E;  1SEB D;  3A56 A;  4G7O C;  1SLJ A;  4LFA L;  1KRT A;  2CQO A;  2NN6 I;  1G6P A;  2SEB D;  2RA4 A;  1TKW B;  1Y8N B;  2K28 A;  4IUP A;  1XYI A;  4A3D H;  4JI4 L;  2E2J B;  1NR2 A;  3IFD A;  5D3D A;  4LFC L;  2LS0 1;  3S1Q H;  4JBJ A;  4OIJ A;  4LF4 Q;  1LTT D;  2EDG A;  4GLX A;  3S24 A;  4X62 L;  2O5J C;  1VQK A;  5C3X A;  2WKD A;  1PZK D;  1KC8 C;  3H3V C;  1MKH A;  4XQN A;  1HHV A;  3K57 A;  2Z6B A;  2Q2H A;  3K80 C;  2DNE A;  2JA7 H;  3E5S A;  3D6C A;  4B9W A;  2V4D A;  2F1M A;  4FF4 A;  3KLS A;  2EYL A;  5DAU A;  5KYL A;  3M7G A;  3C1E A;  3E9H A;  4DAM A;  2XTI A;  1WFQ A;  1I94 L;  5ISR A;  1H9S B;  1GXD C;  2E2D C;  1TWG H;  3URY A;  1TVX A;  2R92 B;  1W6J A;  2F0W A;  1EOV A;  3GD7 A;  2Z1C A;  3GTP H;  4DR3 L;  2F0D A;  3LGJ A;  3MEF A;  1STB A;  4BBR B;  2QIL A;  1X9N A;  4IOA A;  2KBN A;  1X3Q A;  3A7A B;  1LTG D;  1RCV D;  2NVT H;  1QOH A;  2O4X A;  1WD0 A;  3CRK C;  3H94 A;  3D0F A;  4LF7 Q;  4GNX A;  5KND A;  3QO2 A;  2KQ3 A;  2VNU D;  1NTG A;  4P72 A;  2B63 B;  1IBM Q;  2J4X A;  2F3W A;  2NBF A;  4KN4 C;  2ZXP A;  1BCP F;  3A54 A;  3M4P A;  4OO1 I;  2RDG A;  3EBE A;  1FJG Q;  3AEV A;  2K5H A;  3M7N A;  4IJL A;  4AQY Q;  1EY6 A;  5M3F B;  1Q8K A;  3TRZ A;  5GQO A;  2F4V Q;  5ELB A;  2NVX H;  2RVL A;  1YIJ A;  1VDZ A;  1PFM A;  2NZO A;  4QF4 A;  5C4X H;  1VQ5 A;  3KLW A;  3CPW A;  3BZC A;  4L6T B;  4YIJ A;  4V19 0;  1VQM A;  4FYD A;  2JK8 A;  5E4X A;  2K5D A;  1ENF A;  3I70 A;  2B8G A;  1LLR D;  1JE4 A;  2CHB D;  4ULL A;  3HGB A;  1HR0 Q;  3RZO B;  1TWC H;  3OWE B;  2R92 G;  4QIW B;  1I3Q H;  2LSS A;  4KJN A;  4DNI A;  4A3L H;  4QMG A;  3PUX A;  4DV0 L;  3NE5 B;  3HRZ C;  2EYF A;  1CQV A;  1HCZ A;  1VF7 A;  4J1M A;  4QL5 A;  4F8M A;  4BBR G;  1A2T A;  2BA0 A;  4YCW A;  3I4M B;  2B3G A;  2EXD A;  2A8V A;  2D0O A;  1CZG A;  1EY5 A;  4LF9 Q;  4HJ5 A;  3OW7 A;  1O7Z A;  2JYO A;  1VQN A;  2UU9 L;  1UUP A;  2R7Z B;  5JVH 3;  1AZP A;  2K1B A;  5EKK A;  2ZM6 L;  2B63 G;  3A5Z B;  2HQE A;  3NBH B;  3PF5 A;  5T1I A;  3KYH C;  3IAY A;  2MJ8 A;  5DM7 3;  4A3E H;  3RUZ A;  1PDQ A;  1X65 A;  4A76 A;  4UDU C;  1PZJ D;  3PO3 B;  1Y8O B;  2KA7 A;  4XT3 B;  2WAQ B;  4JBW A;  5M3M H;  4JI5 Q;  1CQF A;  5BN3 A;  5C44 H;  4JI0 Q;  4OEL B;  5DM6 3;  4KY7 A;  4YY3 L;  3BS1 A;  1KIX A;  5M3F G;  1K83 B;  1E7Z A;  4OWT B;  3CCE A;  1T5X D;  2IHE A;  3RZD H;  4G4K A;  3J80 i;  1J5E L;  4O1N A;  4HCS A;  1NY4 A;  3M85 A;  5ELO A;  1JOK A;  4PV1 C;  1JE5 A;  3X3M A;  2B8F A;  1L1O C;  3HOZ H;  1NBW A;  2E2H B;  2VB3 X;  2OT2 A;  4JOI A;  5F2D A;  1IHZ A;  1I4H A;  5C3E B;  4GOP C;  1Y8P B;  1EWH A;  1PH5 A;  4RKB A;  3I4O A;  1JOO A;  3NEL A;  1K28 A;  2RBM A;  2YTV A;  1F9Q A;  2SOB A;  3TDQ A;  1VQ9 A;  1X3E A;  3CXC A;  3MXN A;  1EY9 A;  5H1S E;  3I4N H;  5G3L F;  4K2L A;  1CKN A;  3H09 A;  2YV5 A;  4R4I A;  3L0O A;  3KFU A;  1HNZ Q;  1QNU A;  4LUO A;  4JI1 Q;  1V9P A;  1Y14 B;  1S5F D;  1Y1W G;  5IP7 H;  3I4M G;  3K5O A;  4Q0F A;  2RCN A;  2NZ1 D;  1BCP C;  4XT1 B;  2EJM A;  1ET6 A;  1UE6 A;  2KJX A;  4BA2 I;  1YNN C;  3SDZ A;  3UE1 A;  3L3O C;  5J3B A;  5LMN L;  3GTK H;  3HOW B;  3OHX C;  3D4W A;  1B70 B;  3CME A;  3VR3 A;  5EPJ A;  1K8A C;  1C8C A;  1DON A;  1X55 A;  4Y7N B;  1AP0 A;  2CVR A;  4GKK L;  4RHR A;  5CV6 A;  1B50 A;  4IUU A;  2IX1 A;  1PTO F;  4DV6 Q;  1IBL L;  2RF4 A;  4XTC S;  5JJZ A;  3UE0 A;  1I50 B;  3PIP 3;  2IT1 A;  5C0X G;  4KMU C;  1N34 Q;  2K14 A;  3NUC A;  5M5X B;  2PQA B;  3SEB A;  1OXT A;  4LFA Q;  5JEA H;  1TS2 A;  5LMU Q;  2B2U A;  3E9I A;  2XIW A;  4KHZ A;  1ESF A;  2YTX A;  1JT8 A;  2B2Y C;  4F87 A;  2QKI C;  4JI4 Q;  3S2H B;  4LFC Q;  1NSN S;  3G71 A;  4ZAI A;  3MA2 B;  1S40 A;  1C7Y A;  5C3E G;  4DAP A;  4LFB L;  1Q3L A;  4X62 Q;  1LTA D;  3EJI A;  1TT2 A;  4DA2 A;  2VUM B;  4LUZ A;  4HIO A;  1VQ4 A;  4B3M L;  1ZKO A;  1STH A;  3CMA A;  3HOV B;  2HCI A;  2M2L