2K5NA

Solution nmr structure of the n-terminal domain of protein eca1580 from erwinia carotovora, northeast structural genomics consortium target ewr156a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cold-shock protein
publication title NMR Structure of the Putative Cold Shock Protein from Erwinia carotovora: Northeast Structural Genomics Consortium Target EwR156a
rcsb
source organism Pectobacterium atrosepticum
molecule tags Structural genomics, unknown function
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5nA00
4R1JA 3J80i 2EXDA 4DV5L 1HR0L 2UU9L 4C3IH 3HOYH 3GDEA 4BY1H 3S17H 2PQAB 3A74A 1VQKA 5C0XI 1Q46A 3RN5A 2R7ZH 2RF4A 4LFBQ 4DR1Q 3RLNA 4K0KQ 2F4VQ 5IYCH 1SR3A 1TWAH 1EWIA 4HIKA 4NB3A 1K0RA 2N49A 1X3GA 1Q86C 3KDFB 2JA8H 3K0XA 3PSIA 1Y1VG 1KQSA 3VDYA 1X6OA 3M4OH 4EQ5A 4YCWA 1VQOA 4JI0Q 1XPRA 4A93H 1YHAA 4LUVA 5IP9G 4UY8C 1NY4A 2PMZE 5C4XH 3I56A 4L5SA 1NE3A 3CCJA 4A3CG 3GTQH 4X62L 3F2BA 4MNOA 5AJ3Q 1WFQA 3DM3A 1SMXA 4IPDA 4ME3A 4BBRG 3L2PA 2UU9Q 4WJ4A 1PVOA 5JJIA 1NMGA 4P74A 4A3JH 2LXKA 5FLXc 2XTIA 2C35B 4YWKA 4GNXB 2E2IH 1A8VA 1MJCA 2RCNA 3S24A 5GAEC 5HY6A 3PO2G 1EIFA 1VQ5A 1SRUA 4O0AA 3S15H 3K81C 4C3HH 3HOXG 1D7QA 4ALPA 3RR5A 2E5LQ 4HJ9A 3HOUG 2UUCL 4A3GG 4HJ5A 1KHIA 1B7YB 2B63H 4IJHA 3S2DH 3J81c 4KHPQ 1L1OB 3CCRA 4L5TA 4X62Q 4A3MG 1VQMA 4GLAC 4DUYL 4QGUA 1M90C 1OTCA 1HNWQ 2GN5A 4P73A 3ULPA 5C0XG 1WCMG 1X56A 5C44G 3PUYA 1I3QH 2VY3A 3MXNB 5JEAG 1Z47A 1UE1A 4P72A 2K52A 5IP7H 1VQ7A 2YU9H 1Q1BA 1Z9FA 3S1QH 2UXBL 3H15A 1PH1A 4BY7H 3A0JA 4Y52H 1Y1VH 2IX0A 4GLXA 1FJGL 1TWCH 3M3YH 4IJLA 4LNQA 1U0LA 2NN6I 4NXNL 4AH6A 2UUCQ 4DR7L 1C0AA 4IPGA 2R6GA 4DV2L 3K80C 1PA6A 4GKKL 3TS0A 1KL9A 2AWOA 5C3EH 4DUYQ 1OXSC 1YHQA 2Q2TA 1IBMQ 4GOPA 3UDGA 1DGSA 3RN2A 4B3RL 1V1QA 3PUZA 4JG2A 5BR8L 2K5NA 3CXCA 3PO2H 4A3LH 3HOWG 3IRBA 4UP9A 5EAYA 2JK8A 4HJAA 1IBKQ 3U58A 3HOXH 1FJGQ 1XNRQ 1KRSA 4IOAA 3F1ZA 3CCEA 3B6YA 1TWFH 1SFOH 1HNZQ 2IHFA 2GVBA 4NXNQ 2R7FA 3BZKA 4LUZA 1PH9A 4DR7Q 4A3GH 4JOIA 3AYHB 4R4QA 2D62A 3J81j 4DV2Q 4WJ3M 1H95A 2CFMA 1PH8A 4A3MH 4A75A 3JC66 4A3FG 4LFCQ 5M3FG 2NVXH 1SE8A 3TEHB 4POFA 1QZGA 1N32L 3HOVG 1WCMH 5LMNW 4B3RQ 1VQNA 1YNXA 4LWCA 1D8LA 2AHOB 4GLVB 1B8AA 2PNHA 1YJWA 1VQBA 2N8NA 3A5ZB 3KF8B 2Z0SA 3G48A 2IHEA 1XMQL 3U4VA 3GTMH 3TS2A 1GM5A 4AQYL 1HR0W 1Q81C 3D31A 1YJNA 3KOJA 4KLKA 4UP7A 2JA8G 4QY7A 1YI2A 1MJEA 3OYYA 1LUZA 1CKMA 5IWAQ 2VW9A 1NJIC 2A8VA 5GAHC 1N32Q 1E7ZA 3LGJA 3EN2A 2OTJA 5C4XG 1X54A 1K8AC 1VQPA 1WOCA 4LF4Q 4JI5L 1GVPA 1QUQA 1VQCA 2BA1A 3AQQA 2A1AA 4MTNA 1YZ6A 4A3EG 4JI3Q 2R92G 3HOWH 4A3JG 1GD7A 4DUZL 1NMFA 2YTXA 4GKJL 1PYBA 2RHSB 5LMUL 2NVTH 4DAMA 3H3VI 2IY5B 2VS1A 1X55A 1K8GA 4JI8L 4DR5L 4DR6Q 2MQHA 3PIPA 4GOPC 1KIXA 1X3FA 1XMOL 4A3FH 5IE8A 2PI2A 3OW2A 5M3FH 2E2JH 4OX9L 4DV4Q 4B3TL 4X66L 2B63G 3I4NG 1Q7YC 4LF9L 1SLJA 1PH2A 5IT9c 1N34L 3HOZG 2GVAA 4LFAL 2ID0A 2VQFL 5J3BA 2UUAL 1N33L 4PZ8A 1PHJA 3M4QA 4H02A 5C0XJ 4NXMQ 3I4OA 1IZ6A 4DK3C 4JI7L 2KBNA 4DUZQ 4JC0A 4JI2Q 5JEAJ 2JA5G 3PO3G 2KHIA 1VQGA 4JOIC 4HJ8A 3RNUA 5IP7G 5LMUQ 2ALYB 2FXQA 1UE7A 1LTLA 4BY7G 1CSPA 5LMNQ 1YEZA 1PYSB 1Q82C 4DAYB 1VQ6A 4DR5Q 3L7ZC 1GO3E 4LF5Q 3KF6A 1XMOQ 3CC2A 3AEVA 3FP9A 4OX9Q 2Q2UA 3T1HL 2CQOA 4KI0A 4X66Q 1HH2P 4HIMA 4LF9Q 1TXYA 1BBWA 1HR0Q 4LFAQ 3GTKH 3HFZB 4IPCA 2UUAQ 3E9HA 1PFSA 5C3EG 1N33Q 2R92H 2K75A 4UP8A 4AIMA 4A3EH 4L5RC 2QEXA 4C3JH 3UE0A 1WYDA 4P71A 4DV6L 4JBMA 2Y0SG 1L0WA 2HHHL 4A3LG 3UDXA 1PV4A 2BH2A 2MO0A 3JAMc 3PIOA 5M3MG 3T1YL 4PG3A 4JI4L 2ASBA 2ZJQA 4R4IA 4JCVE 1KXLA 1YHBA 4PMWA 3J80c 3I4NH 4QJFA 3I55A 2IX1A 3UDIA 1QZHA 3HOZH 4JYAL 1P16A 1E1OA 2WAQE 4RMFA 1J5EL 4LF6L 1M1KC 1N36L 4IFDI 2EIFA 4IPHA 4DV6Q 2Z6KC 4A76A 2JA5H 1VQFA 3PO3H 3GD7A 2HHHQ 1CSQA 3CW2C 4DR2L 1VQIA 3K7UC 5GROA 1AH9A 3PUVA 1X9NA 2HT1A 3T1YQ 4JI4Q 1PH3A 3CCUA 4A4IA 3G71A 3TRZA 5ELOA 3ICEA 5H1SE 2WFWA 2QA4A 5IYBH 2EQSA 3CC4A 4JYAQ 2N78A 1VQAA 3M9BA 1CUKA 1CKNB 3EIVA 3STBC 3W1GA 1VQDA 4DV3L 1EIYB 1N36Q 2VZAA 2A19A 3S14H 1ASZA 4OXPA 3CCVA 1JB7A 3H3VH 3I7FA 5DLQE 3S2HH 2UXBQ 4BBSH 3ERSX 1G6PA 1I6HH 4YWMA 3E9IA 1XTDA 1A62A 2DGYA 2K5HA 3PUXA 5M3MH 2UUBL 4DV7L 5JJKA 4LW1A 4DV1L 2PQAA 3AFPA 1YVCA 1K73C 3WWVA 1BKBA 1QVFA 1Q12A 2CWAA 4GKKQ 1HZ9A 3GTJH 3M85A 4DV3Q 4JI1L 4DPGA 4IFDG 2R93G 5IYDH 1E24A 1K9MC 5BR8Q 4R4OA 4TVAB 2BH8A 1AE2A 4OO1I 1Q1EA 2UXDL 2ES2A 2ZTCA 2UXCL 3DLLA 5GADC 2UUBQ 2JEAI 1C9OA 2F52A 4DV1Q 3ZJYC 3NENA 2NN6G 3PGZA 3CD6A 3M7NA 3Q8DA 3CMEA 1IYJB 1TWHH 2KENA 4JBJA 4UPAA 1SN8A 1R9TH 3I4MG 4HIOA 3GTPH 3F2DA 1JJCB 1AE3A 1QVGA 2Q2IA 4YWLA 3CMAA 4EX5A 1XPOA 4LF8L 4YCUA 3EBEA 5FLMG 2ZTEA 4A3DH 2UXCQ 2YTVA 1L1OA 2JJQA 1W3SA 2NVYH 1OXTA 3E0EA 1OXXK 3CF5A 1XMQQ 1HJPA 4AQYQ 1WJJA 1YBYA 2JA7G 2Z6KA 2OQ0A 1N8RC 1ASYA 3RZOH 3S1NH 4J15A 2Q2HA 2ZM6L 3STBD 1PH7A 2JA6H 4DV5Q 1E3PA 4BA1I 3HKZE 4OWTB 5M5YH 1NBWA 3J7ZC 3S1MH 2AMCB 4APVA 2R93H 1UEBA 3PUWA 4GN4B 3GTGH 2B3GA 1C7YA 4JI5Q 2OCEA 1OXUA 4A3BG 1Q8KA 4JV5L 2D0OA 3FHWA 3KYHC 3GTLH 4IOCA 2WP8J 1QVCA 1PH6A 3K8AA 4GKJQ 4K0KL 2F4VL 2XGTA 3CCQA 1CKOA 2AWNA 1RL2A 3FKIH 4NPSA 4X65L 1PH5A 1VQ8A 1Y14B 3PV0A 1X65A 2K4KA 4JI8Q 4AYBE 2ZJRA 2YTYA 1O7IA 3KLWA 3CC7A 2PI2E 4GOPB 1HNXL 1VQEA 2YYZA 4B3SL 1GKHA 4JI0L 3I4MH 4BXXH 1MKHA 2V1CC 1HZCA 4B3TQ 2VUMG 4HJ7A 1VCIA 3MEFA 3ULLA 1A0IA 4YCVA 1I50H 1IXRA 1N34Q 1Y1WH 1VQ9A 2JEBI 4LF7L 3J81i 5IYBG 2VQFQ 2I5HA 5FLMH 5AJ3L 2NZHA 1KC8C 3W5OA 2NZOA 4JI7Q 4JV5Q 1YITA 1TWGH 4A3IH 1IL2A 3F2CA 2JA7H 4GNXC 1UE6A 5GQOA 4X65Q 2R7DA 4BBSG 4DR4L 1FGUA 2IT1A 3OTOL 4KHZA 3PF5A 1YJ9A 1HNXQ 2HIVA 3U50C 3ULJA 4B3SQ 2HIXA 1VQJA 3BU2A 1YIJA 2E5LL 1G51A 3F8TA 3NEMA 1KRTA 3T1HQ 1VQHA 4DV0L 5C4JH 3M4PA 3H0GH 1MIUA 4KHPL 1KAWA 1VQ4A 4LF7Q 4TQUS 3S16H 1L1OC 1NTGA 4A3BH 3U4ZA 4GN5A 4P75A 4YY3L 4IFDJ 1HNWL 2ZJPA 5ELNA 3RZDH 4O2DA 4QL5A 3SGIA 5IYDG 1J6QA 1EQQA 3HKZG 3KFUA 3CQZH 2ZTDA 2OTLA 1RIPA 2MO1A 2VL6A 1K83H 2JE6I 1UE5A 3CCMA 3OTOQ 4DR4Q 4LUOA 1A63A 1S40A 2WB1E 5GAGC 1HZAA 1I94L 1WI5A 3RLOA 1EFWA 2VUMH 3TQYA 2NVQH 1QUQB 3TREA 1LM0A 2F3IA 4DV0Q 3RLFA 1B70B 1V9PA 2QGQA 4POGA 4B3ML 4AYBG 1J5EQ 3S1RH 1JMCA 4LF6Q 2N3SA 4YY3Q 3CAMA 3KJPA 1IBML 2OWOA 4OWWB 3AFQA 2MFIA 3CPWA 2YV5A 3CP0A 1HZBA 4MZ9A 4A3DG 1JE5A 4DR2Q 1EYGA 1JJ2A 4R4CA 3CPFA 5K36G 4OWXB 1IBKL 1W2BA 1V43A 1VS0A 2K5VA 5HGQA 3KJOA 1XNRL 1HNZL 1I94Q 2ATWA 1E1TA 3PF4A 1JT8A 5IP9H 1P8LA 4JBWA 4C2MH 3G4SA 4A3KG 3CCLA 2K50A 1VQLA 2VNUD 4A3CH 4R4TA 5M5WH 2VQEL 2HQLA 4B3MQ 2JA6G 1SROA 4LFCL 3BJUA 4BBRH 3KDFA 4DK6C 5JJLA 4JI6L 2BA0A 1LYLA 1EUJA 1KD1C 1XPUA 3HKSA 3KF6B 1I5FA 2L15A 3A5UA 2CWPA 2WAQG 1G291 4PZ6A 5M5XH 2E2HH 4DV7Q 1N9WA 3NELA 5FJ8G 3UDFA 1XNQL 3FKIG 2K14A 4QIWE 1IBLL 3HOUH 4DR3L 5IY0A 4Y7NH 1T9HA 1L2FA 4GNXA 2E8GA 2VQEQ 4BXXG 4GS3A 2JA9A 3D0FA 3GO5A 5IWAL 2WB1G 4JI6Q 4JI1Q 2JQOA 4DNIA 1S72A 4RG1A 5C44H 1Y1WG 4HIDA 4LF4L 1OXVA 4JI3L 2CCZA 4BY1G 3HOYG 2UXDQ 1FL0A 2KCTA 2OQKA 4PZ7A 5E7NA 2R7ZG 2RHQB 4A3IG 1BBUA 4X64L 3GTOH 3G6EA 5IYCG 1XNQQ 1IBLQ 4YHHL 4FDBA 4DR3Q 4A3KH 3UE1A 1K3RA 2I5LX 4DR6L 1BVSA 1UWVA 1JJGA 2I5MX 4A93G 1EQRA 2D0PA 3I2ZA 3K7AH 4DV4L 2DUDA 1FVIA 2Y0SE 3H0GG 2LSSA 3NBHB 4IO9A 4LF8Q 2CKZB 4OONA 1EOVA 1S3OA 4XIGS 4XTCS 4OO1G 2B29A 4NXML 4GN3B 4BA2I 4JI2L 1PH4A 2LXJA 4LFBL 4DR1L 1X3EA 2AKWB 2H5XA 4X64Q 5FJ8H 1CKNA 3CCSA 3J7A5 4DKAC 4YHHQ 3L0OA 2KCMA 3ER0A 5LMNL 2KHJA 3W1BA 3BZCA 2MNAA 2ZM6Q 1U5KA 2I0QA 4JBKA 4X6AH 3JAMi 3PCOB 4LF5L 1E22A 1XJVA 4L5QA 3HOVH 4QQBX
chains in the Genus database with same CATH superfamily
2F0IA 4CJ2C 1V1PA 2UU9L 3HOYH 3S17H 3A74A 3NPPA 5IIFA 3C3LA 2B39A 2KEEA 4X3TA 2RF4A 1TU2B 3RLNA 1EEFD 1CI3M 1EWIA 5CV9A 3MHBA 1X3GA 3KDFB 3K0XA 4R8IA 3M4OH 2R3ZA 1Q90A 1PTOH 3BS1A 3S1QB 1YHAA 4V0BA 1HUNA 1B4OA 5LL6S 1Y1VB 5C4XH 4L5SA 2KA7A 3GTQH 2UU9Q 2MJ8A 1PVOA 5JJIA 1GOZA 1LTBD 3OSOA 4A3JH 4N9TA 2C35B 4RGNA 4JPBW 3S15H 3K81C 4WORA 1EEID 4ALPA 3RR5A 1EOTA 3NQTA 4OIKA 1BCPF 3EROA 4IJHA 3CCRA 4DGZA 2VB3X 4QGUA 4FXDA 1JOKA 4P73A 3ULPA 1F9QA 4FNFA 4FXKC 5ELFA 3S1QH 2Z6BA 1Z9FA 4TKOB 4BY7H 3A0JA 4Y52H 1Y1VH 5LL6X 2I46A 4IJLA 1C0AA 1U0LA 4DU9A 4HR7B 4DR7L 4IPGA 1BOSA 2DY8A 3TS0A 5EKLA 2AWOA 3SHLA 4GOPA 4B3RL 5G3LF 4IURA 2K5NA 3Q23A 2K5WA 1JOQA 1DM0B 4QUCA 2C5CA 2JK8A 1IBKQ 2PMZB 1KRSA 3CCEA 1SFOH 1PH9A 3BZKA 4LUZA 4DR7Q 1RCVD 1WTOA 3AYHB 4QCLA 2IW3A 3JC66 4A3FG 1CZGA 2NVXH 5C0XH 4B3RQ 3VR3A 1FYCA 1PFNA 1H9RA 2PNHA 5EKIA 1AFPA 2N8NA 3KF8B 3G48A 2AQ1B 2F0OA 4ILWA 3C2PA 4AQYL 1Q81C 1IHZA 4KLKA 4UP7A 4KJNA 2CW0D 5ISRA 1MJEA 3OYYA 1BCPB 5IWAQ 4CHTB 3MA2B 5C4XG 3NBIA 1VQPA 3E6ZX 5IOCA 2R92G 1PXUA 3AQQA 4A3EG 4KV6A 5I9PA 4A3JG 2RDHA 1I4PA 1B3AA 1TS3A 2IY5B 4DR5L 2MQHA 5IE8A 4OX9L 4DV4Q 2BDNA 1Q7YC 3PIP3 1PH2A 2BCOA 2ID0A 2VQFL 4XYOA 1ZXTA 4NXMQ 5KRUA 2LFNA 4JC0A 4JI2Q 5JEAJ 2KHIA 3RNUA 1STYA 1UE7A 4BY7G 1CSPA 5LMNQ 1YEZA 4XYQA 2JA5B 3PO3B 4DR5Q 3AEVA 2HCCA 1X3PA 4F8MA 2PZWA 4OX9Q 5FLXL 3MXGA 4F87A 1WVLA 3M3YB 5EJWA 3MFGA 1PFSA 4L5RC 1GJXA 1LTRD 4C3JH 1WYDA 5C3EB 2Y0SG 4EVOA 4XQQA 3J81L 4DAVA 3IFTA 5M3MG 3MVVA 5F2DA 1QJOA 3S14B 2NYZD 2RDGA 4QB4A 2JSOA 3LWEA 1SEBD 4QJFA 2IX1A 1QZHA 1MI2A 2FFKB 1DONA 1J8IA 1N36L 4IFDI 2Z6KC 3N6RA 4A76A 2JA5H 3PO3H 5KYIA 1H9MA 3VYSA 3NBHA 1WCMB 3K7UC 2ZXRA 3SK4A 1X9NA 1PH3A 1CQFA 2L5TA 3G71A 1HA6A 4G7OC 2C9OA 4WJWA 2WFWA 2F4IA 1CK1A 2N78A 3M9BA 1CUKA 2FMCA 3EIVA 3STBC 1N36Q 2F0NA 2OF1A 3EVQA 5DM63 3BDLA 4K6LA 3S14H 4XT1B 3TZUA 4L8JA 