2K5NA

Solution nmr structure of the n-terminal domain of protein eca1580 from erwinia carotovora, northeast structural genomics consortium target ewr156a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of the Putative Cold Shock Protein from Erwinia carotovora: Northeast Structural Genomics Consortium Target EwR156a
rcsb
source organism Pectobacterium atrosepticum
molecule tags Structural genomics, unknown function
molecule keywords Putative cold-shock protein
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5nA00
2ZM6Q 4RMFA 3S1NH 1Q7YC 2A8VA 1YHBA 2VQFQ 1DGSA 1AH9A 1YJNA 3KDFB 3OW2A 1C9OA 4C3IH 4HIOA 4LF7L 4DV5L 3L0OA 4JI8L 3FHWA 2A19A 3BZKA 4DV0L 4B3SQ 2K52A 1HNWL 2N8NA 2K5NA 3CC7A 3G48A 1QVFA 1MJEA 4OX9L 2K5HA 4J15A 1WI5A 4O2DA 4QIWE 1G6PA 4IFDG 2WB1E 3U50C 5LMNW 2AWNA 3ULJA 1SFOH 1W3SA 4GLAC 4DV5Q 1VQOA 2WP8J 5FLMG 4YHHL 1EQQA 3UE1A 4LF7Q 4UY8C 1N36L 4P72A 1E3PA 1FGUA 4X66Q 2NVXH 1WYDA 3NBHB 4A3IG 2WFWA 2IT1A 4JI3L 2R7ZG 3EN2A 5J3BA 2WAQG 2E5LL 1A0IA 2LXJA 4DR1L 3I7FA 3HOZG 1I50H 4DK3C 1C7YA 4JV5Q 1TWAH 3J7ZC 4LUOA 3CCUA 4KI0A 3A5UA 1VQ8A 1P16A 2KCMA 3G6EA 4ME3A 2AHOB 2CQOA 2IY5B 3PUVA 1ASYA 2JA5H 3J80i 3S15H 2BA1A 1OXXK 3GTMH 4X66L 4DUZL 4A3LG 1VQKA 2HHHQ 2B63H 4PZ8A 3RLFA 1M90C 3A5ZB 2ZTEA 5IP9H 1KXLA 3GDEA 1KD1C 1Q46A 1JE5A 2D0OA 3PUYA 3S24A 3KFUA 4K0KL 3RLNA 3CCJA 2UXBQ 5GAGC 3F2DA 2F4VL 3UDXA 1VQBA 1SE8A 2RF4A 3ZJYC 3Q8DA 2ZJQA 2PQAB 5AJ3L 4BBSH 1CSPA 2RHQB 3CF5A 3T1HQ 3S16H 2I0QA 1N32Q 1HZBA 4A3GH 3VDYA 2B29A 5IE8A 1K8GA 2WAQE 3KF8B 1XPOA 1X65A 4TQUS 4X62L 3I56A 5LMNQ 1L1OA 1XMOL 3CC4A 1BBUA 3S14H 4DR3Q 5IWAL 1XNRL 4A3CG 4P75A 4OWWB 4JBKA 3J81i 3I55A 1PVOA 3M4OH 3HKZG 1EQRA 2NZHA 3OTOQ 2HQLA 2ZM6L 2OWOA 2JA6G 4IFDJ 4JI6L 3S1QH 3UDGA 1VQHA 3BJUA 3JC66 4LWCA 4P73A 3K81C 4GLXA 1YJWA 1HR0Q 1E1TA 4A3KG 4DV6Q 4LF4Q 2VZAA 1N9WA 4EQ5A 3KJOA 4QQBX 2VY3A 1NMGA 1SRUA 4JI8Q 1EYGA 3KF6B 2N49A 2VUMH 1W2BA 5GROA 3F2BA 2Q2UA 4ALPA 4DR7Q 3G71A 4HJ5A 5BR8L 1WCMG 2E2JH 4A4IA 3D0FA 5M3MG 4JI0L 3I4NG 2BH8A 3RNUA 3E9HA 5IT9c 5FLMH 4GNXA 4B3RQ 3KDFA 1B7YB 1VCIA 2JA8G 2A1AA 5M5XH 5GADC 1VQ5A 3NENA 5FLXc 3PF4A 1BBWA 2B3GA 4R4IA 2R6GA 1HNZL 4YCVA 1UE6A 4AIMA 2PMZE 3ULPA 4MZ9A 2IX1A 5FJ8G 3FKIG 1FJGQ 1VQLA 4UP7A 2EIFA 4IPCA 1KRSA 4R4OA 3AFQA 4BA1I 1Q1BA 1I94Q 1HNXL 4LNQA 5DLQE 1XNQL 1CKMA 1VQAA 1GVPA 3L7ZC 4GLVB 1I5FA 4NXNL 3GD7A 4HJ8A 3KOJA 4DV0Q 4OXPA 4GN4B 2E2IH 1J5EQ 4JI6Q 3L2PA 3TRZA 2UXDL 4BBSG 1AE3A 2UU9L 4LFAL 2K5VA 1FJGL 4WJ4A 1IYJB 4JI2Q 1EUJA 2IX0A 3GTGH 2L15A 2GN5A 1UE5A 2FXQA 3UDFA 1FVIA 1VQGA 2PI2A 3F1ZA 4YWKA 3H15A 4DV1L 4A3IH 1X54A 1PH6A 4DV2Q 1PH1A 1L2FA 1VQEA 2CKZB 4IJHA 4A3DG 2NVYH 4JI4L 4GKKL 1G291 3HOXG 1N36Q 4OWXB 5IYBH 3T1HL 4A3EG 1TWHH 3PUZA 2UXDQ 4LUVA 2B63G 2JA7H 4DPGA 4QGUA 4GNXC 4IFDI 4DR1Q 5BR8Q 4P74A 3CW2C 1E1OA 2IHFA 2K14A 1PHJA 5C0XJ 3I4MH 2E2HH 3K7UC 3M9BA 4DV1Q 3RN2A 1Y1VH 3M4QA 1NBWA 3HOXH 3T1YQ 1PH3A 3GTOH 4A93H 1A8VA 2D0PA 5C4XG 4HJ9A 1K8AC 1VQ9A 1C0AA 3MXNB 2HHHL 3H0GH 4PZ6A 4LF8L 3SGIA 1Y14B 5M5WH 2JA5G 2VL6A 4QL5A 3LGJA 1PA6A 1VQDA 1X6OA 1VQFA 2EQSA 3I4OA 3RLOA 3DLLA 2Q2IA 1PH9A 4YY3Q 1Q8KA 1Q1EA 4R4CA 2PI2E 2VQEL 2ZJPA 2JK8A 3TREA 1PV4A 4LF9Q 3RR5A 5LMUQ 4B3TQ 1VQIA 2VS1A 4X65Q 2NVTH 2K75A 3GTKH 1Q86C 4GOPC 1XPUA 2VUMG 4KHPL 4JYAQ 2CFMA 3WWVA 4A76A 4UP9A 4DR7L 4Y7NH 4X62Q 2PQAA 1NY4A 1VS0A 2MNAA 1TWFH 5C0XG 1QUQA 2MO0A 1HZCA 4L5TA 4LFAQ 2UU9Q 3RZDH 1QZGA 2VQEQ 3M7NA 1OXTA 2ES2A 1QUQB 4YY3L 2UUCQ 4JBWA 2D62A 3AEVA 1SMXA 1SROA 1RL2A 5M5YH 1NTGA 1X55A 1YBYA 4X64Q 4GKJL 1UWVA 1QZHA 2K50A 1CKOA 5E7NA 2OQ0A 2JEBI 4LF6L 3GTJH 4GOPA 4PMWA 2YTYA 3AQQA 1UE7A 4DV4L 1JJGA 1YZ6A 3H0GG 1KQSA 1J6QA 3T1YL 4A75A 4BY1G 3OYYA 4X64L 2JJQA 5EAYA 4HIMA 4XIGS 1EFWA 1OXUA 2NVQH 4Y52H 3TS0A 4IPGA 1PFSA 2AKWB 1VQ7A 4C3HH 4GN3B 1YVCA 4DV7L 2GVBA 5AJ3Q 4DR5L 1PH7A 2I5LX 3CC2A 4JI7Q 3HOWH 1VQ6A 4A3BG 2UUBL 1JB7A 2E8GA 1WOCA 4OONA 3F8TA 1N8RC 2AWOA 2EXDA 2ZTCA 1E22A 4LFCQ 3HOUH 4GNXB 1UEBA 3TS2A 1N32L 1VQCA 1CUKA 3EBEA 1ASZA 3HKSA 4AYBE 4X65L 4IO9A 1IBLL 5LMUL 4B3TL 4A3EH 5IY0A 3PUWA 2F52A 4B3MQ 4DUZQ 1Q82C 3HOYG 4A3MH 4NB3A 3M4PA 3NEMA 3S17H 1VQNA 2HIXA 1PH2A 4BY1H 1K83H 1HR0L 3K8AA 4LF5Q 2QGQA 3J81j 2F4VQ 4DAMA 2QEXA 1PH4A 3HOZH 3RZOH 1X3EA 1XJVA 1HJPA 1GD7A 4IOCA 5C3EG 4L5QA 1IBLQ 3CCLA 3PO3G 3ERSX 1CSQA 4JI5Q 5C4XH 3HOVG 3A0JA 1S3OA 4YCUA 1VQ4A 1L1OC 1NMFA 1V9PA 1XTDA 2DUDA 4DKAC 3PF5A 4LFBL 1IBKQ 2UXCQ 4JC0A 5LMNL 1Z47A 5GAEC 1B70B 1EOVA 3FKIH 1Q12A 3AFPA 2UUAQ 4JI2L 1GKHA 2R92H 2XTIA 3S2HH 5K36G 4B3RL 2HT1A 4WJ3M 3I2ZA 1OXVA 4QY7A 4POFA 4AYBG 1TWCH 2JA9A 3W1GA 3MEFA 4IJLA 4BBRH 1PH5A 4JI0Q 3CQZH 2NN6I 1MJCA 2CWAA 4YCWA 3EIVA 2XGTA 2QA4A 3S1RH 3HFZB 3PSIA 4A3FH 4XTCS 2YU9H 4DAYB 5M3MH 2JEAI 1NE3A 4B3SL 3JAMc 4DR6L 5JEAG 1UE1A 2OTLA 1BVSA 1WCMH 1O7IA 3J7A5 4K0KQ 5JEAJ 1NJIC 1Z9FA 2DGYA 1X3GA 2ZTDA 5H1SE 1L0WA 4BXXG 3E0EA 5IYDH 4LF4L 5M3FH 1HR0W 1KIXA 4LFCL 3CMEA 1FL0A 2CWPA 1SN8A 2Q2HA 1I3QH 3TQYA 1N34L 3FP9A 3M85A 1Y1WG 4A93G 5HGQA 3STBC 1H95A 3CPFA 1X3FA 2Z0SA 4H02A 3H3VH 1LUZA 4PZ7A 1S72A 4AH6A 1K73C 1XMQQ 4A3KH 3DM3A 4DV2L 4JI3Q 4PG3A 4DR3L 1VQJA 1S40A 5HY6A 2UXCL 4JCVE 3D31A 4DK6C 3PUXA 3STBD 3H3VI 4BA2I 2CCZA 4JI5L 3RN5A 1YHAA 1KRTA 1TXYA 4JI7L 2YTXA 4DR4Q 3KLWA 3U4VA 2KCTA 4DV3Q 4IOAA 2PNHA 2KHJA 3CP0A 1HZAA 4DV6L 3U58A 1N33L 4A3DH 4AQYL 4A3CH 1U5KA 4A3FG 2BH2A 1HNWQ 1KL9A 1U0LA 1P8LA 2IHEA 3PIPA 1G51A 1SR3A 2UUCL 1WJJA 3GTPH 2UXBL 1SLJA 4IPHA 5ELOA 4JBJA 2JQOA 2Y0SG 4LF6Q 4BY7G 4HJAA 4L5RC 2YTVA 3AYHB 4JOIA 5JJLA 1Y1VG 4DUYQ 1XMOQ 3CPWA 2VQFL 2NN6G 1OTCA 5C44G 4DV3L 5C44H 4OO1G 1VQMA 4BY7H 1YHQA 5JJIA 3HOWG 2JA6H 2F3IA 2YYZA 5C3EH 4JV5L 2R7DA 2K4KA 4JI4Q 2JA8H 4GKKQ 1JJCB 1HZ9A 3HOVH 1XNRQ 3A74A 2I5HA 5ELNA 1IL2A 4DUYL 2Z6KA 3I4NH 5GQOA 4NXML 4LFBQ 4OWTB 2R7ZH 4YWMA 2VNUD 4A3GG 4JOIC 2N78A 2ZJRA 4LW1A 1KC8C 2RCNA 3CD6A 3BZCA 4A3MG 1BKBA 1LM0A 3GO5A 1IBML 1JJ2A 4A3JH 3NELA 2HIVA 1A62A 2OQKA 1QVCA 3J80c 1HH2P 2ATWA 4RG1A 3HOUG 1K0RA 3G4SA 1N33Q 4LF8Q 3ICEA 1YNXA 4GN5A 3BU2A 3K0XA 5IYCH 3CCQA 4GOPB 4B3ML 4POGA 4JBMA 2NZOA 4L5SA 2WB1G 3ER0A 1VQPA 2Z6KC 1EWIA 2E5LQ 3PGZA 4DR6Q 1CKNA 1IZ6A 1PYSB 3S1MH 1EIYB 4KHZA 4R4QA 1A63A 5IYCG 3CCRA 1PYBA 3W5OA 2H5XA 1Y1WH 3PO3H 3W1BA 3KYHC 1KAWA 1RIPA 3TEHB 4LF9L 1YEZA 2R7FA 1I6HH 1K3RA 3ULLA 4A3JG 1MKHA 4NPSA 1K9MC 2UUAL 1N34Q 2R93G 3PV0A 5M3FG 2R93H 5IYDG 4BXXH 2ID0A 4FDBA 4DR2Q 3CMAA 4DNIA 3CCMA 3K80C 4OX9Q 3S2DH 1IXRA 3J81c 3CXCA 1I94L 4TVAB 4JI1L 5C4JH 1HNXQ 3B6YA 4MNOA 1XNQQ 2AMCB 2OCEA 4OO1I 3CCEA 4YHHQ 1EIFA 1D8LA 3KJPA 2RHSB 1D7QA 1J5EL 4X6AH 4NXMQ 4GKJQ 2Y0SE 3PIOA 4BBRG 4LF5L 4NXNQ 2LXKA 1X9NA 4JG2A 4APVA 4EX5A 1B8AA 2ALYB 4DR2L 4AQYQ 1JMCA 3GTQH 3I4MG 4KLKA 1IBMQ 1L1OB 2R92G 5IP9G 3F2CA 3M3YH 2JA7G 3UDIA 5GAHC 3K7AH 1V43A 2GVAA 4A3LH 4DV7Q 1E24A 1PH8A 1T9HA 3OTOL 2V1CC 3GTLH 4C2MH 1LTLA 2BA0A 2N3SA 1HNZQ 1YIJA 4YWLA 4HJ7A 1MIUA 2JE6I 2MO1A 3E9IA 1IBKL 4LUZA 3PCOB 2ASBA 1M1KC 3PO2H 2UUBQ 1X56A 4KHPQ 1XMQL 3JAMi 2LSSA 2Q2TA 2OTJA 1CKNB 3UE0A 1XPRA 2KBNA 4DR5Q 5JJKA 4IPDA 3CAMA 2YV5A 4MTNA 1E7ZA 3HKZE 3HOYH 4HIDA 1R9TH 1LYLA 5C0XI 1YI2A 3PO2G 4GS3A 4P71A 2MQHA 1V1QA 1AE2A 4R1JA 3IRBA 4C3JH 3CCVA 1TWGH 4QJFA 4R4TA 4UPAA 4DV4Q 2C35B 4DR4L 1GM5A 5IP7G 4O0AA 5IP7H 2I5MX 5FJ8H 4A3BH 5IYBG 4UP8A 2KENA 1Q81C 4JI1Q 5IWAQ 1GO3E 4JYAL 1YJ9A 2KHIA 2VW9A 4HIKA 2MFIA 1WFQA 3KF6A 3CCSA 3U4ZA 1JT8A 1OXSC 1KHIA 1QVGA 1YITA
chains in the Genus database with same CATH superfamily
4XYQA 3GTLB 1Q7YC 2J7ZA 1IKMA 5EJWA 5IGBA 1F2YA 2KEEA 2KEDA 2Z4IA 3OW2A 5IGGA 4HAEA 3SE0A 4ZAIA 1UEAB 1XWEA 4KN4C 2EPBA 3V2TA 4DV5L 4JI8L 4DV0L 1RKNA 5M5WB 3IKJA 1QVFA 2CHBD 4A93B 4O2DA 4FXDA 5CV4A 1SNOA 5LMNW 4WRDA 1SFOH 1W3SA 4DV5Q 2WP8J 4UY8C 3UE1A 4LF7Q 3T4AC 5ELDA 4A3IG 1EY4A 4JI3L 1M8AA 5T1IA 4HCSA 3A5UA 1VQ8A 2PZWA 2IY5B 1TY2A 2IL8A 4R8NA 2XVSA 2F3VA 2XRSD 3GTMH 5K36H 4DUZL 2E2IB 2HHHQ 2B63H 1K8MA 2ZTEA 5IP9H 2F0JA 1Q46A 3S24A 4K0KL 1AEXA 2F4VL 1QE6A 3UDXA 2KQ3A 4Z9CB 1SYFA 1IKLA 5TSSA 4ZLTF 2RF4A 2EDGA 2EY6A 3CF5A 2NWGA 2I0QA 4A3GH 3OMGA 4DAPA 3VDYA 5G3LD 3H91A 2WAQE 1X65A 4X62L 4NKLA 1L1OA 1BBUA 4DR3Q 4X3TA 4JBKA 2EVBA 1EY9A 2PPBC 2NZHA 3OTOQ 3DEOA 3GTMB 4I65A 3S1QH 1MSHA 3UDGA 1G8ZD 4LWCA 3TP6A 3K81C 2KUMA 5CV8A 3Q6SA 1E1TA 4HSVA 5C0XH 4I7ZC 4CBVA 1NMGA 3I3CA 3KF6B 4DGZA 2N49A 1B1ZA 3T51B 2VUMH 1VF5C 1W2BA 2NVXB 3G71A 2F0HA 1B3AA 1WCMG 1SFOB 1QB5D 1PFMA 4R8IA 4A3JB 4X3UA 1BXTA 3RNUA 1Q90A 5FLMH 4B3RQ 1B7YB 1VCIA 4LJZC 1TKWB 5M5XH 5FLXc 2R6GA 5CYUA 1UE6A 2PMZE 3ULPA 4V190 3DWQA 1IYVA 2E2DC 2G5DA 5E1FA 4R4OA 1KRSA 4BA1I 1I94Q 1IYUA 1XNQL 2SOBA 1VQAA 1QWYA 1I5FA 3LX0A 3KOJA 1F2MA 2PYKA 3RD4A 2UU9L 2K5VA 4PV1C 2VUMB 1EUJA 1F77A 2L15A 2GN5A 1PTOD 4A3IH 1FVIA 4A3DG 1LTAD 4DV2Q 2CKZB 1VQEA 5KYIA 3FPUB 4GKKL 1N36Q 1H9SB 3QOLA 4A3EG 1ONLA 2IW3A 4GNXC 4DR1Q 4P74A 3M9BA 4CKEA 3T1YQ 3CU7A 2K04A 5A35A 1K83B 2D0PA 4HJ9A 1C0AA 1XTCD 2B2UA 4C1NK 5M5WH 1PA6A 4C3IB 1VQDA 2EQSA 4RHSA 1PH9A 4KHVA 4YY3Q 3KBXA 3OHXC 1Q1EA 1E0BA 2VS1A 4X65Q 2K75A 1Q86C 1RTOA 4CJ1B 2VUMG 4JYAQ 2CFMA 3WWVA 1D6EC 4DR7L 3I90A 1ESRA 4CKBA 1O7ZA 4NMZA 1NAPA 2XSCA 5C0XG 4L5TA 4IALA 4LFAQ 1EU4A 3CRKC 2F0SA 2VQEQ 4JW0A 1GHKA 1OXTA 3S2DB 1QUQB 4YY3L 1FNVA 2R93B 3AEVA 5M5YH 1RL2A 2D5DA 4A3BB 1QZHA 5E7NA 2JEBI 3KLSA 3H3VC 4GOPA 3L9AX 3VA5A 1BDOA 5AFWA 4PMWA 4M8AA 2FJ2A 2HD3A 3T1YL 4B9XA 1JOQA 