A;  3CCV A;  4OWW B;  4IPC A;  2F0U A;  4PZ8 A;  3S1M B;  1EEI D;  1SXT A;  1JCK B;  3VR6 A;  4G57 A;  4ME5 A;  4DK1 A;  4KHP L;  2EOT A;  1D1I A;  4QCL A;  2RSN A;  1U0L A;  1ASY A;  3HOW G;  1Z6H A;  2OXP A;  1QNK A;  2JA5 H;  2R7F A;  4DR3 Q;  4JPB W;  4MHE A;  3H15 A;  2FFK B;  2PZW A;  1KDC A;  3DWQ A;  5EBD A;  1H95 A;  4Q5V A;  4DXG A;  3GTQ B;  2VQF L;  4JCV E;  3S17 B;  3S2D H;  1H9S A;  3S15 H;  2JA7 G;  1EYA A;  3R93 A;  4ALP A;  2F0M A;  4AIM A;  1B2T A;  4H7B A;  1LAB A;  2LXK A;  3MXP A;  3IL8 A;  1GHJ A;  4RAU C;  1SFO H;  2HHH L;  3PSI A;  3Q24 A;  4JG2 A;  2G5D A;  2JA8 B;  1K8O A;  3IFT A;  3P75 A;  4GKJ L;  3VYR A;  2BDN A;  4V0B A;  1HZA A;  3H3V I;  1HA6 A;  1U9R A;  3J7A 5;  3OSO A;  4P73 A;  1LTS D;  4LF6 L;  1DXM A;  4I7Z C;  5IYD H;  1L2F A;  3TS2 A;  2XNA C;  3WWV A;  1HQR D;  1D5M C;  3HOV G;  1FGB D;  1LTR D;  2PNH A;  1DGS A;  2K03 A;  2LY7 A;  4IPD A;  3KF6 A;  3NBI A;  4FXD A;  1G91 A;  1S3O A;  1ICW A;  2R61 A;  3I91 A;  1PTO C;  1BBU A;  3D4R A;  3RLN A;  5FOB B;  4X64 L;  4HSV A;  1J8I A;  2A6H C;  2AHO B;  4DV0 Q;  4WJ3 M;  5FLX L;  1P16 A;  1TWH H;  1J9O A;  2A69 D;  1V1P B;  1WCM B;  4JI7 L;  4K2K A;  4EQ5 A;  1EY4 A;  1MSH A;  2KHS A;  5C4X G;  4J6H A;  1W3S A;  4PG3 A;  4JBK A;  1QWY A;  3STB D;  1D5Z C;  2RHS B;  3PV0 A;  2X6G A;  3F2C A;  2UU9 Q;  1M4V A;  3C46 A;  1KRS A;  5BN4 A;  5CGK A;  1F2Z A;  2HUG A;  4X65 L;  1RD9 D;  5EPK A;  2H1E A;  2EY1 A;  3ICE A;  4BBS B;  3KK7 A;  2JA8 G;  1D8L A;  2F0O A;  3T1H L;  4XQJ A;  1HTL D;  1SJE D;  1YEZ A;  1PV4 A;  2QF7 A;  3J81 j;  3HOU B;  1ET9 A;  1CSP A;  1FVI A;  3ERQ A;  4CKE A;  1II3 A;  4YY3 Q;  2E2J H;  1JR0 D;  2MO0 A;  1H9R A;  3HOX B;  4HR7 B;  3NBH A;  4XXE A;  1Q46 A;  3NEN A;  4JV5 L;  4UP9 A;  4C3H B;  5I6W A;  1FL0 A;  4RGT A;  4R4C A;  3Q8D A;  1D2B A;  4A3E G;  4UY8 C;  3IRB A;  3ZJY C;  1EY7 A;  1D6E C;  5GAD C;  4BY7 B;  2C35 B;  2RCF A;  1IL8 A;  4DV3 Q;  1F77 A;  4X66 L;  2B2T C;  5C44 G;  2DY8 A;  2F0K A;  2XRS D;  1C4Q A;  2QW7 A;  3I4L A;  2F0T A;  2AWO A;  1WCM G;  3AU7 A;  3BDC A;  3EVQ A;  3TQY A;  2A1A A;  2R92 H;  1N33 L;  3VA7 A;  1KDA A;  5M5W B;  3FKI B;  4MN3 A;  1FR3 A;  4HMJ A;  1R4Q B;  2CW0 D;  1NJI C;  4KKS A;  2SNS A;  5LMN Q;  4BBR H;  1X54 A;  2IWH A;  3QR8 A;  3T4A C;  2LMC B;  2RDF A;  4L8J A;  3BVM A;  2UXC L;  4O2D A;  3SR1 A;  3FEW X;  1HPC A;  4BBS G;  1KTK A;  3K7A B;  5I2X A;  2F03 A;  3TZU A;  1QJO A;  1IBL Q;  2OTJ A;  3TN2 A;  1YVC A;  1H9J A;  1BO0 A;  1I6V C;  4P75 A;  3HOU G;  2B63 H;  3FRP B;  5DEH A;  2HCC A;  1KNA A;  3FPP A;  5JJK A;  3WOE A;  2DGY A;  1CKO A;  1Q1E A;  4APV A;  1KAA A;  4KN7 C;  1DOK A;  2A68 C;  1QE6 A;  3J7A F;  4CGY B;  4B3S L;  5IGE A;  1Q81 C;  3PMF A;  2I5M X;  1O80 A;  3G6J B;  1S4Z A;  4C3H G;  2WIN B;  5M3F H;  1EYG A;  5C5M A;  2Y0S B;  3ND9 A;  2EJG C;  3F2U A;  2PZU A;  3PIO 3;  4DR5 L;  1ZYR D;  4IFD J;  2ZTE A;  4LFB Q;  1GUG A;  1A6X A;  1MI2 A;  1IW7 C;  2PQA A;  3A74 A;  3R2I A;  1WVL A;  4BY7 G;  4IN3 A;  3MXU A;  3T51 B;  3MVV A;  4B3M Q;  4BXX G;  5J39 A;  1PH6 A;  3QIA A;  1TR5 A;  2NZH A;  2F0G A;  3CCL A;  2Q8T A;  5JEA G;  5C3W A;  4YHH L;  2FJ2 A;  5FLX E;  2D5D A;  1VQ8 A;  3RZO H;  1SRO A;  1PTO D;  3WDN A;  4ABN A;  3U58 A;  4FF3 A;  4DNT B;  3SK5 A;  5CBE E;  3FKI G;  3AYH B;  2AWN A;  3RR5 A;  1HNX L;  1EU4 A;  2L55 A;  4H13 C;  1HQM C;  1IYV A;  3I4M H;  1I4Q A;  3MXN B;  4CDF C;  1JMC A;  4DK3 C;  2KCT A;  1Z7T A;  5CV8 A;  1Q82 C;  1V43 A;  1X3P A;  4CDD C;  2L0C A;  4KHV A;  3V05 A;  2D62 A;  2R7Z H;  1OO9 B;  5IGC A;  4B3T L;  2VQF Q;  1XNR Q;  4DN4 M;  2ZXO A;  2UUC L;  3F1Z A;  1UE1 A;  3Q6S A;  2Z6K A;  1PH8 A;  4IFD I;  1D7Q A;  3PO3 H;  2OTL A;  2IY5 B;  3CQZ B;  2HDL A;  5C0X H;  1F2L A;  3GO5 A;  1N32 L;  3QWN A;  1K83 H;  1I4P A;  2KCC A;  2CH4 W;  2F0J A;  5FLX c;  4MTN A;  1XXG