3PQIA 3CCVA 3H3VH 5C4HA 4BBSH 5EBDA 1DXMA 4YWMA 2DGYA 3PUXA 2K5HA 3TZDA 1U4LA 2PQAA 3EQLC 3M4YA 1YVCA 3FRPB 3WWVA 4RA8A 3QB3A 5IGFA 4X3UA 1K9MC 4DNTB 5BR8Q 2E2JB 4OO1I 2EYHA 2ES2A 2R93B 3K0YA 1UUPA 1C9OA 2A6HD 2E74C 3GTLB 3LX0A 1TWHH 5JPNC 2EOTA 3F2DA 3SK8A 1AE3A 4FF4A 2Q2IA 1STHA 4YWLA 4EX5A 3CMAA 1XPOA 3I4MB 3G7LA 2FMMA 1F2LA 3JAME 4C3JG 4FF1A 2BE5C 2MUYA 3J80E 3S1NH 4J15A 1HQMC 1TWGB 3NTIA 2JA6H 2HD3A 4Q0FA 4X3SA 3J7ZC 4RHSA 2R93H 3PUWA 1C7YA 1H9SA 3D4DA 3GTLH 4IOCA 2NZ1D 4RGTA 2Z4IA 1SNCA 3NK9A 4QMGA 4K0KL 4KTAA 5ELEA 3FKIH 1PH5A 3KLSA 1Y14B 1A3VA 4JI8Q 1PFMA 5I9OA 4B3SL 3I4MH 1VDZA 1GKHA 1KLGD 2SDFA 2VUMG 1VCIA 1NNXA 4CDFC 1IXRA 2K03A 1EIGA 2I5HA 5AJ3L 3KLSX 1SNMA 1JWMD 1TWGH 3F2CA 4CDEC 4GNXC 1UE6A 1HTPA 1RKNA 2R7DA 1FD7D 4XQNA 4BBSG 1YJ9A 1CFMA 2HIVA 4XT3B 4B3SQ 2HIXA 1YIJA 1AEXA 3F8TA 3S2HB 1B44D 1PFBA 3H0GH 1L1OC 2X69A 1NTGA 2O5JC 2DNCA 2XNAC 4IFDJ 1A2UA 4K8JA 3ND8A 2MO1A 3GTJB 1K83H 5D3IB 5KYLA 1EY6A 3HKZB 1SJED 5GAGC 1HZAA 3RLOA 5CYUA 5L37A 3TQYA 2F3WA 2F3IA 1B70B 3DUZA 4B3ML 3NTHA 2H1EA 1J5EQ 1Y8PB 3S1RH 1IBML 3AFQA 2MFIA 1R9TB 3QG1A 4AYBB 1SNDA 3CP0A 3FPPA 3H6MA 5EBCA 3CPFA 2R61A 1W2BA 5HGQA 1LTGD 2AUJD 4Q5VA 1HNZL 2ATWA 1PRTD 3CCLA 3GTOB 2JA6G 4B3MQ 4KD3A 2MPMA 3MZ5A 4UDUC 2BA0A 2SEBD 1I6VC 4WRDA 1STBA 1KD1C 1O7YA 1TS5A 5LHY1 3GTGB 3MTSA 3NELA 1OO9B 3UI2A 3HOUH 3FKIG 5IY0A 2K32A 4GS3A 3OOCA 3H91A 1B1ZA 2NWGA 2WB1G 1ZEQX 3D6WA 4DNIA 5IGGA 5C44H 1PTOC 1OXVA 4C3IG 4JI3L 2CCZA 1CHQD 4BY1G 4PZ7A 1O78A 3OWEB 2R7ZG 5K36H 2RHQB 3GTOH 5IYCG 5CGKA 4YHHL 5M9OA 4QF4A 3UE1A 1UWVA 1TWAB 4A93G 2Z4HA 3A8KE 2D0PA 5E1FA 2KQ3A 1E2WA 1FVIA 3VA7A 2Y0SE 3H0GG 4LF8Q 4HSVA 3HRZC 1ESRA 1S3OA 4XTCS 4IUUA 4NDXA 2H5XA 1BBXC 3HZXA 3J7A5 3T51B 2AQ2B 4N9PA 1DOKA 4YHHQ 1MGSA 2E2IB 3PCOB 1ICFB 4C3HB 1IYUA 3QR8A 4RCNA 3JAML 3FDTA 1AZQA 3J7AV 3RN5A 1GUWA 1DD2A 3J80L 1TWAH 2N49A 3IFDA 1Q86C 2JA8H 1KQSA 1WD1A 1X6OA 4JI0Q 2M00A 2ZXPA 2PMZE 4X62L 4MNOA 1ESFA 3DM3A 1SMXA 3L2PA 4C2MB 4WJ4A 4IUPA 1HTLD 2QEJC 4GNXB 2E2IH 1A8VA 5GAEC 3PO2G 5C3WA 1CQVA 4C3HH 3HOXG 3AB9A 4CDCC 5IODA 1SXTA 2E5LQ 4HJ9A 1K3BC 3HOUG 4B9WA 3SXHA 1B7YB 4KHPQ 1L1OB 3A7LA 4L5TA 2PYKA 4X62Q 4A3MG 2PNRC 4GLAC 3DHQA 4DA2A 1M90C 1HNWQ 2F0HA 2GN5A 1M4VA 1X56A 5C44G 1CTMA 2TSSA 2VY3A 4O1NA 5JEAG 4G4KA 4P72A 5IP7H 2K52A 1Q1BA 2EYFA 2UXBL 3H15A 1PH1A 2SNMA 3A56A 1FJGL 2MGSA 3H09A 2EYOA 4LNQA 4NXNL 4AH6A 3QIAA 1SYBA 4GKKL 3BDOA 3NWSA 2LMCB 1YHQA 4QUFA 3UDGA 1YNJC 3I70A 1V1QA 5NUCA 5FKAC 3HOWG 3IRBA 4FF2A 1IW7D 1FJGQ 4IOAA 1SYDA 2GVBA 4FP5D 4NXNQ 1V1PB 4JOIA 1S5CD 1EY4A 1VMCA 1H95A 4OHJA 2NVTB 4FVMA 3OHXC 1HHVA 4MHEA 4LFCQ 1HFGA 1T5EA 3C46A 1UNSA 1SE8A 4POFA 1LLRD 3ITPA 3W2DA 4DXGA 4A3FB 2E75C 2A68D 4ABNA 1G8ZD 4B08A 3SVMA 1RTNA 3BYTB 4CKBA 2Z0SA 1EU3A 2B8FA 3GTMH 3TS2A 1GM5A 1XX8A 3KOJA 2JA8G 2PW7A 4IUQA 5D65A 1YI2A 1A6XA 2EYJA 2VW9A 2VXWA 3QOLA 5FLXE 5CBEE 1K8AC 3M4OB 2KCCA 4JI5L 1ZYRC 5IGBA 1GVPA 1QUQA 5C4XB 5DAUA 2PPBC 4DUZL 3GTQB 2YTXA 1PYBA 2RHSB 5LMUL 2NVTH 5CV5A 2R92B 1RTOA 4A3EB 1G6ZA 4A3JB 1SMYC 3K5MA 5JAVA 2XWJB 3J81E 1K8GA 3SK5A 4DR6Q 4A3FH 3OIPA 3W3AA 4B3TL 1B53A 2L9HA 4X66L 3S15B 3I4NG 1AW7A 1N34L 3HOZG 2SOBA 4PZ8A 1PHJA 2RVLA 4H02A 1IZ6A 1HQRD 4DXFA 4H0LC 4DUZQ 5IP7G 5LMUQ 1QB5D 5J39A 2NN6H 4IQZA 1Q82C 1PYSB 4HMJA 4DAYB 1VQ6A 3L7ZC 4LF5Q 3KF6A 3K5OA 1WTQA 3IAYA 3BYYB 1X3QA 4BY7B 2CQOA 1WTHA 4KI0A 3H3VC 4X66Q 1BBWA 1DYQA 4IPCA 2R92H 4A3EH 1F9SA 3KK7A 4P71A 4JBMA 4DFAA 2HHHL 1PV4A 5CV4A 2BH2A 1K28A 3TDQA 4ID6A 1I4QA 2TMPA 4PG3A 2Y0SB 2ZJQA 4R4IA 1G2SA 1LV9A 4JCVE 1PYWD 2XRSD 5M3MB 2EDGA 3UDIA 1SFOB 1TT2A 4FO2A 4JYAL 3T4AC 1P16A 1E1OA 2HCIA 4RMFA 3RUZA 5FOBB 1M1KC 2LY7A 3NE5B 1D1IA 2XIWA 3GD7A 5A2QL 2NVXB 2HHHQ 3CW2C 4DR2L 3PUVA 2HT1A 1A3TA 2M9VA 4DNRB 4A4IA 3TRZA 4RFBA 1SNQA 1B9MA 3HP3A 3FPUB 4JYAQ 1L0XB 1VQAA 1EIYB 3DWPA 2B2TC 1QWYA 5CC4A 3CKIB 1EY5A 1EQVA 1UAPA 2UUBL 1XTDA 5M3MH 5JJKA 4DV1L 1Y8NB 3AFPA 5IT9E 1BKBA 1QVFA 2A69C 1W6KA 2A6EC 1HZ9A 2G9HD 4IFDG 1D1KA 1U9RA 1EZ8A 5A35A 5M5YB 4IUNA 3J7YW 1TS4A 5CORA 3DLLA 1HXYD 2UUBQ 1F2YA 5TSSA 2Z1CA 2F52A 1EY9A 4DV1Q 2NN6G 3PGZA 3M7NA 1TKWB 1IYJB 5T1IA 1SN8A 2K6AA 4HIOA 1D6EC 1JJCB 2EJGC 1MHWC 3Q22A 3EBEA 5FLMG 2ZTEA 5HGTA 4A3DH 1EU4A 1WTXA 2YTVA 2JJQA 2NVYH 3VA5A 1OXXK 1D5ZC 4AQYQ 1YBYA 1ILPA 2JA7G 1VF5C 1ASYA 1IL8A 4C3JB 2Q2HA 4L63B 2QDLA 1FNVA 2ZT9C 3HKZE 5M5YH 1NBWA 3TN2A 2F0WA 3D3RA 2F03A 1JORA 4A3BG 1Q8KA 5C4JB 3FHWA 3KYHC 3FVQA 1QVCA 4B9XA 1KDAA 3H94A 3K8AA 2RSNA 2EYMA 1K0SA 1QNKA 2F4VL 3CCQA 4NPSA 4K5VA 4ZRZA 4AYBE 5FK9C 3X3NA 2A8VA 3S1MH 2YTYA 2PI2E 3CQZB 3P1HA 1K8MA 1MKHA 3ULLA 3L3OC 2VQFQ 2VUMB 2EY2A 1PMRA 1SJHD 1HA5A 1BXTA 4A3IH 1R4PB 2J7ZA 4CBVA 1ML0D 2F0FA 5EQ0A 4DR4L 4KHZA 3U50C 2WACA 1VQJA 1Z7TA 3NEMA 4BBSB 4DV0L 3F2UA 5C4JH 3M4PA 1PTOD 1MIUA 5D14A 3S16H 1VQ4A 4Z9CB 1KDCA 3U4ZA 4GN5A 3TMEA 1EYDA 5ELNA 2N55A 4O2DA 5COYA 5C4ZA 3SGIA 3CRLC 1J6QA 3CQZH 2OTLA 1RIPA 3NP8A 2JE6I 4DR4Q 3WOEA 1A63A 2EJFC 1I94L 1EFWA 2VUMH 3NHHA 4DV0Q 3OPOA 3RLFA 4ZKBB 5M5XB 1V9PA 3I72A 4ZLTF 2WV6D 1SNPA 3VR6A 5E4WC 2L11A 2N3SA 1BR9A 3CAMA 1BNZA 3AMUA 1TWHB 3GV6A 1BQQT 3SR1A 2B2WC 4F88A 1HZBA 4MZ9A 4A3DG 5C5MA 2L1BA 1XNRL 1SBBB 1I94Q 5DEHA 4JBWA 3G4SA 4A3KG 3I73A 2K50A 4A3CH 4R4TA 5M5WH 2HQLA 2RCFA 1DJRD 4BBRH 5JJLA 4JI6L 3S1NB 3K58A 2MHVA 2JA6B 3QO2A 4H7BA 1I5FA 2WAQG 1G291 5M5XH 3E0JA 5E3FA 2O4XA 3UDFA 1I4HA 4DR3L 2A74C 3Q24A 4Y7NH 1JCKB 3FKIB 2JA9A 3GO5A 1YNNC 1HCZA 3DXJC 4JI6Q 4BS9A 4LF4L 5ELDA 2WB1B 2KCTA 2OQKA 3WDNA 1DOMA 4A3IG 4C3IB 4X64L 3G6EA 2F3VA 3OIQA 1ICWA 4BY1B 5IT9L 4DR3Q 3I8ZA 5EPLA 3TBIB 3P7JA 5I4DA 2OT2A 1ET6A 4H44C 4IO9A 4DAPA 4A93B 3A7AB 1EOVA 4XIGS 4KN4C 4PV1C 2F0UA 3H0GB 4O42A 1PH4A 1H9KA 2AKWB 4X64Q 2LKVA 3VYTA 4DKAC 1LT6D 4RKBA 5JJZA 2KHJA 3W1BA 4C1NI 4CJ0B 1LTSD 3JAMi 4C1NK 1K83B 4HN7A 3RMHA 2PZTA 2NB0A 4CJ1B 3HOVH 4R1JA 2L55A 3J80i 1HR0L 4C3IH 2BOSA 4BY1H 1KAAA 1Y69U 5C0XI 3S2DB 1Q46A 2R7ZH 4PMCA 4K0KQ 3SEBA 5IYCH 3S1RB 4HIKA 1K0RA 2BDOA 3PSIA 1EWCA 1BCPD 4EQ5A 4YCWA 1VQOA 1XTCD 4A93H 1ONLA 4LUVA 4UY8C 2H4OA 1NY4A 3TP5A 3CCJA 4A3CG 1PZJD 3F2BA 2PQEA 5AJ3Q 4BBRG 4P74A 4JVZA 4YWKA 1RHPA 2CH4W 4PQXA 5JVG3 1EIFA 1VQ5A 4O0AA 1D7QA 1SYCA 2WIIB 3PO2B 2N88A 2UUCL 2FHTA 4A3GG 2KEDA 5I2YA 1KHIA 2RBMA 2B63H 3HOXB 1ZYRD 3S2DH 1TVXA 1STGA 1TWFB 5G3LD 2IX3A 2CW0C 5JOBA 3HOUB 4ZK9B 4DUYL 5EPJA 1LT4D 1F9RA 1WCMG 4ZUJA 3PUYA 1F2MA 4A3MB 3MXNB 3CHBD 1VQ7A 3KUPA 1SYFA 5C44B 2IX0A 1XYIA 2UUCQ 3K80C 3NWTA 2K1BA 1KL9A 4OELB 1AN8A 4DUYQ 2K28A 2Q2TA 1IBMQ 4EGVA 1S5FD 4JG2A 2ICIA 3CXCA 4KN7C 3PO2H 4UP9A 4UHVA 3IKJA 4KJOA 4HJAA 3U58A 2EY5A 3E5SA 1HUMA 3HOXH 1TWFH 3B6YA 1HNZQ 4JW0A 3HOWB 2QILA 2NTSA 2E2DC 2D62A 3NXWA 2PW5A 2F0VA 1PH8A 4A3MH 4A75A 2ZXOA 4L6TB 5M3FG 1N32L 3TEHB 4HMIA 4RGOS 3HOVG 2PCFB 3VR4A 1BUVT 5JEAH 1B8AA 1ZKOA 1YJWA 4KKTA 1EY0A 1VQBA 3A5ZB 4ZUIA 1XMQL 3U4VA 1K8OA 3RD4A 2RKSA 1HR0W 3D31A 1YJNA 4QY7A 4JK1C 4ZKCB 4IN3A 1LUZA 2X6LA 1CKMA 1MSGA 2JA8B 1N32Q 5GAHC 1E7ZA 3LGJA 1JR0D 3V96A 2F1MA 2A1AA 4JI3Q 1VQCA 2BA1A 4MTNA 3HOWH 1YZ6A 1UEAB 1GD7A 1PDQA 4RH6A 4GKJL 1FNUA 1DOLA 4DAMA 2RDFA 3H3VI 2VS1A 1LTAD 4E6IA 1SYEA 4GOPC 1AP0A 1X3FA 2RSOA 3OW2A 2PI2A 2B63G 4C56C 2GVAA 4LFAL 1N33L 3M4QA 5C0XJ 3IL8A 3I4NB 4DK3C 3MWYW 3R93A 4JI7L 3HOZB 2F0KA 2ALYB 2FXQA 2JXMB 1LTLA 5A2QE 1NSNS 1SE4A 4HEDA 4I7AA 3OMGA 2Q8IB 1GO3E 1NR2A 3FP9A 1EL0A 2DJFC 3T1HL 1HH2P 4KY7A 1ENFA 1TXYA 3P75A 3KLRA 4LFAQ 1N33Q 2CHBD 1LTID 3E9HA 3D6CA 4UP8A 1SSOA 2K05A 3UE0A 3QWNA 4DV6L 2IPKD 1L0WA 1F2ZA 5EKKA 2MO0A 3DEOA 2FJ2A 3JAMc 3PIOA 3T1YL 4JI4L 1EY7A 2Z9HA 1L0YB 1KXLA 1IKLA 4PMWA 3J80c 2NUCA 3A55A 3I4NH 3I55A 2A6HC 2HQEA 3HOZH 4LK1C 2B2VA 2WAQE 4HSPA 4LF6L 4IPHA 5KGUA 2F0EA 4DV6Q 2IL8A 1CSQA 3MXUA 3LNNA 1VQIA 3T1YQ 4HTHA 4JI4Q 4P2CB 5T1GA 3CCUA 2XWBB 5ELOA 1STEA 4NKLA 2K5QA 3GTMB 3ICEA 5H1SE 4M1UB 5IYBH 2EQSA 2K7VA 1T5XD 2D9UA 1CKNB 3W1GA 1VQDA 1Z6HA 1BF4A 1ENAA 5BN3A 2A19A 1SE2A 1ASZA 2K5DA 1JB7A 2F0DA 3I7FA 4K2LA 2EVBA 5DLQE 2UXBQ 3ERSX 1I6HH 1JWSD 3E9IA 4BWGB 1D5MC 4DV7L 4LW1A 2IJ0A 1U4RA 1JE4A 4J1MA 4GKKQ 4TRDA 3MEHA 3BVGA 1GUTA 1E2ZA 4JI1L 2MP1A 5IYDH 4R4OA 1XWEA 2BH8A 2F0TA 2UXDL 3N52A 2F0PA 2ZTCA 1NAPA 5KNBA 2XSCA 3TSSA 4N8X1 1O7ZA 1I4RA 3CD6A 3Q8DA 3BG3A 1Q3LA 3CMEA 4JBJA 1G91A 3X3MA 4OL7A 1S4ZA 3DM1A 2QKIC 1I4XA 4RGMA 2VB2X 1GUOA 1I50B 3BVZA 1L1OA 1QCBD 3E0EA 3CF5A 2D5DA 1HJPA 1WJJA 2OQ0A 2X6GA 2ZM6L 3STBD 2JA7B 1E3PA 2RQXA 1NCVA 2EY6A 4NW2A 3GQBA 4APVA 4IFDH 1TR5A 4JI5Q 4NMZA 1OXUA 3DEPA 1WTPA 4JV5L 2WP8J 4KK7A 2KUMA 4A3BB 2AWNA 3RZDB 1VQ8A 1X65A 4RHRA 2ZJRA 4GOPB 1HNXL 3EJIA 3R8BA 3CC7A 1VQEA 2YYZA 4BXXH 1GUGA 1HZCA 4B3TQ 3R2TA 4HJ7A 4V190 5EGTA 3MEFA 3QJYA 4HAEA 1I50H 1PRTC 1N34Q 1Y1WH 2JEBI 3TP8A 3J81i 5IYBG 5FLMH 1KC8C 2NVQB 3W5OA 4JV5Q 1YITA 3I91A 1IL2A 1HFNA 5I6WA 4J8QA 2JA7H 1EYAA 2IT1A 3OTOL 3PF5A 1HNXQ 3ULJA 3VYRA 1YNND 4FXGC 1G51A 1M8AA 1S5ED 2F0JA 2J4XA 1MBYA 3DWAA 4FF3A 4TQUS 4A3BH 4OO1H 4P75A 2BE5D 4YY3L 4IUTA 3RZDH 1EWHA 2NTTA 5IYDG 4N8FA 3K5NA 1EQQA 3KFUA 3TP7A 2VL6A 3OTOQ 5I2XA 4LUOA 1S40A 2KCNA 2WB1E 3C1FA 1TQOA 1SNOA 1MD2D 2NVQH 1EZ6A 1LM0A 1C4QA 3J7AF 2E2HB 2QGQA 4I65A 5KEEA 2XRQD 4YY3Q 2OWOA 1O7LA 5IGCA 3SE0A 3V05A 3G6JB 4K6DA 1JE5A 4DR2Q 2B2YA 2HDMA 4K5XA 3ERQA 5ELCA 4OWXB 1IBKL 1V43A 3KJOA 3PF4A 2XVSA 1E1TA 4A3DB 2A73B 5IP9H 1CA5A 1W6JA 1P8LA 4X3KA 1SAPA 5I6YA 2NVYB 3MAQA 1VQLA 