4A75A 2JJQA 4HIMA 3RZDB 5KNBA 2K1BA 1LTRD 4GN3B 1YVCA 2OXPA 1F9RA 1EEFD 3CC2A 4RGTA 3KUPA 3ONAB 4KY5A 2UUBL 1JB7A 2E8GA 1WOCA 4S3SA 2Q8IB 3TMEA 1N32L 2H1EA 3EBEA 1ASZA 3KBGA 1ENAA 4C3HG 5LMUL 4B3TL 1HA5A 3PUWA 4DUZQ 3X3MA 1VQNA 1STEA 3MZ5A 1HR0L 2NTTA 2QGQA 1YNJC 2F4VQ 2O5JC 4DAMA 3HOZH 1XJVA 1LLRD 4DK1A 3I70A 1GD7A 3P7JA 5C3EG 3CCLA 1IBLQ 4KN7C 1S3OA 1L1OC 1JORA 1V9PA 2DUDA 3VR4A 3DEPA 5GAEC 3FKIH 1B70B 3AFPA 3AU7A 1GKHA 1U4MA 1U9RA 4WJ3M 4POFA 1OXVA 1RDPD 2JA9A 1PH5A 2SNSA 1MJCA 4FF1A 4X3SA 3EIVA 2QA4A 4OWWB 2YU9H 3D6CA 5M3MH 4ULLA 3JAMc 3J7A5 2ENBA 4EQNA 3J80E 2DGYA 3GP7A 3W3AA 2EJFC 4C1NI 3S16B 4FXKC 5DEHA 3NWSA 3M85A 4K6LA 4G57A 5M5XB 1X3FA 1NR2A 3H3VH 4PZ7A 1S72A 4AH6A 3OWEB 3MTSA 4DR3L 1PRTC 2UXCL 1S40A 3NWTA 2WIIB 3H3VI 5EKLA 4DF7A 2CCZA 4JI5L 4RHRA 1YHAA 1TXYA 4IOAA 4DV6L 1ENCA 4AQYL 2QEJC 1CI3M 1KL9A 3GTPH 1TWAB 3KF8A 3MFYA 5I9PA 2H4OA 4LF6Q 2A5HA 2RKSA 1X32A 1LV9A 1Q8IA 3P75A 1S5BD 3NP8A 1LTTD 1S5CD 4QB4A 5C44G 4OO1G 4C3JG 5C6AA 2DNEA 1O7LA 1D5ZC 4JI4Q 4A3KB 1OO9B 1XNRQ 2I5HA 2R7ZH 1GHJA 3FVQA 2N78A 2DN8A 1KC8C 3CD6A 1EIHA 3BZCA 4A3MG 2JA6B 1PFNA 2OQKA 2F0DA 4OL7A 2ATWA 4RG1A 1K0RA 3DUZA 4LF8Q 4GN5A 3BU2A 4GOPB 5IYCH 2WB1G 2DJGC 4G7HC 1QILA 1CA5A 1EWIA 1Z7TA 4DR6Q 3S1MH 4R4QA 2B39A 2R7FA 4C3JB 1I6HH 1K3RA 4RGOS 1N34Q 2F0FA 3PV0A 4DA2A 5M3FG 1KABA 2ID0A 4FDBA 4DR2Q 4OX9Q 2PZUA 4J1MA 3K5LA 1U4LA 2K28A 4IUPA 4TVAB 3E5SA 2PW7A 4ODGA 4GKJQ 4BBRG 4JG2A 4DR2L 4AQYQ 1B8AA 2ALYB 1JMCA 5ELEA 5CGKA 2HDLA 2R92G 3OOCA 3GQBA 3M3YH 3A7LA 1V43A 2I07B 4DV7Q 1SAPA 1PH8A 2EYOA 3GTLH 4RKBA 2QW7A 1LO5D 2N3SA 3T16A 2JE6I 2XIWA 1E2ZA 5G3LF 4HEDA 4LUZA 1IBKL 2UUBQ 1XMQL 3JAMi 2LSSA 2OTJA 3UE0A 2EYHA 2KBNA 4ZRZA 4IUQA 2YV5A 1E7ZA 3I4MB 5C0XI 1YI2A 3S2HB 2MQHA 3NTHA 2KCCA 4C3JH 3CCVA 1A3VA 1Z6HA 4QJFA 4R4TA 4DR4L 5I4DA 4A3BH 5FJ8H 2IWHA 4UP8A 2KENA 3A54A 2RSNA 5J39A 1STYA 2B2TC 4JYAL 2Q8RE 1YJ9A 2VW9A 1AFPA 4HIKA 1B44D 1OXSC 1KDBA 3PF4A 1YITA 2ZM6Q 3K6OA 4K5XA 1PYWD 1YHBA 1DGSA 4C2MB 1AH9A 1LT5D 2ICIA 4C3IH 4HIOA 2B2TA 2EYJA 3BZKA 2PQEA 2EOTA 4IZ8A 3J81E 1HNWL 2N8NA 2HCCA 1MJEA 4OX9L 4FF3A 2K5HA 1G6PA 3QR8A 5FLMG 1N36L 4QIWB 2F0UA 1FGUA 1LACA 1WYDA 3NBHB 2WFWA 2IT1A 2LMCB 2ZXOA 2PW5A 3MC0B 5JEAH 4HMIA 2K32A 4MTKA 4DK3C 1C7YA 4JV5Q 1TWAH 4ZUIA 5E3FA 1I4XA 3A8JE 4ME3A 2AHOB 5FKAC 2JA5H 1WTQA 3NSWA 1I4PA 1OXXK 1EZ6A 1GUGA 4N9TA 4X66L 4A3LG 1NNXA 1VQKA 3J7AV 1M90C 3A5ZB 3KFUA 1JE5A 3RLNA 3CCJA 5GAGC 4ZYSA 1VQBA 4K2KA 1D2BA 5BN4A 3Q8DA 2PQAB 2WACA 3RMHA 3T1HQ 2JA8B 3S16H 1HZBA 2B29A 1K8GA 3KF8B 4UAIA 1KXLA 3S14H 4B08A 2MJ8A 2O4XA 5IWAL 3GV3A 3I55A 1SJED 1Y1VB 1ICFB 1L0YB 2EYMA 5M3MB 3BJUA 3JC66 4GLXA 3E6ZX 1YJWA 1HR0Q 1ET9A 4DV6Q 4IURA 4LF4Q 4ZQ3A 3V96A 4EQ5A 3KJOA 3S1MB 3SEBA 4QQBX 1BR9A 1SRUA 4JI8Q 1EYGA 3K5NA 4FF2A 3S1QB 3JAML 2Q2UA 2IPKD 2GA4B 3HZXA 3KK7A 4A4IA 3D0FA 3MHBA 3S14B 1SE3A 1STNA 5D65A 1LT4D 5KYLA 2IX3A 2JA8G 5JPNC 1QNUA 5GADC 1SNDA 1JWSD 1VQ5A 4KJOA 4R4IA 1HNZL 3E3XA 4RH6A 4MZ9A 4EQPA 3SVMA 1S5FD 1CKMA 3L7ZC 4GLVB 4DXGA 2WV6D 3GD7A 4NXNL 1VDZA 4CDCC 4GN4B 2L9HA 2F0TA 5KEEA 1J5EQ 2E2IH 3TRZA 2TSSA 4BBSG 1AE3A 2EJMA 4WJ4A 1TWCB 5EGTA 1I4RA 1PRTF 3F2UA 2FXQA 3UDFA 1ENFA 3F1ZA 4XYOA 3H15A 2F1MA 1PH6A 1L2FA 4IJHA 2QDBA 5I2XA 1G291 4OWXB 5DM73 1SJHD 4XT3B 2UXDQ 2JA7H 1CA6A 4DPGA 1H9KA 1QOHA 3DXJC 5BR8Q 3CW2C 1E1OA 2IHFA 1SYDA 4R9WA 1QNKA 5C0XJ 2E2HH 3K7UC 4DV1Q 3RN2A 2N55A 3M4QA 3GTOH 2B2YC 2I46A 2QCPX 1ZYRC 4K8JA 1SMYD 4KKUA 1VQ9A 3MXNB 3OW7A 4RWSC 4OGQC 4PZ6A 3SGIA 1TS5A 2JA5G 2VL6A 2MGSA 1X6OA 3I4OA 3RLOA 4A3EB 1Q8KA 3J7AF 2MP1A 1I4HA 3TREA 2VB2X 3RR5A 5FO9B 1VQIA 2RDGA 4FXGC 3GTKH 4CHTB 1XPUA 3D6WA 4Y7NH 4X62Q 1E2VA 1NY4A 1QUQA 5ELFA 2XN9C 1HZCA 2UU9Q 2A6EC 1SNPA 5DNFA 2FHTA 1KDCA 3C1EA 4K2LA 3IFTA 2ES2A 1MHWC 4JBWA 1HQRD 2D62A 1SMXA 5DAUA 1UWVA 3R93A 3QOJA 5CC4A 1TVXA 5CBAE 1JJGA 1KQSA 4A3IB 1J6QA 5HGTA 5C3XA 4BY1G 2UXCQ 2KA7A 4XIGS 1EFWA 1OXUA 3W2DA 1TS3A 4QUCA 4IPGA 4X3KA 1PFSA 3VR6A 1G2SA 3TP7A 1WTHA 2R3ZA 3OIQA 3BYTB 4QF4A 4A3BG 4BS9A 1N8RC 4ZK9B 3FMCA 2AWOA 2ZTCA 4LFCQ 3TS2A 1CUKA 3NHHA 2WINB 3EJIA 1IBLL 4A3EH 2NYZD 3S17H 1MSGA 4BY1H 5C4JB 4LF5Q 1JQYD 4IN3A 3J81j 3EFXD 1SE2A 1Y8OB 4XQJA 5A2QL 1PH4A 3C2PA 1G91A 1XX8A 1EY8A 2C5CA 4IOCA 1U4PA 2E2HB 3A0JA 1VQ4A 4LFBL 1XTDA 1TS2A 4H13C 1A3UA 2M2LA 4K5WA 1ILQA 4HCEA 5LMNL 1CT1D 1EOVA 1Q12A 2UUAQ 4JVZA 2R92H 2XTIA 4PNYA 5K36G 4F88A 3I2ZA 4HN7A 4QY7A 3DMUA 3C3LA 3MEFA 1SYEA 4BBRH 4JI0Q 3CQZH 4CDEC 1AN8A 4YCWA 1IHZA 3HFZB 4A3FH 2JEAI 4DAYB 3NTKA 3P1HA 1T5EA 2OTLA 5JEAJ 2PCFB 5KGUA 3I91A 1B53A 1F9QA 4BXXG 3E0EA 1SNMA 3Q22A 4LF4L 1KIXA 3H94A 5IT9L 1I3QH 1SBBB 3FP9A 1WTXA 1H95A 5HGQA 3CPFA 1WTPA 1J8IA 4FF4A 2F0MA 4U673 4N8FA 1HRJA 3SK6A 4JI3Q 4PG3A 4CJ0B 1VQJA 5HY6A 2NUCA 4DK6C 1JICA 3STBD 3URYA 1SSOA 2WAQB 3RN5A 1NSNS 1RTNA 4Q0FA 2CH4W 4JI7L 2YTXA 1S4ZA 5JJZA 2EJGC 3SHLA 5CMDA 5EPJA 1VMPA 3T53B 1O7YA 1SXTA 1NUCA 2RDFA 2BH2A 2IHEA 2UXBL 2UUCL 1CHPD 2N88A 3PQIA 4HJAA 4L5RC 3OSOA 3AYHB 4A3DB 3BG3A 3GV6A 2ZXPA 3T56B 2VQFL 1GUTA 1OTCA 5C44H 2KVMA 3QWNA 5FLXL 2YYZA 4H0LC 5C3EH 4JV5L 2K4KA 4GKKQ 1JJCB 3HOVH 4HMJA 3A74A 3QIAA 2Z6KA 3NXWA 5BN3A 4NXML 4OIKA 2NTSA 3KLRA 4A3GG 1PTOC 3UI2A 2ZJRA 2RCNA 4CJ2C 1BKBA 1JJ2A 4A3JH 2KECA 2HIVA 1A62A 5C44B 3HOUG 1PTOH 3G4SA 2F0GA 5C5MA 3ICEA 1JCKB 4B3ML 4POGA 4J6HA 4QMGA 3NE5B 2NZOA 2XRQD 3ER0A 2B2VC 3HS0C 1EYDA 4O1NA 1A63A 3FKIB 1PYBA 3C46A 2H5XA 3PO3H 1CZGA 1KAWA 3KYHC 3R3OA 1HQMC 3ULLA 2AQ3B 2R93G 4BXXH 1PLFA 3CMAA 3RZOB 3K80C 3CXCA 3HG9A 3I73A 2OCEA 4OO1I 3CCEA 4YHHQ 4N9PA 3KJPA 5T1GA 2OF1A 1J5EL 4A3GB 1D7QA 4X6AH 4K6DA 4YIJA 3BS1A 1TIID 4KKSA 4NXNQ 1PRTB 3GTQH 2O5IC 4ILWA 4EGVA 1C8CA 3HOUB 1I4QA 2JA7G 1TR5A 3K7AH 4JK1C 3IL8A 3J80L 2GVAA 1E24A 3MWYW 4G7ZC 4C2MH 1HNZQ 1HFGA 1YIJA 4JPBW 4HJ7A 1HUMA 1D1KA 2MO1A 2K7VA 3E9IA 4M1UB 4KHPQ 2OEOA 4NW2A 4C3HB 2Q2TA 1CKNB 3S15B 5JJKA 3CAMA 5FO8B 2RCFA 3LNNA 4BBRB 2AQ1B 4MTNA 4KK7A 1EY0A 3PO2G 4P71A 3D4RA 4RGMA 1SMYC 1TWGB 3IRBA 1TWGH 3GTJB 4G7OC 2K5DA 2FINB 1GM5A 5CR3A 5IP7G 4DAYA 1LT3D 2DNCA 5ISRA 3FDTA 3FPPA 2KHIA 2MFIA 3VYUA 1KHIA 2Z9HA 3S1NH 2A8VA 5IIFA 2VQFQ 1PZID 5C4HA 1D5XC 5IGCA 4OHJA 1YJNA 3KDFB 2K33A 1BCPD 4LF7L 2DY7A 1B2TA 4B3SQ 2K52A 2K5NA 1RJTA 3CC7A 1A2TA 1EEID 4QIWE 2F0VA 2EYLA 2WB1E 1EWCA 3U50C 2VB3X 1PXUA 1PTOF 1MI2A 1A15A 1VQOA 4YHHL 1C4QA 1UAPA 5E4XA 1L0XB 3BVGA 1E3PA 4X66Q 1HUNA 2R7ZG 3SK8A 2E5LL 5IGFA 3MAQA 1A0IA 2LXJA 1I50H 4LUOA 3CCUA 1SNQA 2KCMA 4IUVA 4EQOA 5KRUA 2X69A 2CQOA 2JYOA 4XT1B 1ASYA 5D14A 4ABNA 2CQAA 3BDLA 2D9UA 4L63B 4PZ8A 3RLFA 1SYGA 3GDEA 5IGEA 1KD1C 1CZWA 2EY1A 1V8QA 4K8IA 3F2DA 1YNNC 2L5TA 3I4NB 3BDOA 1KDAA 2JN4A 1SDFA 1K8OA 1FGBD 4BBSH 2RHQB 1IL8A 5IE8A 4GZYC 1N32Q 5LMNQ 3CC4A 1I4GA 3EVQA 4FO2A 1EY6A 3M4OH 3CRLC 3HKZG 1EQRA 3N6RA 1BOSA 1TU2B 4G4KA 2HQLA 2ZM6L 2JA6G 2Z1CA 4JI6L 4P73A 1TWHB 5IODA 1ICWA 3MXNA 4A3KG 3T13A 2BCOA 2VZAA 1N9WA 1BCPC 1F2LA 2RA4A 5A2QE 1LTBD 2B2WC 3F2BA 2E74C 4DR7Q 3BYYB 3HRZC 1HTPA 5BR8L 5M3MG 3I4NG 2BE5D 2BH8A 4TRDA 3E9HA 3H09A 1ESFA 5ELBA 5IT9c 3MFGA 2XWJB 2L1BA 4P2CB 1EIGA 2WB1B 1LTGD 2B2YA 3A8KE 2LKVA 4YCVA 2HDMA 4KJNA 5FJ8G 1K0SA 3HKZB 1I3QB 1WD0A 3U9SA 2QDLA 1Q1BA 4LNQA 5DLQE 1EFID 1FD7D 5NUCA 4HJ8A 4DV0Q 4OXPA 1B3QA 4ZUJA 3SK4A 4JI6Q 3K58A 1FJGL 2K01A 4JI2Q 1UE5A 4MHEA 3PF5A 2PI2A 1DYQA 1PH1A 1X54A 2NVYH 3OPOA 3HOXG 2L12A 1ZEQX 3TN2A 1TWHH 1G6ZA 2B63G 4QGUA 1HHVA 3L3OC 5JOBA 2A73B 1PHJA 2K14A 4L6TB 4IUNA 1LTID 1NBWA 3HOXH 4A93H 2IJ0A 1A8VA 5JPMC 1X3QA 5C4XG 4QUFA 4N8X1 2HHHL 4LF8L 5E4WC 1Y14B 1VQFA 1GXDC 1PFBA 1B9NA 4KD4A 2PI2E 1FNWA 2VQEL 2JK8A 1PV4A 2HUGA 1UUPA 3GTQB 2EXZA 2F3WA 2J0TD 5F2DA 1GUWA 2RSOA 4GOPC 4KHPL 3H0GB 2VXWA 2PQAA 5IGDA 1PRTD 2MO0A 4KV6A 1JWMD 2JP1A 3RZDH 1QZGA 3HOXB 1BF4A 2UUCQ 1SEBD 4O42A 1CQFA 1SROA 4KKTA 4X64Q 1NTGA 1I6HB 3A8IE 1YNJD 3DWPA 2K50A 1CKOA 4OELB 4LF6L 3GTJH 1UE7A 4DV4L 1NR4A 5M5YB 1YZ6A 5C4XB 4KY7A 5IOCA 1BO0A 1WD1A 3QO2A 4Y52H 2AKWB 5ELCA 2HQEA 3VR2A 4DV7L 1AZQA 2NB0A 2GVBA 4CDDC 4DR5L 2I5LX 1PH7A 4Y7NB 3GTKB 2RDHA 4RAUC 3PIP3 4OONA 3F8TA 2EXDA 3X3NA 4GNXB 1UEBA 4AYBE 4IO9A 5IY0A 4B3MQ 3HOYG 3NEMA 2TMPA 4AYBB 2HIXA 1V1PA 1DCZA 3VR5A 2WKDA 3K8AA 2K05A 3GTOB 2QEXA 4DXFA 2JSOA 1TS4A 1HJPA 3ND8A 4F87A 4L5QA 3PO3G 3ERSX 4JI5Q 5C4XH 4YCUA 3WOEA 1NMFA 5CV5A 4DNTB 3QB3A 4OEMB 1RF2D 1WTVA 1C48A 4WORA 3SR1A 4B3RL 4F8MA 2HT1A 1TWCH 4IJLA 1Y69U 1V1OA 2C9OA 4XDXA 5BN5A 3S1RH 1FYCA 3MA2B 1CTMA 4LK1C 4B3SL 2KOLA 1UE1A 1BVSA 1WCMH 1O7IA 5JVG3 2X6LA 3M4OB 1NJIC 1Z9FA 2LFNA 1X3GA 5H1SE 2EZVA 5M3FH 1WTWA 3V05A 4FP5D 4LFCL 1ZYRD 3CMEA 2Q2HA 1SN8A 2EYPA 1HPCA 4IFDH 2QILA 1Y1WG 4A93G 4WFN3 3TZUA 1JB3A 4RGNA 1LUZA 3BZDB 1K73C 1BBXC 1XMQQ 2B2WA 2A6ED 4DV2L 4BY7B 3LWUA 3PUXA 4FNFA 2P5ZX 4BA2I 1KRTA 3G7LA 3PIO3 2SDFA 3KLWA 1JWUD 4DV3Q 3NTIA 2PNHA 2KHJA 4HTHA 1HZAA 3U58A 1N33L 4A3DH 4F7XA 1STBA 1HNWQ 1P8LA 1KAAA 1WJJA 4DFAA 3C1FA 1I50B 1ML0D 1SLJA 4IQZA 5I6YA 2B2VA 2Y0SG 1PMRA 4JOIA 1TQOA 2BOSA 1FNUA 3A56A 3TP8A 4RCNA 1XMOQ 1PZKD 1DXMA 3CPWA 1D1IA 2NN6G 2Q8TA 4DV3L 1VQMA 1YHQA 3HOWG 2JA6H 2F3IA 1TT2A 4L8JA 2JA8H 4BBSB 1MGSA 4ME5A 1EYCA 3OWFA 4DUYL 3I4NH 4LFBQ 4YWMA 2VNUD 3SDZA 2DJFC 4JOIC 5M9OA 1A2UA 2B2UC 4UHVA 3TP5A 3GO5A 3H6MA 1IBML 3NELA 1WCMB 3J80c 1QVCA 3JAME 1HH2P 5L37A 3MXUA 4DNRB 1YNXA 3R2TA 3VYRA 1MD2D 3KLSX 1VQPA 2Z6BA 3A7AB 1PYSB 4KHZA 1KLUD 1RCVD 5IYCG 1JE4A 3W5OA 