A;  1WTQ A;  1BKB A;  2E2H H;  1MD2 D;  3GDE A;  2D9U A;  4K5V A;  2F0P A;  2IL8 A;  1STN A;  5C3E H;  3BDO A;  2I46 A;  1PH4 A;  2A6E D;  1PZI D;  1K9M C;  5D14 A;  1JJ2 A;  4B3R L;  5FO7 B;  4IUN A;  2N88 A;  1DYQ A;  1SND A;  4DV5 L;  3Q0A A;  4DR2 L;  1OXU A;  3V2T A;  2ZJR A;  2HQL A;  4X64 Q;  4RCO A;  3Q22 A;  1SN8 A;  2YYZ A;  4U68 A;  2F4I A;  4HCE A;  2FHT A;  1S5C D;  3O13 A;  3KF8 A;  4DUZ Q;  4A4I A;  1K0S A;  5IYD G;  1SYF A;  3HOW H;  2CFM A;  2PI2 E;  4DV4 Q;  3CW2 C;  3MXG A;  4DK6 C;  1AE2 A;  1HJP A;  3NK9 A;  4LF5 L;  2NN6 H;  4Y7N H;  3RN5 A;  1LUZ A;  3I72 A;  3KUP A;  1K8G A;  2K6A A;  3ND8 A;  4ME3 A;  3TRE A;  1X3F A;  4X65 Q;  1QVC A;  3B6Y A;  3TSS A;  3P20 A;  1I50 H;  4RGO S;  1BDO A;  1V1P A;  2EYJ A;  2NTT A;  1EEF D;  2J7Z A;  5M5X H;  5C5L A;  3T1H Q;  5KNB A;  3GV6 A;  4MTK A;  2KHJ A;  4DR4 L;  4X3S A;  1PA6 A;  1Y1V B;  1J6Q A;  4JVZ A;  1QZG A;  1VQP A;  3SK8 A;  1XPR A;  4DNR B;  1PHJ A;  3S2H H;  3GTO B;  4OHJ A;  2KVM A;  1SE2 A;  2Q2I A;  1EIH A;  1SR3 A;  1IYU A;  2C9O A;  5M9O A;  1WYD A;  1JQY D;  2EXZ A;  1IYJ B;  4JV5 Q;  1JWM D;  4HJA A;  1Q7Y C;  2ZJP A;  2VUM H;  1I6H B;  2PYK A;  1X6O A;  4YWL A;  1CM9 A;  5K36 H;  2N3S A;  1M1K C;  1IW7 D;  3HOV H;  1VF5 C;  2PW5 A;  1I4R A;  3NQT A;  5JOB A;  5LHY 1;  1EWC A;  2DY7 A;  3JAM E;  3S1M H;  1ZXT A;  2J0T D;  1GOZ A;  3DEO A;  5E4W C;  1IKM A;  4LW1 A;  4WOR A;  1AFP A;  1T5E A;  2L1B A;  1XNQ L;  5D65 A;  3EQL C;  1A2U A;  2ZXR A;  5GAH C;  3K5M A;  3KF6 B;  1SYE A;  4ZUJ A;  2VB2 X;  4IPH A;  1MJE A;  3J80 E;  1RF2 D;  2RKS A;  1G2S A;  2BOS A;  3UDX A;  2MNA A;  5IY0 A;  1WI5 A;  4QGU A;  3OTO L;  3GTQ H;  2UXC Q;  2GVA A;  1SE3 A;  1ILP A;  3S17 H;  1B8A A;  4OIK A;  1L1O B;  2MUY A;  2SDF A;  2K5W A;  2L11 A;  2B2W C;  5IWA L;  5IYC G;  4A3J B;  1N9W A;  2EYH A;  3M3Y B;  2Z9H A;  4GOP B;  4A3K B;  3W1G A;  3HKS A;  4GN5 A;  1TY2 A;  4A3M B;  2F0E A;  5EGT A;  3RLO A;  2JA8 H;  2ZT9 C;  2VY3 A;  1TS5 A;  4L5R C;  3S1R B;  3BJU A;  3CAM A;  1PFS A;  4TSS A;  1EYD A;  4AYB B;  1PFN A;  1E22 A;  3X3N A;  3NXW A;  3DXJ C;  3EIV A;  2K5N A;  1WTW A;  4DR5 Q;  1CHQ D;  2MGS A;  3WOF A;  1LT5 D;  3M9B A;  4QB4 A;  2RDH A;  3VR4 A;  2L9H A;  3J80 c;  3BDL A;  1IBK L;  4S3S A;  4RH6 A;  4KD3 A;  5AJ3 L;  1MSG A;  4KY6 A;  4LK1 C;  3FHW A;  3I55 A;  1QVF A;  1H9M A;  1KLG D;  3JAM i;  1CHP D;  3DMU A;  4DXF A;  4YHH Q;  5JAV A;  1E2W A;  4RCN A;  5E1F A;  3LNN A;  3R3O A;  1SMY C;  5J1Z A;  1HNX Q;  4WFN 3;  1EIG A;  2KHI A;  4DPG A;  3F2B A;  1WCM H;  1G51 A;  3D8G A;  1KLU D;  2AKW B;  4OL7 A;  1R9T B;  4NXM L;  4PMC A;  2D0P A;  3E3X A;  4M1U B;  4X3K A;  2QEX A;  4A3J G;  1SYC A;  1GUO A;  4L5Q A;  4B3T Q;  2EVB A;  3W3A A;  3CCQ A;  2UUC Q;  1WJJ A;  4BBS H;  2B39 A;  1KAB A;  3E0J A;  4K6D A;  3GTJ B;  1ML0 D;  1EWI A;  4FO2 A;  1EFW A;  1A63 A;  3HOU H;  1D5X C;  4AYB G;  4XDX A;  3CU7 A;  2EZV A;  5IOD A;  3T53 B;  1N32 Q;  1VQG A;  1VQA A;  2O2L D;  2M9V A;  3I56 A;  3OW2 A;  2I0Q A;  3HOX H;  3NQI A;  3GTG B;  2R93 B;  5EBC A;  3KLS X;  3CPF A;  3LX0 A;  4GN3 B;  2B29 A;  2N8N A;  4C3H H;  2R7Z G;  5C4Z A;  2KUM A;  2K5V A;  2B2V A;  1WTO A;  5LL6 X;  1X32 A;  3V96 A;  1B53 A;  3FVQ A;  1PH3 A;  1PH2 A;  3PO3 G;  3L2P A;  1PLF A;  3BVG A;  4BY7 H;  2WAQ G;  5EKI A;  4DAV A;  3GTM B;  4BXX H;  4DV5 Q;  1DZ1 A;  1HRJ A;  3UDF A;  3AFQ A;  4DR2 Q;  4B08 A;  4F88 A;  4DV1 L;  4JI6 L;  2XWB B;  1HA5 A;  2X69 A;  4U67 3;  3K59 A;  3D4D A;  5IGF A;  2P5Z X;  5M5W H;  3FKI H;  1UE7 A;  2AQ3 B;  4HED A;  2RQX A;  1GM5 A;  5ELN A;  3DM3 A;  2I5H A;  2A19 A;  4E6I A;  1EZ8 A;  2OF1 A;  2PQE A;  1Q86 C;  2XSC A;  3L7Z C;  4LF5 Q;  1WTV A;  1XMO L;  1PXU A;  2E2I B;  2HIV A;  3DEP A;  2UUA L;  4GN4 B;  3K7A H;  4P71 A;  1SYB A;  3PGZ A;  2F0S A;  1YHB A;  3KDF B;  4C3J B;  3H6M A;  2F0Q A;  