3FMCA 2VQEL 1JQYD 2F0QA 3BJUA 3KDFA 4A3KB 4DAYA 1CA6A 1EUJA 4PNYA 1XPUA 4WFN3 3A5UA 4KY6A 1AZPA 2E2HH 1N9WA 2B2UA 5FJ8G 1XNQL 1IBLL 2WAQB 5DNFA 1T9HA 2JN4A 3T13A 5IGDA 2VQEQ 5CV8A 1PRTF 4BXXG 3WOFA 5IWAL 3S1MB 2F0GA 2KHSA 1S72A 1RJTA 4RG1A 1Y1WG 3HOYG 5IGEA 1FL0A 2JP1A 1WTRA 1BBUA 4U68A 1XNQQ 2RA4A 1IBLQ 4A3KH 1DZ1A 4A3IB 1K3RA 2I5LX 1BVSA 4KD4A 1JJGA 1FGBD 3P20A 3I2ZA 4DV4L 1A2TA 1PZKD 4M8AA 3NBHB 1F77A 2O2LD 2CKZB 4K5WA 1KLUD 4OO1G 4NXML 1EIHA 1Y8OB 4BA2I 4JI2L 2OXPA 3S16B 2LXJA 4LFBL 4DR1L 3ZYYX 3CCSA 1PLFA 2WKCA 2KCMA 5LMNL 2MNAA 4JBKA 1U5KA 3SDZA 1LABA 1SYGA 1GUSA 4H13C 5D3DA 4QQBX 1C8CA 2EXDA 4DV5L 2JYOA 2EZVA 3GDEA 2PQAB 1VQKA 2LS01 1JWUD 4QIWB 4LFBQ 4DR1Q 4ME5A 5EPKA 2F4VQ 1SR3A 2L12A 1G2TA 4NB3A 1Y1VG 2ICEC 3VDYA 1I3QB 1IW7C 1XPRA 2YU9B 5IP9G 1RDPD 1CZWA 1LACA 3KF8A 1PRTB 2AUKA 3I56A 1NE3A 1RODA 1TWCB 2WKDA 5KIXA 4DV5Q 1WFQA 2K04A 4IPDA 4ME3A 1NMGA 2LXKA 5FLXc 5M5WB 2XTIA 2QDBA 3L9AX 4BBRB 1MJCA 2RCNA 3S24A 5HY6A 1SRUA 4R9WA 4U673 2A68C 3K6OA 3K5LA 1HRJA 4G7HC 4HJ5A 4RKLA 2EYLA 3J81c 2Q8RE 1VQMA 4A3GB 4ZYSA 1OTCA 4Y7NB 1Q8IA 5C0XG 3TP6A 1I3QH 1Z47A 1UE1A 2YU9H 1VF7A 3S9WA 4GLXA 2HUGA 1TWCH 3M3YH 4RCOA 2NN6I 4MTKA 1H9SB 2B8GA 2G9DA 4DN4M 2R6GA 3E3XA 4KY5A 2G5DA 4DV2L 3Q0AA 1PA6A 4HCSA 3T56B 5CV7A 1QNUA 3HEJA 5C3EH 4KMUC 1OXSC 1DGSA 1NUCA 1SDFA 3KBGA 3RN2A 1X32A 3PUZA 2EYPA 1TY2A 5BR8L 1LT5D 1HPCA 3URYA 1FNWA 4RWSC 3VYUA 4A3LH 5EAYA 1XNRQ 2J0TD 3F1ZA 1B3QA 2IHFA 1QG7A 2R7FA 4A3GH 4R4QA 5CBAE 3J81j 4ZQ3A 4DV2Q 4WJ3M 4XQJA 2CFMA 2SNSA 3T16A 1QZGA 4F7XA 1WCMH 3OW7A 5LMNW 1VQNA 1YNXA 4LWCA 4TSSA 1D8LA 2AHOB 4GLVB 5M3FB 1B2TA 1GHJA 4FYDA 3HOVB 1C48A 1LT3D 2IHEA 1U4MA 2R7ZB 2PZUA 2B2VC 1ILQA 1RD9D 3GP7A 1B50A 1NJIC 2OTJA 3EN2A 4XXEA 1B9NA 1X54A 2EJMA 1WOCA 4LF4Q 1QE6A 3GTKB 1NMFA 3NSWA 2HDLA 1CM9A 3I90A 4IALA 4ZAIA 1X55A 4EQPA 4JI8L 2EY1A 3PIPA 1DCZA 1KIXA 1XMOL 2E2JH 5M3FH 1YNJD 4KKUA 2K01A 2I07B 1F9PA 3LWUA 4LF9L 1SLJA 1GUNA 5IT9c 2AQ3B 4DK1A 5J3BA 3OMCA 2UUAL 1KTKA 1BDOA 3I4OA 2B63B 4K2KA 2KBNA 3D4RA 2WINB 2JA5G 3PO3G 1VQGA 4JOIC 4HJ8A 2B2TA 5FO8B 2DNEA 4LJZC 2NBFA 4S3SA 2F0SA 1XMOQ 3CC2A 2Q2UA 2F0MA 4HIMA 4LF9Q 1HR0Q 3GTKH 3K57A 3HFZB 2UUAQ 5C3EG 2K75A 2CH4A 1E2VA 4AIMA 5ELBA 2QEXA 4YIJA 1JOOA 2L4NA 4A3LG 3UDXA 5C5LA 2KJXA 4OIJA 5CR3A 2ASBA 1WTVA 5AFWA 3NQIA 1YHBA 3NUCA 3PIO3 3OWFA 1J9OA 1J5EL 1S5BD 2EIFA 3CRKC 1VQFA 3EFXD 1SMYD 1TIID 1GXDC 2CQAA 2O5IC 5GROA 1AH9A 4K14A 4DF7A 4ULLA 2ENBA 4I7ZC 2QA4A 4PMBA 3CC4A 1EY8A 5J22A 1EQTA 1RF2D 2EPBA 4DV3L 2A5HA 2OEOA 4OGQC 2VZAA 1KNAA 4CDDC 1V1OA 3GTPB 1IYVA 4OXPA 3S2HH 4RAUC 1G6PA 1A62A 2QF7A 1R4QB 1K73C 1A15A 1Q12A 2CWAA 3EA6A 1QILA 4EQNA 2D2CC 3I3CA 3RZOB 3GTJH 3M85A 4DV3Q 4DPGA 2R93G 2PO4A 1E24A 2M2LA 4TVAB 1AE2A 1JC7A 1KNEA 1Q1EA 2UXCL 5GADC 2JEAI 3ZJYC 3NENA 5JPMC 1LO5D 1BO0A 1STAA 3U9SA 5DM73 3I4MG 2KENA 4UPAA 1R9TH 3KBXA 4CKEA 3GTPH 2QCPX 5HURA 1QVGA 5KNCA 1TY0A 4XDXA 4LF8L 3DWQA 4YCUA 3V2TA 4LAAA 5E4XA 1U4PA 4G7ZC 2UXCQ 2Z8LA 2IWHA 1SE3A 1W3SA 1OXTA 1XMQQ 2Z6KA 1CT1D 1N8RC 1EFID 3HGBA 3RZOH 4HCEA 3MXNA 1PH7A 2L0CA 2DN8A 4BA1I 4K8IA 4OWTB 5JVH3 2AMCB 3ONAB 1UEBA 4GN4B 3GTGH 1PZID 2B3GA 1D2BA 1STNA 2B2YC 2OCEA 1A3UA 1MSHA 2CVRA 2D0OA 1PH6A 1KDBA 4GKJQ 3BVMA 3BDCA 3R2IA 2XGTA 1CKOA 2A69D 1RL2A 4X65L 2B2WA 3PV0A 2K4KA 4MN3A 2A6ED 1O7IA 3KLWA 4KHVA 4JI0L 1S5DD 2V1CC 4ZCKA 1A0IA 4YCVA 1VQ9A 4LF7L 2NZHA 2F0LA 2B2UC 2KECA 2KOLA 2NZOA 1LTTD 5BN4A 5FO9B 4JI7Q 4CGYB 3DMUA 2V4DA 1IKMA 3NTKA 5GQOA 1D5XC 4X65Q 1FGUA 2Q8TA 3A8JE 3BU2A 2E5LL 1KRTA 3T1HQ 3R3OA 1VQHA 3Q6SA 1O80A 1I6HB 3U9OA 2DY7A 2XN9C 4KHPL 1V8QA 1KAWA 4LF7Q 5J1ZA 4EQOA 1HNWL 2ZJPA 1VMPA 4QL5A 3GV3A 5C6AA 3HKZG 2ZTDA 1H9JA 5KNDA 4R8NA 1UE5A 3CCMA 4GZYC 2E76C 1I4GA 1WI5A 4J6HA 3A54A 2P5ZX 1QUQB 3TREA 3HS0C 1JB3A 5FO7B 4POGA 4AYBG 2EE1A 1JMCA 4LF6Q 1PTOF 3KJPA 4OWWB 2GA4B 4NP5A 3CPWA 1ET9A 3PMFA 2YV5A 3HG9A 5CMDA 1EYGA 3D8GA 1JJ2A 1CHPD 4R4CA 5K36G 2VNUD 1VS0A 2K5VA 1JT8A 5K5PA 3VR5A 2FINB 4C2MH 3BZDB 4LMQD 1SROA 3D4WA 4LFCL 4DK6C 1LYLA 4G57A 3HKSA 3K7AB 3KF6B 1FR3A 2L15A 4UAIA 2CWPA 3T53B 4PZ6A 3MC0B 4DV7Q 1KABA 1XXGA 1QOHA 1ENCA 2K14A 4QIWE 4IUVA 2DJGC 4GNXA 1L2FA 1EYCA 2E8GA 2K33A 1E0BA 1BCPC 3D0FA 4JI1Q 2JQOA 5BN5A 4HIDA 1JICA 3I4LA 2UXDQ 3MFYA 5E7NA 1Y1WB 4CKCA 1NR4A 2KVMA 3HOYB 3S17B 3M7GA 4FDBA 4OEMB 2QW7A 3K59A 4DR6L 2EXZA 2I5MX 1EQRA 3SK6A 3K7AH 2DUDA 4KKSA 2LSSA 1PTOB 3ND9A 3O13A 4OONA 2B29A 4GN3B 3VR2A 1TS2A 1WD0A 3A8IE 3C1EA 4IZ8A 1X3EA 1WTWA 5FJ8H 1CKNA 3MXPA 3L0OA 4MIUA 5CV6A 3CU7A 4DK0A 5C3XA 3ER0A 2I0QA 2ZM6Q 3BZCA 3AU7A 4C3HG 4X6AH 4ODGA 4LF5L 1E22A 1XJVA 3QOJA 4L5QA 1II3A 3FEWX 1GHKA
chains in the Genus database with same CATH topology
4R1JA 3J80i 2EXDA 4DV5L 1HR0L 2UU9L 4C3IH 3HOYH 3GDEA 4BY1H 3S17H 2PQAB 3A74A 1VQKA 5C0XI 1Q46A 3RN5A 2R7ZH 2RF4A 4LFBQ 4DR1Q 3RLNA 4K0KQ 2F4VQ 5IYCH 1SR3A 1TWAH 1EWIA 4HIKA 4NB3A 1K0RA 2N49A 1X3GA 1Q86C 3KDFB 2JA8H 3K0XA 3PSIA 1Y1VG 1KQSA 3VDYA 1X6OA 3M4OH 4EQ5A 4YCWA 1VQOA 4JI0Q 1XPRA 4A93H 1YHAA 4LUVA 5IP9G 4UY8C 1NY4A 2PMZE 5C4XH 3I56A 4L5SA 1NE3A 3CCJA 4A3CG 3GTQH 4X62L 3F2BA 4MNOA 5AJ3Q 1WFQA 3DM3A 1SMXA 4IPDA 4ME3A 4BBRG 3L2PA 2UU9Q 4WJ4A 1PVOA 5JJIA 1NMGA 4P74A 4A3JH 2LXKA 5FLXc 2XTIA 2C35B 4YWKA 4GNXB 2E2IH 1A8VA 1MJCA 2RCNA 3S24A 5GAEC 5HY6A 3PO2G 1EIFA 1VQ5A 1SRUA 4O0AA 3S15H 3K81C 4C3HH 3HOXG 1D7QA 4ALPA 3RR5A 2E5LQ 4HJ9A 3HOUG 2UUCL 4A3GG 4HJ5A 1KHIA 1B7YB 2B63H 4IJHA 3S2DH 3J81c 4KHPQ 1L1OB 3CCRA 4L5TA 4X62Q 4A3MG 1VQMA 4GLAC 4DUYL 4QGUA 1M90C 1OTCA 1HNWQ 2GN5A 4P73A 3ULPA 5C0XG 1WCMG 1X56A 5C44G 3PUYA 1I3QH 2VY3A 3MXNB 5JEAG 1Z47A 1UE1A 4P72A 2K52A 5IP7H 1VQ7A 2YU9H 1Q1BA 1Z9FA 3S1QH 2UXBL 3H15A 1PH1A 4BY7H 3A0JA 4Y52H 1Y1VH 2IX0A 4GLXA 1FJGL 1TWCH 3M3YH 4IJLA 4LNQA 1U0LA 2NN6I 4NXNL 4AH6A 2UUCQ 4DR7L 1C0AA 4IPGA 2R6GA 4DV2L 3K80C 1PA6A 4GKKL 3TS0A 1KL9A 2AWOA 5C3EH 4DUYQ 1OXSC 1YHQA 2Q2TA 1IBMQ 4GOPA 3UDGA 1DGSA 3RN2A 4B3RL 1V1QA 3PUZA 4JG2A 5BR8L 2K5NA 3CXCA 3PO2H 4A3LH 3HOWG 3IRBA 4UP9A 5EAYA 2JK8A 4HJAA 1IBKQ 3U58A 3HOXH 1FJGQ 1XNRQ 1KRSA 4IOAA 3F1ZA 3CCEA 3B6YA 1TWFH 1SFOH 1HNZQ 2IHFA 2GVBA 4NXNQ 2R7FA 3BZKA 4LUZA 1PH9A 4DR7Q 4A3GH 4JOIA 3AYHB 4R4QA 2D62A 3J81j 4DV2Q 4WJ3M 1H95A 2CFMA 1PH8A 4A3MH 4A75A 3JC66 4A3FG 4LFCQ 5M3FG 2NVXH 1SE8A 3TEHB 4POFA 1QZGA 1N32L 3HOVG 1WCMH 5LMNW 4B3RQ 1VQNA 1YNXA 4LWCA 1D8LA 2AHOB 4GLVB 1B8AA 2PNHA 1YJWA 1VQBA 2N8NA 3A5ZB 3KF8B 2Z0SA 3G48A 2IHEA 1XMQL 3U4VA 3GTMH 3TS2A 1GM5A 4AQYL 1HR0W 1Q81C 3D31A 1YJNA 3KOJA 4KLKA 4UP7A 2JA8G 4QY7A 1YI2A 1MJEA 3OYYA 1LUZA 1CKMA 5IWAQ 2VW9A 1NJIC 2A8VA 5GAHC 1N32Q 1E7ZA 3LGJA 3EN2A 2OTJA 5C4XG 1X54A 1K8AC 1VQPA 1WOCA 4LF4Q 4JI5L 1GVPA 1QUQA 1VQCA 2BA1A 3AQQA 2A1AA 4MTNA 1YZ6A 4A3EG 4JI3Q 2R92G 3HOWH 4A3JG 1GD7A 4DUZL 1NMFA 2YTXA 4GKJL 1PYBA 2RHSB 5LMUL 2NVTH 4DAMA 3H3VI 2IY5B 2VS1A 1X55A 1K8GA 4JI8L 4DR5L 4DR6Q 2MQHA 3PIPA 4GOPC 1KIXA 1X3FA 1XMOL 4A3FH 5IE8A 2PI2A 3OW2A 5M3FH 2E2JH 4OX9L 4DV4Q 4B3TL 4X66L 2B63G 3I4NG 1Q7YC 4LF9L 1SLJA 1PH2A 5IT9c 1N34L 3HOZG 2GVAA 4LFAL 2ID0A 2VQFL 5J3BA 2UUAL 1N33L 4PZ8A 1PHJA 3M4QA 4H02A 5C0XJ 4NXMQ 3I4OA 1IZ6A 4DK3C 4JI7L 2KBNA 4DUZQ 4JC0A 4JI2Q 5JEAJ 2JA5G 3PO3G 2KHIA 1VQGA 4JOIC 4HJ8A 3RNUA 5IP7G 5LMUQ 2ALYB 2FXQA 1UE7A 1LTLA 4BY7G 1CSPA 5LMNQ 1YEZA 1PYSB 1Q82C 4DAYB 1VQ6A 4DR5Q 3L7ZC 1GO3E 4LF5Q 3KF6A 1XMOQ 3CC2A 3AEVA 3FP9A 4OX9Q 2Q2UA 3T1HL 2CQOA 4KI0A 4X66Q 1HH2P 4HIMA 4LF9Q 1TXYA 1BBWA 1HR0Q 4LFAQ 3GTKH 3HFZB 4IPCA 2UUAQ 3E9HA 1PFSA 5C3EG 1N33Q 2R92H 2K75A 4UP8A 4AIMA 4A3EH 4L5RC 2QEXA 4C3JH 3UE0A 1WYDA 4P71A 4DV6L 4JBMA 2Y0SG 1L0WA 2HHHL 4A3LG 3UDXA 1PV4A 2BH2A 2MO0A 3JAMc 3PIOA 5M3MG 3T1YL 4PG3A 4JI4L 2ASBA 2ZJQA 4R4IA 4JCVE 1KXLA 1YHBA 4PMWA 3J80c 3I4NH 4QJFA 3I55A 2IX1A 3UDIA 1QZHA 3HOZH 4JYAL 1P16A 1E1OA 2WAQE 4RMFA 1J5EL 4LF6L 1M1KC 1N36L 4IFDI 2EIFA 4IPHA 4DV6Q 2Z6KC 4A76A 2JA5H 1VQFA 3PO3H 3GD7A 2HHHQ 1CSQA 3CW2C 4DR2L 1VQIA 3K7UC 5GROA 1AH9A 3PUVA 1X9NA 2HT1A 3T1YQ 4JI4Q 1PH3A 3CCUA 4A4IA 3G71A 3TRZA 5ELOA 3ICEA 5H1SE 2WFWA 2QA4A 5IYBH 2EQSA 3CC4A 4JYAQ 2N78A 1VQAA 3M9BA 1CUKA 1CKNB 3EIVA 3STBC 3W1GA 1VQDA 4DV3L 1EIYB 1N36Q 2VZAA 2A19A 3S14H 1ASZA 4OXPA 3CCVA 1JB7A 3H3VH 3I7FA 5DLQE 3S2HH 2UXBQ 4BBSH 3ERSX 1G6PA 1I6HH 4YWMA 3E9IA 1XTDA 1A62A 2DGYA 2K5HA 3PUXA 5M3MH 2UUBL 4DV7L 5JJKA 4LW1A 4DV1L 2PQAA 3AFPA 1YVCA 1K73C 3WWVA 1BKBA 1QVFA 1Q12A 2CWAA 4GKKQ 1HZ9A 3GTJH 3M85A 4DV3Q 4JI1L 4DPGA 4IFDG 2R93G 5IYDH 1E24A 1K9MC 5BR8Q 4R4OA 4TVAB 2BH8A 1AE2A 4OO1I 1Q1EA 2UXDL 2ES2A 2ZTCA 2UXCL 3DLLA 5GADC 2UUBQ 2JEAI 1C9OA 2F52A 4DV1Q 3ZJYC 3NENA 2NN6G 3PGZA 3CD6A 3M7NA 3Q8DA 3CMEA 1IYJB 1TWHH 2KENA 4JBJA 4UPAA 1SN8A 1R9TH 3I4MG 4HIOA 3GTPH 3F2DA 1JJCB 1AE3A 1QVGA 2Q2IA 4YWLA 3CMAA 4EX5A 1XPOA 4LF8L 4YCUA 3EBEA 5FLMG 2ZTEA 4A3DH 2UXCQ 2YTVA 1L1OA 2JJQA 1W3SA 2NVYH 1OXTA 3E0EA 1OXXK 3CF5A 1XMQQ 1HJPA 4AQYQ 1WJJA 1YBYA 2JA7G 2Z6KA 2OQ0A 1N8RC 1ASYA 3RZOH 3S1NH 4J15A 2Q2HA 2ZM6L 3STBD 1PH7A 2JA6H 4DV5Q 1E3PA 4BA1I 3HKZE 4OWTB 5M5YH 1NBWA 3J7ZC 3S1MH 2AMCB 4APVA 2R93H 1UEBA 3PUWA 4GN4B 3GTGH 2B3GA 1C7YA 4JI5Q 2OCEA 1OXUA 4A3BG 1Q8KA 4JV5L 2D0OA 3FHWA 3KYHC 3GTLH 4IOCA 2WP8J 1QVCA 1PH6A 3K8AA 4GKJQ 4K0KL 2F4VL 2XGTA 3CCQA 1CKOA 2AWNA 1RL2A 3FKIH 4NPSA 4X65L 1PH5A 1VQ8A 1Y14B 3PV0A 1X65A 2K4KA 4JI8Q 4AYBE 2ZJRA 2YTYA 1O7IA 3KLWA 3CC7A 2PI2E 4GOPB 1HNXL 1VQEA 2YYZA 4B3SL 1GKHA 4JI0L 3I4MH 4BXXH 