4KY6A 1RIPA 1JOOA 2F0PA 1KLGD 4A3JG 3VA7A 2R93H 5CV7A 3S2DH 3CCMA 1H9JA 1IXRA 3J81c 1HNXQ 4JI1L 2D2CC 2AMCB 3BVZA 1EIFA 5J22A 4BY1B 4NXMQ 3PIOA 2LXKA 1X9NA 1VQLA 4EX5A 2CH4A 3DM1A 5EQ0A 1BUVT 5KNDA 3F2CA 1RODA 5GAHC 4A3LH 5EKIA 1T9HA 2RVLA 2V1CC 4DK0A 1BCPB 5IT9E 2QF7A 1M1KC 1X56A 5EBDA 1M4VA 2YU9B 1XPRA 1STAA 4DR5Q 4IPDA 3CQZB 3RUZA 3HOYH 1EQVA 1EY5A 4HIDA 1W6JA 2L0CA 4GS3A 5FO7B 1V1QA 2E76C 1JC7A 2JA7B 1QCBD 1VMCA 2SEBD 3M4YA 2BDOA 2C35B 4UPAA 4DV4Q 4V0BA 5IP7H 4FYDA 5IYBG 3ERQA 5FOBB 1Q81C 1B9MA 5I6WA 5IWAQ 1GO3E 2KCNA 3HOZB 4C3IG 1DZ1A 1WFQA 3CCSA 1JOKA 3U4ZA 1JT8A 2MHVA 3ZYYX 1QVGA 3U9OA 4RMFA 3PO2B 2NVTB 3NQTA 5LL6S 1II3A 3M3YB 1UNSA 5I9OA 1C9OA 2MUYA 2B8GA 3L0OA 1WTOA 3FHWA 2A19A 2NZ1D 1A3TA 1ET6A 4XQQA 1GOZA 3G48A 1DOMA 4J15A 1WI5A 2EYFA 4PMBA 4IFDG 1LT6D 2F4IA 2AWNA 3ULJA 4GLAC 1EQQA 3NQIA 3BDCA 2Z8LA 4P72A 2NVXH 1H9MA 3EN2A 5J3BA 2WAQG 2F03A 1SNCA 4DR1L 1QG7A 3I7FA 5JVH3 3HOZG 3J7ZC 4KI0A 1EU3A 1P16A 3G6EA 2CVRA 3PUVA 1IW7C 3J80i 3S15H 2BA1A 2F0QA 5K5PA 4Q5VA 1EOTA 1MBYA 4LMQD 1W6KA 1H9SA 2AUKA 2D0OA 3PUYA 1G2TA 2FMMA 2UXBQ 2RBMA 4XQNA 2A6HD 3HEJA 5JAVA 1CHQD 2CW0D 3EA6A 2B8FA 1SE8A 3Q23A 3R8BA 3ZJYC 2ZJQA 5AJ3L 3SK5A 1CSPA 3J7YW 5C3EB 1XPOA 4RFBA 3I56A 4TQUS 1XMOL 4A3CG 4NDXA 1XNRL 4P75A 1PVOA 3J81i 5EPLA 3D8GA 1K3BC 2OWOA 4TSSA 2CW0C 4IFDJ 2OT2A 1VQHA 3P20A 1SYBA 4H7BA 4U68A 4RKLA 2ZXRA 1WTRA 4K14A 1XYIA 2VY3A 4RCOA 1AP0A 1V1PB 3K5OA 3CHBD 5FK9C 2FFKB 5GROA 3LWEA 1IW7D 4ALPA 5C5LA 2WKCA 4HJ5A 1O80A 1Y8NB 2E2JH 4JI0L 3VR3A 3QG1A 4GNXA 1STGA 3KDFA 3HP3A 3NBIA 2R61A 3MXPA 1QJOA 5EKKA 2A1AA 3D3RA 3NENA 3HGBA 4KTAA 1BBWA 2B3GA 4CKCA 1X3PA 4AIMA 2IX1A 1K28A 3FKIG 1FJGQ 4TKOB 4OO1H 4UP7A 2EIFA 4IPCA 2BDNA 3AFQA 3D4DA 1HNXL 1R4QB 1GVPA 4UDUC 1DOKA 3L2PA 2UXDL 4LFAL 1H9RA 3CKIB 1PDQA 3I72A 1IYJB 2IX0A 5FLXE 3GTGH 4DV1L 1VQGA 4YWKA 5J1ZA 4DR6L 4ZCKA 4JI4L 2A69C 5IYBH 3T1HL 1B4OA 1ZKOA 3PUZA 4LUVA 3MEHA 2O2LD 4IFDI 1TY0A 4NP5A 1R9TB 3I4MH 1Y1VH 1PH3A 1S5DD 2M00A 3NK9A 3OIPA 4ID6A 1K8AC 3S9WA 3H0GH 1T5XD 5CORA 2PMZB 4QL5A 3LGJA 3DLLA 4A3MB 1RD9D 2Q2IA 2MPMA 3A55A 4R4CA 2K6AA 4H44C 2ZJPA 3D4WA 5M3FB 4LF9Q 5LMUQ 4B3TQ 2NVTH 3S1NB 3K59A 2K5WA 2E75C 4A76A 4UP9A 1F9SA 3SXHA 1VS0A 2MNAA 1EWHA 1TWFH 3S1RB 3M7NA 3R2IA 4IUUA 2EY5A 1XXGA 1GJXA 2R92B 1YBYA 1X55A 1BNZA 2DY8A 3O13A 4GKJL 5LL6X 1Y8PB 1WVLA 1EY7A 2OQ0A 3TSSA 4IUTA 2NVYB 1JR0D 5C3WA 2EE1A 2YTYA 3AQQA 3J81L 3H0GG 1GUSA 2PZTA 1HFNA 3OYYA 4X64L 5EAYA 1O78A 2NVQH 1S5ED 2AQ2B 3TS0A 1VQ7A 3M7GA 1TWFB 5DM63 4C3HH 4JI7Q 1DD2A 3HOWH 2L55A 2PNRC 5AJ3Q 3S17B 3G6JB 1EZ8A 2LS01 3TDQA 1VQ6A 3Q24A 1E22A 3HOUH 1ILPA 1VQCA 3AB9A 3K7AB 1FR3A 3E0JA 3HKSA 4X65L 2R7ZB 2NBFA 2F52A 1Q82C 4A3MH 4NB3A 3M4PA 4KMUC 3WDNA 1EQTA 2PO4A 1PH2A 1K83H 3QJYA 1CFMA 4RA8A 2EY2A 3RZOH 1X3EA 3MVVA 1CQVA 4HSPA 1CSQA 3HOVG 4CDFC 1GUOA 4I7AA 4DKAC 1IBKQ 4JC0A 1Z47A 4DAVA 1F2ZA 1LABA 2SNMA 4JI2L 3S2HH 5D3DA 2ICEC 3GTPB 2AUJD 4AYBG 3W1GA 5D3IB 2NN6I 3ND9A 2CWAA 2M9VA 2A68D 2XGTA 3PSIA 4XTCS 1NE3A 2HCIA 1DOLA 5JEAG 4K0KQ 3TBIB 2K5QA 1PTOB 2A68C 2ZTDA 1L0WA 5IYDH 4MIUA 4ZKCB 1HR0W 4J8QA 4CGYB 1I6VC 1FL0A 2CWPA 1HTLD 2F0LA 3TQYA 1N34L 3I4LA 3STBC 2Z0SA 4H02A 1LTSD 1HXYD 5CV6A 2KJXA 1GUNA 2LY7A 3HOVB 4A3KH 3DM3A 5EBCA 4K5VA 3VYSA 1J9OA 4DU9A 1PZJD 4JCVE 4WJWA 4DN4M 3D31A 3IFDA 5LHY1 2E2JB 1STHA 4DR4Q 3U4VA 2KCTA 1Q3LA 3FEWX 4MN3A 3CP0A 2V4DA 1R4PB 2F0KA 3FRPB 1Y1WB 4A3CH 1U5KA 4A3FG 1U0LA 1KNAA 3PIPA 1DONA 1G51A 1SR3A 2QKIC 4ZKBB 4OIJA 5KNCA 2J4XA 4FVMA 4IPHA 3VYTA 2Z4HA 5ELOA 3ITPA 2JQOA 4JBJA 4BY7G 3AMUA 2YTVA 2L4NA 1Y1VG 1DM0B 4DUYQ 2F0IA 2NN6H 5HURA 2L11A 3OMCA 4BY7H 2XWBB 5JJIA 1BQQT 1U4RA 3NPPA 2R7DA 1HZ9A 5ELNA 5KIXA 1IL2A 5I2YA 2FMCA 3N52A 5GQOA 2A74C 2G9DA 2Y0SB 1EYAA 4OWTB 4LW1A 1NCVA 1LM0A 2KHSA 2K03A 4C56C 2ZT9C 2B63B 2RQXA 1N33Q 3HOWB 5C4ZA 3WOFA 4A3FB 3K0XA 3CCQA 4E6IA 4JBMA 2NVQB 4EVOA 4L5SA 5CV9A 2Z6KC 2E5LQ 3PGZA 1SE4A 1CKNA 1IZ6A 1F9PA 4QCLA 1EIYB 2G9HD 2XNAC 3CCRA 1B50A 1CM9A 1Y1WH 3W1BA 3TEHB 4LF9L 1YEZA 2F0OA 4XXEA 5JJLA 1MKHA 4NPSA 1K9MC 1VF7A 2UUAL 1AZPA 3EROA 4PQXA 5IYDG 4DNIA 4HR7B 3EQLC 5CBEE 5C4JH 1I94L 1XNQQ 3B6YA 3NUCA 4MNOA 1YNND 4LAAA 4KD3A 2A6HC 1D8LA 2RHSB 2F0EA 3MXGA 3IAYA 1KTKA 2X6GA 3DWAA 2Y0SE 4LF5L 3DHQA 4APVA 3I4MG 1E2WA 1RHPA 4KLKA 1IBMQ 1L1OB 2A69D 5IP9G 3UDIA 5EPKA 2F0NA 3OTOL 2JXMB 1LTLA 2BA0A 3PMFA 1AW7A 1HA6A 4YWLA 1MIUA 1D5MC 2ASBA 3PCOB 3PO2H 3NBHA 2JA5B 3HKZE 1R9TH 1LYLA 1KNEA 4R1JA 1AE2A 4BWGB 3K5MA 3BVMA 3Q0AA 3K57A 3PO3B 4O0AA 2I5MX 1A6XA 5COYA 1DJRD 3TZDA 4JI1Q 1BCPF 3GTGB 1HCZA 4PMCA 3HOYB 1SYCA 1CK1A 1EL0A 2BE5C 2F0WA 3KF6A 1ZXTA 3K0YA 4B9WA 3I8ZA
chains in the Genus database with same CATH topology
2ZM6Q 4RMFA 3S1NH 1Q7YC 2A8VA 1YHBA 2VQFQ 1DGSA 1AH9A 1YJNA 3KDFB 3OW2A 1C9OA 4C3IH 4HIOA 4LF7L 4DV5L 3L0OA 4JI8L 3FHWA 2A19A 3BZKA 4DV0L 4B3SQ 2K52A 1HNWL 2N8NA 2K5NA 3CC7A 3G48A 1QVFA 1MJEA 4OX9L 2K5HA 4J15A 1WI5A 4O2DA 4QIWE 1G6PA 4IFDG 2WB1E 3U50C 5LMNW 2AWNA 3ULJA 1SFOH 1W3SA 4GLAC 4DV5Q 1VQOA 2WP8J 5FLMG 4YHHL 1EQQA 3UE1A 4LF7Q 4UY8C 1N36L 4P72A 1E3PA 1FGUA 4X66Q 2NVXH 1WYDA 3NBHB 4A3IG 2WFWA 2IT1A 4JI3L 2R7ZG 3EN2A 5J3BA 2WAQG 2E5LL 1A0IA 2LXJA 4DR1L 3I7FA 3HOZG 1I50H 4DK3C 1C7YA 4JV5Q 1TWAH 3J7ZC 4LUOA 3CCUA 4KI0A 3A5UA 1VQ8A 1P16A 2KCMA 3G6EA 4ME3A 2AHOB 2CQOA 2IY5B 3PUVA 1ASYA 2JA5H 3J80i 3S15H 2BA1A 1OXXK 3GTMH 4X66L 4DUZL 4A3LG 1VQKA 2HHHQ 2B63H 4PZ8A 3RLFA 1M90C 3A5ZB 2ZTEA 5IP9H 1KXLA 3GDEA 1KD1C 1Q46A 1JE5A 2D0OA 3PUYA 3S24A 3KFUA 4K0KL 3RLNA 3CCJA 2UXBQ 5GAGC 3F2DA 2F4VL 3UDXA 1VQBA 1SE8A 2RF4A 3ZJYC 3Q8DA 2ZJQA 2PQAB 5AJ3L 4BBSH 1CSPA 2RHQB 3CF5A 3T1HQ 3S16H 2I0QA 1N32Q 1HZBA 4A3GH 3VDYA 2B29A 5IE8A 1K8GA 2WAQE 3KF8B 1XPOA 1X65A 4TQUS 4X62L 3I56A 5LMNQ 1L1OA 1XMOL 3CC4A 1BBUA 3S14H 4DR3Q 5IWAL 1XNRL 4A3CG 4P75A 4OWWB 4JBKA 3J81i 3I55A 1PVOA 3M4OH 3HKZG 1EQRA 2NZHA 3OTOQ 2HQLA 2ZM6L 2OWOA 2JA6G 4IFDJ 4JI6L 3S1QH 3UDGA 1VQHA 3BJUA 3JC66 4LWCA 4P73A 3K81C 4GLXA 1YJWA 1HR0Q 1E1TA 4A3KG 4DV6Q 4LF4Q 2VZAA 1N9WA 4EQ5A 3KJOA 4QQBX 2VY3A 1NMGA 1SRUA 4JI8Q 1EYGA 3KF6B 2N49A 2VUMH 1W2BA 5GROA 3F2BA 2Q2UA 4ALPA 4DR7Q 3G71A 4HJ5A 5BR8L 1WCMG 2E2JH 4A4IA 3D0FA 5M3MG 4JI0L 3I4NG 2BH8A 3RNUA 3E9HA 5IT9c 5FLMH 4GNXA 4B3RQ 3KDFA 1B7YB 1VCIA 2JA8G 2A1AA 5M5XH 5GADC 1VQ5A 3NENA 5FLXc 3PF4A 1BBWA 2B3GA 4R4IA 2R6GA 1HNZL 4YCVA 1UE6A 4AIMA 2PMZE 3ULPA 4MZ9A 2IX1A 5FJ8G 3FKIG 1FJGQ 1VQLA 4UP7A 2EIFA 4IPCA 1KRSA 4R4OA 3AFQA 4BA1I 1Q1BA 1I94Q 1HNXL 4LNQA 5DLQE 1XNQL 1CKMA 1VQAA 1GVPA 3L7ZC 4GLVB 1I5FA 4NXNL 3GD7A 4HJ8A 3KOJA 4DV0Q 4OXPA 4GN4B 2E2IH 1J5EQ 4JI6Q 3L2PA 3TRZA 2UXDL 4BBSG 1AE3A 2UU9L 4LFAL 2K5VA 1FJGL 4WJ4A 1IYJB 4JI2Q 1EUJA 2IX0A 3GTGH 2L15A 2GN5A 1UE5A 2FXQA 3UDFA 1FVIA 1VQGA 2PI2A 3F1ZA 4YWKA 3H15A 4DV1L 4A3IH 1X54A 1PH6A 4DV2Q 1PH1A 1L2FA 1VQEA 2CKZB 4IJHA 4A3DG 2NVYH 4JI4L 4GKKL 1G291 3HOXG 1N36Q 4OWXB 5IYBH 3T1HL 4A3EG 1TWHH 3PUZA 2UXDQ 4LUVA 2B63G 2JA7H 4DPGA 4QGUA 4GNXC 4IFDI 4DR1Q 5BR8Q 4P74A 3CW2C 1E1OA 2IHFA 2K14A 1PHJA 5C0XJ 3I4MH 2E2HH 3K7UC 3M9BA 4DV1Q 3RN2A 1Y1VH 3M4QA 1NBWA 3HOXH 3T1YQ 1PH3A 3GTOH 4A93H 1A8VA 2D0PA 5C4XG 4HJ9A 1K8AC 1VQ9A 1C0AA 3MXNB 2HHHL 3H0GH 4PZ6A 4LF8L 3SGIA 1Y14B 5M5WH 2JA5G 2VL6A 4QL5A 3LGJA 1PA6A 1VQDA 1X6OA 1VQFA 2EQSA 3I4OA 3RLOA 3DLLA 2Q2IA 1PH9A 4YY3Q 1Q8KA 1Q1EA 4R4CA 2PI2E 2VQEL 2ZJPA 2JK8A 3TREA 1PV4A 4LF9Q 3RR5A 5LMUQ 4B3TQ 1VQIA 2VS1A 4X65Q 2NVTH 2K75A 3GTKH 1Q86C 4GOPC 1XPUA 2VUMG 4KHPL 4JYAQ 2CFMA 3WWVA 4A76A 4UP9A 4DR7L 4Y7NH 4X62Q 2PQAA 1NY4A 1VS0A 2MNAA 1TWFH 5C0XG 1QUQA 2MO0A 1HZCA 4L5TA 4LFAQ 2UU9Q 3RZDH 1QZGA 2VQEQ 3M7NA 1OXTA 2ES2A 1QUQB 4YY3L 2UUCQ 4JBWA 2D62A 3AEVA 1SMXA 1SROA 1RL2A 5M5YH 1NTGA 1X55A 1YBYA 4X64Q 4GKJL 1UWVA 1QZHA 2K50A 1CKOA 5E7NA 2OQ0A 2JEBI 4LF6L 3GTJH 4GOPA 4PMWA 2YTYA 3AQQA 1UE7A 4DV4L 1JJGA 1YZ6A 3H0GG 1KQSA 1J6QA 3T1YL 4A75A 4BY1G 3OYYA 4X64L 2JJQA 5EAYA 4HIMA 4XIGS 1EFWA 1OXUA 2NVQH 4Y52H 3TS0A 4IPGA 1PFSA 2AKWB 1VQ7A 4C3HH 4GN3B 1YVCA 4DV7L 2GVBA 5AJ3Q 4DR5L 1PH7A 2I5LX 3CC2A 4JI7Q 3HOWH 1VQ6A 4A3BG 2UUBL 1JB7A 2E8GA 1WOCA 4OONA 3F8TA 1N8RC 2AWOA 2EXDA 2ZTCA 1E22A 4LFCQ 3HOUH 4GNXB 1UEBA 3TS2A 1N32L 1VQCA 1CUKA 3EBEA 1ASZA 3HKSA 4AYBE 4X65L 4IO9A 1IBLL 5LMUL 4B3TL 4A3EH 5IY0A 3PUWA 2F52A 4B3MQ 4DUZQ 1Q82C 3HOYG 4A3MH 4NB3A 3M4PA 3NEMA 3S17H 1VQNA 2HIXA 1PH2A 4BY1H 1K83H 1HR0L 3K8AA 4LF5Q 2QGQA 3J81j 2F4VQ 4DAMA 2QEXA 1PH4A 3HOZH 3RZOH 1X3EA 1XJVA 1HJPA 1GD7A 4IOCA 5C3EG 4L5QA 1IBLQ 3CCLA 3PO3G 3ERSX 1CSQA 4JI5Q 5C4XH 3HOVG 3A0JA 1S3OA 4YCUA 1VQ4A 1L1OC 1NMFA 1V9PA 1XTDA 2DUDA 4DKAC 3PF5A 4LFBL 1IBKQ 2UXCQ 4JC0A 5LMNL 1Z47A 5GAEC 1B70B 1EOVA 3FKIH 1Q12A 3AFPA 2UUAQ 4JI2L 1GKHA 2R92H 2XTIA 3S2HH 5K36G 4B3RL 2HT1A 4WJ3M 3I2ZA 1OXVA 4QY7A 4POFA 4AYBG 1TWCH 2JA9A 3W1GA 3MEFA 4IJLA 4BBRH 1PH5A 4JI0Q 3CQZH 2NN6I 1MJCA 2CWAA 4YCWA 3EIVA 2XGTA 2QA4A 3S1RH 3HFZB 3PSIA 4A3FH 4XTCS 2YU9H 4DAYB 5M3MH 2JEAI 1NE3A 4B3SL 3JAMc 4DR6L 5JEAG 1UE1A 2OTLA 1BVSA 1WCMH 1O7IA 3J7A5 4K0KQ 5JEAJ 1NJIC 1Z9FA 2DGYA 1X3GA 2ZTDA 5H1SE 1L0WA 4BXXG 3E0EA 5IYDH 4LF4L 5M3FH 1HR0W 1KIXA 4LFCL 3CMEA 1FL0A 2CWPA 1SN8A 2Q2HA 1I3QH 3TQYA 1N34L 3FP9A 3M85A 1Y1WG 4A93G 5HGQA 3STBC 1H95A 3CPFA 1X3FA 2Z0SA 4H02A 3H3VH 1LUZA 4PZ7A 1S72A 4AH6A 1K73C 1XMQQ 4A3KH 3DM3A 4DV2L 4JI3Q 4PG3A 4DR3L 1VQJA 1S40A 5HY6A 2UXCL 4JCVE 3D31A 4DK6C 3PUXA 3STBD 3H3VI 4BA2I 2CCZA 4JI5L 3RN5A 