2MQH A;  3BZD B;  4DGZ A;  3CC4 A;  2BA1 A;  3PO2 H;  4R8I A;  3NP8 A;  5FLM G;  1DOL A;  1PTO B;  4O42 A;  4DR4 Q;  4WJ4 A;  2K50 A;  1JC7 A;  1I94 Q;  4CJ2 C;  1PFB A;  2NVY B;  2DN8 A;  1EIF A;  1UE5 A;  1FNU A;  2CWA A;  2PZT A;  4J8Q A;  4NP5 A;  1STY A;  3TP8 A;  1PYB A;  2NN6 G;  1UWV A;  3HEJ A;  2AUJ D;  4B9X A;  1UEA B;  1TWA B;  2QEJ C;  3JC6 6;  4NXN L;  2MFI A;  2IHF A;  3PF4 A;  2XWJ B;  4A3G B;  3KBG A;  4HID A;  1CKM A;  2HT1 A;  4QY7 A;  1V8Q A;  2WKC A;  3PQI A;  1VQ7 A;  1WD1 A;  2EYO A;  1IKL A;  1SDF A;  1A62 A;  3DWP A;  2G9D A;  1JJC B;  1F9R A;  1I5F A;  2JEA I;  4ZLT F;  1XNQ Q;  2XRQ D;  2UXB L;  4A75 A;  5K5P A;  3MFY A;  2HIX A;  1STG A;  1LT6 D;  4DKA C;  3T56 B;  2R7D A;  2BCO A;  1VQO A;  3FDT A;  3P1H A;  4RA8 A;  1QIL A;  3S16 B;  3OYY A;  2WAC A;  4LAA A;  4CDC C;  5A2Q E;  2VUM G;  5M5Y B;  2XN9 C;  2E75 C;  1YNJ C;  5K36 G;  3CKI B;  3S9W A;  4C3J G;  3KF8 B;  3G4S A;  1NCV A;  5IWA Q;  2GN5 A;  2O5I C;  1HNW L;  3H3V H;  1HZ9 A;  1S5E D;  4EQP A;  2QDB A;  3CQZ H;  1CZW A;  1IXR A;  1UNS A;  1BBW A;  3UDG A;  2EJF C;  2QCP X;  4TQU S;  3LWE A;  3GTL B;  3J7Y W;  2FMC A;  1L1O A;  4XIG S;  1M90 C;  1A3T A;  1BQQ T;  3MAQ A;  1YJW A;  2QA4 A;  4A3G G;  1BCP D;  1NUC A;  4IJH A;  4GOP A;  1DOM A;  1YNN D;  4CHT B;  4ZQ3 A;  4OO1 G;  4H02 A;  3DHQ A;  2OEO A;  1O7L A;  2EQS A;  3FP9 A;  2Z6K C;  5AJ3 Q;  4DUY L;  1SSO A;  2ZM6 Q;  4DR1 L;  2TSS A;  1EFI D;  1O7Y A;  3J81 E;  1DJR D;  1LT3 D;  4NDX A;  1MHW C;  2XVS A;  1CFM A;  3RMH A;  3NTH A;  1NMF A;  3A5U A;  3CF5 A;  4IOC A;  2F0V A;  2PCF B;  4KI0 A;  3H0G B;  4NB3 A;  3TEH B;  3G7L A;  4ZK9 B;  1NAP A;  5FK9 C;  2DJG C;  3HZX A;  1J5E Q;  2PPB C;  3S1N B;  1VS0 A;  2F0N A;  4G7H C;  1B1Z A;  2F0F A;  1XTC D;  4PZ7 A;  1AZQ A;  2AMC B;  2BH2 A;  3AB9 A;  3K0Y A;  1PRT F;  5GAE C;  2Q8R E;  1S5B D;  1B9M A;  4X3T A;  5IYB G;  3ITP A;  1E0B A;  5GAG C;  1ZEQ X;  3RLF A;  5IYC H;  1HR0 W;  1K0R A;  1LTI D;  4DK0 A;  1CA5 A;  3N52 A;  4YCU A;  1PH1 A;  1SNM A;  1JB7 A;  2EY6 A;  5NUC A;  1Y1V H;  1RDP D;  3C1F A;  2EIF A;  3DLL A;  1CA6 A;  1E3P A;  3U50 C;  3GTO H;  4N9T A;  1BNZ A;  3D6W A;  2NYZ D;  1VMP A;  4R4Q A;  1SRU A;  1B4O A;  1HUM A;  4I7A A;  4FF1 A;  1I6H H;  1YZ6 A;  4GKK Q;  3T13 A;  3KBX A;  1QCB D;  2L12 A;  3SE0 A;  1Z9F A;  3J81 i;  1QB5 D;  3HG9 A;  1M8A A;  4OGQ C;  3H0G G;  5C4J B;  4DV1 Q;  3PO2 B;  1TS4 A;  4MIU A;  1QZH A;  4JI6 Q;  2L5T A;  2IJ0 A;  4DAY A;  1YHA A;  3DUZ A;  1E24 A;  1DM0 B;  1A3V A;  3HOX G;  2YU9 B;  5G3L D;  4EQO A;  1VQF A;  3PUV A;  5FJ8 G;  4FDB A;  2CCZ A;  3DWA A;  1YNX A;  4IUQ A;  2F0L A;  3SK4 A;  4GS3 A;  5IE8 A;  1N8R C;  1SJH D;  2Z4I A;  4A3B B;  1F2M A;  3GP7 A;  4WJW A;  2YTY A;  3MEH A;  3CC7 A;  3CCR A;  1XMO Q;  2N49 A;  2UUA Q;  3T1Y L;  4DF7 A;  4GNX C;  3FPU B;  4QUF A;  1VQB A;  3UI2 A;  3K58 A;  4A3J H;  3M3Y H;  4C1N I;  4TVA B;  5C0X J;  3OOC A;  4A3K H;  3HKZ B;  1L0W A;  1H9K A;  3R8B A;  2E74 C;  1LAC A;  4A3M H;  1HUN A;  1EZ6 A;  5DNF A;  3NWS A;  4FXG C;  1OTC A;  4RGM A;  1HFG A;  3S1R H;  2JQO A;  4H0L C;  4CBV A;  3JAM L;  4BY1 H;  4KHP Q;  5E7N A;  2NVQ B;  1AE3 A;  4PNY A;  4XYO A;  2A6H D;  4A3I B;  4PQX A;  3EN2 A;  3N6R A;  4KJO A;  3K0X A;  1OXX K;  2KEE A;  3KDF A;  1I4G A;  1YBY A;  1AW7 A;  4GZY C;  4NXN Q;  2MO1 A;  3J80 L;  2Z8L A;  2EY5 A;  2WII B;  1KDB A;  1G2T A;  4JI5 L;  1PRT C;  1TQO A;  4PMW A;  2ES2 A;  1G6Z A;  3PO2 G;  1SE4 A;  4DR6 L;  3EA6 A;  3I90 A;  1G29 1;  2HHH Q;  1E1O A;  1LM0 A;  1PH9 A;  1VQH A;  1KAW A;  2UXB Q;  4FP5 D;  5BR8 L;  1E1T A;  5EQ0 A;  2Y0S G;  5C0X I;  4GKJ Q;  2A73 B;  4ZCK A;  4JC0 A;  1JOQ A;  4A3B G;  3BZK A;  1R9T H;  4R9W A;  3MFG A;  4IFD H;  4LF6 Q;  4UAI A;  1A3U A;  1B44 D;  2K32 A;  2R3Z A;  4HN7 A;  4JI3 L;  1HNZ L;  2MHV A;  3HKZ G;  2FIN B;  4JI1 L;  4YCV A;  