1MKHA 2V1CC 1HZCA 4B3TQ 2VUMG 4HJ7A 1VCIA 3MEFA 3ULLA 1A0IA 4YCVA 1I50H 1IXRA 1N34Q 1Y1WH 1VQ9A 2JEBI 4LF7L 3J81i 5IYBG 2VQFQ 2I5HA 5FLMH 5AJ3L 2NZHA 1KC8C 3W5OA 2NZOA 4JI7Q 4JV5Q 1YITA 1TWGH 4A3IH 1IL2A 3F2CA 2JA7H 4GNXC 1UE6A 5GQOA 4X65Q 2R7DA 4BBSG 4DR4L 1FGUA 2IT1A 3OTOL 4KHZA 3PF5A 1YJ9A 1HNXQ 2HIVA 3U50C 3ULJA 4B3SQ 2HIXA 1VQJA 3BU2A 1YIJA 2E5LL 1G51A 3F8TA 3NEMA 1KRTA 3T1HQ 1VQHA 4DV0L 5C4JH 3M4PA 3H0GH 1MIUA 4KHPL 1KAWA 1VQ4A 4LF7Q 4TQUS 3S16H 1L1OC 1NTGA 4A3BH 3U4ZA 4GN5A 4P75A 4YY3L 4IFDJ 1HNWL 2ZJPA 5ELNA 3RZDH 4O2DA 4QL5A 3SGIA 5IYDG 1J6QA 1EQQA 3HKZG 3KFUA 3CQZH 2ZTDA 2OTLA 1RIPA 2MO1A 2VL6A 1K83H 2JE6I 1UE5A 3CCMA 3OTOQ 4DR4Q 4LUOA 1A63A 1S40A 2WB1E 5GAGC 1HZAA 1I94L 1WI5A 3RLOA 1EFWA 2VUMH 3TQYA 2NVQH 1QUQB 3TREA 1LM0A 2F3IA 4DV0Q 3RLFA 1B70B 1V9PA 2QGQA 4POGA 4B3ML 4AYBG 1J5EQ 3S1RH 1JMCA 4LF6Q 2N3SA 4YY3Q 3CAMA 3KJPA 1IBML 2OWOA 4OWWB 3AFQA 2MFIA 3CPWA 2YV5A 3CP0A 1HZBA 4MZ9A 4A3DG 1JE5A 4DR2Q 1EYGA 1JJ2A 4R4CA 3CPFA 5K36G 4OWXB 1IBKL 1W2BA 1V43A 1VS0A 2K5VA 5HGQA 3KJOA 1XNRL 1HNZL 1I94Q 2ATWA 1E1TA 3PF4A 1JT8A 5IP9H 1P8LA 4JBWA 4C2MH 3G4SA 4A3KG 3CCLA 2K50A 1VQLA 2VNUD 4A3CH 4R4TA 5M5WH 2VQEL 2HQLA 4B3MQ 2JA6G 1SROA 4LFCL 3BJUA 4BBRH 3KDFA 4DK6C 5JJLA 4JI6L 2BA0A 1LYLA 1EUJA 1KD1C 1XPUA 3HKSA 3KF6B 1I5FA 2L15A 3A5UA 2CWPA 2WAQG 1G291 4PZ6A 5M5XH 2E2HH 4DV7Q 1N9WA 3NELA 5FJ8G 3UDFA 1XNQL 3FKIG 2K14A 4QIWE 1IBLL 3HOUH 4DR3L 5IY0A 4Y7NH 1T9HA 1L2FA 4GNXA 2E8GA 2VQEQ 4BXXG 4GS3A 2JA9A 3D0FA 3GO5A 5IWAL 2WB1G 4JI6Q 4JI1Q 2JQOA 4DNIA 1S72A 4RG1A 5C44H 1Y1WG 4HIDA 4LF4L 1OXVA 4JI3L 2CCZA 4BY1G 3HOYG 2UXDQ 1FL0A 2KCTA 2OQKA 4PZ7A 5E7NA 2R7ZG 2RHQB 4A3IG 1BBUA 4X64L 3GTOH 3G6EA 5IYCG 1XNQQ 1IBLQ 4YHHL 4FDBA 4DR3Q 4A3KH 3UE1A 1K3RA 2I5LX 4DR6L 1BVSA 1UWVA 1JJGA 2I5MX 4A93G 1EQRA 2D0PA 3I2ZA 3K7AH 4DV4L 2DUDA 1FVIA 2Y0SE 3H0GG 2LSSA 3NBHB 4IO9A 4LF8Q 2CKZB 4OONA 1EOVA 1S3OA 4XIGS 4XTCS 4OO1G 2B29A 4NXML 4GN3B 4BA2I 4JI2L 1PH4A 2LXJA 4LFBL 4DR1L 1X3EA 2AKWB 2H5XA 4X64Q 5FJ8H 1CKNA 3CCSA 3J7A5 4DKAC 4YHHQ 3L0OA 2KCMA 3ER0A 5LMNL 2KHJA 3W1BA 3BZCA 2MNAA 2ZM6Q 1U5KA 2I0QA 4JBKA 4X6AH 3JAMi 3PCOB 4LF5L 1E22A 1XJVA 4L5QA 3HOVH 4QQBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1J A;  3J80 i;  2EXD A;  4DV5 L;  1HR0 L;  2UU9 L;  4C3I H;  3HOY H;  3GDE A;  4BY1 H;  3S17 H;  2PQA B;  3A74 A;  1VQK A;  5C0X I;  1Q46 A;  3RN5 A;  2R7Z H;  2RF4 A;  4LFB Q;  4DR1 Q;  3RLN A;  4K0K Q;  2F4V Q;  5IYC H;  1SR3 A;  1TWA H;  1EWI A;  4HIK A;  4NB3 A;  1K0R A;  2N49 A;  1X3G A;  1Q86 C;  3KDF B;  2JA8 H;  3K0X A;  3PSI A;  1Y1V G;  1KQS A;  3VDY A;  1X6O A;  3M4O H;  4EQ5 A;  4YCW A;  1VQO A;  4JI0 Q;  1XPR A;  4A93 H;  1YHA A;  4LUV A;  5IP9 G;  4UY8 C;  1NY4 A;  2PMZ E;  5C4X H;  3I56 A;  4L5S A;  1NE3 A;  3CCJ A;  4A3C G;  3GTQ H;  4X62 L;  3F2B A;  4MNO A;  5AJ3 Q;  1WFQ A;  3DM3 A;  1SMX A;  4IPD A;  4ME3 A;  4BBR G;  3L2P A;  2UU9 Q;  4WJ4 A;  1PVO A;  5JJI A;  1NMG A;  4P74 A;  4A3J H;  2LXK A;  5FLX c;  2XTI A;  2C35 B;  4YWK A;  4GNX B;  2E2I H;  1A8V A;  1MJC A;  2RCN A;  3S24 A;  5GAE C;  5HY6 A;  3PO2 G;  1EIF A;  1VQ5 A;  1SRU A;  4O0A A;  3S15 H;  3K81 C;  4C3H H;  3HOX G;  1D7Q A;  4ALP A;  3RR5 A;  2E5L Q;  4HJ9 A;  3HOU G;  2UUC L;  4A3G G;  4HJ5 A;  1KHI A;  1B7Y B;  2B63 H;  4IJH A;  3S2D H;  3J81 c;  4KHP Q;  1L1O B;  3CCR A;  4L5T A;  4X62 Q;  4A3M G;  1VQM A;  4GLA C;  4DUY L;  4QGU A;  1M90 C;  1OTC A;  1HNW Q;  2GN5 A;  4P73 A;  3ULP A;  5C0X G;  1WCM G;  1X56 A;  5C44 G;  3PUY A;  1I3Q H;  2VY3 A;  3MXN B;  5JEA G;  1Z47 A;  1UE1 A;  4P72 A;  2K52 A;  5IP7 H;  1VQ7 A;  2YU9 H;  1Q1B A;  1Z9F A;  3S1Q H;  2UXB L;  3H15 A;  1PH1 A;  4BY7 H;  3A0J A;  4Y52 H;  1Y1V H;  2IX0 A;  4GLX A;  1FJG L;  1TWC H;  3M3Y H;  4IJL A;  4LNQ A;  1U0L A;  2NN6 I;  4NXN L;  4AH6 A;  2UUC Q;  4DR7 L;  1C0A A;  4IPG A;  2R6G A;  4DV2 L;  3K80 C;  1PA6 A;  4GKK L;  3TS0 A;  1KL9 A;  2AWO A;  5C3E H;  4DUY Q;  1OXS C;  1YHQ A;  2Q2T A;  1IBM Q;  4GOP A;  3UDG A;  1DGS A;  3RN2 A;  4B3R L;  1V1Q A;  3PUZ A;  4JG2 A;  5BR8 L;  2K5N A;  3CXC A;  3PO2 H;  4A3L H;  3HOW G;  3IRB A;  4UP9 A;  5EAY A;  2JK8 A;  4HJA A;  1IBK Q;  3U58 A;  3HOX H;  1FJG Q;  1XNR Q;  1KRS A;  4IOA A;  3F1Z A;  3CCE A;  3B6Y A;  1TWF H;  1SFO H;  1HNZ Q;  2IHF A;  2GVB A;  4NXN Q;  2R7F A;  3BZK A;  4LUZ A;  1PH9 A;  4DR7 Q;  4A3G H;  4JOI A;  3AYH B;  4R4Q A;  2D62 A;  3J81 j;  4DV2 Q;  4WJ3 M;  1H95 A;  2CFM A;  1PH8 A;  4A3M H;  4A75 A;  3JC6 6;  4A3F G;  4LFC Q;  5M3F G;  2NVX H;  1SE8 A;  3TEH B;  4POF A;  1QZG A;  1N32 L;  3HOV G;  1WCM H;  5LMN W;  4B3R Q;  1VQN A;  1YNX A;  4LWC A;  1D8L A;  2AHO B;  4GLV B;  1B8A A;  2PNH A;  1YJW A;  1VQB A;  2N8N A;  3A5Z B;  3KF8 B;  2Z0S A;  3G48 A;  2IHE A;  1XMQ L;  3U4V A;  3GTM H;  3TS2 A;  1GM5 A;  4AQY L;  1HR0 W;  1Q81 C;  3D31 A;  1YJN A;  3KOJ A;  4KLK A;  4UP7 A;  2JA8 G;  4QY7 A;  1YI2 A;  1MJE A;  3OYY A;  1LUZ A;  1CKM A;  5IWA Q;  2VW9 A;  1NJI C;  2A8V A;  5GAH C;  1N32 Q;  1E7Z A;  3LGJ A;  3EN2 A;  2OTJ A;  5C4X G;  1X54 A;  1K8A C;  1VQP A;  1WOC A;  4LF4 Q;  4JI5 L;  1GVP A;  1QUQ A;  1VQC A;  2BA1 A;  3AQQ A;  2A1A A;  4MTN A;  1YZ6 A;  4A3E G;  4JI3 Q;  2R92 G;  3HOW H;  4A3J G;  1GD7 A;  4DUZ L;  1NMF A;  2YTX A;  4GKJ L;  1PYB A;  2RHS B;  5LMU L;  2NVT H;  4DAM A;  3H3V I;  2IY5 B;  2VS1 A;  1X55 A;  1K8G A;  4JI8 L;  4DR5 L;  4DR6 Q;  2MQH A;  3PIP A;  4GOP C;  1KIX A;  1X3F A;  1XMO L;  4A3F H;  5IE8 A;  2PI2 A;  3OW2 A;  5M3F H;  2E2J H;  4OX9 L;  4DV4 Q;  4B3T L;  4X66 L;  2B63 G;  3I4N G;  1Q7Y C;  4LF9 L;  1SLJ A;  1PH2 A;  5IT9 c;  1N34 L;  3HOZ G;  2GVA A;  4LFA L;  2ID0 A;  2VQF L;  5J3B A;  2UUA L;  1N33 L;  4PZ8 A;  1PHJ A;  3M4Q A;  4H02 A;  5C0X J;  4NXM Q;  3I4O A;  1IZ6 A;  4DK3 C;  4JI7 L;  2KBN A;  4DUZ Q;  4JC0 A;  4JI2 Q;  5JEA J;  2JA5 G;  3PO3 G;  2KHI A;  1VQG A;  4JOI C;  4HJ8 A;  3RNU A;  5IP7 G;  5LMU Q;  2ALY B;  2FXQ A;  1UE7 A;  1LTL A;  4BY7 G;  1CSP A;  5LMN Q;  1YEZ A;  1PYS B;  1Q82 C;  4DAY B;  1VQ6 A;  4DR5 Q;  3L7Z C;  1GO3 E;  4LF5 Q;  3KF6 A;  1XMO Q;  3CC2 A;  3AEV A;  3FP9 A;  4OX9 Q;  2Q2U A;  3T1H L;  2CQO A;  4KI0 A;  4X66 Q;  1HH2 P;  4HIM A;  4LF9 Q;  1TXY A;  1BBW A;  1HR0 Q;  4LFA Q;  3GTK H;  3HFZ B;  4IPC A;  2UUA Q;  3E9H A;  1PFS A;  5C3E G;  1N33 Q;  2R92 H;  2K75 A;  4UP8 A;  4AIM A;  4A3E H;  4L5R C;  2QEX A;  4C3J H;  3UE0 A;  1WYD A;  4P71 A;  4DV6 L;  4JBM A;  2Y0S G;  1L0W A;  2HHH L;  4A3L G;  3UDX A;  1PV4 A;  2BH2 A;  2MO0 A;  3JAM c;  3PIO A;  5M3M G;  3T1Y L;  4PG3 A;  4JI4 L;  2ASB A;  2ZJQ A;  4R4I A;  4JCV E;  1KXL A;  1YHB A;  4PMW A;  3J80 c;  3I4N H;  4QJF A;  3I55 A;  2IX1 A;  3UDI A;  1QZH A;  3HOZ H;  4JYA L;  1P16 A;  1E1O A;  2WAQ E;  4RMF A;  1J5E L;  4LF6 L;  1M1K C;  1N36 L;  4IFD I;  2EIF A;  4IPH A;  4DV6 Q;  2Z6K C;  4A76 A;  2JA5 H;  1VQF A;  3PO3 H;  3GD7 A;  2HHH Q;  1CSQ A;  3CW2 C;  4DR2 L;  1VQI A;  3K7U C;  5GRO A;  1AH9 A;  3PUV A;  1X9N A;  2HT1 A;  3T1Y Q;  4JI4 Q;  1PH3 A;  3CCU A;  4A4I A;  3G71 A;  3TRZ A;  5ELO A;  3ICE A;  5H1S E;  2WFW A;  2QA4 A;  5IYB H;  2EQS A;  3CC4 A;  4JYA Q;  2N78 A;  1VQA A;  3M9B A;  1CUK A;  1CKN B;  3EIV A;  3STB C;  3W1G A;  1VQD A;  4DV3 L;  1EIY B;  1N36 Q;  2VZA A;  2A19 A;  3S14 H;  1ASZ A;  4OXP A;  3CCV A;  1JB7 A;  3H3V H;  3I7F A;  5DLQ E;  3S2H H;  2UXB Q;  4BBS H;  3ERS X;  1G6P A;  1I6H H;  4YWM A;  3E9I A;  1XTD A;  1A62 A;  2DGY A;  2K5H A;  3PUX A;  5M3M H;  2UUB L;  4DV7 L;  5JJK A;  4LW1 A;  4DV1 L;  2PQA A;  3AFP A;  1YVC A;  1K73 C;  3WWV A;  1BKB A;  1QVF A;  1Q12 A;  2CWA A;  4GKK Q;  1HZ9 A;  3GTJ H;  3M85 A;  4DV3 Q;  4JI1 L;  4DPG A;  4IFD G;  2R93 G;  5IYD H;  1E24 A;  1K9M C;  5BR8 Q;  4R4O A;  4TVA B;  2BH8 A;  1AE2 A;  4OO1 I;  1Q1E A;  2UXD L;  2ES2 A;  2ZTC A;  2UXC L;  3DLL A;  5GAD C;  2UUB Q;  2JEA I;  1C9O A;  2F52 A;  4DV1 Q;  3ZJY C;  3NEN A;  2NN6 G;  3PGZ A;  3CD6 A;  3M7N A;  3Q8D A;  3CME A;  1IYJ B;  1TWH H;  2KEN A;  4JBJ A;  4UPA A;  1SN8 A;  1R9T H;  3I4M G;  4HIO A;  3GTP H;  3F2D A;  1JJC B;  1AE3 A;  1QVG A;  2Q2I A;  4YWL A;  3CMA A;  4EX5 A;  1XPO A;  4LF8 L;  4YCU A;  3EBE A;  5FLM G;  2ZTE A;  4A3D H;  2UXC Q;  2YTV A;  1L1O A;  2JJQ A;  1W3S A;  2NVY H;  1OXT A;  3E0E A;  1OXX K;  3CF5 A;  1XMQ Q;  1HJP A;  4AQY Q;  1WJJ A;  1YBY A;  2JA7 G;  2Z6K A;  2OQ0 A;  1N8R C;  1ASY A;  3RZO H;  3S1N H;  4J15 A;  2Q2H A;  2ZM6 L;  3STB D;  1PH7 A;  2JA6 H;  4DV5 Q;  1E3P A;  4BA1 I;  3HKZ E;  4OWT B;  5M5Y H;  1NBW A;  3J7Z C;  3S1M H;  2AMC B;  4APV A;  2R93 H;  1UEB A;  3PUW A;  4GN4 B;  3GTG H;  2B3G A;  1C7Y A;  4JI5 Q;  2OCE A;  1OXU A;  4A3B G;  1Q8K A;  4JV5 L;  2D0O A;  3FHW A;  3KYH C;  3GTL H;  4IOC A;  2WP8 J;  1QVC A;  1PH6 A;  3K8A A;  4GKJ Q;  4K0K L;  2F4V L;  2XGT A;  3CCQ A;  1CKO A;  2AWN A;  1RL2 A;  3FKI H;  4NPS A;  4X65 L;  1PH5 A;  1VQ8 A;  1Y14 B;  3PV0 A;  1X65 A;  2K4K A;  4JI8 Q;  4AYB E;  2ZJR A;  2YTY A;  1O7I A;  3KLW A;  3CC7 A;  2PI2 E;  4GOP B;  1HNX L;  1VQE A;  2YYZ A;  4B3S L;  1GKH A;  4JI0 L;  3I4M H;  4BXX H;  1MKH A;  2V1C C;  1HZC A;  4B3T Q;  2VUM G;  4HJ7 A;  1VCI A;  3MEF A;  3ULL A;  1A0I A;  4YCV A;  1I50 H;  1IXR A;  1N34 