1YHAA 1KRTA 1TXYA 4JI7L 2YTXA 4DR4Q 3KLWA 3U4VA 2KCTA 4DV3Q 4IOAA 2PNHA 2KHJA 3CP0A 1HZAA 4DV6L 3U58A 1N33L 4A3DH 4AQYL 4A3CH 1U5KA 4A3FG 2BH2A 1HNWQ 1KL9A 1U0LA 1P8LA 2IHEA 3PIPA 1G51A 1SR3A 2UUCL 1WJJA 3GTPH 2UXBL 1SLJA 4IPHA 5ELOA 4JBJA 2JQOA 2Y0SG 4LF6Q 4BY7G 4HJAA 4L5RC 2YTVA 3AYHB 4JOIA 5JJLA 1Y1VG 4DUYQ 1XMOQ 3CPWA 2VQFL 2NN6G 1OTCA 5C44G 4DV3L 5C44H 4OO1G 1VQMA 4BY7H 1YHQA 5JJIA 3HOWG 2JA6H 2F3IA 2YYZA 5C3EH 4JV5L 2R7DA 2K4KA 4JI4Q 2JA8H 4GKKQ 1JJCB 1HZ9A 3HOVH 1XNRQ 3A74A 2I5HA 5ELNA 1IL2A 4DUYL 2Z6KA 3I4NH 5GQOA 4NXML 4LFBQ 4OWTB 2R7ZH 4YWMA 2VNUD 4A3GG 4JOIC 2N78A 2ZJRA 4LW1A 1KC8C 2RCNA 3CD6A 3BZCA 4A3MG 1BKBA 1LM0A 3GO5A 1IBML 1JJ2A 4A3JH 3NELA 2HIVA 1A62A 2OQKA 1QVCA 3J80c 1HH2P 2ATWA 4RG1A 3HOUG 1K0RA 3G4SA 1N33Q 4LF8Q 3ICEA 1YNXA 4GN5A 3BU2A 3K0XA 5IYCH 3CCQA 4GOPB 4B3ML 4POGA 4JBMA 2NZOA 4L5SA 2WB1G 3ER0A 1VQPA 2Z6KC 1EWIA 2E5LQ 3PGZA 4DR6Q 1CKNA 1IZ6A 1PYSB 3S1MH 1EIYB 4KHZA 4R4QA 1A63A 5IYCG 3CCRA 1PYBA 3W5OA 2H5XA 1Y1WH 3PO3H 3W1BA 3KYHC 1KAWA 1RIPA 3TEHB 4LF9L 1YEZA 2R7FA 1I6HH 1K3RA 3ULLA 4A3JG 1MKHA 4NPSA 1K9MC 2UUAL 1N34Q 2R93G 3PV0A 5M3FG 2R93H 5IYDG 4BXXH 2ID0A 4FDBA 4DR2Q 3CMAA 4DNIA 3CCMA 3K80C 4OX9Q 3S2DH 1IXRA 3J81c 3CXCA 1I94L 4TVAB 4JI1L 5C4JH 1HNXQ 3B6YA 4MNOA 1XNQQ 2AMCB 2OCEA 4OO1I 3CCEA 4YHHQ 1EIFA 1D8LA 3KJPA 2RHSB 1D7QA 1J5EL 4X6AH 4NXMQ 4GKJQ 2Y0SE 3PIOA 4BBRG 4LF5L 4NXNQ 2LXKA 1X9NA 4JG2A 4APVA 4EX5A 1B8AA 2ALYB 4DR2L 4AQYQ 1JMCA 3GTQH 3I4MG 4KLKA 1IBMQ 1L1OB 2R92G 5IP9G 3F2CA 3M3YH 2JA7G 3UDIA 5GAHC 3K7AH 1V43A 2GVAA 4A3LH 4DV7Q 1E24A 1PH8A 1T9HA 3OTOL 2V1CC 3GTLH 4C2MH 1LTLA 2BA0A 2N3SA 1HNZQ 1YIJA 4YWLA 4HJ7A 1MIUA 2JE6I 2MO1A 3E9IA 1IBKL 4LUZA 3PCOB 2ASBA 1M1KC 3PO2H 2UUBQ 1X56A 4KHPQ 1XMQL 3JAMi 2LSSA 2Q2TA 2OTJA 1CKNB 3UE0A 1XPRA 2KBNA 4DR5Q 5JJKA 4IPDA 3CAMA 2YV5A 4MTNA 1E7ZA 3HKZE 3HOYH 4HIDA 1R9TH 1LYLA 5C0XI 1YI2A 3PO2G 4GS3A 4P71A 2MQHA 1V1QA 1AE2A 4R1JA 3IRBA 4C3JH 3CCVA 1TWGH 4QJFA 4R4TA 4UPAA 4DV4Q 2C35B 4DR4L 1GM5A 5IP7G 4O0AA 5IP7H 2I5MX 5FJ8H 4A3BH 5IYBG 4UP8A 2KENA 1Q81C 4JI1Q 5IWAQ 1GO3E 4JYAL 1YJ9A 2KHIA 2VW9A 4HIKA 2MFIA 1WFQA 3KF6A 3CCSA 3U4ZA 1JT8A 1OXSC 1KHIA 1QVGA 1YITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 Q;  4RMF A;  3S1N H;  1Q7Y C;  2A8V A;  1YHB A;  2VQF Q;  1DGS A;  1AH9 A;  1YJN A;  3KDF B;  3OW2 A;  1C9O A;  4C3I H;  4HIO A;  4LF7 L;  4DV5 L;  3L0O A;  4JI8 L;  3FHW A;  2A19 A;  3BZK A;  4DV0 L;  4B3S Q;  2K52 A;  1HNW L;  2N8N A;  2K5N A;  3CC7 A;  3G48 A;  1QVF A;  1MJE A;  4OX9 L;  2K5H A;  4J15 A;  1WI5 A;  4O2D A;  4QIW E;  1G6P A;  4IFD G;  2WB1 E;  3U50 C;  5LMN W;  2AWN A;  3ULJ A;  1SFO H;  1W3S A;  4GLA C;  4DV5 Q;  1VQO A;  2WP8 J;  5FLM G;  4YHH L;  1EQQ A;  3UE1 A;  4LF7 Q;  4UY8 C;  1N36 L;  4P72 A;  1E3P A;  1FGU A;  4X66 Q;  2NVX H;  1WYD A;  3NBH B;  4A3I G;  2WFW A;  2IT1 A;  4JI3 L;  2R7Z G;  3EN2 A;  5J3B A;  2WAQ G;  2E5L L;  1A0I A;  2LXJ A;  4DR1 L;  3I7F A;  3HOZ G;  1I50 H;  4DK3 C;  1C7Y A;  4JV5 Q;  1TWA H;  3J7Z C;  4LUO A;  3CCU A;  4KI0 A;  3A5U A;  1VQ8 A;  1P16 A;  2KCM A;  3G6E A;  4ME3 A;  2AHO B;  2CQO A;  2IY5 B;  3PUV A;  1ASY A;  2JA5 H;  3J80 i;  3S15 H;  2BA1 A;  1OXX K;  3GTM H;  4X66 L;  4DUZ L;  4A3L G;  1VQK A;  2HHH Q;  2B63 H;  4PZ8 A;  3RLF A;  1M90 C;  3A5Z B;  2ZTE A;  5IP9 H;  1KXL A;  3GDE A;  1KD1 C;  1Q46 A;  1JE5 A;  2D0O A;  3PUY A;  3S24 A;  3KFU A;  4K0K L;  3RLN A;  3CCJ A;  2UXB Q;  5GAG C;  3F2D A;  2F4V L;  3UDX A;  1VQB A;  1SE8 A;  2RF4 A;  3ZJY C;  3Q8D A;  2ZJQ A;  2PQA B;  5AJ3 L;  4BBS H;  1CSP A;  2RHQ B;  3CF5 A;  3T1H Q;  3S16 H;  2I0Q A;  1N32 Q;  1HZB A;  4A3G H;  3VDY A;  2B29 A;  5IE8 A;  1K8G A;  2WAQ E;  3KF8 B;  1XPO A;  1X65 A;  4TQU S;  4X62 L;  3I56 A;  5LMN Q;  1L1O A;  1XMO L;  3CC4 A;  1BBU A;  3S14 H;  4DR3 Q;  5IWA L;  1XNR L;  4A3C G;  4P75 A;  4OWW B;  4JBK A;  3J81 i;  3I55 A;  1PVO A;  3M4O H;  3HKZ G;  1EQR A;  2NZH A;  3OTO Q;  2HQL A;  2ZM6 L;  2OWO A;  2JA6 G;  4IFD J;  4JI6 L;  3S1Q H;  3UDG A;  1VQH A;  3BJU A;  3JC6 6;  4LWC A;  4P73 A;  3K81 C;  4GLX A;  1YJW A;  1HR0 Q;  1E1T A;  4A3K G;  4DV6 Q;  4LF4 Q;  2VZA A;  1N9W A;  4EQ5 A;  3KJO A;  4QQB X;  2VY3 A;  1NMG A;  1SRU A;  4JI8 Q;  1EYG A;  3KF6 B;  2N49 A;  2VUM H;  1W2B A;  5GRO A;  3F2B A;  2Q2U A;  4ALP A;  4DR7 Q;  3G71 A;  4HJ5 A;  5BR8 L;  1WCM G;  2E2J H;  4A4I A;  3D0F A;  5M3M G;  4JI0 L;  3I4N G;  2BH8 A;  3RNU A;  3E9H A;  5IT9 c;  5FLM H;  4GNX A;  4B3R Q;  3KDF A;  1B7Y B;  1VCI A;  2JA8 G;  2A1A A;  5M5X H;  5GAD C;  1VQ5 A;  3NEN A;  5FLX c;  3PF4 A;  1BBW A;  2B3G A;  4R4I A;  2R6G A;  1HNZ L;  4YCV A;  1UE6 A;  4AIM A;  2PMZ E;  3ULP A;  4MZ9 A;  2IX1 A;  5FJ8 G;  3FKI G;  1FJG Q;  1VQL A;  4UP7 A;  2EIF A;  4IPC A;  1KRS A;  4R4O A;  3AFQ A;  4BA1 I;  1Q1B A;  1I94 Q;  1HNX L;  4LNQ A;  5DLQ E;  1XNQ L;  1CKM A;  1VQA A;  1GVP A;  3L7Z C;  4GLV B;  1I5F A;  4NXN L;  3GD7 A;  4HJ8 A;  3KOJ A;  4DV0 Q;  4OXP A;  4GN4 B;  2E2I H;  1J5E Q;  4JI6 Q;  3L2P A;  3TRZ A;  2UXD L;  4BBS G;  1AE3 A;  2UU9 L;  4LFA L;  2K5V A;  1FJG L;  4WJ4 A;  1IYJ B;  4JI2 Q;  1EUJ A;  2IX0 A;  3GTG H;  2L15 A;  2GN5 A;  1UE5 A;  2FXQ A;  3UDF A;  1FVI A;  1VQG A;  2PI2 A;  3F1Z A;  4YWK A;  3H15 A;  4DV1 L;  4A3I H;  1X54 A;  1PH6 A;  4DV2 Q;  1PH1 A;  1L2F A;  1VQE A;  2CKZ B;  4IJH A;  4A3D G;  2NVY H;  4JI4 L;  4GKK L;  1G29 1;  3HOX G;  1N36 Q;  4OWX B;  5IYB H;  3T1H L;  4A3E G;  1TWH H;  3PUZ A;  2UXD Q;  4LUV A;  2B63 G;  2JA7 H;  4DPG A;  4QGU A;  4GNX C;  4IFD I;  4DR1 Q;  5BR8 Q;  4P74 A;  3CW2 C;  1E1O A;  2IHF A;  2K14 A;  1PHJ A;  5C0X J;  3I4M H;  2E2H H;  3K7U C;  3M9B A;  4DV1 Q;  3RN2 A;  1Y1V H;  3M4Q A;  1NBW A;  3HOX H;  3T1Y Q;  1PH3 A;  3GTO H;  4A93 H;  1A8V A;  2D0P A;  5C4X G;  4HJ9 A;  1K8A C;  1VQ9 A;  1C0A A;  3MXN B;  2HHH L;  3H0G H;  4PZ6 A;  4LF8 L;  3SGI A;  1Y14 B;  5M5W H;  2JA5 G;  2VL6 A;  4QL5 A;  3LGJ A;  1PA6 A;  1VQD A;  1X6O A;  1VQF A;  2EQS A;  3I4O A;  3RLO A;  3DLL A;  2Q2I A;  1PH9 A;  4YY3 Q;  1Q8K A;  1Q1E A;  4R4C A;  2PI2 E;  2VQE L;  2ZJP A;  2JK8 A;  3TRE A;  1PV4 A;  4LF9 Q;  3RR5 A;  5LMU Q;  4B3T Q;  1VQI A;  2VS1 A;  4X65 Q;  2NVT H;  2K75 A;  3GTK H;  1Q86 C;  4GOP C;  1XPU A;  2VUM G;  4KHP L;  4JYA Q;  2CFM A;  3WWV A;  4A76 A;  4UP9 A;  4DR7 L;  4Y7N H;  4X62 Q;  2PQA A;  1NY4 A;  1VS0 A;  2MNA A;  1TWF H;  5C0X G;  1QUQ A;  2MO0 A;  1HZC A;  4L5T A;  4LFA Q;  2UU9 Q;  3RZD H;  1QZG A;  2VQE Q;  3M7N A;  1OXT A;  2ES2 A;  1QUQ B;  4YY3 L;  2UUC Q;  4JBW A;  2D62 A;  3AEV A;  1SMX A;  1SRO A;  1RL2 A;  5M5Y H;  1NTG A;  1X55 A;  1YBY A;  4X64 Q;  4GKJ L;  1UWV A;  1QZH A;  2K50 A;  1CKO A;  5E7N A;  2OQ0 A;  2JEB I;  4LF6 L;  3GTJ H;  4GOP A;  4PMW A;  2YTY A;  3AQQ A;  1UE7 A;  4DV4 L;  1JJG A;  1YZ6 A;  3H0G G;  1KQS A;  1J6Q A;  3T1Y L;  4A75 A;  4BY1 G;  3OYY A;  4X64 L;  2JJQ A;  5EAY A;  4HIM A;  4XIG S;  1EFW A;  1OXU A;  2NVQ H;  4Y52 H;  3TS0 A;  4IPG A;  1PFS A;  2AKW B;  1VQ7 A;  4C3H H;  4GN3 B;  1YVC A;  4DV7 L;  2GVB A;  5AJ3 Q;  4DR5 L;  1PH7 A;  2I5L X;  3CC2 A;  4JI7 Q;  3HOW H;  1VQ6 A;  4A3B G;  2UUB L;  1JB7 A;  2E8G A;  1WOC A;  4OON A;  3F8T A;  1N8R C;  2AWO A;  2EXD A;  2ZTC A;  1E22 A;  4LFC Q;  3HOU H;  4GNX B;  1UEB A;  3TS2 A;  1N32 L;  1VQC A;  1CUK A;  3EBE A;  1ASZ A;  3HKS A;  4AYB E;  4X65 L;  4IO9 A;  1IBL L;  5LMU L;  4B3T L;  4A3E H;  5IY0 A;  3PUW A;  2F52 A;  4B3M Q;  4DUZ Q;  1Q82 C;  3HOY G;  4A3M H;  4NB3 A;  3M4P A;  3NEM A;  3S17 H;  1VQN A;  2HIX A;  1PH2 A;  4BY1 H;  1K83 H;  1HR0 L;  3K8A A;  4LF5 Q;  2QGQ A;  3J81 j;  2F4V Q;  4DAM A;  2QEX A;  1PH4 A;  3HOZ H;  3RZO H;  1X3E A;  1XJV A;  1HJP A;  1GD7 A;  4IOC A;  5C3E G;  4L5Q A;  1IBL Q;  3CCL A;  3PO3 G;  3ERS X;  1CSQ A;  4JI5 Q;  5C4X H;  3HOV G;  3A0J A;  1S3O A;  4YCU A;  1VQ4 A;  1L1O C;  1NMF A;  1V9P A;  1XTD A;  2DUD A;  4DKA C;  3PF5 A;  4LFB L;  1IBK Q;  2UXC Q;  4JC0 A;  5LMN L;  1Z47 A;  5GAE C;  1B70 B;  1EOV A;  3FKI H;  1Q12 A;  3AFP A;  2UUA Q;  4JI2 L;  1GKH A;  2R92 H;  2XTI A;  3S2H H;  5K36 G;  4B3R L;  2HT1 A;  4WJ3 M;  3I2Z A;  1OXV A;  4QY7 A;  4POF A;  4AYB G;  1TWC H;  2JA9 A;  3W1G A;  3MEF A;  4IJL A;  4BBR H;  1PH5 A;  4JI0 Q;  3CQZ H;  2NN6 I;  1MJC A;  2CWA A;  4YCW A;  3EIV A;  2XGT A;  2QA4 A;  3S1R H;  3HFZ B;  3PSI A;  4A3F H;  4XTC S;  2YU9 H;  4DAY B;  5M3M H;  2JEA I;  1NE3 A;  4B3S L;  3JAM c;  4DR6 L;  5JEA G;  1UE1 A;  2OTL A;  1BVS A;  1WCM H;  1O7I A;  3J7A 5;  4K0K Q;  5JEA J;  1NJI C;  1Z9F A;  2DGY A;  1X3G A;  2ZTD A;  5H1S E;  1L0W A;  4BXX G;  3E0E A;  5IYD H;  4LF4 L;  5M3F H;  1HR0 W;  1KIX A;  4LFC L;  3CME A;  1FL0 A;  2CWP A;  1SN8 A;  2Q2H A;  1I3Q H;  3TQY A;  1N34 L;  3FP9 A;  3M85 A;  1Y1W G;  4A93 G;  5HGQ A;  3STB C;  1H95 A;  3CPF A;  1X3F A;  2Z0S A;  4H02 A;  3H3V H;  1LUZ A;  4PZ7 A;  1S72 A;  4AH6 A;  1K73 C;  1XMQ Q;  4A3K H;  3DM3 A;  4DV2 L;  4JI3 Q;  4PG3 A;  4DR3 L;  1VQJ A;  1S40 A;  5HY6 A;  2UXC L;  4JCV E;  3D31 A;  4DK6 C;  3PUX A;  3STB D;  3H3V I;  4BA2 I;  2CCZ A;  4JI5 L;  3RN5 A;  1YHA A;  1KRT A;  1TXY A;  4JI7 L;  2YTX A;  4DR4 Q;  3KLW A;  3U4V A;  2KCT A;  4DV3 Q;  4IOA A;  2PNH A;  2KHJ A;  3CP0 A;  