3I3C A;  4NPS A;  4C2M B;  1JJG A;  1S5D D;  4IUT A;  5JJI A;  4A3F B;  3R2T A;  4FXK C;  3CP0 A;  2WB1 B;  5EJW A;  3GTJ H;  2PW7 A;  3QOJ A;  1U4L A;  3G48 A;  1V1O A;  4IZ8 A;  5HGT A;  3TS0 A;  2ICE C;  1HXY D;  4QJF A;  4A3I G;  5FLM H;  2UUB L;  3M4O B;  3RNU A;  4CJ1 B;  2IPK D;  1GUT A;  3QJY A;  3GTG H;  2R93 H;  4JI7 Q;  1SYD A;  1C9O A;  4LWC A;  2BE5 C;  4P74 A;  3T16 A;  1EQR A;  4JOI C;  1XPU A;  2FXQ A;  4KKT A;  1LO5 D;  5JVG 3;  4DV2 L;  1N34 L;  2WFW A;  1ENA A;  4HIK A;  3MTS A;  1F9P A;  5LMU L;  4DV7 L;  1YHQ A;  1RIP A;  5CV5 A;  1B3Q A;  4DUY Q;  2B2T A;  4DR1 Q;  3GTM H;  1RL2 A;  1TY0 A;  2OQ0 A;  3L9A X;  2E5L L;  2ENB A;  1HFN A;  2PMZ B;  1QVG A;  2JEB I;  2SNM A;  2JXM B;  4JI8 L;  2RSO A;  3E6Z X;  3I8Z A;  3M4Y A;  2FMM A;  4POG A;  3Q23 A;  3HS0 C;  3U9S A;  2VXW A;  2DUD A;  1JWS D;  1SNC A;  3I2Z A;  2A68 D;  3MHB A;  1B9N A;  2UXD L;  2B2V C;  4I65 A;  1RJT A;  1FNW A;  2E2I H;  1VQL A;  3PIO A;  4KK7 A;  3S14 B;  4MNO A;  1TII D;  5ELE A;  1SMX A;  4A3F G;  3VA5 A;  2WB1 G;  1PYS B;  5HGQ A;  2JA6 H;  1MBY A;  2QDL A;  4C3J H;  4FF2 A;  2Z4H A;  5I9P A;  4DR7 L;  4KLK A;  3BU2 A;  1OXV A;  4ODG A;  1O7I A;  4RMF A;  2B2U C;  4X66 Q;  1PTO H;  1PYW D;  3GQB A;  2NVY H;  4F7X A;  5CV9 A;  2OCE A;  2NUC A;  3CCJ A;  4IUV A;  4IO9 A;  2Q8I B;  2JN4 A;  1STE A;  1N33 Q;  1O78 A;  2VL6 A;  1W2B A;  4GLA C;  1OXS C;  3SXH A;  3CCS A;  1E2Z A;  4K14 A;  1TWA H;  2JJQ A;  4EGV A;  3NSW A;  5CMD A;  4A3G H;  1AN8 A;  4J15 A;  3U4Z A;  4O0A A;  3CCM A;  4OO1 H;  5ELD A;  4QIW E;  1VMC A;  4JYA L;  4LF8 L;  1LT4 D;  2IW3 A;  2KEC A;  1PRT D;  4AYB E;  1Y1V G;  1EQV A;  2ZJQ A;  1I4X A;  4CDE C;  4RGN A;  5IGB A;  2A74 C;  3PUZ A;  4B3S Q;  3JAM c;  4PZ6 A;  3LWU A;  1L0Y B;  4UHV A;  5IP9 G;  2N55 A;  4BY1 B;  2HD3 A;  4K8I A;  3S16 H;  4A3C G;  3KJO A;  2C5C A;  2XGT A;  1JIC A;  2ICI A;  4NMZ A;  3K5N A;  3C2P A;  1BXT A;  1BCP B;  5M5Y H;  1SBB B;  5I9O A;  4DU9 A;  4KTA A;  1HZC A;  3SHL A;  5KYI A;  1JOR A;  4HJ7 A;  4JI2 L;  3FMC A;  2ATW A;  3VR5 A;  3HOY B;  3ONA B;  2EYP A;  1G8Z D;  3ZYY X;  3T1Y Q;  1VQJ A;  2I07 B;  4H44 C;  2GVB A;  2WAQ E;  1HH2 P;  3ULL A;  1SAP A;  1EQT A;  4L5T A;  1TWF H;  4HJ8 A;  4A93 B;  4K8J A;  1X3G A;  3TP7 A;  5IYB H;  1Y1W B;  1LV9 A;  4BA1 I;  4R4T A;  4RWS C;  3SK6 A;  1GO3 E;  4HMI A;  1YJ9 A;  1NNX A;  1KL9 A;  1GVP A;  2KOL A;  1CK1 A;  3GTL H;  2F0H A;  5BN5 A;  2L15 A;  3MC0 B;  1Q90 A;  5LMN W;  4C3I B;  4K0K L;  3TP6 A;  2BE5 D;  1DCZ A;  4RG1 A;  3U9O A;  4A3K G;  5I4D A;  1KHI A;  3OPO A;  5A2Q L;  5JEA J;  1XWE A;  4TRD A;  1BUV T;  4A3M G;  1U4M A;  4DR6 Q;  1L0X B;  3W2D A;  4P2C B;  5L37 A;  1MJC A;  5C4H A;  4HJ9 A;  4YWK A;  4BY1 G;  4LUV A;  5BR8 Q;  3H0G H;  3PUY A;  3OWF A;  4N8X 1;  5I2Y A;  3ULJ A;  4PMB A;  3C3L A;  3BYY B;  1ONL A;  1KXL A;  3NPP A;  2WV6 D;  3S1N H;  2M00 A;  5FJ8 H;  3HOY G;  3M4Q A;  3ERS X;  3J7Z C;  1PVO A;  1CTM A;  1EY0 A;  4DAY B;  4RHS A;  5IOC A;  4DV3 L;  1XJV A;  2JP1 A;  3U4V A;  3AFP A;  4JI3 Q;  3KLR A;  4A93 G;  4R4O A;  2A69 C;  1SNO A;  2OWO A;  5AFW A;  4LMQ D;  4RFB A;  4ZUI A;  1F2Y A;  1CT1 D;  1AEX A;  4B3R Q;  3QB3 A;  1EQQ A;  3ULP A;  1XMQ L;  4A3D B;  3STB C;  1P8L A;  1SYG A;  5KNC A;  1JB3 A;  3S1Q B;  1WTX A;  3J81 L;  2UUB Q;  1XPO A;  5CBA E;  2F0I A;  4C3I G;  4IFD G;  3NTK A;  5CV4 A;  4RKL A;  3HP3 A;  5COR A;  1A0I A;  4ID6 A;  1WOC A;  3K7U C;  4FVM A;  2Q2T A;  2JA7 B;  3TZD A;  3G6E A;  4DV2 Q;  2HDM A;  1GHK A;  4KY5 A;  5FO8 B;  1S72 A;  2MPM A;  4OX9 L;  1EUJ A;  4NW2 A;  4DV7 Q;  5FKA C;  2PO4 A;  4GLV B;  1U4P A;  5KIX A;  3P7J A;  2VW9 A;  1K3B C;  3IKJ A;  4K6L A;  2JA6 B;  1TWG B;  4OXP A;  4N8F A;  1FYC A;  2K04 A;  2E5L Q;  4K5X A;  5C4J H;  1LTB D;  4JI8 Q;  3GTP B;  4HTH A;  4UP8 A;  2EE1 A;  1YI2 A;  2YU9 H;  1EYC A;  5CV7 A;  