Q;  1Y1W H;  1VQ9 A;  2JEB I;  4LF7 L;  3J81 i;  5IYB G;  2VQF Q;  2I5H A;  5FLM H;  5AJ3 L;  2NZH A;  1KC8 C;  3W5O A;  2NZO A;  4JI7 Q;  4JV5 Q;  1YIT A;  1TWG H;  4A3I H;  1IL2 A;  3F2C A;  2JA7 H;  4GNX C;  1UE6 A;  5GQO A;  4X65 Q;  2R7D A;  4BBS G;  4DR4 L;  1FGU A;  2IT1 A;  3OTO L;  4KHZ A;  3PF5 A;  1YJ9 A;  1HNX Q;  2HIV A;  3U50 C;  3ULJ A;  4B3S Q;  2HIX A;  1VQJ A;  3BU2 A;  1YIJ A;  2E5L L;  1G51 A;  3F8T A;  3NEM A;  1KRT A;  3T1H Q;  1VQH A;  4DV0 L;  5C4J H;  3M4P A;  3H0G H;  1MIU A;  4KHP L;  1KAW A;  1VQ4 A;  4LF7 Q;  4TQU S;  3S16 H;  1L1O C;  1NTG A;  4A3B H;  3U4Z A;  4GN5 A;  4P75 A;  4YY3 L;  4IFD J;  1HNW L;  2ZJP A;  5ELN A;  3RZD H;  4O2D A;  4QL5 A;  3SGI A;  5IYD G;  1J6Q A;  1EQQ A;  3HKZ G;  3KFU A;  3CQZ H;  2ZTD A;  2OTL A;  1RIP A;  2MO1 A;  2VL6 A;  1K83 H;  2JE6 I;  1UE5 A;  3CCM A;  3OTO Q;  4DR4 Q;  4LUO A;  1A63 A;  1S40 A;  2WB1 E;  5GAG C;  1HZA A;  1I94 L;  1WI5 A;  3RLO A;  1EFW A;  2VUM H;  3TQY A;  2NVQ H;  1QUQ B;  3TRE A;  1LM0 A;  2F3I A;  4DV0 Q;  3RLF A;  1B70 B;  1V9P A;  2QGQ A;  4POG A;  4B3M L;  4AYB G;  1J5E Q;  3S1R H;  1JMC A;  4LF6 Q;  2N3S A;  4YY3 Q;  3CAM A;  3KJP A;  1IBM L;  2OWO A;  4OWW B;  3AFQ A;  2MFI A;  3CPW A;  2YV5 A;  3CP0 A;  1HZB A;  4MZ9 A;  4A3D G;  1JE5 A;  4DR2 Q;  1EYG A;  1JJ2 A;  4R4C A;  3CPF A;  5K36 G;  4OWX B;  1IBK L;  1W2B A;  1V43 A;  1VS0 A;  2K5V A;  5HGQ A;  3KJO A;  1XNR L;  1HNZ L;  1I94 Q;  2ATW A;  1E1T A;  3PF4 A;  1JT8 A;  5IP9 H;  1P8L A;  4JBW A;  4C2M H;  3G4S A;  4A3K G;  3CCL A;  2K50 A;  1VQL A;  2VNU D;  4A3C H;  4R4T A;  5M5W H;  2VQE L;  2HQL A;  4B3M Q;  2JA6 G;  1SRO A;  4LFC L;  3BJU A;  4BBR H;  3KDF A;  4DK6 C;  5JJL A;  4JI6 L;  2BA0 A;  1LYL A;  1EUJ A;  1KD1 C;  1XPU A;  3HKS A;  3KF6 B;  1I5F A;  2L15 A;  3A5U A;  2CWP A;  2WAQ G;  1G29 1;  4PZ6 A;  5M5X H;  2E2H H;  4DV7 Q;  1N9W A;  3NEL A;  5FJ8 G;  3UDF A;  1XNQ L;  3FKI G;  2K14 A;  4QIW E;  1IBL L;  3HOU H;  4DR3 L;  5IY0 A;  4Y7N H;  1T9H A;  1L2F A;  4GNX A;  2E8G A;  2VQE Q;  4BXX G;  4GS3 A;  2JA9 A;  3D0F A;  3GO5 A;  5IWA L;  2WB1 G;  4JI6 Q;  4JI1 Q;  2JQO A;  4DNI A;  1S72 A;  4RG1 A;  5C44 H;  1Y1W G;  4HID A;  4LF4 L;  1OXV A;  4JI3 L;  2CCZ A;  4BY1 G;  3HOY G;  2UXD Q;  1FL0 A;  2KCT A;  2OQK A;  4PZ7 A;  5E7N A;  2R7Z G;  2RHQ B;  4A3I G;  1BBU A;  4X64 L;  3GTO H;  3G6E A;  5IYC G;  1XNQ Q;  1IBL Q;  4YHH L;  4FDB A;  4DR3 Q;  4A3K H;  3UE1 A;  1K3R A;  2I5L X;  4DR6 L;  1BVS A;  1UWV A;  1JJG A;  2I5M X;  4A93 G;  1EQR A;  2D0P A;  3I2Z A;  3K7A H;  4DV4 L;  2DUD A;  1FVI A;  2Y0S E;  3H0G G;  2LSS A;  3NBH B;  4IO9 A;  4LF8 Q;  2CKZ B;  4OON A;  1EOV A;  1S3O A;  4XIG S;  4XTC S;  4OO1 G;  2B29 A;  4NXM L;  4GN3 B;  4BA2 I;  4JI2 L;  1PH4 A;  2LXJ A;  4LFB L;  4DR1 L;  1X3E A;  2AKW B;  2H5X A;  4X64 Q;  5FJ8 H;  1CKN A;  3CCS A;  3J7A 5;  4DKA C;  4YHH Q;  3L0O A;  2KCM A;  3ER0 A;  5LMN L;  2KHJ A;  3W1B A;  3BZC A;  2MNA A;  2ZM6 Q;  1U5K A;  2I0Q A;  4JBK A;  4X6A H;  3JAM i;  3PCO B;  4LF5 L;  1E22 A;  1XJV A;  4L5Q A;  3HOV H;  4QQB X; 
#chains in the Genus database with same CATH topology
 2F0I A;  4CJ2 C;  1V1P A;  2UU9 L;  3HOY H;  3S17 H;  3A74 A;  3NPP A;  5IIF A;  3C3L A;  2B39 A;  2KEE A;  4X3T A;  2RF4 A;  1TU2 B;  3RLN A;  1EEF D;  1CI3 M;  1EWI A;  5CV9 A;  3MHB A;  1X3G A;  3KDF B;  3K0X A;  4R8I A;  3M4O H;  2R3Z A;  1Q90 A;  1PTO H;  3BS1 A;  3S1Q B;  1YHA A;  4V0B A;  1HUN A;  1B4O A;  5LL6 S;  1Y1V B;  5C4X H;  4L5S A;  2KA7 A;  3GTQ H;  2UU9 Q;  2MJ8 A;  1PVO A;  5JJI A;  1GOZ A;  1LTB D;  3OSO A;  4A3J H;  4N9T A;  2C35 B;  4RGN A;  4JPB W;  3S15 H;  3K81 C;  4WOR A;  1EEI D;  4ALP A;  3RR5 A;  1EOT A;  3NQT A;  4OIK A;  1BCP F;  3ERO A;  4IJH A;  3CCR A;  4DGZ A;  2VB3 X;  4QGU A;  4FXD A;  1JOK A;  4P73 A;  3ULP A;  1F9Q A;  4FNF A;  4FXK C;  5ELF A;  3S1Q H;  2Z6B A;  1Z9F A;  4TKO B;  4BY7 H;  3A0J A;  4Y52 H;  1Y1V H;  5LL6 X;  2I46 A;  4IJL A;  1C0A A;  1U0L A;  4DU9 A;  4HR7 B;  4DR7 L;  4IPG A;  1BOS A;  2DY8 A;  3TS0 A;  5EKL A;  2AWO A;  3SHL A;  4GOP A;  4B3R L;  5G3L F;  4IUR A;  2K5N A;  3Q23 A;  2K5W A;  1JOQ A;  1DM0 B;  4QUC A;  2C5C A;  2JK8 A;  1IBK Q;  2PMZ B;  1KRS A;  3CCE A;  1SFO H;  1PH9 A;  3BZK A;  4LUZ A;  4DR7 Q;  1RCV D;  1WTO A;  3AYH B;  4QCL A;  2IW3 A;  3JC6 6;  4A3F G;  1CZG A;  2NVX H;  5C0X H;  4B3R Q;  3VR3 A;  1FYC A;  1PFN A;  1H9R A;  2PNH A;  5EKI A;  1AFP A;  2N8N A;  3KF8 B;  3G48 A;  2AQ1 B;  2F0O A;  4ILW A;  3C2P A;  4AQY L;  1Q81 C;  1IHZ A;  4KLK A;  4UP7 A;  4KJN A;  2CW0 D;  5ISR A;  1MJE A;  3OYY A;  1BCP B;  5IWA Q;  4CHT B;  3MA2 B;  5C4X G;  3NBI A;  1VQP A;  3E6Z X;  5IOC A;  2R92 G;  1PXU A;  3AQQ A;  4A3E G;  4KV6 A;  5I9P A;  4A3J G;  2RDH A;  1I4P A;  1B3A A;  1TS3 A;  2IY5 B;  4DR5 L;  2MQH A;  5IE8 A;  4OX9 L;  4DV4 Q;  2BDN A;  1Q7Y C;  3PIP 3;  1PH2 A;  2BCO A;  2ID0 A;  2VQF L;  4XYO A;  1ZXT A;  4NXM Q;  5KRU A;  2LFN A;  4JC0 A;  4JI2 Q;  5JEA J;  2KHI A;  3RNU A;  1STY A;  1UE7 A;  4BY7 G;  1CSP A;  5LMN Q;  1YEZ A;  4XYQ A;  2JA5 B;  3PO3 B;  4DR5 Q;  3AEV A;  2HCC A;  1X3P A;  4F8M A;  2PZW A;  4OX9 Q;  5FLX L;  3MXG A;  4F87 A;  1WVL A;  3M3Y B;  5EJW A;  3MFG A;  1PFS A;  4L5R C;  1GJX A;  1LTR D;  4C3J H;  1WYD A;  5C3E B;  2Y0S G;  4EVO A;  4XQQ A;  3J81 L;  4DAV A;  3IFT A;  5M3M G;  3MVV A;  5F2D A;  1QJO A;  3S14 B;  2NYZ D;  2RDG A;  4QB4 A;  2JSO A;  3LWE A;  1SEB D;  4QJF A;  2IX1 A;  1QZH A;  1MI2 A;  2FFK B;  1DON A;  1J8I A;  1N36 L;  4IFD I;  2Z6K C;  3N6R A;  4A76 A;  2JA5 H;  3PO3 H;  5KYI A;  1H9M A;  3VYS A;  3NBH A;  1WCM B;  3K7U C;  2ZXR A;  3SK4 A;  1X9N A;  1PH3 A;  1CQF A;  2L5T A;  3G71 A;  1HA6 A;  4G7O C;  2C9O A;  4WJW A;  2WFW A;  2F4I A;  1CK1 A;  2N78 A;  3M9B A;  1CUK A;  2FMC A;  3EIV A;  3STB C;  1N36 Q;  2F0N A;  2OF1 A;  3EVQ A;  5DM6 3;  3BDL A;  4K6L A;  3S14 H;  4XT1 B;  3TZU A;  4L8J A;  3PQI A;  3CCV A;  3H3V H;  5C4H A;  4BBS H;  5EBD A;  1DXM A;  4YWM A;  2DGY A;  3PUX A;  2K5H A;  3TZD A;  1U4L A;  2PQA A;  3EQL C;  3M4Y A;  1YVC A;  3FRP B;  3WWV A;  4RA8 A;  3QB3 A;  5IGF A;  4X3U A;  1K9M C;  4DNT B;  5BR8 Q;  2E2J B;  4OO1 I;  2EYH A;  2ES2 A;  2R93 B;  3K0Y A;  1UUP A;  1C9O A;  2A6H D;  2E74 C;  3GTL B;  3LX0 A;  1TWH H;  5JPN C;  2EOT A;  3F2D A;  3SK8 A;  1AE3 A;  4FF4 A;  2Q2I A;  1STH A;  4YWL A;  4EX5 A;  3CMA A;  1XPO A;  3I4M B;  3G7L A;  2FMM A;  1F2L A;  3JAM E;  4C3J G;  4FF1 A;  2BE5 C;  2MUY A;  3J80 E;  3S1N H;  4J15 A;  1HQM C;  1TWG B;  3NTI A;  2JA6 H;  2HD3 A;  4Q0F A;  4X3S A;  3J7Z C;  4RHS A;  2R93 H;  3PUW A;  1C7Y A;  1H9S A;  3D4D A;  3GTL H;  4IOC A;  2NZ1 D;  4RGT A;  2Z4I A;  1SNC A;  3NK9 A;  4QMG A;  4K0K L;  4KTA A;  5ELE A;  3FKI H;  1PH5 A;  3KLS A;  1Y14 B;  1A3V A;  4JI8 Q;  1PFM A;  5I9O A;  4B3S L;  3I4M H;  1VDZ A;  1GKH A;  1KLG D;  2SDF A;  2VUM G;  1VCI A;  1NNX A;  4CDF C;  1IXR A;  2K03 A;  1EIG A;  2I5H A;  5AJ3 L;  3KLS X;  1SNM A;  1JWM D;  1TWG H;  3F2C A;  4CDE C;  4GNX C;  1UE6 A;  1HTP A;  1RKN A;  2R7D A;  1FD7 D;  4XQN A;  4BBS G;  1YJ9 A;  1CFM A;  2HIV A;  4XT3 B;  4B3S Q;  2HIX A;  1YIJ A;  1AEX A;  3F8T A;  3S2H B;  1B44 D;  1PFB A;  3H0G H;  1L1O C;  2X69 A;  1NTG A;  2O5J C;  2DNC A;  2XNA C;  4IFD J;  1A2U A;  4K8J A;  3ND8 A;  2MO1 A;  3GTJ B;  1K83 H;  5D3I B;  5KYL A;  1EY6 A;  3HKZ B;  1SJE D;  5GAG C;  1HZA A;  3RLO A;  5CYU A;  5L37 A;  3TQY A;  2F3W A;  2F3I A;  1B70 B;  3DUZ A;  4B3M L;  3NTH A;  2H1E A;  1J5E Q;  1Y8P B;  3S1R H;  1IBM L;  3AFQ A;  2MFI A;  1R9T B;  3QG1 A;  4AYB B;  1SND A;  3CP0 A;  3FPP A;  3H6M A;  5EBC A;  3CPF A;  2R61 A;  1W2B A;  5HGQ A;  1LTG D;  2AUJ D;  4Q5V A;  1HNZ L;  2ATW A;  1PRT D;  3CCL A;  3GTO B;  2JA6 G;  4B3M Q;  4KD3 A;  2MPM A;  3MZ5 A;  4UDU C;  2BA0 A;  2SEB D;  1I6V C;  4WRD A;  1STB A;  1KD1 C;  1O7Y A;  1TS5 A;  5LHY 1;  3GTG B;  3MTS A;  3NEL A;  1OO9 B;  3UI2 A;  3HOU H;  3FKI G;  5IY0 A;  2K32 A;  4GS3 A;  3OOC A;  3H91 A;  1B1Z A;  2NWG A;  2WB1 G;  1ZEQ X;  3D6W A;  4DNI A;  5IGG A;  5C44 H;  1PTO C;  1OXV A;  4C3I G;  4JI3 L;  2CCZ A;  1CHQ D;  4BY1 G;  4PZ7 A;  1O78 A;  3OWE B;  2R7Z G;  5K36 H;  2RHQ B;  3GTO H;  5IYC G;  5CGK A;  4YHH L;  5M9O A;  4QF4 A;  3UE1 A;  1UWV A;  1TWA B;  4A93 G;  2Z4H A;  3A8K E;  2D0P A;  5E1F A;  2KQ3 A;  1E2W A;  1FVI A;  3VA7 A;  2Y0S E;  3H0G G;  4LF8 Q;  4HSV A;  3HRZ C;  1ESR A;  1S3O A;  4XTC S;  4IUU A;  4NDX A;  2H5X A;  1BBX C;  3HZX A;  3J7A 5;  3T51 B;  2AQ2 B;  4N9P A;  1DOK A;  4YHH Q;  1MGS A;  2E2I B;  3PCO B;  1ICF B;  4C3H B;  1IYU A;  3QR8 A;  4RCN A;  3JAM L;  3FDT A;  1AZQ A;  3J7A V;  3RN5 A;  1GUW A;  1DD2 A;  3J80 L;  1TWA H;  2N49 A;  3IFD A;  1Q86 C;  2JA8 H;  1KQS A;  1WD1 A;  1X6O A;  4JI0 Q;  2M00 A;  2ZXP A;  2PMZ E;  4X62 L;  4MNO A;  1ESF A;  3DM3 A;  1SMX A;  3L2P A;  4C2M B;  4WJ4 A;  4IUP A;  1HTL D;  2QEJ C;  4GNX B;  2E2I H;  1A8V A;  5GAE C;  3PO2 G;  5C3W A;  1CQV A;  4C3H H;  3HOX G;  3AB9 A;  4CDC C;  5IOD A;  1SXT A;  2E5L Q;  4HJ9 A;  1K3B C;  3HOU G;  4B9W A;  3SXH A;  1B7Y B;  4KHP Q;  1L1O B;  3A7L A;  4L5T A;  2PYK A;  4X62 Q;  4A3M G;  2PNR C;  4GLA C;  3DHQ A;  4DA2 A;  1M90 C;  1HNW Q;  2F0H A;  2GN5 A;  1M4V A;  1X56 A;  5C44 G;  1CTM A;  2TSS A;  2VY3 A;  4O1N A;  5JEA G;  4G4K A;  4P72 A;  5IP7 H;  2K52 A;  1Q1B A;  2EYF A;  2UXB L;  3H15 A;  1PH1 A;  2SNM A;  3A56 A;  1FJG L;  2MGS A;  3H09 A;  2EYO A;  4LNQ A;  4NXN L;  4AH6 A;  3QIA A;  1SYB A;  4GKK L;  3BDO A;  3NWS A;  2LMC B;  1YHQ A;  4QUF A;  3UDG A;  1YNJ C;  3I70 A;  1V1Q A;  5NUC A;  5FKA C;  3HOW G;  3IRB A;  4FF2 A;  1IW7 D;  1FJG Q;  4IOA A;  1SYD A;  2GVB A;  4FP5 D;  4NXN Q;  1V1P B;  4JOI A;  1S5C D;  1EY4 A;  1VMC A;  1H95 A;  4OHJ A;  2NVT B;  4FVM A;  3OHX C;  1HHV A;  4MHE A;  4LFC Q;  1HFG A;  1T5E A;  3C46 A;  1UNS A;  1SE8 A;  4POF A;  1LLR D;  3ITP A;  3W2D A;  4DXG A;  4A3F B;  2E75 C;  2A68 D;  4ABN A;  1G8Z D;  4B08 A;  3SVM A;  1RTN A;  3BYT B;  4CKB A;  2Z0S A;  1EU3 A;  2B8F A;  3GTM H;  3TS2 A;  1GM5 A;  1XX8 A;  3KOJ A;  2JA8 G;  2PW7 A;  4IUQ A;  5D65 A;  1YI2 A;  1A6X A;  2EYJ A;  2VW9 A;  2VXW A;  3QOL A;  5FLX E;  5CBE E;  1K8A C;  3M4O B;  2KCC A;  4JI5 L;  1ZYR C;  5IGB A;  1GVP A;  1QUQ A;  5C4X B;  5DAU A;  2PPB C;  4DUZ L;  3GTQ B;  2YTX A;  1PYB A;  2RHS B;  5LMU L;  2NVT H;  5CV5 A;  2R92 B;  1RTO A;  4A3E B;  1G6Z A;  4A3J B;  1SMY C;  3K5M A;  5JAV A;  2XWJ B;  3J81 E;  1K8G A;  3SK5 A;  4DR6 Q;  4A3F H;  3OIP A;  3W3A A;  4B3T L;  1B53 A;  2L9H A;  4X66 L;  3S15 B;  3I4N G;  1AW7 A;  1N34 L;  3HOZ G;  2SOB A;  4PZ8 A;  1PHJ A;  2RVL A;  4H02 A;  1IZ6 A;  1HQR D;  4DXF A;  4H0L C;  4DUZ Q;  5IP7 G;  5LMU Q;  1QB5 D;  5J39 A;  2NN6 H;  4IQZ A;  1Q82 C;  1PYS B;  4HMJ A;  4DAY B;  1VQ6 A;  3L7Z C;  4LF5 Q;  3KF6 A;  3K5O A;  1WTQ A;  3IAY A;  3BYY B;  1X3Q A;  4BY7 B;  2CQO A;  1WTH A;  4KI0 A;  3H3V C;  4X66 Q;  1BBW A;  1DYQ A;  4IPC A;  2R92 H;  4A3E H;  1F9S A;  3KK7 A;  4P71 A;  4JBM A;  4DFA A;  2HHH L;  1PV4 A;  5CV4 A;  2BH2 A;  1K28 A;  3TDQ A;  4ID6 A;  1I4Q A;  2TMP A;  4PG3 A;  2Y0S B;  2ZJQ A;  4R4I A;  1G2S A;  1LV9 A;  4JCV E;  1PYW D;  2XRS D;  5M3M B;  2EDG A;  3UDI A;  1SFO B;  1TT2 A;  4FO2 A;  4JYA L;  3T4A C;  1P16 A;  1E1O A;  2HCI A;  4RMF A;  3RUZ A;  5FOB B;  1M1K C;  2LY7 A;  3NE5 B;  1D1I A;  2XIW A;  3GD7 A;  5A2Q L;  2NVX B;  2HHH Q;  3CW2 C;  4DR2 L;  3PUV A;  2HT1 A;  1A3T A;  2M9V A;  4DNR B;  4A4I A;  3TRZ A;  4RFB A;  1SNQ A;  1B9M A;  3HP3 A;  3FPU B;  4JYA Q;  1L0X B;  1VQA A;  1EIY B;  3DWP A;  2B2T C;  1QWY A;  5CC4 A;  3CKI B;  1EY5 A;  1EQV A;  1UAP A;  2UUB L;  1XTD A;  5M3M H;  5JJK A;  4DV1 L;  1Y8N B;  3AFP A;  5IT9 E;  1BKB A;  1QVF A;  2A69 C;  1W6K A;  2A6E C;  1HZ9 A;  2G9H D;  4IFD G;  1D1K A;  1U9R A;  1EZ8 A;  5A35 A;  5M5Y B;  4IUN A;  3J7Y W;  1TS4 A;  5COR A;  3DLL A;  1HXY D;  2UUB Q;  1F2Y A;  5TSS A;  2Z1C A;  2F52 A;  1EY9 A;  4DV1 Q;  2NN6 G;  3PGZ A;  3M7N A;  1TKW B;  1IYJ B;  5T1I A;  1SN8 A;  2K6A A;  4HIO A;  1D6E C;  1JJC B;  2EJG C;  1MHW C;  3Q22 A;  3EBE A;  5FLM G;  2ZTE A;  5HGT A;  4A3D H;  1EU4 A;  1WTX A;  2YTV A;  2JJQ A;  2NVY H;  3VA5 A;  1OXX K;  1D5Z C;  4AQY Q;  1YBY A;  1ILP A;  2JA7 G;  1VF5 C;  1ASY A;  1IL8 A;  4C3J B;  2Q2H A;  4L63 B;  2QDL A;  1FNV A;  2ZT9 C;  3HKZ E;  5M5Y H;  1NBW A;  3TN2 A;  2F0W A;  3D3R A;  2F03 A;  1JOR A;  4A3B G;  1Q8K A;  5C4J B;  3FHW A;  3KYH C;  3FVQ A;  1QVC A;  4B9X A;  1KDA A;  3H94 A;  3K8A A;  2RSN A;  2EYM A;  1K0S A;  1QNK A;  2F4V L;  3CCQ A;  4NPS A;  4K5V A;  4ZRZ A;  4AYB E;  5FK9 C;  3X3N A;  2A8V A;  3S1M H;  2YTY A;  2PI2 E;  3CQZ B;  3P1H A;  1K8M A;  1MKH A;  3ULL A;  3L3O C;  2VQF Q;  2VUM B;  2EY2 A;  1PMR A;  1SJH D;  1HA5 A;  1BXT A;  4A3I H;  1R4P B;  2J7Z A;  4CBV A;  1ML0 D;  2F0F A;  5EQ0 A;  4DR4 L;  4KHZ A;  3U50 C;  2WAC A;  1VQJ A;  1Z7T A;  3NEM A;  4BBS B;  4DV0 L;  3F2U A;  5C4J H;  3M4P A;  1PTO D;  1MIU A;  5D14 A;  3S16 H;  1VQ4 A;  4Z9C B;  1KDC A;  3U4Z A;  4GN5 A;  3TME A;  1EYD A;  5ELN A;  2N55 A;  4O2D A;  5COY A;  5C4Z A;  3SGI A;  3CRL C;  1J6Q A;  3CQZ H;  2OTL A;  1RIP A;  3NP8 A;  2JE6 I;  4DR4 Q;  3WOE A;  1A63 A;  2EJF C;  1I94 L;  1EFW A;  2VUM H;  3NHH A;  4DV0 Q;  3OPO A;  3RLF A;  4ZKB B;  5M5X B;  1V9P A;  3I72 A;  4ZLT F;  2WV6 D;  1SNP A;  3VR6 A;  5E4W C;  2L11 A;  2N3S A;  1BR9 A;  3CAM A;  1BNZ A;  3AMU A;  1TWH B;  3GV6 A;  1BQQ T;  3SR1 A;  2B2W C;  4F88 A;  1HZB A;  4MZ9 A;  4A3D G;  5C5M A;  2L1B A;  1XNR L;  1SBB B;  1I94 Q;  5DEH A;  4JBW A;  3G4S A;  4A3K G;  3I73 A;  2K50 A;  4A3C H;  4R4T A;  5M5W H;  2HQL A;  2RCF A;  1DJR D;  4BBR H;  5JJL A;  4JI6 L;  3S1N B;  3K58 A;  2MHV A;  2JA6 B;  3QO2 A;  4H7B A;  1I5F A;  2WAQ G;  1G29 1;  5M5X H;  3E0J A;  5E3F A;  2O4X A;  3UDF A;  1I4H A;  4DR3 L;  2A74 C;  3Q24 A;  4Y7N H;  1JCK B;  3FKI B;  2JA9 A;  3GO5 A;  1YNN C;  1HCZ A;  3DXJ C;  4JI6 Q;  4BS9 A;  4LF4 L;  5ELD A;  2WB1 B;  2KCT A;  2OQK A;  3WDN A;  1DOM A;  4A3I G;  4C3I B;  4X64 L;  3G6E A;  2F3V A;  3OIQ A;  1ICW A;  4BY1 B;  5IT9 L;  4DR3 Q;  3I8Z A;  5EPL A;  3TBI B;  3P7J A;  5I4D A;  2OT2 A;  1ET6 A;  4H44 C;  4IO9 A;  4DAP A;  4A93 B;  3A7A B;  1EOV A;  4XIG S;  4KN4 C;  4PV1 C;  2F0U A;  3H0G B;  4O42 A;  1PH4 A;  1H9K A;  2AKW B;  4X64 Q;  2LKV A;  3VYT A;  4DKA C;  1LT6 D;  4RKB A;  5JJZ A;  2KHJ A;  3W1B A;  4C1N I;  4CJ0 B;  1LTS D;  3JAM i;  4C1N K;  1K83 B;  4HN7 A;  3RMH A;  2PZT A;  2NB0 A;  4CJ1 B;  3HOV H;  4R1J A;  2L55 A;  3J80 i;  1HR0 L;  4C3I H;  2BOS A;  4BY1 H;  1KAA A;  1Y69 U;  5C0X I;  3S2D B;  1Q46 A;  2R7Z H;  4PMC A;  4K0K Q;  3SEB A;  5IYC H;  3S1R B;  4HIK A;  1K0R A;  2BDO A;  3PSI A;  1EWC A;  1BCP D;  4EQ5 A;  4YCW A;  1VQO A;  1XTC D;  4A93 H;  1ONL A;  4LUV A;  4UY8 C;  2H4O A;  1NY4 A;  3TP5 A;  3CCJ A;  4A3C G;  1PZJ D;  3F2B A;  2PQE A;  5AJ3 Q;  4BBR G;  4P74 A;  4JVZ A;  4YWK A;  1RHP A;  2CH4 W;  4PQX A;  5JVG 3;  1EIF A;  1VQ5 A;  4O0A A;  1D7Q A;  1SYC A;  2WII B;  3PO2 B;  2N88 A;  2UUC L;  2FHT A;  4A3G G;  2KED A;  5I2Y A;  1KHI A;  2RBM A;  2B63 H;  3HOX B;  1ZYR D;  3S2D H;  1TVX A;  1STG A;  1TWF B;  5G3L D;  2IX3 A;  2CW0 C;  5JOB A;  3HOU B;  4ZK9 B;  4DUY L;  5EPJ A;  1LT4 D;  1F9R A;  1WCM G;  4ZUJ A;  3PUY A;  1F2M A;  4A3M B;  3MXN B;  3CHB D;  1VQ7 A;  3KUP A;  1SYF A;  5C44 B;  2IX0 A;  1XYI A;  2UUC Q;  3K80 C;  3NWT A;  2K1B A;  1KL9 A;  4OEL B;  1AN8 A;  4DUY Q;  2K28 A;  2Q2T A;  1IBM Q;  4EGV A;  1S5F D;  4JG2 A;  2ICI A;  3CXC A;  4KN7 C;  3PO2 H;  4UP9 A;  4UHV A;  3IKJ A;  4KJO A;  4HJA A;  3U58 A;  2EY5 A;  3E5S A;  1HUM A;  3HOX H;  1TWF H;  3B6Y A;  1HNZ Q;  4JW0 A;  3HOW B;  2QIL A;  2NTS A;  2E2D C;  2D62 A;  3NXW A;  2PW5 A;  2F0V A;  1PH8 A;  4A3M H;  4A75 A;  2ZXO A;  4L6T B;  5M3F G;  1N32 L;  3TEH B;  4HMI A;  4RGO S;  3HOV G;  2PCF B;  3VR4 A;  1BUV T;  5JEA H;  1B8A A;  1ZKO A;  1YJW A;  4KKT A;  1EY0 A;  1VQB A;  3A5Z B;  4ZUI A;  1XMQ L;  3U4V A;  1K8O A;  3RD4 A;  2RKS A;  1HR0 W;  3D31 A;  1YJN A;  4QY7 A;  4JK1 C;  4ZKC B;  4IN3 A;  1LUZ A;  2X6L A;  1CKM A;  1MSG A;  2JA8 B;  1N32 Q;  5GAH C;  1E7Z A;  3LGJ A;  1JR0 D;  3V96 A;  2F1M A;  2A1A A;  4JI3 Q;  1VQC A;  2BA1 A;  4MTN A;  3HOW H;  1YZ6 A;  1UEA B;  1GD7 A;  1PDQ A;  4RH6 A;  4GKJ L;  1FNU A;  1DOL A;  4DAM A;  2RDF A;  3H3V I;  2VS1 A;  1LTA D;  4E6I A;  1SYE A;  4GOP C;  1AP0 A;  1X3F A;  2RSO A;  3OW2 A;  2PI2 A;  2B63 G;  4C56 C;  2GVA A;  4LFA L;  1N33 L;  3M4Q A;  5C0X J;  3IL8 A;  3I4N B;  4DK3 C;  3MWY W;  3R93 A;  4JI7 L;  3HOZ B;  2F0K A;  2ALY B;  2FXQ A;  2JXM B;  1LTL A;  5A2Q E;  1NSN S;  1SE4 A;  4HED A;  4I7A A;  3OMG A;  2Q8I B;  1GO3 E;  1NR2 A;  3FP9 A;  1EL0 A;  2DJF C;  3T1H L;  1HH2 P;  4KY7 A;  1ENF A;  1TXY A;  3P75 A;  3KLR A;  4LFA Q;  1N33 Q;  2CHB D;  1LTI D;  3E9H A;  3D6C A;  4UP8 A;  1SSO A;  2K05 A;  3UE0 A;  3QWN A;  4DV6 L;  2IPK D;  1L0W A;  1F2Z A;  5EKK A;  2MO0 A;  3DEO A;  2FJ2 A;  3JAM c;  3PIO A;  3T1Y L;  4JI4 L;  1EY7 A;  2Z9H A;  1L0Y B;  1KXL A;  1IKL A;  4PMW A;  3J80 c;  2NUC A;  3A55 A;  3I4N H;  3I55 A;  2A6H C;  2HQE A;  3HOZ H;  4LK1 C;  2B2V A;  2WAQ E;  4HSP A;  4LF6 L;  4IPH A;  5KGU A;  2F0E A;  4DV6 Q;  2IL8 A;  1CSQ A;  3MXU A;  3LNN A;  1VQI A;  3T1Y Q;  4HTH A;  4JI4 Q;  4P2C B;  5T1G A;  3CCU A;  2XWB B;  5ELO A;  1STE A;  4NKL A;  2K5Q A;  3GTM B;  3ICE A;  5H1S E;  4M1U B;  5IYB H;  2EQS A;  2K7V A;  1T5X D;  2D9U A;  1CKN B;  3W1G A;  1VQD A;  1Z6H A;  1BF4 A;  1ENA A;  5BN3 A;  2A19 A;  1SE2 A;  1ASZ A;  2K5D A;  1JB7 A;  2F0D A;  3I7F A;  4K2L A;  2EVB A;  5DLQ E;  2UXB Q;  3ERS X;  1I6H H;  1JWS D;  3E9I A;  4BWG B;  1D5M C;  4DV7 L;  4LW1 A;  2IJ0 A;  1U4R A;  1JE4 A;  4J1M A;  4GKK Q;  4TRD A;  3MEH A;  3BVG A;  1GUT A;  1E2Z A;  4JI1 L;  2MP1 A;  5IYD H;  4R4O A;  1XWE A;  2BH8 A;  2F0T A;  2UXD L;  3N52 A;  2F0P A;  2ZTC A;  1NAP A;  5KNB A;  2XSC A;  3TSS A;  4N8X 1;  1O7Z A;  1I4R A;  3CD6 A;  3Q8D A;  3BG3 A;  1Q3L A;  3CME A;  4JBJ A;  1G91 A;  3X3M A;  4OL7 A;  1S4Z A;  3DM1 A;  2QKI C;  1I4X A;  4RGM A;  2VB2 X;  1GUO A;  1I50 B;  3BVZ A;  1L1O A;  1QCB D;  3E0E A;  3CF5 A;  2D5D A;  1HJP A;  1WJJ A;  2OQ0 A;  2X6G A;  2ZM6 L;  3STB D;  2JA7 B;  1E3P A;  2RQX A;  1NCV A;  2EY6 A;  4NW2 A;  3GQB A;  4APV A;  4IFD