1HZA A;  4DV6 L;  3U58 A;  1N33 L;  4A3D H;  4AQY L;  4A3C H;  1U5K A;  4A3F G;  2BH2 A;  1HNW Q;  1KL9 A;  1U0L A;  1P8L A;  2IHE A;  3PIP A;  1G51 A;  1SR3 A;  2UUC L;  1WJJ A;  3GTP H;  2UXB L;  1SLJ A;  4IPH A;  5ELO A;  4JBJ A;  2JQO A;  2Y0S G;  4LF6 Q;  4BY7 G;  4HJA A;  4L5R C;  2YTV A;  3AYH B;  4JOI A;  5JJL A;  1Y1V G;  4DUY Q;  1XMO Q;  3CPW A;  2VQF L;  2NN6 G;  1OTC A;  5C44 G;  4DV3 L;  5C44 H;  4OO1 G;  1VQM A;  4BY7 H;  1YHQ A;  5JJI A;  3HOW G;  2JA6 H;  2F3I A;  2YYZ A;  5C3E H;  4JV5 L;  2R7D A;  2K4K A;  4JI4 Q;  2JA8 H;  4GKK Q;  1JJC B;  1HZ9 A;  3HOV H;  1XNR Q;  3A74 A;  2I5H A;  5ELN A;  1IL2 A;  4DUY L;  2Z6K A;  3I4N H;  5GQO A;  4NXM L;  4LFB Q;  4OWT B;  2R7Z H;  4YWM A;  2VNU D;  4A3G G;  4JOI C;  2N78 A;  2ZJR A;  4LW1 A;  1KC8 C;  2RCN A;  3CD6 A;  3BZC A;  4A3M G;  1BKB A;  1LM0 A;  3GO5 A;  1IBM L;  1JJ2 A;  4A3J H;  3NEL A;  2HIV A;  1A62 A;  2OQK A;  1QVC A;  3J80 c;  1HH2 P;  2ATW A;  4RG1 A;  3HOU G;  1K0R A;  3G4S A;  1N33 Q;  4LF8 Q;  3ICE A;  1YNX A;  4GN5 A;  3BU2 A;  3K0X A;  5IYC H;  3CCQ A;  4GOP B;  4B3M L;  4POG A;  4JBM A;  2NZO A;  4L5S A;  2WB1 G;  3ER0 A;  1VQP A;  2Z6K C;  1EWI A;  2E5L Q;  3PGZ A;  4DR6 Q;  1CKN A;  1IZ6 A;  1PYS B;  3S1M H;  1EIY B;  4KHZ A;  4R4Q A;  1A63 A;  5IYC G;  3CCR A;  1PYB A;  3W5O A;  2H5X A;  1Y1W H;  3PO3 H;  3W1B A;  3KYH C;  1KAW A;  1RIP A;  3TEH B;  4LF9 L;  1YEZ A;  2R7F A;  1I6H H;  1K3R A;  3ULL A;  4A3J G;  1MKH A;  4NPS A;  1K9M C;  2UUA L;  1N34 Q;  2R93 G;  3PV0 A;  5M3F G;  2R93 H;  5IYD G;  4BXX H;  2ID0 A;  4FDB A;  4DR2 Q;  3CMA A;  4DNI A;  3CCM A;  3K80 C;  4OX9 Q;  3S2D H;  1IXR A;  3J81 c;  3CXC A;  1I94 L;  4TVA B;  4JI1 L;  5C4J H;  1HNX Q;  3B6Y A;  4MNO A;  1XNQ Q;  2AMC B;  2OCE A;  4OO1 I;  3CCE A;  4YHH Q;  1EIF A;  1D8L A;  3KJP A;  2RHS B;  1D7Q A;  1J5E L;  4X6A H;  4NXM Q;  4GKJ Q;  2Y0S E;  3PIO A;  4BBR G;  4LF5 L;  4NXN Q;  2LXK A;  1X9N A;  4JG2 A;  4APV A;  4EX5 A;  1B8A A;  2ALY B;  4DR2 L;  4AQY Q;  1JMC A;  3GTQ H;  3I4M G;  4KLK A;  1IBM Q;  1L1O B;  2R92 G;  5IP9 G;  3F2C A;  3M3Y H;  2JA7 G;  3UDI A;  5GAH C;  3K7A H;  1V43 A;  2GVA A;  4A3L H;  4DV7 Q;  1E24 A;  1PH8 A;  1T9H A;  3OTO L;  2V1C C;  3GTL H;  4C2M H;  1LTL A;  2BA0 A;  2N3S A;  1HNZ Q;  1YIJ A;  4YWL A;  4HJ7 A;  1MIU A;  2JE6 I;  2MO1 A;  3E9I A;  1IBK L;  4LUZ A;  3PCO B;  2ASB A;  1M1K C;  3PO2 H;  2UUB Q;  1X56 A;  4KHP Q;  1XMQ L;  3JAM i;  2LSS A;  2Q2T A;  2OTJ A;  1CKN B;  3UE0 A;  1XPR A;  2KBN A;  4DR5 Q;  5JJK A;  4IPD A;  3CAM A;  2YV5 A;  4MTN A;  1E7Z A;  3HKZ E;  3HOY H;  4HID A;  1R9T H;  1LYL A;  5C0X I;  1YI2 A;  3PO2 G;  4GS3 A;  4P71 A;  2MQH A;  1V1Q A;  1AE2 A;  4R1J A;  3IRB A;  4C3J H;  3CCV A;  1TWG H;  4QJF A;  4R4T A;  4UPA A;  4DV4 Q;  2C35 B;  4DR4 L;  1GM5 A;  5IP7 G;  4O0A A;  5IP7 H;  2I5M X;  5FJ8 H;  4A3B H;  5IYB G;  4UP8 A;  2KEN A;  1Q81 C;  4JI1 Q;  5IWA Q;  1GO3 E;  4JYA L;  1YJ9 A;  2KHI A;  2VW9 A;  4HIK A;  2MFI A;  1WFQ A;  3KF6 A;  3CCS A;  3U4Z A;  1JT8 A;  1OXS C;  1KHI A;  1QVG A;  1YIT A; 
#chains in the Genus database with same CATH topology
 4XYQ A;  3GTL B;  1Q7Y C;  2J7Z A;  1IKM A;  5EJW A;  5IGB A;  1F2Y A;  2KEE A;  2KED A;  2Z4I A;  3OW2 A;  5IGG A;  4HAE A;  3SE0 A;  4ZAI A;  1UEA B;  1XWE A;  4KN4 C;  2EPB A;  3V2T A;  4DV5 L;  4JI8 L;  4DV0 L;  1RKN A;  5M5W B;  3IKJ A;  1QVF A;  2CHB D;  4A93 B;  4O2D A;  4FXD A;  5CV4 A;  1SNO A;  5LMN W;  4WRD A;  1SFO H;  1W3S A;  4DV5 Q;  2WP8 J;  4UY8 C;  3UE1 A;  4LF7 Q;  3T4A C;  5ELD A;  4A3I G;  1EY4 A;  4JI3 L;  1M8A A;  5T1I A;  4HCS A;  3A5U A;  1VQ8 A;  2PZW A;  2IY5 B;  1TY2 A;  2IL8 A;  4R8N A;  2XVS A;  2F3V A;  2XRS D;  3GTM H;  5K36 H;  4DUZ L;  2E2I B;  2HHH Q;  2B63 H;  1K8M A;  2ZTE A;  5IP9 H;  2F0J A;  1Q46 A;  3S24 A;  4K0K L;  1AEX A;  2F4V L;  1QE6 A;  3UDX A;  2KQ3 A;  4Z9C B;  1SYF A;  1IKL A;  5TSS A;  4ZLT F;  2RF4 A;  2EDG A;  2EY6 A;  3CF5 A;  2NWG A;  2I0Q A;  4A3G H;  3OMG A;  4DAP A;  3VDY A;  5G3L D;  3H91 A;  2WAQ E;  1X65 A;  4X62 L;  4NKL A;  1L1O A;  1BBU A;  4DR3 Q;  4X3T A;  4JBK A;  2EVB A;  1EY9 A;  2PPB C;  2NZH A;  3OTO Q;  3DEO A;  3GTM B;  4I65 A;  3S1Q H;  1MSH A;  3UDG A;  1G8Z D;  4LWC A;  3TP6 A;  3K81 C;  2KUM A;  5CV8 A;  3Q6S A;  1E1T A;  4HSV A;  5C0X H;  4I7Z C;  4CBV A;  1NMG A;  3I3C A;  3KF6 B;  4DGZ A;  2N49 A;  1B1Z A;  3T51 B;  2VUM H;  1VF5 C;  1W2B A;  2NVX B;  3G71 A;  2F0H A;  1B3A A;  1WCM G;  1SFO B;  1QB5 D;  1PFM A;  4R8I A;  4A3J B;  4X3U A;  1BXT A;  3RNU A;  1Q90 A;  5FLM H;  4B3R Q;  1B7Y B;  1VCI A;  4LJZ C;  1TKW B;  5M5X H;  5FLX c;  2R6G A;  5CYU A;  1UE6 A;  2PMZ E;  3ULP A;  4V19 0;  3DWQ A;  1IYV A;  2E2D C;  2G5D A;  5E1F A;  4R4O A;  1KRS A;  4BA1 I;  1I94 Q;  1IYU A;  1XNQ L;  2SOB A;  1VQA A;  1QWY A;  1I5F A;  3LX0 A;  3KOJ A;  1F2M A;  2PYK A;  3RD4 A;  2UU9 L;  2K5V A;  4PV1 C;  2VUM B;  1EUJ A;  1F77 A;  2L15 A;  2GN5 A;  1PTO D;  4A3I H;  1FVI A;  4A3D G;  1LTA D;  4DV2 Q;  2CKZ B;  1VQE A;  5KYI A;  3FPU B;  4GKK L;  1N36 Q;  1H9S B;  3QOL A;  4A3E G;  1ONL A;  2IW3 A;  4GNX C;  4DR1 Q;  4P74 A;  3M9B A;  4CKE A;  3T1Y Q;  3CU7 A;  2K04 A;  5A35 A;  1K83 B;  2D0P A;  4HJ9 A;  1C0A A;  1XTC D;  2B2U A;  4C1N K;  5M5W H;  1PA6 A;  4C3I B;  1VQD A;  2EQS A;  4RHS A;  1PH9 A;  4KHV A;  4YY3 Q;  3KBX A;  3OHX C;  1Q1E A;  1E0B A;  2VS1 A;  4X65 Q;  2K75 A;  1Q86 C;  1RTO A;  4CJ1 B;  2VUM G;  4JYA Q;  2CFM A;  3WWV A;  1D6E C;  4DR7 L;  3I90 A;  1ESR A;  4CKB A;  1O7Z A;  4NMZ A;  1NAP A;  2XSC A;  5C0X G;  4L5T A;  4IAL A;  4LFA Q;  1EU4 A;  3CRK C;  2F0S A;  2VQE Q;  4JW0 A;  1GHK A;  1OXT A;  3S2D B;  1QUQ B;  4YY3 L;  1FNV A;  2R93 B;  3AEV A;  5M5Y H;  1RL2 A;  2D5D A;  4A3B B;  1QZH A;  5E7N A;  2JEB I;  3KLS A;  3H3V C;  4GOP A;  3L9A X;  3VA5 A;  1BDO A;  5AFW A;  4PMW A;  4M8A A;  2FJ2 A;  2HD3 A;  3T1Y L;  4B9X A;  1JOQ A;  4A75 A;  2JJQ A;  4HIM A;  3RZD B;  5KNB A;  2K1B A;  1LTR D;  4GN3 B;  1YVC A;  2OXP A;  1F9R A;  1EEF D;  3CC2 A;  4RGT A;  3KUP A;  3ONA B;  4KY5 A;  2UUB L;  1JB7 A;  2E8G A;  1WOC A;  4S3S A;  2Q8I B;  3TME A;  1N32 L;  2H1E A;  3EBE A;  1ASZ A;  3KBG A;  1ENA A;  4C3H G;  5LMU L;  4B3T L;  1HA5 A;  3PUW A;  4DUZ Q;  3X3M A;  1VQN A;  1STE A;  3MZ5 A;  1HR0 L;  2NTT A;  2QGQ A;  1YNJ C;  2F4V Q;  2O5J C;  4DAM A;  3HOZ H;  1XJV A;  1LLR D;  4DK1 A;  3I70 A;  1GD7 A;  3P7J A;  5C3E G;  3CCL A;  1IBL Q;  4KN7 C;  1S3O A;  1L1O C;  1JOR A;  1V9P A;  2DUD A;  3VR4 A;  3DEP A;  5GAE C;  3FKI H;  1B70 B;  3AFP A;  3AU7 A;  1GKH A;  1U4M A;  1U9R A;  4WJ3 M;  4POF A;  1OXV A;  1RDP D;  2JA9 A;  1PH5 A;  2SNS A;  1MJC A;  4FF1 A;  4X3S A;  3EIV A;  2QA4 A;  4OWW B;  2YU9 H;  3D6C A;  5M3M H;  4ULL A;  3JAM c;  3J7A 5;  2ENB A;  4EQN A;  3J80 E;  2DGY A;  3GP7 A;  3W3A A;  2EJF C;  4C1N I;  3S16 B;  4FXK C;  5DEH A;  3NWS A;  3M85 A;  4K6L A;  4G57 A;  5M5X B;  1X3F A;  1NR2 A;  3H3V H;  4PZ7 A;  1S72 A;  4AH6 A;  3OWE B;  3MTS A;  4DR3 L;  1PRT C;  2UXC L;  1S40 A;  3NWT A;  2WII B;  3H3V I;  5EKL A;  4DF7 A;  2CCZ A;  4JI5 L;  4RHR A;  1YHA A;  1TXY A;  4IOA A;  4DV6 L;  1ENC A;  4AQY L;  2QEJ C;  1CI3 M;  1KL9 A;  3GTP H;  1TWA B;  3KF8 A;  3MFY A;  5I9P A;  2H4O A;  4LF6 Q;  2A5H A;  2RKS A;  1X32 A;  1LV9 A;  1Q8I A;  3P75 A;  1S5B D;  3NP8 A;  1LTT D;  1S5C D;  4QB4 A;  5C44 G;  4OO1 G;  4C3J G;  5C6A A;  2DNE A;  1O7L A;  1D5Z C;  4JI4 Q;  4A3K B;  1OO9 B;  1XNR Q;  2I5H A;  2R7Z H;  1GHJ A;  3FVQ A;  2N78 A;  2DN8 A;  1KC8 C;  3CD6 A;  1EIH A;  3BZC A;  4A3M G;  2JA6 B;  1PFN A;  2OQK A;  2F0D A;  4OL7 A;  2ATW A;  4RG1 A;  1K0R A;  3DUZ A;  4LF8 Q;  4GN5 A;  3BU2 A;  4GOP B;  5IYC H;  2WB1 G;  2DJG C;  4G7H C;  1QIL A;  1CA5 A;  1EWI A;  1Z7T A;  4DR6 Q;  3S1M H;  4R4Q A;  2B39 A;  2R7F A;  4C3J B;  1I6H H;  1K3R A;  4RGO S;  1N34 Q;  2F0F A;  3PV0 A;  4DA2 A;  5M3F G;  1KAB A;  2ID0 A;  4FDB A;  4DR2 Q;  4OX9 Q;  2PZU A;  4J1M A;  3K5L A;  1U4L A;  2K28 A;  4IUP A;  4TVA B;  3E5S A;  2PW7 A;  4ODG A;  4GKJ Q;  4BBR G;  4JG2 A;  4DR2 L;  4AQY Q;  1B8A A;  2ALY B;  1JMC A;  5ELE A;  5CGK A;  2HDL A;  2R92 G;  3OOC A;  3GQB A;  3M3Y H;  3A7L A;  1V43 A;  2I07 B;  4DV7 Q;  1SAP A;  1PH8 A;  2EYO A;  3GTL H;  4RKB A;  2QW7 A;  1LO5 D;  2N3S A;  3T16 A;  2JE6 I;  2XIW A;  1E2Z A;  5G3L F;  4HED A;  4LUZ A;  1IBK L;  2UUB Q;  1XMQ L;  3JAM i;  2LSS A;  2OTJ A;  3UE0 A;  2EYH A;  2KBN A;  4ZRZ A;  4IUQ A;  2YV5 A;  1E7Z A;  3I4M B;  5C0X I;  1YI2 A;  3S2H B;  2MQH A;  3NTH A;  2KCC A;  4C3J H;  3CCV A;  1A3V A;  1Z6H A;  4QJF A;  4R4T A;  4DR4 L;  5I4D A;  4A3B H;  5FJ8 H;  2IWH A;  4UP8 A;  2KEN A;  3A54 A;  2RSN A;  5J39 A;  1STY A;  2B2T C;  4JYA L;  2Q8R E;  1YJ9 A;  2VW9 A;  1AFP A;  4HIK A;  1B44 D;  1OXS C;  1KDB A;  3PF4 A;  1YIT A;  2ZM6 Q;  3K6O A;  4K5X A;  1PYW D;  1YHB A;  1DGS A;  4C2M B;  1AH9 A;  1LT5 D;  2ICI A;  4C3I H;  4HIO A;  2B2T A;  2EYJ A;  3BZK A;  2PQE A;  2EOT A;  4IZ8 A;  3J81 E;  1HNW L;  2N8N A;  2HCC A;  1MJE A;  4OX9 L;  4FF3 A;  2K5H A;  1G6P A;  3QR8 A;  5FLM G;  1N36 L;  4QIW B;  2F0U A;  1FGU A;  1LAC A;  1WYD A;  3NBH B;  2WFW A;  2IT1 A;  