1CSQ A;  2R93 G;  4QUC A;  1N36 L;  3W5O A;  2MP1 A;  3PUW A;  1VCI A;  1GUW A;  5DLQ E;  4IQZ A;  2NVT B;  1BR9 A;  2NWG A;  3ER0 A;  2UXD Q;  2JA9 A;  4A3B H;  3MWY W;  1FGU A;  2F3V A;  2VQE L;  2B2W A;  2H5X A;  2K33 A;  3TME A;  2JSO A;  1NR4 A;  3CC2 A;  4IPG A;  4EX5 A;  3K81 C;  4C1N K;  3ERO A;  3NHH A;  1CUK A;  1U4R A;  4A3D G;  2CW0 C;  1QG7 A;  2K05 A;  4YWM A;  3OMC A;  5ELF A;  4DR7 Q;  3H91 A;  3CD6 A;  5TSS A;  2PI2 A;  1SNQ A;  1BOS A;  3PCO B;  4POF A;  1EL0 A;  1FNV A;  1ICF B;  4KV6 A;  2NVX B;  2NVQ H;  5C4X B;  1SMY D;  1VQE A;  1XNR L;  4A3I H;  1PMR A;  1KQS A;  1SE8 A;  4NKL A;  1YIT A;  3GV3 A;  1GUN A;  4AH6 A;  1BF4 A;  1B7Y B;  5LL6 S;  5HUR A;  4BS9 A;  4HSP A;  1SNP A;  3OTO Q;  5CR3 A;  3TBI B;  2JA6 G;  3KOJ A;  3CRL C;  3QG1 A;  1EIY B;  1QUQ B;  2E8G A;  1TWC B;  1I3Q B;  4JYA Q;  4LF8 Q;  1Y69 U;  1TWF B;  4DFA A;  1ZYR C;  2KED A;  5E3F A;  2TMP A;  2EY2 A;  5D3I B;  2N78 A;  4L5S A;  4M8A A;  1WTP A;  4ZYS A;  5IGG A;  1FD7 D;  2QGQ A;  2LFN A;  2IX3 A;  5JPN C;  3VYU A;  1EU3 A;  1Q1B A;  2I5L X;  1VQ6 A;  4L63 B;  3DM1 A;  2R6G A;  3OMG A;  4JI2 Q;  4A3E B;  1W6K A;  4TKO B;  1RTO A;  1TS3 A;  1RHP A;  1IBK Q;  4LJZ C;  4C2M H;  1NMG A;  5M3M B;  5IT9 L;  1A8V A;  5C44 B;  4A3F H;  2H4O A;  1KD1 C;  1JWU D;  4DUZ L;  3RZD B;  3VDY A;  1TXY A;  2IX0 A;  3PIP A;  1ENC A;  1K3R A;  3K6O A;  4DV4 L;  5CYU A;  4LF4 L;  2ZTD A;  3M4O H;  2LXJ A;  3HOZ B;  4LNQ A;  5IGD A;  4HIM A;  3BG3 A; 
#chains in the Genus database with same CATH homology
 3OTO L;  1G29 1;  4KHZ A;  3GTQ H;  2GVA A;  3SGI A;  1E1O A;  1GKH A;  2YTX A;  1B8A A;  3HFZ B;  1LM0 A;  4UP7 A;  1PH9 A;  2HHH Q;  1VQH A;  1L1O B;  1KAW A;  4X6A H;  2UXB Q;  1JT8 A;  5BR8 L;  4K0K Q;  2CWP A;  4JI4 Q;  1E1T A;  1VQD A;  5IWA L;  5IYC G;  4LFC Q;  2Y0S G;  1N9W A;  5C0X I;  3G71 A;  5IYB H;  2Q2U A;  4A3L G;  4GKJ Q;  1S40 A;  1C7Y A;  4JC0 A;  5C3E G;  5EAY A;  4GOP B;  3W1G A;  3HKS A;  4GN5 A;  4A3B G;  3BZK A;  1R9T H;  1MIU A;  4LFB L;  4X62 Q;  3K8A A;  3RLO A;  4Y52 H;  4LF6 Q;  2JA8 H;  4GNX B;  4LUZ A;  2VY3 A;  4HIO A;  1VQ4 A;  4B3M L;  1Q12 A;  4L5R C;  3BJU A;  3CMA A;  3CAM A;  4JI3 L;  1PFS A;  1HNZ L;  3HKZ G;  3CCV A;  4OWW B;  4JI1 L;  4IPC A;  4YCV A;  1E22 A;  4PZ8 A;  1ASZ A;  4NPS A;  3J81 c;  1JJG A;  3EIV A;  5JJI A;  2K5N A;  3CP0 A;  4DR5 Q;  3GTJ H;  3TS0 A;  1NE3 A;  3G48 A;  4KHP L;  3M9B A;  5IP9 H;  4LF7 L;  1U0L A;  1ASY A;  3J80 c;  4A3C H;  3HOW G;  5JJL A;  2K4K A;  4QJF A;  1IBK L;  3S14 H;  5AJ3 L;  4A3I G;  5M3M G;  3AQQ A;  2JA5 H;  5FLM H;  2UUB L;  2R7F A;  3RNU A;  4DR3 Q;  3FHW A;  3I55 A;  3H15 A;  1IBM L;  1QVF A;  3JAM i;  3GTG H;  2R93 H;  1VQI A;  4YHH Q;  4JI7 Q;  1LYL A;  1H95 A;  1C9O A;  3D31 A;  4LWC A;  4P74 A;  1EQR A;  1FJG L;  4JOI C;  2VQF L;  4JCV E;  1XPU A;  2FXQ A;  3S15 H;  3S2D H;  2JA7 G;  4AQY L;  4DV2 L;  3HOZ G;  4ALP A;  1XMQ Q;  1N34 L;  2WFW A;  1HNX Q;  4AIM A;  4HIK A;  2KHI A;  4DPG A;  3F2B A;  2Y0S E;  1WCM H;  2LXK A;  1G51 A;  5LMU L;  4DV7 L;  1YHQ A;  4NXM Q;  2F4V L;  1RIP A;  4DUY Q;  1U5K A;  1Z47 A;  4DR1 Q;  1SFO H;  2HHH L;  2AKW B;  4NXM L;  3PSI A;  3GTM H;  1RL2 A;  4JG2 A;  2OQ0 A;  2D0P A;  2E5L L;  1QVG A;  3A0J A;  2JEB I;  2KEN A;  2QEX A;  4A3J G;  3I4N G;  4GKJ L;  4JI8 L;  2ASB A;  4L5Q A;  4B3T Q;  3HKZ E;  1HZA A;  5HY6 A;  3H3V I;  4POG A;  3CCQ A;  5IP7 G;  2UUC Q;  3J7A 5;  1HR0 L;  1WJJ A;  4BBS H;  4P73 A;  2WP8 J;  4LF6 L;  4OX9 Q;  2DUD A;  2K52 A;  3I2Z A;  5IYD H;  1L2F A;  3TS2 A;  3WWV A;  2ALY B;  3HOV G;  1EWI A;  2UXD L;  2PNH A;  1DGS A;  1EFW A;  1A63 A;  3HOU H;  4AYB G;  4IPD A;  3KF6 A;  2E2I H;  1VQL A;  3PIO A;  1N32 Q;  2RHQ B;  1VQG A;  1VQA A;  1S3O A;  4MNO A;  3I56 A;  1SMX A;  4LF9 L;  3OW2 A;  4A3F G;  2I0Q A;  2WB1 G;  1BBU A;  1PYS B;  3HOX H;  2F52 A;  5HGQ A;  2JA6 H;  3F8T A;  1N36 Q;  4C3J H;  2ID0 A;  3RLN A;  1GD7 A;  3CPF A;  4KLK A;  4X64 L;  3BU2 A;  4GN3 B;  4DR7 L;  2B29 A;  1OXV A;  2N8N A;  4C3H H;  2R7Z G;  1O7I A;  4RMF A;  4UPA A;  2AHO B;  4X66 Q;  4DV0 Q;  2K5V A;  4WJ3 M;  1P16 A;  1TWH H;  2NVY H;  2OQK A;  1YJN A;  2OCE A;  2VQE Q;  4JI7 L;  5GRO A;  1PH3 A;  3HOY H;  4EQ5 A;  3CCJ A;  1PH2 A;  3PO3 G;  3L2P A;  3CCU A;  4BY7 H;  4IO9 A;  2WAQ G;  1N33 Q;  5C4X G;  4R1J A;  2F3I A;  4BXX H;  2VL6 A;  4JBK A;  1W3S A;  4PG3 A;  4GLA C;  1OXS C;  4DV5 Q;  1VQC A;  1W2B A;  3CCS A;  3STB D;  2RHS B;  3AFQ A;  3UDF A;  4DR2 Q;  3PV0 A;  4DV1 L;  4A93 H;  1TWA H;  2JJQ A;  3F2C A;  1Y1W H;  2UU9 Q;  4JBM A;  4JI6 L;  1KRS A;  4A3G H;  2K75 A;  1BVS A;  4X65 L;  1IZ6 A;  1CKN B;  4J15 A;  1K73 C;  2VZA A;  3U4Z A;  3FKI H;  5M5W H;  1UE7 A;  2VS1 A;  4MZ9 A;  4O0A A;  3CCM A;  3ICE A;  3W1B A;  1XTD A;  1C0A A;  2JA8 G;  4QIW E;  1D8L A;  4JYA L;  3T1H L;  2ZTC A;  1GM5 A;  4LF8 L;  5ELN A;  3DM3 A;  2I5H A;  1X56 A;  2A19 A;  2KCM A;  1YEZ A;  1PV4 A;  3J81 j;  1Q86 C;  1CSP A;  1FVI A;  3L7Z C;  4AYB E;  1Y1V G;  2Z0S A;  1XMO L;  4LF5 Q;  2ZJQ A;  2HIV A;  4C3I H;  4YY3 Q;  3RN2 A;  2UUA L;  4GN4 B;  3F2D A;  3K7A H;  2E2J H;  3KJP A;  4P71 A;  2MO0 A;  3PGZ A;  2BH8 A;  2WB1 E;  2JE6 I;  3PUZ A;  1YHB A;  3JAM c;  4PZ6 A;  4B3S Q;  1IL2 A;  3KDF B;  5IP9 G;  1Q46 A;  2MQH A;  3NEN A;  3CC4 A;  3S16 H;  4A3C G;  3KJO A;  2BA1 A;  4UP9 A;  2XGT A;  4JV5 L;  3PO2 H;  1FL0 A;  1UEB A;  3UDI A;  5IT9 c;  2JA5 G;  5FLM G;  1HNW Q;  5M5Y H;  4DR4 Q;  4WJ4 A;  2K50 A;  1I94 Q;  1V1Q A;  4R4C A;  1PH7 A;  3NEM A;  1HZC A;  2V1C C;  1EIF A;  1UE5 A;  3Q8D A;  4QQB X;  4HJ7 A;  4A3E G;  4JI2 L;  4UY8 C;  3IRB A;  2ATW A;  3ZJY C;  5GAD C;  3T1Y Q;  1T9H A;  1VQJ A;  2CWA A;  2C35 B;  1HZB A;  2GVB A;  2WAQ E;  1HH2 P;  3ULL A;  4DV3 Q;  4X66 L;  1PYB A;  4L5T A;  4OON A;  2NN6 G;  1TWF H;  1UWV A;  5C44 G;  4HJ8 A;  1QUQ A;  4OWX B;  3JC6 6;  1X3G A;  4NXN L;  2MFI A;  2AWO A;  1WCM G;  3TQY A;  2IHF A;  3E0E A;  3I7F A;  4BA1 I;  3PF4 A;  2A1A A;  4R4T A;  4DV6 L;  4HID A;  1AH9 A;  2R92 H;  1CKM A;  2CKZ B;  1N33 L;  2HT1 A;  1GO3 E;  1YJ9 A;  4QY7 A;  1LTL A;  1KL9 A;  1GVP A;  1NJI C;  3GTL H;  1VQ7 A;  2PMZ E;  2L15 A;  1SLJ A;  5LMN Q;  4LFA L;  1KRT A;  2CQO A;  2NN6 I;  3S17 H;  4BBR H;  1A62 A;  1G6P A;  1X54 A;  1JJC B;  5LMN W;  2UXC L;  4O2D A;  1I5F A;  2JEA I;  1XNQ Q;  2UXB L;  4BBS G;  4A3D H;  4K0K L;  4JI4 L;  4A75 A;  2HIX A;  4LFC L;  1IBL Q;  2OTJ A;  4DKA C;  3S1Q H;  4JBJ A;  4RG1 A;  1YVC A;  2R7D A;  4LF4 Q;  4P75 A;  1VQO A;  4A3K G;  3HOU G;  1KHI A;  2B63 H;  4GLX A;  3S24 A;  5JEA J;  4X62 L;  5JJK A;  3OYY A;  4A3M G;  4DR6 Q;  2DGY A;  1VQK A;  1CKO A;  1Q1E A;  4APV A;  1KC8 C;  2VUM G;  1MKH A;  5K36 G;  1MJC A;  4HJ9 A;  4B3S L;  4YWK A;  2Q2H A;  3K80 C;  4BY1 G;  4LUV A;  2JA7 H;  3KF8 B;  5BR8 Q;  3G4S A;  1Q81 C;  2I5M X;  3H0G H;  1EYG A;  3PUY A;  5M3F H;  5IWA Q;  2GN5 A;  3ULJ A;  1HNW L;  3E9H A;  4DAM A;  3H3V H;  2XTI A;  1WFQ A;  1I94 L;  1HZ9 A;  4DR5 L;  4IFD J;  1KXL A;  2ZTE A;  4LFB Q;  3CQZ H;  3S1N H;  1IXR A;  1TWG H;  5FJ8 H;  3HOY G;  2PQA A;  3A74 A;  3ERS X;  3M4Q A;  3J7Z C;  4BY7 G;  4DAY B;  1PVO A;  1BBW A;  4DV3 L;  3UDG A;  1XJV A;  1EOV A;  3GD7 A;  3U4V A;  4TQU S;  4B3M Q;  4BXX G;  3AFP A;  1PH6 A;  3GTP H;  4DR3 L;  4JI3 Q;  4A93 G;  1L1O A;  2NZH A;  4R4O A;  4XIG S;  1M90 C;  3CCL A;  3LGJ A;  5JEA G;  4YHH L;  3MEF A;  1YJW A;  2OWO A;  2QA4 A;  1VQ8 A;  4A3G G;  3RZO H;  1SRO A;  1X9N A;  4IJH A;  4IOA A;  3U58 A;  2KBN A;  4GOP A;  2NVT H;  4B3R Q;  3FKI G;  3AYH B;  1EQQ A;  2AWN A;  3ULP A;  3RR5 A;  4OO1 G;  1HNX L;  1XMQ L;  3D0F A;  4H02 A;  3STB C;  4LF7 Q;  1P8L A;  4GNX A;  2EQS A;  3FP9 A;  2Z6K C;  3I4M H;  3MXN B;  5AJ3 Q;  4DUY L;  1JMC A;  2VNU