H;  1TR5 A;  4JI5 Q;  4NMZ A;  1OXU A;  3DEP A;  1WTP A;  4JV5 L;  2WP8 J;  4KK7 A;  2KUM A;  4A3B B;  2AWN A;  3RZD B;  1VQ8 A;  1X65 A;  4RHR A;  2ZJR A;  4GOP B;  1HNX L;  3EJI A;  3R8B A;  3CC7 A;  1VQE A;  2YYZ A;  4BXX H;  1GUG A;  1HZC A;  4B3T Q;  3R2T A;  4HJ7 A;  4V19 0;  5EGT A;  3MEF A;  3QJY A;  4HAE A;  1I50 H;  1PRT C;  1N34 Q;  1Y1W H;  2JEB I;  3TP8 A;  3J81 i;  5IYB G;  5FLM H;  1KC8 C;  2NVQ B;  3W5O A;  4JV5 Q;  1YIT A;  3I91 A;  1IL2 A;  1HFN A;  5I6W A;  4J8Q A;  2JA7 H;  1EYA A;  2IT1 A;  3OTO L;  3PF5 A;  1HNX Q;  3ULJ A;  3VYR A;  1YNN D;  4FXG C;  1G51 A;  1M8A A;  1S5E D;  2F0J A;  2J4X A;  1MBY A;  3DWA A;  4FF3 A;  4TQU S;  4A3B H;  4OO1 H;  4P75 A;  2BE5 D;  4YY3 L;  4IUT A;  3RZD H;  1EWH A;  2NTT A;  5IYD G;  4N8F A;  3K5N A;  1EQQ A;  3KFU A;  3TP7 A;  2VL6 A;  3OTO Q;  5I2X A;  4LUO A;  1S40 A;  2KCN A;  2WB1 E;  3C1F A;  1TQO A;  1SNO A;  1MD2 D;  2NVQ H;  1EZ6 A;  1LM0 A;  1C4Q A;  3J7A F;  2E2H B;  2QGQ A;  4I65 A;  5KEE A;  2XRQ D;  4YY3 Q;  2OWO A;  1O7L A;  5IGC A;  3SE0 A;  3V05 A;  3G6J B;  4K6D A;  1JE5 A;  4DR2 Q;  2B2Y A;  2HDM A;  4K5X A;  3ERQ A;  5ELC A;  4OWX B;  1IBK L;  1V43 A;  3KJO A;  3PF4 A;  2XVS A;  1E1T A;  4A3D B;  2A73 B;  5IP9 H;  1CA5 A;  1W6J A;  1P8L A;  4X3K A;  1SAP A;  5I6Y A;  2NVY B;  3MAQ A;  1VQL A;  3FMC A;  2VQE L;  1JQY D;  2F0Q A;  3BJU A;  3KDF A;  4A3K B;  4DAY A;  1CA6 A;  1EUJ A;  4PNY A;  1XPU A;  4WFN 3;  3A5U A;  4KY6 A;  1AZP A;  2E2H H;  1N9W A;  2B2U A;  5FJ8 G;  1XNQ L;  1IBL L;  2WAQ B;  5DNF A;  1T9H A;  2JN4 A;  3T13 A;  5IGD A;  2VQE Q;  5CV8 A;  1PRT F;  4BXX G;  3WOF A;  5IWA L;  3S1M B;  2F0G A;  2KHS A;  1S72 A;  1RJT A;  4RG1 A;  1Y1W G;  3HOY G;  5IGE A;  1FL0 A;  2JP1 A;  1WTR A;  1BBU A;  4U68 A;  1XNQ Q;  2RA4 A;  1IBL Q;  4A3K H;  1DZ1 A;  4A3I B;  1K3R A;  2I5L X;  1BVS A;  4KD4 A;  1JJG A;  1FGB D;  3P20 A;  3I2Z A;  4DV4 L;  1A2T A;  1PZK D;  4M8A A;  3NBH B;  1F77 A;  2O2L D;  2CKZ B;  4K5W A;  1KLU D;  4OO1 G;  4NXM L;  1EIH A;  1Y8O B;  4BA2 I;  4JI2 L;  2OXP A;  3S16 B;  2LXJ A;  4LFB L;  4DR1 L;  3ZYY X;  3CCS A;  1PLF A;  2WKC A;  2KCM A;  5LMN L;  2MNA A;  4JBK A;  1U5K A;  3SDZ A;  1LAB A;  1SYG A;  1GUS A;  4H13 C;  5D3D A;  4QQB X;  1C8C A;  2EXD A;  4DV5 L;  2JYO A;  2EZV A;  3GDE A;  2PQA B;  1VQK A;  2LS0 1;  1JWU D;  4QIW B;  4LFB Q;  4DR1 Q;  4ME5 A;  5EPK A;  2F4V Q;  1SR3 A;  2L12 A;  1G2T A;  4NB3 A;  1Y1V G;  2ICE C;  3VDY A;  1I3Q B;  1IW7 C;  1XPR A;  2YU9 B;  5IP9 G;  1RDP D;  1CZW A;  1LAC A;  3KF8 A;  1PRT B;  2AUK A;  3I56 A;  1NE3 A;  1ROD A;  1TWC B;  2WKD A;  5KIX A;  4DV5 Q;  1WFQ A;  2K04 A;  4IPD A;  4ME3 A;  1NMG A;  2LXK A;  5FLX c;  5M5W B;  2XTI A;  2QDB A;  3L9A X;  4BBR B;  1MJC A;  2RCN A;  3S24 A;  5HY6 A;  1SRU A;  4R9W A;  4U67 3;  2A68 C;  3K6O A;  3K5L A;  1HRJ A;  4G7H C;  4HJ5 A;  4RKL A;  2EYL A;  3J81 c;  2Q8R E;  1VQM A;  4A3G B;  4ZYS A;  1OTC A;  4Y7N B;  1Q8I A;  5C0X G;  3TP6 A;  1I3Q H;  1Z47 A;  1UE1 A;  2YU9 H;  1VF7 A;  3S9W A;  4GLX A;  2HUG A;  1TWC H;  3M3Y H;  4RCO A;  2NN6 I;  4MTK A;  1H9S B;  2B8G A;  2G9D A;  4DN4 M;  2R6G A;  3E3X A;  4KY5 A;  2G5D A;  4DV2 L;  3Q0A A;  1PA6 A;  4HCS A;  3T56 B;  5CV7 A;  1QNU A;  3HEJ A;  5C3E H;  4KMU C;  1OXS C;  1DGS A;  1NUC A;  1SDF A;  3KBG A;  3RN2 A;  1X32 A;  3PUZ A;  2EYP A;  1TY2 A;  5BR8 L;  1LT5 D;  1HPC A;  3URY A;  1FNW A;  4RWS C;  3VYU A;  4A3L H;  5EAY A;  1XNR Q;  2J0T D;  3F1Z A;  1B3Q A;  2IHF A;  1QG7 A;  2R7F A;  4A3G H;  4R4Q A;  5CBA E;  3J81 j;  4ZQ3 A;  4DV2 Q;  4WJ3 M;  4XQJ A;  2CFM A;  2SNS A;  3T16 A;  1QZG A;  4F7X A;  1WCM H;  3OW7 A;  5LMN W;  1VQN A;  1YNX A;  4LWC A;  4TSS A;  1D8L A;  2AHO B;  4GLV B;  5M3F B;  1B2T A;  1GHJ A;  4FYD A;  3HOV B;  1C48 A;  1LT3 D;  2IHE A;  1U4M A;  2R7Z B;  2PZU A;  2B2V C;  1ILQ A;  1RD9 D;  3GP7 A;  1B50 A;  1NJI C;  2OTJ A;  3EN2 A;  4XXE A;  1B9N A;  1X54 A;  2EJM A;  1WOC A;  4LF4 Q;  1QE6 A;  3GTK B;  1NMF A;  3NSW A;  2HDL A;  1CM9 A;  3I90 A;  4IAL A;  4ZAI A;  1X55 A;  4EQP A;  4JI8 L;  2EY1 A;  3PIP A;  1DCZ A;  1KIX A;  1XMO L;  2E2J H;  5M3F H;  1YNJ D;  4KKU A;  2K01 A;  2I07 B;  1F9P A;  3LWU A;  4LF9 L;  1SLJ A;  1GUN A;  5IT9 c;  2AQ3 B;  4DK1 A;  5J3B A;  3OMC A;  2UUA L;  1KTK A;  1BDO A;  3I4O A;  2B63 B;  4K2K A;  2KBN A;  3D4R A;  2WIN B;  2JA5 G;  3PO3 G;  1VQG A;  4JOI C;  4HJ8 A;  2B2T A;  5FO8 B;  2DNE A;  4LJZ C;  2NBF A;  4S3S A;  2F0S A;  1XMO Q;  3CC2 A;  2Q2U A;  2F0M A;  4HIM A;  4LF9 Q;  1HR0 Q;  3GTK H;  3K57 A;  3HFZ B;  2UUA Q;  5C3E G;  2K75 A;  2CH4 A;  1E2V A;  4AIM A;  5ELB A;  2QEX A;  4YIJ A;  1JOO A;  2L4N A;  4A3L G;  3UDX A;  5C5L A;  2KJX A;  4OIJ A;  5CR3 A;  2ASB A;  1WTV A;  5AFW A;  3NQI A;  1YHB A;  3NUC A;  3PIO 3;  3OWF A;  1J9O A;  1J5E L;  1S5B D;  2EIF A;  3CRK C;  1VQF A;  3EFX D;  1SMY D;  1TII D;  1GXD C;  2CQA A;  2O5I C;  5GRO A;  1AH9 A;  4K14 A;  4DF7 A;  4ULL A;  2ENB A;  4I7Z C;  2QA4 A;  4PMB A;  3CC4 A;  1EY8 A;  5J22 A;  1EQT A;  1RF2 D;  2EPB A;  4DV3 L;  2A5H A;  2OEO A;  4OGQ C;  2VZA A;  1KNA A;  4CDD C;  1V1O A;  3GTP B;  1IYV A;  4OXP A;  3S2H H;  4RAU C;  1G6P A;  1A62 A;  2QF7 A;  1R4Q B;  1K73 C;  1A15 A;  1Q12 A;  2CWA A;  3EA6 A;  1QIL A;  4EQN A;  2D2C C;  3I3C A;  3RZO B;  3GTJ H;  3M85 A;  4DV3 Q;  4DPG A;  2R93 G;  2PO4 A;  1E24 A;  2M2L A;  4TVA B;  1AE2 A;  1JC7 A;  1KNE A;  1Q1E A;  2UXC L;  5GAD C;  2JEA I;  3ZJY C;  3NEN A;  5JPM C;  1LO5 D;  1BO0 A;  1STA A;  3U9S A;  5DM7 3;  3I4M G;  2KEN A;  4UPA A;  1R9T H;  3KBX A;  4CKE A;  3GTP H;  2QCP X;  5HUR A;  1QVG A;  5KNC A;  1TY0 A;  4XDX A;  4LF8 L;  3DWQ A;  4YCU A;  3V2T A;  4LAA A;  5E4X A;  1U4P A;  4G7Z C;  2UXC Q;  2Z8L A;  2IWH A;  1SE3 A;  1W3S A;  1OXT A;  1XMQ Q;  2Z6K A;  1CT1 D;  1N8R C;  1EFI D;  3HGB A;  3RZO H;  4HCE A;  3MXN A;  1PH7 A;  2L0C A;  2DN8 A;  4BA1 I;  4K8I A;  4OWT B;  5JVH 3;  2AMC B;  3ONA B;  1UEB A;  4GN4 B;  3GTG H;  1PZI D;  2B3G A;  1D2B A;  1STN A;  2B2Y C;  2OCE A;  1A3U A;  1MSH A;  2CVR A;  2D0O A;  1PH6 A;  1KDB A;  4GKJ Q;  3BVM A;  3BDC A;  3R2I A;  2XGT A;  1CKO A;  2A69 D;  1RL2 A;  4X65 L;  2B2W A;  3PV0 A;  2K4K A;  4MN3 A;  2A6E D;  1O7I A;  3KLW A;  4KHV A;  4JI0 L;  1S5D D;  2V1C C;  4ZCK A;  1A0I A;  4YCV A;  1VQ9 A;  4LF7 L;  2NZH A;  2F0L A;  2B2U C;  2KEC A;  2KOL A;  2NZO A;  1LTT D;  5BN4 A;  5FO9 B;  4JI7 Q;  4CGY B;  3DMU A;  2V4D A;  1IKM A;  3NTK A;  5GQO A;  1D5X C;  4X65 Q;  1FGU A;  2Q8T A;  3A8J E;  3BU2 A;  2E5L L;  1KRT A;  3T1H Q;  3R3O A;  1VQH A;  3Q6S A;  1O80 A;  1I6H B;  3U9O A;  2DY7 A;  2XN9 C;  4KHP L;  1V8Q A;  1KAW A;  4LF7 Q;  5J1Z A;  4EQO A;  1HNW L;  2ZJP A;  1VMP A;  4QL5 A;  3GV3 A;  5C6A A;  3HKZ G;  2ZTD A;  1H9J A;  5KND A;  4R8N A;  1UE5 A;  3CCM A;  4GZY C;  2E76 C;  1I4G A;  1WI5 A;  4J6H A;  3A54 A;  2P5Z X;  1QUQ B;  3TRE A;  3HS0 C;  1JB3 A;  5FO7 B;  4POG A;  4AYB G;  2EE1 A;  1JMC A;  4LF6 Q;  1PTO F;  3KJP A;  4OWW B;  2GA4 B;  4NP5 A;  3CPW A;  1ET9 A;  3PMF A;  2YV5 A;  3HG9 A;  5CMD A;  1EYG A;  3D8G A;  1JJ2 A;  1CHP D;  4R4C A;  5K36 G;  2VNU D;  1VS0 A;  2K5V A;  1JT8 A;  5K5P A;  3VR5 A;  2FIN B;  4C2M H;  3BZD B;  4LMQ D;  1SRO A;  3D4W A;  4LFC L;  4DK6 C;  1LYL A;  4G57 A;  3HKS A;  3K7A B;  3KF6 B;  1FR3 A;  2L15 A;  4UAI A;  2CWP A;  3T53 B;  4PZ6 A;  3MC0 B;  4DV7 Q;  1KAB A;  1XXG A;  1QOH A;  1ENC A;  2K14 A;  4QIW E;  4IUV A;  2DJG C;  4GNX A;  1L2F A;  1EYC A;  2E8G A;  2K33 A;  1E0B A;  1BCP C;  3D0F A;  4JI1 Q;  2JQO A;  5BN5 A;  4HID A;  1JIC A;  3I4L A;  2UXD Q;  3MFY A;  5E7N A;  1Y1W B;  4CKC A;  1NR4 A;  2KVM A;  3HOY B;  3S17 B;  3M7G A;  4FDB A;  4OEM B;  2QW7 A;  3K59 A;  4DR6 L;  2EXZ A;  2I5M X;  1EQR A;  3SK6 A;  3K7A H;  2DUD A;  4KKS A;  2LSS A;  1PTO B;  3ND9 A;  3O13 A;  4OON A;  2B29 A;  4GN3 B;  3VR2 A;  1TS2 A;  1WD0 A;  3A8I E;  3C1E A;  4IZ8 A;  1X3E A;  1WTW A;  5FJ8 H;  1CKN A;  3MXP A;  3L0O A;  4MIU A;  5CV6 A;  3CU7 A;  4DK0 A;  5C3X A;  3ER0 A;  2I0Q A;  2ZM6 Q;  3BZC A;  3AU7 A;  4C3H G;  4X6A H;  4ODG A;  4LF5 L;  1E22 A;  1XJV A;  3QOJ A;  4L5Q A;  1II3 A;  3FEW X;  1GHK A; 
#chains in the Genus database with same CATH homology