2LMC B;  2ZXO A;  2PW5 A;  3MC0 B;  5JEA H;  4HMI A;  2K32 A;  4MTK A;  4DK3 C;  1C7Y A;  4JV5 Q;  1TWA H;  4ZUI A;  5E3F A;  1I4X A;  3A8J E;  4ME3 A;  2AHO B;  5FKA C;  2JA5 H;  1WTQ A;  3NSW A;  1I4P A;  1OXX K;  1EZ6 A;  1GUG A;  4N9T A;  4X66 L;  4A3L G;  1NNX A;  1VQK A;  3J7A V;  1M90 C;  3A5Z B;  3KFU A;  1JE5 A;  3RLN A;  3CCJ A;  5GAG C;  4ZYS A;  1VQB A;  4K2K A;  1D2B A;  5BN4 A;  3Q8D A;  2PQA B;  2WAC A;  3RMH A;  3T1H Q;  2JA8 B;  3S16 H;  1HZB A;  2B29 A;  1K8G A;  3KF8 B;  4UAI A;  1KXL A;  3S14 H;  4B08 A;  2MJ8 A;  2O4X A;  5IWA L;  3GV3 A;  3I55 A;  1SJE D;  1Y1V B;  1ICF B;  1L0Y B;  2EYM A;  5M3M B;  3BJU A;  3JC6 6;  4GLX A;  3E6Z X;  1YJW A;  1HR0 Q;  1ET9 A;  4DV6 Q;  4IUR A;  4LF4 Q;  4ZQ3 A;  3V96 A;  4EQ5 A;  3KJO A;  3S1M B;  3SEB A;  4QQB X;  1BR9 A;  1SRU A;  4JI8 Q;  1EYG A;  3K5N A;  4FF2 A;  3S1Q B;  3JAM L;  2Q2U A;  2IPK D;  2GA4 B;  3HZX A;  3KK7 A;  4A4I A;  3D0F A;  3MHB A;  3S14 B;  1SE3 A;  1STN A;  5D65 A;  1LT4 D;  5KYL A;  2IX3 A;  2JA8 G;  5JPN C;  1QNU A;  5GAD C;  1SND A;  1JWS D;  1VQ5 A;  4KJO A;  4R4I A;  1HNZ L;  3E3X A;  4RH6 A;  4MZ9 A;  4EQP A;  3SVM A;  1S5F D;  1CKM A;  3L7Z C;  4GLV B;  4DXG A;  2WV6 D;  3GD7 A;  4NXN L;  1VDZ A;  4CDC C;  4GN4 B;  2L9H A;  2F0T A;  5KEE A;  1J5E Q;  2E2I H;  3TRZ A;  2TSS A;  4BBS G;  1AE3 A;  2EJM A;  4WJ4 A;  1TWC B;  5EGT A;  1I4R A;  1PRT F;  3F2U A;  2FXQ A;  3UDF A;  1ENF A;  3F1Z A;  4XYO A;  3H15 A;  2F1M A;  1PH6 A;  1L2F A;  4IJH A;  2QDB A;  5I2X A;  1G29 1;  4OWX B;  5DM7 3;  1SJH D;  4XT3 B;  2UXD Q;  2JA7 H;  1CA6 A;  4DPG A;  1H9K A;  1QOH A;  3DXJ C;  5BR8 Q;  3CW2 C;  1E1O A;  2IHF A;  1SYD A;  4R9W A;  1QNK A;  5C0X J;  2E2H H;  3K7U C;  4DV1 Q;  3RN2 A;  2N55 A;  3M4Q A;  3GTO H;  2B2Y C;  2I46 A;  2QCP X;  1ZYR C;  4K8J A;  1SMY D;  4KKU A;  1VQ9 A;  3MXN B;  3OW7 A;  4RWS C;  4OGQ C;  4PZ6 A;  3SGI A;  1TS5 A;  2JA5 G;  2VL6 A;  2MGS A;  1X6O A;  3I4O A;  3RLO A;  4A3E B;  1Q8K A;  3J7A F;  2MP1 A;  1I4H A;  3TRE A;  2VB2 X;  3RR5 A;  5FO9 B;  1VQI A;  2RDG A;  4FXG C;  3GTK H;  4CHT B;  1XPU A;  3D6W A;  4Y7N H;  4X62 Q;  1E2V A;  1NY4 A;  1QUQ A;  5ELF A;  2XN9 C;  1HZC A;  2UU9 Q;  2A6E C;  1SNP A;  5DNF A;  2FHT A;  1KDC A;  3C1E A;  4K2L A;  3IFT A;  2ES2 A;  1MHW C;  4JBW A;  1HQR D;  2D62 A;  1SMX A;  5DAU A;  1UWV A;  3R93 A;  3QOJ A;  5CC4 A;  1TVX A;  5CBA E;  1JJG A;  1KQS A;  4A3I B;  1J6Q A;  5HGT A;  5C3X A;  4BY1 G;  2UXC Q;  2KA7 A;  4XIG S;  1EFW A;  1OXU A;  3W2D A;  1TS3 A;  4QUC A;  4IPG A;  4X3K A;  1PFS A;  3VR6 A;  1G2S A;  3TP7 A;  1WTH A;  2R3Z A;  3OIQ A;  3BYT B;  4QF4 A;  4A3B G;  4BS9 A;  1N8R C;  4ZK9 B;  3FMC A;  2AWO A;  2ZTC A;  4LFC Q;  3TS2 A;  1CUK A;  3NHH A;  2WIN B;  3EJI A;  1IBL L;  4A3E H;  2NYZ D;  3S17 H;  1MSG A;  4BY1 H;  5C4J B;  4LF5 Q;  1JQY D;  4IN3 A;  3J81 j;  3EFX D;  1SE2 A;  1Y8O B;  4XQJ A;  5A2Q L;  1PH4 A;  3C2P A;  1G91 A;  1XX8 A;  1EY8 A;  2C5C A;  4IOC A;  1U4P A;  2E2H B;  3A0J A;  1VQ4 A;  4LFB L;  1XTD A;  1TS2 A;  4H13 C;  1A3U A;  2M2L A;  4K5W A;  1ILQ A;  4HCE A;  5LMN L;  1CT1 D;  1EOV A;  1Q12 A;  2UUA Q;  4JVZ A;  2R92 H;  2XTI A;  4PNY A;  5K36 G;  4F88 A;  3I2Z A;  4HN7 A;  4QY7 A;  3DMU A;  3C3L A;  3MEF A;  1SYE A;  4BBR H;  4JI0 Q;  3CQZ H;  4CDE C;  1AN8 A;  4YCW A;  1IHZ A;  3HFZ B;  4A3F H;  2JEA I;  4DAY B;  3NTK A;  3P1H A;  1T5E A;  2OTL A;  5JEA J;  2PCF B;  5KGU A;  3I91 A;  1B53 A;  1F9Q A;  4BXX G;  3E0E A;  1SNM A;  3Q22 A;  4LF4 L;  1KIX A;  3H94 A;  5IT9 L;  1I3Q H;  1SBB B;  3FP9 A;  1WTX A;  1H95 A;  5HGQ A;  3CPF A;  1WTP A;  1J8I A;  4FF4 A;  2F0M A;  4U67 3;  4N8F A;  1HRJ A;  3SK6 A;  4JI3 Q;  4PG3 A;  4CJ0 B;  1VQJ A;  5HY6 A;  2NUC A;  4DK6 C;  1JIC A;  3STB D;  3URY A;  1SSO A;  2WAQ B;  3RN5 A;  1NSN S;  1RTN A;  4Q0F A;  2CH4 W;  4JI7 L;  2YTX A;  1S4Z A;  5JJZ A;  2EJG C;  3SHL A;  5CMD A;  5EPJ A;  1VMP A;  3T53 B;  1O7Y A;  1SXT A;  1NUC A;  2RDF A;  2BH2 A;  2IHE A;  2UXB L;  2UUC L;  1CHP D;  2N88 A;  3PQI A;  4HJA A;  4L5R C;  3OSO A;  3AYH B;  4A3D B;  3BG3 A;  3GV6 A;  2ZXP A;  3T56 B;  2VQF L;  1GUT A;  1OTC A;  5C44 H;  2KVM A;  3QWN A;  5FLX L;  2YYZ A;  4H0L C;  5C3E H;  4JV5 L;  2K4K A;  4GKK Q;  1JJC B;  3HOV H;  4HMJ A;  3A74 A;  3QIA A;  2Z6K A;  3NXW A;  5BN3 A;  4NXM L;  4OIK A;  2NTS A;  3KLR A;  4A3G G;  1PTO C;  3UI2 A;  2ZJR A;  2RCN A;  4CJ2 C;  1BKB A;  1JJ2 A;  4A3J H;  2KEC A;  2HIV A;  1A62 A;  5C44 B;  3HOU G;  1PTO H;  3G4S A;  2F0G A;  5C5M A;  3ICE A;  1JCK B;  4B3M L;  4POG A;  4J6H A;  4QMG A;  3NE5 B;  2NZO A;  2XRQ D;  3ER0 A;  2B2V C;  3HS0 C;  1EYD A;  4O1N A;  1A63 A;  3FKI B;  1PYB A;  3C46 A;  2H5X A;  3PO3 H;  1CZG A;  1KAW A;  3KYH C;  3R3O A;  1HQM C;  3ULL A;  2AQ3 B;  2R93 G;  4BXX H;  1PLF A;  3CMA A;  3RZO B;  3K80 C;  3CXC A;  3HG9 A;  3I73 A;  2OCE A;  4OO1 I;  3CCE A;  4YHH Q;  4N9P A;  3KJP A;  5T1G A;  2OF1 A;  1J5E L;  4A3G B;  1D7Q A;  4X6A H;  4K6D A;  4YIJ A;  3BS1 A;  1TII D;  4KKS A;  4NXN Q;  1PRT B;  3GTQ H;  2O5I C;  4ILW A;  4EGV A;  1C8C A;  3HOU B;  1I4Q A;  2JA7 G;  1TR5 A;  3K7A H;  4JK1 C;  3IL8 A;  3J80 L;  2GVA A;  1E24 A;  3MWY W;  4G7Z C;  4C2M H;  1HNZ Q;  1HFG A;  1YIJ A;  4JPB W;  4HJ7 A;  1HUM A;  1D1K A;  2MO1 A;  2K7V A;  3E9I A;  4M1U B;  4KHP Q;  2OEO A;  4NW2 A;  4C3H B;  2Q2T A;  1CKN B;  3S15 B;  5JJK A;  3CAM A;  5FO8 B;  2RCF A;  3LNN A;  4BBR B;  2AQ1 B;  4MTN A;  4KK7 A;  1EY0 A;  3PO2 G;  4P71 A;  3D4R A;  4RGM A;  1SMY C;  1TWG B;  3IRB A;  1TWG H;  3GTJ B;  4G7O C;  2K5D A;  2FIN B;  1GM5 A;  5CR3 A;  5IP7 G;  4DAY A;  1LT3 D;  2DNC A;  5ISR A;  3FDT A;  3FPP A;  2KHI A;  2MFI A;  3VYU A;  1KHI A;  2Z9H A;  3S1N H;  2A8V A;  5IIF A;  2VQF Q;  1PZI D;  5C4H A;  1D5X C;  5IGC A;  4OHJ A;  1YJN A;  3KDF B;  2K33 A;  1BCP D;  4LF7 L;  2DY7 A;  1B2T A;  4B3S Q;  2K52 A;  2K5N A;  1RJT A;  3CC7 A;  1A2T A;  1EEI D;  4QIW E;  2F0V A;  2EYL A;  2WB1 E;  1EWC A;  3U50 C;  2VB3 X;  1PXU A;  1PTO F;  1MI2 A;  1A15 A;  1VQO A;  4YHH L;  1C4Q A;  1UAP A;  5E4X A;  1L0X B;  3BVG A;  1E3P A;  4X66 Q;  1HUN A;  2R7Z G;  3SK8 A;  2E5L L;  5IGF A;  3MAQ A;  1A0I A;  2LXJ A;  1I50 H;  4LUO A;  3CCU A;  1SNQ A;  2KCM A;  4IUV A;  4EQO A;  5KRU A;  2X69 A;  2CQO A;  2JYO A;  4XT1 B;  1ASY A;  5D14 A;  4ABN A;  2CQA A;  3BDL A;  2D9U A;  4L63 B;  4PZ8 A;  3RLF A;  1SYG A;  3GDE A;  5IGE A;  1KD1 C;  1CZW A;  2EY1 A;  1V8Q A;  4K8I A;  3F2D A;  1YNN C;  2L5T A;  3I4N B;  3BDO A;  1KDA A;  2JN4 A;  1SDF A;  1K8O A;  1FGB D;  4BBS H;  2RHQ B;  1IL8 A;  5IE8 A;  4GZY C;  1N32 Q;  5LMN Q;  3CC4 A;  1I4G A;  3EVQ A;  4FO2 A;  1EY6 A;  3M4O H;  3CRL C;  3HKZ G;  1EQR A;  3N6R A;  1BOS A;  1TU2 B;  4G4K A;  2HQL A;  2ZM6 L;  2JA6 G;  2Z1C A;  4JI6 L;  4P73 A;  1TWH B;  5IOD A;  1ICW A;  3MXN A;  4A3K G;  3T13 A;  2BCO A;  2VZA A;  1N9W A;  1BCP C;  1F2L A;  2RA4 A;  5A2Q E;  1LTB D;  2B2W C;  3F2B A;  2E74 C;  4DR7 Q;  3BYY B;  3HRZ C;  1HTP A;  5BR8 L;  5M3M G;  3I4N G;  2BE5 D;  2BH8 A;  4TRD A;  3E9H A;  3H09 A;  1ESF A;  5ELB A;  5IT9 c;  3MFG A;  2XWJ B;  2L1B A;  4P2C B;  1EIG A;  2WB1 B;  1LTG D;  2B2Y A;  3A8K E;  2LKV A;  4YCV A;  2HDM A;  4KJN A;  5FJ8 G;  1K0S A;  3HKZ B;  1I3Q B;  1WD0 A;  3U9S A;  2QDL A;  1Q1B A;  4LNQ A;  5DLQ E;  1EFI D;  1FD7 D;  5NUC A;  4HJ8 A;  4DV0 Q;  4OXP A;  1B3Q A;  4ZUJ A;  3SK4 A;  4JI6 Q;  3K58 A;  1FJG L;  2K01 A;  4JI2 Q;  1UE5 A;  4MHE A;  3PF5 A;  2PI2 A;  1DYQ A;  1PH1 A;  1X54 A;  2NVY H;  3OPO A;  3HOX G;  2L12 A;  1ZEQ X;  3TN2 A;  1TWH H;  1G6Z A;  2B63 G;  4QGU A;  1HHV A;  3L3O C;  5JOB A;  2A73 B;  1PHJ A;  2K14 A;  4L6T B;  4IUN A;  1LTI D;  1NBW A;  3HOX H;  4A93 H;  2IJ0 A;  1A8V A;  5JPM C;  1X3Q A;  5C4X G;  4QUF A;  4N8X 1;  2HHH L;  4LF8 L;  5E4W C;  1Y14 B;  1VQF A;  1GXD C;  1PFB A;  1B9N A;  4KD4 A;  2PI2 E;  1FNW A;  2VQE L;  2JK8 A;  1PV4 A;  2HUG A;  1UUP A;  3GTQ B;  2EXZ A;  2F3W A;  2J0T D;  5F2D A;  1GUW A;  2RSO A;  4GOP C;  4KHP L;  3H0G B;  2VXW A;  2PQA A;  5IGD A;  1PRT D;  2MO0 A;  4KV6 A;  1JWM D;  2JP1 A;  3RZD H;  1QZG A;  3HOX B;  1BF4 A;  2UUC Q;  1SEB D;  4O42 A;  1CQF A;  1SRO A;  4KKT A;  4X64 Q;  1NTG A;  1I6H B;  3A8I E;  1YNJ D;  3DWP A;  2K50 A;  1CKO A;  4OEL B;  4LF6 L;  3GTJ H;  1UE7 A;  4DV4 L;  1NR4 A;  5M5Y B;  1YZ6 A;  5C4X B;  4KY7 A;  5IOC A;  1BO0 A;  1WD1 A;  3QO2 A;  4Y52 H;  2AKW B;  5ELC A;  2HQE A;  3VR2 A;  4DV7 L;  1AZQ A;  2NB0 A;  2GVB A;  4CDD C;  4DR5 L;  2I5L X;  1PH7 A;  4Y7N B;  3GTK B;  2RDH A;  4RAU C;  3PIP 3;  4OON A;  3F8T A;  2EXD A;  3X3N A;  4GNX B;  1UEB A;  4AYB E;  4IO9 A;  5IY0 A;  4B3M Q;  3HOY G;  3NEM A;  2TMP A;  4AYB B;  2HIX A;  1V1P A;  1DCZ A;  3VR5 A;  2WKD A;  3K8A A;  2K05 A;  3GTO B;  2QEX A;  4DXF A;  2JSO A;  1TS4 A;  1HJP A;  3ND8 A;  4F87 A;  4L5Q A;  3PO3 G;  3ERS X;  4JI5 Q;  5C4X H;  4YCU A;  3WOE A;  1NMF A;  5CV5 A;  4DNT B;  3QB3 A;  4OEM B;  1RF2 D;  1WTV A;  1C48 A;  4WOR A;  3SR1 A;  4B3R L;  4F8M A;  2HT1 A;  1TWC H;  4IJL A;  1Y69 U;  1V1O A;  2C9O A;  4XDX A;  5BN5 A;  3S1R H;  1FYC A;  3MA2 B;  1CTM A;  4LK1 C;  4B3S L;  2KOL A;  1UE1 A;  1BVS