D;  4DK3 C;  1NTG A;  2KCT A;  4P72 A;  2ZM6 Q;  4DR1 L;  1XPO A;  1V43 A;  1Q82 C;  2UUB Q;  4IFD G;  1IBM Q;  3M4P A;  4OO1 I;  2D62 A;  3EBE A;  1FJG Q;  3A5U A;  1NMF A;  2R7Z H;  3CF5 A;  4B3T L;  1A0I A;  3AEV A;  2VQF Q;  1WOC A;  3K7U C;  1XNR Q;  2K5H A;  2Q2T A;  4IOC A;  4IJL A;  3M7N A;  4AQY Q;  3G6E A;  4DV2 Q;  2UUC L;  3F1Z A;  4KI0 A;  1UE1 A;  1S72 A;  1Q8K A;  4NB3 A;  3TEH B;  4OX9 L;  1EUJ A;  3TRZ A;  5GQO A;  4DV7 Q;  2F4V Q;  2Z6K A;  4GLV B;  2NVX H;  1PH8 A;  4IFD I;  1D7Q A;  1J5E Q;  3PO3 H;  1YIJ A;  2OTL A;  2NZO A;  5C4X H;  1VQ5 A;  2IY5 B;  2VW9 A;  3KLW A;  1VS0 A;  3CPW A;  3BZC A;  4OXP A;  1VQM A;  2JK8 A;  2E5L Q;  3GO5 A;  4PZ7 A;  5C4J H;  2AMC B;  1N32 L;  2BH2 A;  1K83 H;  4JI8 Q;  5FLX c;  5GAE C;  4UP8 A;  1YI2 A;  2YU9 H;  4MTN A;  1CSQ A;  5IYB G;  1N36 L;  2R93 G;  3W5O A;  1HR0 Q;  3PUW A;  1BKB A;  1TWC H;  2E2H H;  2R92 G;  1VCI A;  5GAG C;  1I3Q H;  2LSS A;  5DLQ E;  4DNI A;  3RLF A;  3GDE A;  5IYC H;  1K0R A;  1HR0 W;  4A3L H;  3PUX A;  4DV0 L;  3ER0 A;  4YCU A;  2UXD Q;  5C3E H;  1PH1 A;  1PH4 A;  2JA9 A;  1JB7 A;  4A3B H;  1FGU A;  1Y1V H;  4QL5 A;  2VQE L;  4BBR G;  2BA0 A;  2EIF A;  2H5X A;  4YCW A;  3DLL A;  2B3G A;  2EXD A;  1K9M C;  1E3P A;  2D0O A;  3CC2 A;  4IPG A;  4EX5 A;  1JJ2 A;  2A8V A;  3U50 C;  4LF9 Q;  3K81 C;  4HJ5 A;  3GTO H;  4B3R L;  4DV5 L;  1CUK A;  4DR2 L;  4A3D G;  4R4Q A;  1SRU A;  1OXU A;  4YWM A;  1VQN A;  2UU9 L;  2ZJR A;  2HQL A;  4X64 Q;  4DR7 Q;  3CD6 A;  1SN8 A;  2PI2 A;  2YYZ A;  2ZM6 L;  3PCO B;  4POF A;  2B63 G;  3A5Z B;  1I6H H;  3NBH B;  3PF5 A;  1YZ6 A;  3KYH C;  4GKK Q;  4DUZ Q;  4A4I A;  4A3E H;  1X65 A;  5IYD G;  4A76 A;  2NVQ H;  3HOW H;  2CFM A;  2PI2 E;  4DV4 Q;  1Z9F A;  3CW2 C;  1VQE A;  4JBW A;  3J81 i;  4A3I H;  5M3M H;  1XNR L;  4JI5 Q;  4DK6 C;  1AE2 A;  1HJP A;  5C44 H;  1KQS A;  4Y7N H;  1SE8 A;  4JI0 Q;  3RN5 A;  1LUZ A;  1YIT A;  4LF5 L;  4AH6 A;  4YY3 L;  3H0G G;  1B7Y B;  4DV1 Q;  2UXC Q;  1KIX A;  5M3F G;  1QZH A;  1E7Z A;  4OWT B;  3CCE A;  1K8G A;  4JI6 Q;  1YHA A;  2IHE A;  3RZD H;  4ME3 A;  3J80 i;  1J5E L;  3TRE A;  1E24 A;  1X3F A;  1NY4 A;  4X65 Q;  3M85 A;  1QVC A;  3OTO Q;  3HOX G;  3B6Y A;  5ELO A;  1VQF A;  3KOJ A;  3PUV A;  1I50 H;  1JE5 A;  5FJ8 G;  1EIY B;  2JA6 G;  1QUQ B;  2E8G A;  1L1O C;  4FDB A;  2CCZ A;  1NBW A;  1YNX A;  3HOZ H;  5M5X H;  4JYA Q;  3T1H Q;  4JI0 L;  4LF8 Q;  4JOI A;  4GS3 A;  5IE8 A;  2KHJ A;  4DR4 L;  1N8R C;  4GOP C;  1PH5 A;  3I4O A;  1PA6 A;  1J6Q A;  2YTY A;  3NEL A;  3CC7 A;  3CCR A;  1XMO Q;  2N49 A;  2YTV A;  2UUA Q;  1QZG A;  1VQP A;  3T1Y L;  1XPR A;  1X3E A;  3CXC A;  2N78 A;  4GNX C;  1PHJ A;  1VQB A;  5H1S E;  4A3J H;  1VQ9 A;  4L5S A;  3I4N H;  3M3Y H;  3S2H H;  1CKN A;  2Q2I A;  2YV5 A;  2QGQ A;  4R4I A;  4TVA B;  1SR3 A;  5C0X J;  3L0O A;  4A3K H;  1WYD A;  1HNZ Q;  3KFU A;  1L0W A;  4LUO A;  4JI1 Q;  1V9P A;  1Y14 B;  1IYJ B;  1Y1W G;  5IP7 H;  4JV5 Q;  4A3M H;  3I4M G;  2I5L X;  1Q1B A;  4HJA A;  1Q7Y C;  2ZJP A;  2RCN A;  2VUM H;  1OTC A;  1X6O A;  1VQ6 A;  1UE6 A;  4YWL A;  3S1R H;  4BA2 I;  2N3S A;  2JQO A;  1M1K C;  3HOV H;  2R6G A;  3UE1 A;  4BY1 H;  4JI2 Q;  4KHP Q;  5E7N A;  5J3B A;  5LMN L;  1AE3 A;  3GTK H;  1B70 B;  3CME A;  1K8A C;  1IBK Q;  3S1M H;  4C2M H;  1NMG A;  1X55 A;  1A8V A;  3EN2 A;  3K0X A;  4A3F H;  1OXX K;  3KDF A;  4LW1 A;  1YBY A;  1KD1 C;  1XNQ L;  4GKK L;  5GAH C;  4DUZ L;  4NXN Q;  3KF6 B;  2MO1 A;  2IX1 A;  4DV6 Q;  3VDY A;  1TXY A;  2IX0 A;  3PIP A;  1IBL L;  1K3R A;  4DV4 L;  2RF4 A;  4XTC S;  4LF4 L;  2ZTD A;  4IPH A;  3UE0 A;  4JI5 L;  1MJE A;  2IT1 A;  3M4O H;  2LXJ A;  5C0X G;  3UDX A;  4LNQ A;  1N34 Q;  2K14 A;  4PMW A;  2ES2 A;  3PO2 G;  2PQA B;  4DR6 L;  2MNA A;  1OXT A;  4LFA Q;  5LMU Q;  4HIM A;  5IY0 A;  1WI5 A;  3E9I A;  4QGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...