 4R1J A;  3J80 i;  2EXD A;  4DV5 L;  1HR0 L;  2UU9 L;  4C3I H;  3HOY H;  3GDE A;  4BY1 H;  3S17 H;  2PQA B;  3A74 A;  1VQK A;  5C0X I;  1Q46 A;  3RN5 A;  2R7Z H;  2RF4 A;  4LFB Q;  4DR1 Q;  3RLN A;  4K0K Q;  2F4V Q;  5IYC H;  1SR3 A;  1TWA H;  1EWI A;  4HIK A;  4NB3 A;  1K0R A;  2N49 A;  1X3G A;  1Q86 C;  3KDF B;  2JA8 H;  3K0X A;  3PSI A;  1Y1V G;  1KQS A;  3VDY A;  1X6O A;  3M4O H;  4EQ5 A;  4YCW A;  1VQO A;  4JI0 Q;  1XPR A;  4A93 H;  1YHA A;  4LUV A;  5IP9 G;  4UY8 C;  1NY4 A;  2PMZ E;  5C4X H;  3I56 A;  4L5S A;  1NE3 A;  3CCJ A;  4A3C G;  3GTQ H;  4X62 L;  3F2B A;  4MNO A;  5AJ3 Q;  1WFQ A;  3DM3 A;  1SMX A;  4IPD A;  4ME3 A;  4BBR G;  3L2P A;  2UU9 Q;  4WJ4 A;  1PVO A;  5JJI A;  1NMG A;  4P74 A;  4A3J H;  2LXK A;  5FLX c;  2XTI A;  2C35 B;  4YWK A;  4GNX B;  2E2I H;  1A8V A;  1MJC A;  2RCN A;  3S24 A;  5GAE C;  5HY6 A;  3PO2 G;  1EIF A;  1VQ5 A;  1SRU A;  4O0A A;  3S15 H;  3K81 C;  4C3H H;  3HOX G;  1D7Q A;  4ALP A;  3RR5 A;  2E5L Q;  4HJ9 A;  3HOU G;  2UUC L;  4A3G G;  4HJ5 A;  1KHI A;  1B7Y B;  2B63 H;  4IJH A;  3S2D H;  3J81 c;  4KHP Q;  1L1O B;  3CCR A;  4L5T A;  4X62 Q;  4A3M G;  1VQM A;  4GLA C;  4DUY L;  4QGU A;  1M90 C;  1OTC A;  1HNW Q;  2GN5 A;  4P73 A;  3ULP A;  5C0X G;  1WCM G;  1X56 A;  5C44 G;  3PUY A;  1I3Q H;  2VY3 A;  3MXN B;  5JEA G;  1Z47 A;  1UE1 A;  4P72 A;  2K52 A;  5IP7 H;  1VQ7 A;  2YU9 H;  1Q1B A;  1Z9F A;  3S1Q H;  2UXB L;  3H15 A;  1PH1 A;  4BY7 H;  3A0J A;  4Y52 H;  1Y1V H;  2IX0 A;  4GLX A;  1FJG L;  1TWC H;  3M3Y H;  4IJL A;  4LNQ A;  1U0L A;  2NN6 I;  4NXN L;  4AH6 A;  2UUC Q;  4DR7 L;  1C0A A;  4IPG A;  2R6G A;  4DV2 L;  3K80 C;  1PA6 A;  4GKK L;  3TS0 A;  1KL9 A;  2AWO A;  5C3E H;  4DUY Q;  1OXS C;  1YHQ A;  2Q2T A;  1IBM Q;  4GOP A;  3UDG A;  1DGS A;  3RN2 A;  4B3R L;  1V1Q A;  3PUZ A;  4JG2 A;  5BR8 L;  2K5N A;  3CXC A;  3PO2 H;  4A3L H;  3HOW G;  3IRB A;  4UP9 A;  5EAY A;  2JK8 A;  4HJA A;  1IBK Q;  3U58 A;  3HOX H;  1FJG Q;  1XNR Q;  1KRS A;  4IOA A;  3F1Z A;  3CCE A;  3B6Y A;  1TWF H;  1SFO H;  1HNZ Q;  2IHF A;  2GVB A;  4NXN Q;  2R7F A;  3BZK A;  4LUZ A;  1PH9 A;  4DR7 Q;  4A3G H;  4JOI A;  3AYH B;  4R4Q A;  2D62 A;  3J81 j;  4DV2 Q;  4WJ3 M;  1H95 A;  2CFM A;  1PH8 A;  4A3M H;  4A75 A;  3JC6 6;  4A3F G;  4LFC Q;  5M3F G;  2NVX H;  1SE8 A;  3TEH B;  4POF A;  1QZG A;  1N32 L;  3HOV G;  1WCM H;  5LMN W;  4B3R Q;  1VQN A;  1YNX A;  4LWC A;  1D8L A;  2AHO B;  4GLV B;  1B8A A;  2PNH A;  1YJW A;  1VQB A;  2N8N A;  3A5Z B;  3KF8 B;  2Z0S A;  3G48 A;  2IHE A;  1XMQ L;  3U4V A;  3GTM H;  3TS2 A;  1GM5 A;  4AQY L;  1HR0 W;  1Q81 C;  3D31 A;  1YJN A;  3KOJ A;  4KLK A;  4UP7 A;  2JA8 G;  4QY7 A;  1YI2 A;  1MJE A;  3OYY A;  1LUZ A;  1CKM A;  5IWA Q;  2VW9 A;  1NJI C;  2A8V A;  5GAH C;  1N32 Q;  1E7Z A;  3LGJ A;  3EN2 A;  2OTJ A;  5C4X G;  1X54 A;  1K8A C;  1VQP A;  1WOC A;  4LF4 Q;  4JI5 L;  1GVP A;  1QUQ A;  1VQC A;  2BA1 A;  3AQQ A;  2A1A A;  4MTN A;  1YZ6 A;  4A3E G;  4JI3 Q;  2R92 G;  3HOW H;  4A3J G;  1GD7 A;  4DUZ L;  1NMF A;  2YTX A;  4GKJ L;  1PYB A;  2RHS B;  5LMU L;  2NVT H;  4DAM A;  3H3V I;  2IY5 B;  2VS1 A;  1X55 A;  1K8G A;  4JI8 L;  4DR5 L;  4DR6 Q;  2MQH A;  3PIP A;  4GOP C;  1KIX A;  1X3F A;  1XMO L;  4A3F H;  5IE8 A;  2PI2 A;  3OW2 A;  5M3F H;  2E2J H;  4OX9 L;  4DV4 Q;  4B3T L;  4X66 L;  2B63 G;  3I4N G;  1Q7Y C;  4LF9 L;  1SLJ A;  1PH2 A;  5IT9 c;  1N34 L;  3HOZ G;  2GVA A;  4LFA L;  2ID0 A;  2VQF L;  5J3B A;  2UUA L;  1N33 L;  4PZ8 A;  1PHJ A;  3M4Q A;  4H02 A;  5C0X J;  4NXM Q;  3I4O A;  1IZ6 A;  4DK3 C;  4JI7 L;  2KBN A;  4DUZ Q;  4JC0 A;  4JI2 Q;  5JEA J;  2JA5 G;  3PO3 G;  2KHI A;  1VQG A;  4JOI C;  4HJ8 A;  3RNU A;  5IP7 G;  5LMU Q;  2ALY B;  2FXQ A;  1UE7 A;  1LTL A;  4BY7 G;  1CSP A;  5LMN Q;  1YEZ A;  1PYS B;  1Q82 C;  4DAY B;  1VQ6 A;  4DR5 Q;  3L7Z C;  1GO3 E;  4LF5 Q;  3KF6 A;  1XMO Q;  3CC2 A;  3AEV A;  3FP9 A;  4OX9 Q;  2Q2U A;  3T1H L;  2CQO A;  4KI0 A;  4X66 Q;  1HH2 P;  4HIM A;  4LF9 Q;  1TXY A;  1BBW A;  1HR0 Q;  4LFA Q;  3GTK H;  3HFZ B;  4IPC A;  2UUA Q;  3E9H A;  1PFS A;  5C3E G;  1N33 Q;  2R92 H;  2K75 A;  4UP8 A;  4AIM A;  4A3E H;  4L5R C;  2QEX A;  4C3J H;  3UE0 A;  1WYD A;  4P71 A;  4DV6 L;  4JBM A;  2Y0S G;  1L0W A;  2HHH L;  4A3L G;  3UDX A;  1PV4 A;  2BH2 A;  2MO0 A;  3JAM c;  3PIO A;  5M3M G;  3T1Y L;  4PG3 A;  4JI4 L;  2ASB A;  2ZJQ A;  4R4I A;  4JCV E;  1KXL A;  1YHB A;  4PMW A;  3J80 c;  3I4N H;  4QJF A;  3I55 A;  2IX1 A;  3UDI A;  1QZH A;  3HOZ H;  4JYA L;  1P16 A;  1E1O A;  2WAQ E;  4RMF A;  1J5E L;  4LF6 L;  1M1K C;  1N36 L;  4IFD I;  2EIF A;  4IPH A;  4DV6 Q;  2Z6K C;  4A76 A;  2JA5 H;  1VQF A;  3PO3 H;  3GD7 A;  2HHH Q;  1CSQ A;  3CW2 C;  4DR2 L;  1VQI A;  3K7U C;  5GRO A;  1AH9 A;  3PUV A;  1X9N A;  2HT1 A;  3T1Y Q;  4JI4 Q;  1PH3 A;  3CCU A;  4A4I A;  3G71 A;  3TRZ A;  5ELO A;  3ICE A;  5H1S E;  2WFW A;  2QA4 A;  5IYB H;  2EQS A;  3CC4 A;  4JYA Q;  2N78 A;  1VQA A;  3M9B A;  1CUK A;  1CKN B;  3EIV A;  3STB C;  3W1G A;  1VQD A;  4DV3 L;  1EIY B;  1N36 Q;  2VZA A;  2A19 A;  3S14 H;  1ASZ A;  4OXP A;  3CCV A;  1JB7 A;  3H3V H;  3I7F A;  5DLQ E;  3S2H H;  2UXB Q;  4BBS H;  3ERS X;  1G6P A;  1I6H H;  4YWM A;  3E9I A;  1XTD A;  1A62 A;  2DGY A;  2K5H A;  3PUX A;  5M3M H;  2UUB L;  4DV7 L;  5JJK A;  4LW1 A;  4DV1 L;  2PQA A;  3AFP A;  1YVC A;  1K73 C;  3WWV A;  1BKB A;  1QVF A;  1Q12 A;  2CWA A;  4GKK Q;  1HZ9 A;  3GTJ H;  3M85 A;  4DV3 Q;  4JI1 L;  4DPG A;  4IFD G;  2R93 G;  5IYD H;  1E24 A;  1K9M C;  5BR8 Q;  4R4O A;  4TVA B;  2BH8 A;  1AE2 A;  4OO1 I;  1Q1E A;  2UXD L;  2ES2 A;  2ZTC A;  2UXC L;  3DLL A;  5GAD C;  2UUB Q;  2JEA I;  1C9O A;  2F52 A;  4DV1 Q;  3ZJY C;  3NEN A;  2NN6 G;  3PGZ A;  3CD6 A;  3M7N A;  3Q8D A;  3CME A;  1IYJ B;  1TWH H;  2KEN A;  4JBJ A;  4UPA A;  1SN8 A;  1R9T H;  3I4M G;  4HIO A;  3GTP H;  3F2D A;  1JJC B;  1AE3 A;  1QVG A;  2Q2I A;  4YWL A;  3CMA A;  4EX5 A;  1XPO A;  4LF8 L;  4YCU A;  3EBE A;  5FLM G;  2ZTE A;  4A3D H;  2UXC Q;  2YTV A;  1L1O A;  2JJQ A;  1W3S A;  2NVY H;  1OXT A;  3E0E A;  1OXX K;  3CF5 A;  1XMQ Q;  1HJP A;  4AQY Q;  1WJJ A;  1YBY A;  2JA7 G;  2Z6K A;  2OQ0 A;  1N8R C;  1ASY A;  3RZO H;  3S1N H;  4J15 A;  2Q2H A;  2ZM6 L;  3STB D;  1PH7 A;  2JA6 H;  4DV5 Q;  1E3P A;  4BA1 I;  3HKZ E;  4OWT B;  5M5Y H;  1NBW A;  3J7Z C;  3S1M H;  2AMC B;  4APV A;  2R93 H;  1UEB A;  3PUW A;  4GN4 B;  3GTG H;  2B3G A;  1C7Y A;  4JI5 Q;  2OCE A;  1OXU A;  4A3B G;  1Q8K A;  4JV5 L;  2D0O A;  3FHW A;  3KYH C;  3GTL H;  4IOC A;  2WP8 J;  1QVC A;  1PH6 A;  3K8A A;  4GKJ Q;  4K0K L;  2F4V L;  2XGT A;  3CCQ A;  1CKO A;  2AWN A;  1RL2 A;  3FKI H;  4NPS A;  4X65 L;  1PH5 A;  1VQ8 A;  1Y14 B;  3PV0 A;  1X65 A;  2K4K A;  4JI8 Q;  4AYB E;  2ZJR A;  2YTY A;  1O7I A;  3KLW A;  3CC7 A;  2PI2 E;  4GOP B;  1HNX L;  1VQE A;  2YYZ A;  4B3S L;  1GKH A;  4JI0 L;  3I4M H;  4BXX H;  1MKH A;  2V1C C;  1HZC A;  4B3T Q;  2VUM G;  4HJ7 A;  1VCI A;  3MEF A;  3ULL A;  1A0I A;  4YCV A;  1I50 H;  1IXR A;  1N34 Q;  1Y1W H;  1VQ9 A;  2JEB I;  4LF7 L;  3J81 i;  5IYB G;  2VQF Q;  2I5H A;  5FLM H;  5AJ3 L;  2NZH A;  1KC8 C;  3W5O A;  2NZO A;  4JI7 Q;  4JV5 Q;  1YIT A;  1TWG H;  4A3I H;  1IL2 A;  3F2C A;  2JA7 H;  4GNX C;  1UE6 A;  5GQO A;  4X65 Q;  2R7D A;  4BBS G;  4DR4 L;  1FGU A;  2IT1 A;  3OTO L;  4KHZ A;  3PF5 A;  1YJ9 A;  1HNX Q;  2HIV A;  3U50 C;  3ULJ A;  4B3S Q;  2HIX A;  1VQJ A;  3BU2 A;  1YIJ A;  2E5L L;  1G51 A;  3F8T A;  3NEM A;  1KRT A;  3T1H Q;  1VQH A;  4DV0 L;  5C4J H;  3M4P A;  3H0G H;  1MIU A;  4KHP L;  1KAW A;  1VQ4 A;  4LF7 Q;  4TQU S;  3S16 H;  1L1O C;  1NTG A;  4A3B H;  3U4Z A;  4GN5 A;  4P75 A;  4YY3 L;  4IFD J;  1HNW L;  2ZJP A;  5ELN A;  3RZD H;  4O2D A;  4QL5 A;  3SGI A;  5IYD G;  1J6Q A;  1EQQ A;  3HKZ G;  3KFU A;  3CQZ H;  2ZTD A;  2OTL A;  1RIP A;  2MO1 A;  2VL6 A;  1K83 H;  2JE6 I;  1UE5 A;  3CCM A;  3OTO Q;  4DR4 Q;  4LUO A;  1A63 A;  1S40 A;  2WB1 E;  5GAG C;  1HZA A;  1I94 L;  1WI5 A;  3RLO A;  1EFW A;  2VUM H;  3TQY A;  2NVQ H;  1QUQ B;  3TRE A;  1LM0 A;  2F3I A;  4DV0 Q;  3RLF A;  1B70 B;  1V9P A;  2QGQ A;  4POG A;  4B3M L;  4AYB G;  1J5E Q;  3S1R H;  1JMC A;  4LF6 Q;  2N3S A;  4YY3 Q;  3CAM A;  3KJP A;  1IBM L;  2OWO A;  4OWW B;  3AFQ A;  2MFI A;  3CPW A;  2YV5 A;  3CP0 A;  1HZB A;  4MZ9 A;  4A3D G;  1JE5 A;  4DR2 Q;  1EYG A;  1JJ2 A;  4R4C A;  3CPF A;  5K36 G;  4OWX B;  1IBK L;  1W2B A;  1V43 A;  1VS0 A;  2K5V A;  5HGQ A;  3KJO A;  1XNR L;  1HNZ L;  1I94 Q;  2ATW A;  1E1T A;  3PF4 A;  1JT8 A;  5IP9 H;  1P8L A;  4JBW A;  4C2M H;  3G4S A;  4A3K G;  3CCL A;  2K50 A;  1VQL A;  2VNU D;  4A3C H;  4R4T A;  5M5W H;  2VQE L;  2HQL A;  4B3M Q;  2JA6 G;  1SRO A;  4LFC L;  3BJU A;  4BBR H;  3KDF A;  4DK6 C;  5JJL A;  4JI6 L;  2BA0 A;  1LYL A;  1EUJ A;  1KD1 C;  1XPU A;  3HKS A;  3KF6 B;  1I5F A;  2L15 A;  3A5U A;  2CWP A;  2WAQ G;  1G29 1;  4PZ6 A;  5M5X H;  2E2H H;  4DV7 Q;  1N9W A;  3NEL A;  5FJ8 G;  3UDF A;  1XNQ L;  3FKI G;  2K14 A;  4QIW E;  1IBL L;  3HOU H;  4DR3 L;  5IY0 A;  4Y7N H;  1T9H A;  1L2F A;  4GNX A;  2E8G A;  2VQE Q;  4BXX G;  4GS3 A;  2JA9 A;  3D0F A;  3GO5 A;  5IWA L;  2WB1 G;  4JI6 Q;  4JI1 Q;  2JQO A;  4DNI A;  1S72 A;  4RG1 A;  5C44 H;  1Y1W G;  4HID A;  4LF4 L;  1OXV A;  4JI3 L;  2CCZ A;  4BY1 G;  3HOY G;  2UXD Q;  1FL0 A;  2KCT A;  2OQK A;  4PZ7 A;  5E7N A;  2R7Z G;  2RHQ B;  4A3I G;  1BBU A;  4X64 L;  3GTO H;  3G6E A;  5IYC G;  1XNQ Q;  1IBL Q;  4YHH L;  4FDB A;  4DR3 Q;  4A3K H;  3UE1 A;  1K3R A;  2I5L X;  4DR6 L;  1BVS A;  1UWV A;  1JJG A;  2I5M X;  4A93 G;  1EQR A;  2D0P A;  3I2Z A;  3K7A H;  4DV4 L;  2DUD A;  1FVI A;  2Y0S E;  3H0G G;  2LSS A;  3NBH B;  4IO9 A;  4LF8 Q;  2CKZ B;  4OON A;  1EOV A;  1S3O A;  4XIG S;  4XTC S;  4OO1 G;  2B29 A;  4NXM L;  4GN3 B;  4BA2 I;  4JI2 L;  1PH4 A;  2LXJ A;  4LFB L;  4DR1 L;  1X3E A;  2AKW B;  2H5X A;  4X64 Q;  5FJ8 H;  1CKN A;  3CCS A;  3J7A 5;  4DKA C;  4YHH Q;  3L0O A;  2KCM A;  3ER0 A;  5LMN L;  2KHJ A;  3W1B A;  3BZC A;  2MNA A;  2ZM6 Q;  1U5K A;  2I0Q A;  4JBK A;  4X6A H;  3JAM i;  3PCO B;  4LF5 L;  1E22 A;  1XJV A;  4L5Q A;  3HOV H;  4QQB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...