A;  1WCM H;  1O7I A;  5JVG 3;  2X6L A;  3M4O B;  1NJI C;  1Z9F A;  2LFN A;  1X3G A;  5H1S E;  2EZV A;  5M3F H;  1WTW A;  3V05 A;  4FP5 D;  4LFC L;  1ZYR D;  3CME A;  2Q2H A;  1SN8 A;  2EYP A;  1HPC A;  4IFD H;  2QIL A;  1Y1W G;  4A93 G;  4WFN 3;  3TZU A;  1JB3 A;  4RGN A;  1LUZ A;  3BZD B;  1K73 C;  1BBX C;  1XMQ Q;  2B2W A;  2A6E D;  4DV2 L;  4BY7 B;  3LWU A;  3PUX A;  4FNF A;  2P5Z X;  4BA2 I;  1KRT A;  3G7L A;  3PIO 3;  2SDF A;  3KLW A;  1JWU D;  4DV3 Q;  3NTI A;  2PNH A;  2KHJ A;  4HTH A;  1HZA A;  3U58 A;  1N33 L;  4A3D H;  4F7X A;  1STB A;  1HNW Q;  1P8L A;  1KAA A;  1WJJ A;  4DFA A;  3C1F A;  1I50 B;  1ML0 D;  1SLJ A;  4IQZ A;  5I6Y A;  2B2V A;  2Y0S G;  1PMR A;  4JOI A;  1TQO A;  2BOS A;  1FNU A;  3A56 A;  3TP8 A;  4RCN A;  1XMO Q;  1PZK D;  1DXM A;  3CPW A;  1D1I A;  2NN6 G;  2Q8T A;  4DV3 L;  1VQM A;  1YHQ A;  3HOW G;  2JA6 H;  2F3I A;  1TT2 A;  4L8J A;  2JA8 H;  4BBS B;  1MGS A;  4ME5 A;  1EYC A;  3OWF A;  4DUY L;  3I4N H;  4LFB Q;  4YWM A;  2VNU D;  3SDZ A;  2DJF C;  4JOI C;  5M9O A;  1A2U A;  2B2U C;  4UHV A;  3TP5 A;  3GO5 A;  3H6M A;  1IBM L;  3NEL A;  1WCM B;  3J80 c;  1QVC A;  3JAM E;  1HH2 P;  5L37 A;  3MXU A;  4DNR B;  1YNX A;  3R2T A;  3VYR A;  1MD2 D;  3KLS X;  1VQP A;  2Z6B A;  3A7A B;  1PYS B;  4KHZ A;  1KLU D;  1RCV D;  5IYC G;  1JE4 A;  3W5O A;  4KY6 A;  1RIP A;  1JOO A;  2F0P A;  1KLG D;  4A3J G;  3VA7 A;  2R93 H;  5CV7 A;  3S2D H;  3CCM A;  1H9J A;  1IXR A;  3J81 c;  1HNX Q;  4JI1 L;  2D2C C;  2AMC B;  3BVZ A;  1EIF A;  5J22 A;  4BY1 B;  4NXM Q;  3PIO A;  2LXK A;  1X9N A;  1VQL A;  4EX5 A;  2CH4 A;  3DM1 A;  5EQ0 A;  1BUV T;  5KND A;  3F2C A;  1ROD A;  5GAH C;  4A3L H;  5EKI A;  1T9H A;  2RVL A;  2V1C C;  4DK0 A;  1BCP B;  5IT9 E;  2QF7 A;  1M1K C;  1X56 A;  5EBD A;  1M4V A;  2YU9 B;  1XPR A;  1STA A;  4DR5 Q;  4IPD A;  3CQZ B;  3RUZ A;  3HOY H;  1EQV A;  1EY5 A;  4HID A;  1W6J A;  2L0C A;  4GS3 A;  5FO7 B;  1V1Q A;  2E76 C;  1JC7 A;  2JA7 B;  1QCB D;  1VMC A;  2SEB D;  3M4Y A;  2BDO A;  2C35 B;  4UPA A;  4DV4 Q;  4V0B A;  5IP7 H;  4FYD A;  5IYB G;  3ERQ A;  5FOB B;  1Q81 C;  1B9M A;  5I6W A;  5IWA Q;  1GO3 E;  2KCN A;  3HOZ B;  4C3I G;  1DZ1 A;  1WFQ A;  3CCS A;  1JOK A;  3U4Z A;  1JT8 A;  2MHV A;  3ZYY X;  1QVG A;  3U9O A;  4RMF A;  3PO2 B;  2NVT B;  3NQT A;  5LL6 S;  1II3 A;  3M3Y B;  1UNS A;  5I9O A;  1C9O A;  2MUY A;  2B8G A;  3L0O A;  1WTO A;  3FHW A;  2A19 A;  2NZ1 D;  1A3T A;  1ET6 A;  4XQQ A;  1GOZ A;  3G48 A;  1DOM A;  4J15 A;  1WI5 A;  2EYF A;  4PMB A;  4IFD G;  1LT6 D;  2F4I A;  2AWN A;  3ULJ A;  4GLA C;  1EQQ A;  3NQI A;  3BDC A;  2Z8L A;  4P72 A;  2NVX H;  1H9M A;  3EN2 A;  5J3B A;  2WAQ G;  2F03 A;  1SNC A;  4DR1 L;  1QG7 A;  3I7F A;  5JVH 3;  3HOZ G;  3J7Z C;  4KI0 A;  1EU3 A;  1P16 A;  3G6E A;  2CVR A;  3PUV A;  1IW7 C;  3J80 i;  3S15 H;  2BA1 A;  2F0Q A;  5K5P A;  4Q5V A;  1EOT A;  1MBY A;  4LMQ D;  1W6K A;  1H9S A;  2AUK A;  2D0O A;  3PUY A;  1G2T A;  2FMM A;  2UXB Q;  2RBM A;  4XQN A;  2A6H D;  3HEJ A;  5JAV A;  1CHQ D;  2CW0 D;  3EA6 A;  2B8F A;  1SE8 A;  3Q23 A;  3R8B A;  3ZJY C;  2ZJQ A;  5AJ3 L;  3SK5 A;  1CSP A;  3J7Y W;  5C3E B;  1XPO A;  4RFB A;  3I56 A;  4TQU S;  1XMO L;  4A3C G;  4NDX A;  1XNR L;  4P75 A;  1PVO A;  3J81 i;  5EPL A;  3D8G A;  1K3B C;  2OWO A;  4TSS A;  2CW0 C;  4IFD J;  2OT2 A;  1VQH A;  3P20 A;  1SYB A;  4H7B A;  4U68 A;  4RKL A;  2ZXR A;  1WTR A;  4K14 A;  1XYI A;  2VY3 A;  4RCO A;  1AP0 A;  1V1P B;  3K5O A;  3CHB D;  5FK9 C;  2FFK B;  5GRO A;  3LWE A;  1IW7 D;  4ALP A;  5C5L A;  2WKC A;  4HJ5 A;  1O80 A;  1Y8N B;  2E2J H;  4JI0 L;  3VR3 A;  3QG1 A;  4GNX A;  1STG A;  3KDF A;  3HP3 A;  3NBI A;  2R61 A;  3MXP A;  1QJO A;  5EKK A;  2A1A A;  3D3R A;  3NEN A;  3HGB A;  4KTA A;  1BBW A;  2B3G A;  4CKC A;  1X3P A;  4AIM A;  2IX1 A;  1K28 A;  3FKI G;  1FJG Q;  4TKO B;  4OO1 H;  4UP7 A;  2EIF A;  4IPC A;  2BDN A;  3AFQ A;  3D4D A;  1HNX L;  1R4Q B;  1GVP A;  4UDU C;  1DOK A;  3L2P A;  2UXD L;  4LFA L;  1H9R A;  3CKI B;  1PDQ A;  3I72 A;  1IYJ B;  2IX0 A;  5FLX E;  3GTG H;  4DV1 L;  1VQG A;  4YWK A;  5J1Z A;  4DR6 L;  4ZCK A;  4JI4 L;  2A69 C;  5IYB H;  3T1H L;  1B4O A;  1ZKO A;  3PUZ A;  4LUV A;  3MEH A;  2O2L D;  4IFD I;  1TY0 A;  4NP5 A;  1R9T B;  3I4M H;  1Y1V H;  1PH3 A;  1S5D D;  2M00 A;  3NK9 A;  3OIP A;  4ID6 A;  1K8A C;  3S9W A;  3H0G H;  1T5X D;  5COR A;  2PMZ B;  4QL5 A;  3LGJ A;  3DLL A;  4A3M B;  1RD9 D;  2Q2I A;  2MPM A;  3A55 A;  4R4C A;  2K6A A;  4H44 C;  2ZJP A;  3D4W A;  5M3F B;  4LF9 Q;  5LMU Q;  4B3T Q;  2NVT H;  3S1N B;  3K59 A;  2K5W A;  2E75 C;  4A76 A;  4UP9 A;  1F9S A;  3SXH A;  1VS0 A;  2MNA A;  1EWH A;  1TWF H;  3S1R B;  3M7N A;  3R2I A;  4IUU A;  2EY5 A;  1XXG A;  1GJX A;  2R92 B;  1YBY A;  1X55 A;  1BNZ A;  2DY8 A;  3O13 A;  4GKJ L;  5LL6 X;  1Y8P B;  1WVL A;  1EY7 A;  2OQ0 A;  3TSS A;  4IUT A;  2NVY B;  1JR0 D;  5C3W A;  2EE1 A;  2YTY A;  3AQQ A;  3J81 L;  3H0G G;  1GUS A;  2PZT A;  1HFN A;  3OYY A;  4X64 L;  5EAY A;  1O78 A;  2NVQ H;  1S5E D;  2AQ2 B;  3TS0 A;  1VQ7 A;  3M7G A;  1TWF B;  5DM6 3;  4C3H H;  4JI7 Q;  1DD2 A;  3HOW H;  2L55 A;  2PNR C;  5AJ3 Q;  3S17 B;  3G6J B;  1EZ8 A;  2LS0 1;  3TDQ A;  1VQ6 A;  3Q24 A;  1E22 A;  3HOU H;  1ILP A;  1VQC A;  3AB9 A;  3K7A B;  1FR3 A;  3E0J A;  3HKS A;  4X65 L;  2R7Z B;  2NBF A;  2F52 A;  1Q82 C;  4A3M H;  4NB3 A;  3M4P A;  4KMU C;  3WDN A;  1EQT A;  2PO4 A;  1PH2 A;  1K83 H;  3QJY A;  1CFM A;  4RA8 A;  2EY2 A;  3RZO H;  1X3E A;  3MVV A;  1CQV A;  4HSP A;  1CSQ A;  3HOV G;  4CDF C;  1GUO A;  4I7A A;  4DKA C;  1IBK Q;  4JC0 A;  1Z47 A;  4DAV A;  1F2Z A;  1LAB A;  2SNM A;  4JI2 L;  3S2H H;  5D3D A;  2ICE C;  3GTP B;  2AUJ D;  4AYB G;  3W1G A;  5D3I B;  2NN6 I;  3ND9 A;  2CWA A;  2M9V A;  2A68 D;  2XGT A;  3PSI A;  4XTC S;  1NE3 A;  2HCI A;  1DOL A;  5JEA G;  4K0K Q;  3TBI B;  2K5Q A;  1PTO B;  2A68 C;  2ZTD A;  1L0W A;  5IYD H;  4MIU A;  4ZKC B;  1HR0 W;  4J8Q A;  4CGY B;  1I6V C;  1FL0 A;  2CWP A;  1HTL D;  2F0L A;  3TQY A;  1N34 L;  3I4L A;  3STB C;  2Z0S A;  4H02 A;  1LTS D;  1HXY D;  5CV6 A;  2KJX A;  1GUN A;  2LY7 A;  3HOV B;  4A3K H;  3DM3 A;  5EBC A;  4K5V A;  3VYS A;  1J9O A;  4DU9 A;  1PZJ D;  4JCV E;  4WJW A;  4DN4 M;  3D31 A;  3IFD A;  5LHY 1;  2E2J B;  1STH A;  4DR4 Q;  3U4V A;  2KCT A;  1Q3L A;  3FEW X;  4MN3 A;  3CP0 A;  2V4D A;  1R4P B;  2F0K A;  3FRP B;  1Y1W B;  4A3C H;  1U5K A;  4A3F G;  1U0L A;  1KNA A;  3PIP A;  1DON A;  1G51 A;  1SR3 A;  2QKI C;  4ZKB B;  4OIJ A;  5KNC A;  2J4X A;  4FVM A;  4IPH A;  3VYT A;  2Z4H A;  5ELO A;  3ITP A;  2JQO A;  4JBJ A;  4BY7 G;  3AMU A;  2YTV A;  2L4N A;  1Y1V G;  1DM0 B;  4DUY Q;  2F0I A;  2NN6 H;  5HUR A;  2L11 A;  3OMC A;  4BY7 H;  2XWB B;  5JJI A;  1BQQ T;  1U4R A;  3NPP A;  2R7D A;  1HZ9 A;  5ELN A;  5KIX A;  1IL2 A;  5I2Y A;  2FMC A;  3N52 A;  5GQO A;  2A74 C;  2G9D A;  2Y0S B;  1EYA A;  4OWT B;  4LW1 A;  1NCV A;  1LM0 A;  2KHS A;  2K03 A;  4C56 C;  2ZT9 C;  2B63 B;  2RQX A;  1N33 Q;  3HOW B;  5C4Z A;  3WOF A;  4A3F B;  3K0X A;  3CCQ A;  4E6I A;  4JBM A;  2NVQ B;  4EVO A;  4L5S A;  5CV9 A;  2Z6K C;  2E5L Q;  3PGZ A;  1SE4 A;  1CKN A;  1IZ6 A;  1F9P A;  4QCL A;  1EIY B;  2G9H D;  2XNA C;  3CCR A;  1B50 A;  1CM9 A;  1Y1W H;  3W1B A;  3TEH B;  4LF9 L;  1YEZ A;  2F0O A;  4XXE A;  5JJL A;  1MKH A;  4NPS A;  1K9M C;  1VF7 A;  2UUA L;  1AZP A;  3ERO A;  4PQX A;  5IYD G;  4DNI A;  4HR7 B;  3EQL C;  5CBE E;  5C4J H;  1I94 L;  1XNQ Q;  3B6Y A;  3NUC A;  4MNO A;  1YNN D;  4LAA A;  4KD3 A;  2A6H C;  1D8L A;  2RHS B;  2F0E A;  3MXG A;  3IAY A;  1KTK A;  2X6G A;  3DWA A;  2Y0S E;  4LF5 L;  3DHQ A;  4APV A;  3I4M G;  1E2W A;  1RHP A;  4KLK A;  1IBM Q;  1L1O B;  2A69 D;  5IP9 G;  3UDI A;  5EPK A;  2F0N A;  3OTO L;  2JXM B;  1LTL A;  2BA0 A;  3PMF A;  1AW7 A;  1HA6 A;  4YWL A;  1MIU A;  1D5M C;  2ASB A;  3PCO B;  3PO2 H;  3NBH A;  2JA5 B;  3HKZ E;  1R9T H;  1LYL A;  1KNE A;  4R1J A;  1AE2 A;  4BWG B;  3K5M A;  3BVM A;  3Q0A A;  3K57 A;  3PO3 B;  4O0A A;  2I5M X;  1A6X A;  5COY A;  1DJR D;  3TZD A;  4JI1 Q;  1BCP F;  3GTG B;  1HCZ A;  4PMC A;  3HOY B;  1SYC A;  1CK1 A;  1EL0 A;  2BE5 C;  2F0W A;  3KF6 A;  1ZXT A;  3K0Y A;  4B9W A;  3I8Z A; 
#chains in the Genus database with same CATH homology
 2ZM6 Q;  4RMF A;  3S1N H;  1Q7Y C;  2A8V A;  1YHB A;  2VQF Q;  1DGS A;  1AH9 A;  1YJN A;  3KDF B;  3OW2 A;  1C9O A;  4C3I H;  4HIO A;  4LF7 L;  4DV5 L;  3L0O A;  4JI8 L;  3FHW A;  2A19 A;  3BZK A;  4DV0 L;  4B3S Q;  2K52 A;  1HNW L;  2N8N A;  2K5N A;  3CC7 A;  3G48 A;  1QVF A;  1MJE A;  4OX9 L;  2K5H A;  4J15 A;  1WI5 A;  4O2D A;  4QIW E;  1G6P A;  4IFD G;  2WB1 E;  3U50 C;  5LMN W;  2AWN A;  3ULJ A;  1SFO H;  1W3S A;  4GLA C;  4DV5 Q;  1VQO A;  2WP8 J;  5FLM G;  4YHH L;  1EQQ A;  3UE1 A;  4LF7 Q;  4UY8 C;  1N36 L;  4P72 A;  1E3P A;  1FGU A;  4X66 Q;  2NVX H;  1WYD A;  3NBH B;  4A3I G;  2WFW A;  2IT1 A;  4JI3 L;  2R7Z G;  3EN2 A;  5J3B A;  2WAQ G;  2E5L L;  1A0I A;  2LXJ A;  4DR1 L;  3I7F A;  3HOZ G;  1I50 H;  4DK3 C;  1C7Y A;  4JV5 Q;  1TWA H;  3J7Z C;  4LUO A;  3CCU A;  4KI0 A;  3A5U A;  1VQ8 A;  1P16 A;  2KCM A;  3G6E A;  4ME3 A;  2AHO B;  2CQO A;  2IY5 B;  3PUV A;  1ASY A;  2JA5 H;  3J80 i;  3S15 H;  2BA1 A;  1OXX K;  3GTM H;  4X66 L;  4DUZ L;  4A3L G;  1VQK A;  2HHH Q;  2B63 H;  4PZ8 A;  3RLF A;  1M90 C;  3A5Z B;  2ZTE A;  5IP9 H;  1KXL A;  3GDE A;  1KD1 C;  1Q46 A;  1JE5 A;  2D0O A;  3PUY A;  3S24 A;  3KFU A;  4K0K L;  3RLN A;  3CCJ A;  2UXB Q;  5GAG C;  3F2D A;  2F4V L;  3UDX A;  1VQB A;  1SE8 A;  2RF4 A;  3ZJY C;  3Q8D A;  2ZJQ A;  2PQA B;  5AJ3 L;  4BBS H;  1CSP A;  2RHQ B;  3CF5 A;  3T1H Q;  3S16 H;  2I0Q A;  1N32 Q;  1HZB A;  4A3G H;  3VDY A;  2B29 A;  5IE8 A;  1K8G A;  2WAQ E;  3KF8 B;  1XPO A;  1X65 A;  4TQU S;  4X62 L;  3I56 A;  5LMN Q;  1L1O A;  1XMO L;  3CC4 A;  1BBU A;  3S14 H;  4DR3 Q;  5IWA L;  1XNR L;  4A3C G;  4P75 A;  4OWW B;  4JBK A;  3J81 i;  3I55 A;  1PVO A;  3M4O H;  3HKZ G;  1EQR A;  2NZH A;  3OTO Q;  2HQL A;  2ZM6 L;  2OWO A;  2JA6 G;  4IFD J;  4JI6 L;  3S1Q H;  3UDG A;  1VQH A;  3BJU A;  3JC6 6;  4LWC A;  4P73 A;  3K81 C;  4GLX A;  1YJW A;  1HR0 Q;  1E1T A;  4A3K G;  4DV6 Q;  4LF4 Q;  2VZA A;  1N9W A;  4EQ5 A;  3KJO A;  4QQB X;  2VY3 A;  1NMG A;  1SRU A;  4JI8 Q;  1EYG A;  3KF6 B;  2N49 A;  2VUM H;  1W2B A;  5GRO A;  3F2B A;  2Q2U A;  4ALP A;  4DR7 Q;  3G71 A;  4HJ5 A;  5BR8 L;  1WCM G;  2E2J H;  4A4I A;  3D0F A;  5M3M G;  4JI0 L;  3I4N G;  2BH8 A;  3RNU A;  3E9H A;  5IT9 c;  5FLM H;  4GNX A;  4B3R Q;  3KDF A;  1B7Y B;  1VCI A;  2JA8 G;  2A1A A;  5M5X H;  5GAD C;  1VQ5 A;  3NEN A;  5FLX c;  3PF4 A;  1BBW A;  2B3G A;  4R4I A;  2R6G A;  1HNZ L;  4YCV A;  1UE6 A;  4AIM A;  2PMZ E;  3ULP A;  4MZ9 A;  2IX1 A;  5FJ8 G;  3FKI G;  1FJG Q;  1VQL A;  4UP7 A;  2EIF A;  4IPC A;  1KRS A;  4R4O A;  3AFQ A;  4BA1 I;  1Q1B A;  1I94 Q;  1HNX L;  4LNQ A;  5DLQ E;  1XNQ L;  1CKM A;  1VQA A;  1GVP A;  3L7Z C;  4GLV B;  1I5F A;  4NXN L;  3GD7 A;  4HJ8 A;  3KOJ A;  4DV0 Q;  4OXP A;  4GN4 B;  2E2I H;  1J5E Q;  4JI6 Q;  3L2P A;  3TRZ A;  2UXD L;  4BBS G;  1AE3 A;  2UU9 L;  4LFA L;  2K5V A;  1FJG L;  4WJ4 A;  1IYJ B;  4JI2 Q;  1EUJ A;  2IX0 A;  3GTG H;  2L15 A;  2GN5 A;  1UE5 A;  2FXQ A;  3UDF A;  1FVI A;  1VQG A;  2PI2 A;  3F1Z A;  4YWK A;  3H15 A;  4DV1 L;  4A3I H;  1X54 A;  1PH6 A;  4DV2 Q;  1PH1 A;  1L2F A;  1VQE A;  2CKZ B;  4IJH A;  4A3D G;  2NVY H;  4JI4 L;  4GKK L;  1G29 1;  3HOX G;  1N36 Q;  4OWX B;  5IYB H;  3T1H L;  4A3E G;  1TWH H;  3PUZ A;  2UXD Q;  4LUV A;  2B63 G;  2JA7 H;  4DPG A;  4QGU A;  4GNX C;  4IFD I;  4DR1 Q;  5BR8 Q;  4P74 A;  3CW2 C;  1E1O A;  2IHF A;  2K14 A;  1PHJ A;  5C0X J;  3I4M H;  2E2H H;  3K7U C;  3M9B A;  4DV1 Q;  3RN2 A;  1Y1V H;  3M4Q A;  1NBW A;  3HOX H;  3T1Y Q;  1PH3 A;  3GTO H;  4A93 H;  1A8V A;  2D0P A;  5C4X G;  4HJ9 A;  1K8A C;  1VQ9 A;  1C0A A;  3MXN B;  2HHH L;  3H0G H;  4PZ6 A;  4LF8 L;  3SGI A;  1Y14 B;  5M5W H;  2JA5 G;  2VL6 A;  4QL5 A;  3LGJ A;  1PA6 A;  1VQD A;  1X6O A;  1VQF A;  2EQS A;  3I4O A;  3RLO A;  3DLL A;  2Q2I A;  1PH9 A;  4YY3 Q;  1Q8K A;  1Q1E A;  4R4C A;  2PI2 E;  2VQE L;  2ZJP A;  2JK8 A;  3TRE A;  1PV4 A;  4LF9 Q;  3RR5 A;  5LMU Q;  4B3T Q;  1VQI A;  2VS1 A;  4X65 Q;  2NVT H;  2K75 A;  3GTK H;  1Q86 C;  4GOP C;  1XPU A;  2VUM G;  4KHP L;  4JYA Q;  2CFM A;  3WWV A;  4A76 A;  4UP9 A;  4DR7 L;  4Y7N H;  4X62 Q;  2PQA A;  1NY4 A;  1VS0 A;  2MNA A;  1TWF H;  5C0X G;  1QUQ A;  2MO0 A;  1HZC A;  4L5T A;  4LFA Q;  2UU9 Q;  3RZD H;  1QZG A;  2VQE Q;  3M7N A;  1OXT A;  2ES2 A;  1QUQ B;  4YY3 L;  2UUC Q;  4JBW A;  2D62 A;  3AEV A;  1SMX A;  1SRO A;  1RL2 A;  5M5Y H;  1NTG A;  1X55 A;  1YBY A;  4X64 Q;  4GKJ L;  1UWV A;  1QZH A;  2K50 A;  1CKO A;  5E7N A;  2OQ0 A;  2JEB I;  4LF6 L;  3GTJ H;  4GOP A;  4PMW A;  2YTY A;  3AQQ A;  1UE7 A;  4DV4 L;  1JJG A;  1YZ6 A;  3H0G G;  1KQS A;  1J6Q A;  3T1Y L;  4A75 A;  4BY1 G;  3OYY A;  4X64 L;  2JJQ A;  5EAY A;  4HIM A;  4XIG S;  1EFW A;  1OXU A;  2NVQ H;  4Y52 H;  3TS0 A;  4IPG A;  1PFS A;  2AKW B;  1VQ7 A;  4C3H H;  4GN3 B;  1YVC A;  4DV7 L;  2GVB A;  5AJ3 Q;  4DR5 L;  1PH7 A;  2I5L X;  3CC2 A;  4JI7 Q;  3HOW H;  1VQ6 A;  4A3B G;  2UUB L;  1JB7 A;  2E8G A;  1WOC A;  4OON A;  3F8T A;  1N8R C;  2AWO A;  2EXD A;  2ZTC A;  1E22 A;  4LFC Q;  3HOU H;  4GNX B;  1UEB A;  3TS2 A;  1N32 L;  1VQC A;  1CUK A;  3EBE A;  1ASZ A;  3HKS A;  4AYB E;  4X65 L;  4IO9 A;  1IBL L;  5LMU L;  4B3T L;  4A3E H;  5IY0 A;  3PUW A;  2F52 A;  4B3M Q;  4DUZ Q;  1Q82 C;  3HOY G;  4A3M H;  4NB3 A;  3M4P A;  3NEM A;  3S17 H;  1VQN A;  2HIX A;  1PH2 A;  4BY1 H;  1K83 H;  1HR0 L;  3K8A A;  4LF5 Q;  2QGQ A;  3J81 j;  2F4V Q;  4DAM A;  2QEX A;  1PH4 A;  3HOZ H;  3RZO H;  1X3E A;  1XJV A;  1HJP A;  1GD7 A;  4IOC A;  5C3E G;  4L5Q A;  1IBL Q;  3CCL A;  3PO3 G;  3ERS X;  1CSQ A;  4JI5 Q;  5C4X H;  3HOV G;  3A0J A;  1S3O A;  4YCU A;  1VQ4 A;  1L1O C;  1NMF A;  1V9P A;  1XTD A;  2DUD A;  4DKA C;  3PF5 A;  4LFB L;  1IBK Q;  2UXC Q;  4JC0 A;  5LMN L;  1Z47 A;  5GAE C;  1B70 B;  1EOV A;  3FKI H;  1Q12 A;  3AFP A;  2UUA Q;  4JI2 L;  1GKH A;  2R92 H;  2XTI A;  3S2H H;  5K36 G;  4B3R L;  2HT1 A;  4WJ3 M;  3I2Z A;  1OXV A;  4QY7 A;  4POF A;  4AYB G;  1TWC H;  2JA9 A;  3W1G A;  3MEF A;  4IJL A;  4BBR H;  1PH5 A;  4JI0 Q;  3CQZ H;  2NN6 I;  1MJC A;  2CWA A;  4YCW A;  3EIV A;  2XGT A;  2QA4 A;  3S1R H;  3HFZ B;  3PSI A;  4A3F H;  4XTC S;  2YU9 H;  4DAY B;  5M3M H;  2JEA I;  1NE3 A;  4B3S L;  3JAM c;  4DR6 L;  5JEA G;  1UE1 A;  2OTL A;  1BVS A;  1WCM H;  1O7I A;  3J7A 5;  4K0K Q;  5JEA J;  1NJI C;  1Z9F A;  2DGY A;  1X3G A;  2ZTD A;  5H1S E;  1L0W A;  4BXX G;  3E0E A;  5IYD H;  4LF4 L;  5M3F H;  1HR0 W;  1KIX A;  4LFC L;  3CME A;  1FL0 A;  2CWP A;  1SN8 A;  2Q2H A;  1I3Q H;  3TQY A;  1N34 L;  3FP9 A;  3M85 A;  1Y1W G;  4A93 G;  5HGQ A;  3STB C;  1H95 A;  3CPF A;  1X3F A;  2Z0S A;  4H02 A;  3H3V H;  1LUZ A;  4PZ7 A;  1S72 A;  4AH6 A;  1K73 C;  1XMQ Q;  4A3K H;  3DM3 A;  4DV2 L;  4JI3 Q;  4PG3 A;  4DR3 L;  1VQJ A;  1S40 A;  5HY6 A;  2UXC L;  4JCV E;  3D31 A;  4DK6 C;  3PUX A;  3STB D;  3H3V I;  4BA2 I;  2CCZ A;  4JI5 L;  3RN5 A;  1YHA A;  1KRT A;  1TXY A;  4JI7 L;  2YTX A;  4DR4 Q;  3KLW A;  3U4V A;  2KCT A;  4DV3 Q;  4IOA A;  2PNH A;  2KHJ A;  3CP0 A;  1HZA A;  4DV6 L;  3U58 A;  1N33 L;  4A3D H;  4AQY L;  4A3C H;  1U5K A;  4A3F G;  2BH2 A;  1HNW Q;  1KL9 A;  1U0L A;  1P8L A;  2IHE A;  3PIP A;  1G51 A;  1SR3 A;  2UUC L;  1WJJ A;  3GTP H;  2UXB L;  1SLJ A;  4IPH A;  5ELO A;  4JBJ A;  2JQO A;  2Y0S G;  4LF6 Q;  4BY7 G;  4HJA A;  4L5R C;  2YTV A;  3AYH B;  4JOI A;  5JJL A;  1Y1V G;  4DUY Q;  1XMO Q;  3CPW A;  2VQF L;  2NN6 G;  1OTC A;  5C44 G;  4DV3 L;  5C44 H;  4OO1 G;  1VQM A;  4BY7 H;  1YHQ A;  5JJI A;  3HOW G;  2JA6 H;  2F3I A;  2YYZ A;  5C3E H;  4JV5 L;  2R7D A;  2K4K A;  4JI4 Q;  2JA8 H;  4GKK Q;  1JJC B;  1HZ9 A;  3HOV H;  1XNR Q;  3A74 A;  2I5H A;  5ELN A;  1IL2 A;  4DUY L;  2Z6K A;  3I4N H;  5GQO A;  4NXM L;  4LFB Q;  4OWT B;  2R7Z H;  4YWM A;  2VNU D;  4A3G G;  4JOI C;  2N78 A;  2ZJR A;  4LW1 A;  1KC8 C;  2RCN A;  3CD6 A;  3BZC A;  4A3M G;  1BKB A;  1LM0 A;  3GO5 A;  1IBM L;  1JJ2 A;  4A3J H;  3NEL A;  2HIV A;  1A62 A;  2OQK A;  1QVC A;  3J80 c;  1HH2 P;  2ATW A;  4RG1 A;  3HOU G;  1K0R A;  3G4S A;  1N33 Q;  4LF8 Q;  3ICE A;  1YNX A;  4GN5 A;  3BU2 A;  3K0X A;  5IYC H;  3CCQ A;  4GOP B;  4B3M L;  4POG A;  4JBM A;  2NZO A;  4L5S A;  2WB1 G;  3ER0 A;  1VQP A;  2Z6K C;  1EWI A;  2E5L Q;  3PGZ A;  4DR6 Q;  1CKN A;  1IZ6 A;  1PYS B;  3S1M H;  1EIY B;  4KHZ A;  4R4Q A;  1A63 A;  5IYC G;  3CCR A;  1PYB A;  3W5O A;  2H5X A;  1Y1W H;  3PO3 H;  3W1B A;  3KYH C;  1KAW A;  1RIP A;  3TEH B;  4LF9 L;  1YEZ A;  2R7F A;  1I6H H;  1K3R A;  3ULL A;  4A3J G;  1MKH A;  4NPS A;  1K9M C;  2UUA L;  1N34 Q;  2R93 G;  3PV0 A;  5M3F G;  2R93 H;  5IYD G;  4BXX H;  2ID0 A;  4FDB A;  4DR2 Q;  3CMA A;  4DNI A;  3CCM A;  3K80 C;  4OX9 Q;  3S2D H;  1IXR A;  3J81 c;  3CXC A;  1I94 L;  4TVA B;  4JI1 L;  5C4J H;  1HNX Q;  3B6Y A;  4MNO A;  1XNQ Q;  2AMC B;  2OCE A;  4OO1 I;  3CCE A;  4YHH Q;  1EIF A;  1D8L A;  3KJP A;  2RHS B;  1D7Q A;  1J5E L;  4X6A H;  4NXM Q;  4GKJ Q;  2Y0S E;  3PIO A;  4BBR G;  4LF5 L;  4NXN Q;  2LXK A;  1X9N A;  4JG2 A;  4APV A;  4EX5 A;  1B8A A;  2ALY B;  4DR2 L;  4AQY Q;  1JMC A;  3GTQ H;  3I4M G;  4KLK A;  1IBM Q;  1L1O B;  2R92 G;  5IP9 G;  3F2C A;  3M3Y H;  2JA7 G;  3UDI A;  5GAH C;  3K7A H;  1V43 A;  2GVA A;  4A3L H;  4DV7 Q;  1E24 A;  1PH8 A;  1T9H A;  3OTO L;  2V1C C;  3GTL H;  4C2M H;  1LTL A;  2BA0 A;  2N3S A;  1HNZ Q;  1YIJ A;  4YWL A;  4HJ7 A;  1MIU A;  2JE6 I;  2MO1 A;  3E9I A;  1IBK L;  4LUZ A;  3PCO B;  2ASB A;  1M1K C;  3PO2 H;  2UUB Q;  1X56 A;  4KHP Q;  1XMQ L;  3JAM i;  2LSS A;  2Q2T A;  2OTJ A;  1CKN B;  3UE0 A;  1XPR A;  2KBN A;  4DR5 Q;  5JJK A;  4IPD A;  3CAM A;  2YV5 A;  4MTN A;  1E7Z A;  3HKZ E;  3HOY H;  4HID A;  1R9T H;  1LYL A;  5C0X I;  1YI2 A;  3PO2 G;  4GS3 A;  4P71 A;  2MQH A;  1V1Q A;  1AE2 A;  4R1J A;  3IRB A;  4C3J H;  3CCV A;  1TWG H;  4QJF A;  4R4T A;  4UPA A;  4DV4 Q;  2C35 B;  4DR4 L;  1GM5 A;  5IP7 G;  4O0A A;  5IP7 H;  2I5M X;  5FJ8 H;  4A3B H;  5IYB G;  4UP8 A;  2KEN A;  1Q81 C;  4JI1 Q;  5IWA Q;  1GO3 E;  4JYA L;  1YJ9 A;  2KHI A;  2VW9 A;  4HIK A;  2MFI A;  1WFQ A;  3KF6 A;  3CCS A;  3U4Z A;  1JT8 A;  1OXS C;  1KHI A;  1QVG A;  1YIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...