2K5NA

Solution nmr structure of the n-terminal domain of protein eca1580 from erwinia carotovora, northeast structural genomics consortium target ewr156a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cold-shock protein
publication title NMR Structure of the Putative Cold Shock Protein from Erwinia carotovora: Northeast Structural Genomics Consortium Target EwR156a
rcsb
source organism Pectobacterium atrosepticum
molecule tags Structural genomics, unknown function
total genus 13
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5nA00
1SLJA 4JI6L 2HIXA 1WFQA 5C44H 4A3JG 1SFOH 4GLAC 1NBWA 1GKHA 1G291 3NENA 1K8GA 3OTOL 1J5EQ 2GN5A 3PO2G 1EIFA 2CQOA 2QEXA 4JI0L 5IP9G 5JEAJ 5ELOA 1PH7A 1Z9FA 4YCVA 3RN2A 5FLXc 3CC2A 2A1AA 1WOCA 2NZOA 5GROA 2JA5G 2JE6I 3HOWH 4MZ9A 5C3EH 2UU9L 1C7YA 1QVCA 1TWCH 1BVSA 2YTVA 1HNZQ 3GTKH 1QZGA 2YTYA 4EQ5A 2VQFQ 2E2JH 1Q1BA 1VQGA 2XTIA 2E2HH 2ZTCA 2GVBA 4IO9A 3GTQH 4DR1Q 1HJPA 3I55A 4A3GG 1X65A 3L7ZC 3UDIA 4DR3Q 1KAWA 5C0XI 4QL5A 2I0QA 1JJ2A 2KENA 2RCNA 3GTOH 4UP7A 2E5LL 3PO2H 3E9IA 1Y1WG 4YWLA 3E0EA 4TVAB 1U5KA 1G51A 4HJ9A 5HY6A 2HHHL 4OWXB 3FKIG 2Z6KA 4GS3A 4HJAA 2A8VA 4MNOA 1X9NA 4LF7Q 2R92G 2WAQG 3F8TA 3CQZH 1K9MC 2JK8A 1AH9A 5IY0A 2NVYH 3W5OA 1JE5A 3S24A 4DPGA 2ID0A 4UP9A 4JI7Q 1HZCA 3TRZA 4DAYB 3H3VH 4KLKA 5LMUL 3CC7A 4BBSG 4JV5L 1TWGH 4A3BG 4KHPQ 4LUVA 1NJIC 1VQIA 3CCJA 1XTDA 5H1SE 4GOPC 4L5TA 4RMFA 4DV3L 1MJCA 2ZTEA 4OX9Q 3KJOA 2F3IA 3F2CA 2QA4A 4IOCA 4DR4L 4FDBA 1X3EA 2AHOB 1M90C 4B3MQ 5IP7G 4O2DA 1N34Q 3T1YQ 1MJEA 4DNIA 1VQOA 4LF5L 5M3MG 4DV7L 1N33Q 3CCRA 3TS0A 3F2BA 1OXTA 3CP0A 2UXCQ 3PV0A 4IPDA 3S1RH 1S72A 1IBKL 2VW9A 3CD6A 3M3YH 2V1CC 2PI2A 5AJ3L 3HOUH 5EAYA 1RIPA 2EIFA 1PVOA 4OWTB 5GADC 4OX9L 1V9PA 1V43A 2VY3A 2K5HA 1YHQA 5BR8Q 3T1HL 2OWOA 3S14H 1FVIA 2Q2UA 2ATWA 1CKMA 4B3SQ 3G4SA 3PF4A 3TS2A 1PH6A 2GVAA 3HOVG 1VQ4A 3H3VI 1FGUA 2Q2TA 3S1NH 1VQFA 1YHBA 1EIYB 1PA6A 1E1TA 5C4XH 3MXNB 3PUYA 3PF5A 2JA6G 4DR7L 3H0GG 4BXXH 3K7UC 4JI2Q 1XMQQ 1OXXK 1H95A 4C2MH 3PO3G 4PZ6A 4OO1I 2VS1A 4C3JH 5BR8L 2R7ZG 3M7NA 3K8AA 4IPHA 4R4QA 5GAHC 3K0XA 4XTCS 2IHEA 2F4VQ 2Q2IA 2PNHA 2NN6I 4R1JA 1NMGA 2ZJRA 4LF6Q 1SE8A 4JI3L 4BY7G 2MQHA 2YV5A 4ALPA 4DV0L 4GKKQ 1YJ9A 4JOIA 2F52A 3U58A 3F2DA 3J80c 4A3LG 4UP8A 2NVXH 4GKJL 3Q8DA 5FLMG 3HOXG 1VQPA 3HOYG 1HH2P 3H0GH 4LF8Q 1HZ9A 2YYZA 4WJ3M 3PO3H 2VUMH 4DV5L 2CWPA 3FHWA 4A3FG 2D0OA 5GAEC 1VQEA 2HQLA 4A3IH 1YJNA 4IFDJ 4JBMA 3A5UA 3W1GA 4JI1L 3CW2C 2LSSA 4LF9L 2MO0A 4DK6C 4LUOA 1JT8A 4X64L 4BY1G 4JCVE 4JI0Q 2ZJQA 2I5LX 3J81c 4A3CG 1IL2A 1VS0A 3I4OA 4HJ5A 5LMNL 2VL6A 4A4IA 4X65L 1BBWA 1NMFA 2UU9Q 3CPWA 4JBKA 3CPFA 5C4JH 3BJUA 1EUJA 1OXUA 3UDFA 1J6QA 4JG2A 3CAMA 3ZJYC 2ZM6L 1EOVA 4JBWA 2R7DA 2ALYB 4P74A 3I56A 1E1OA 1Q82C 2I5MX 2D62A 2A19A 4BBRG 1Y1VH 1B70B 4X6AH 3RLFA 4POGA 2YU9H 3L2PA 3UE0A 1EQQA 4Y52H 4YCWA 2E5LQ 4JYAL 1Q86C 3J81j 3I4MG 1SMXA 3W1BA 1E3PA 3MEFA 1VQMA 3D31A 2N78A 1IBML 5M3FH 1VQ6A 2HHHQ 1IBLL 3ULLA 3GTJH 1O7IA 4L5QA 1HZBA 1GO3E 1SN8A 1Z47A 3KFUA 3NEMA 4J15A 4A3JH 4NPSA 2ES2A 1FJGL 4QQBX 2D0PA 3SGIA 3CCSA 1Q8KA 4UPAA 4JV5Q 4BBRH 5LMUQ 1XMOL 1CSPA 5IP9H 1KHIA 1BKBA 3KOJA 4GNXA 3CCQA 4QY7A 2JA5H 1VQLA 1IYJB 1PH4A 4DV3Q 3BU2A 1VQKA 2CFMA 4OONA 3S17H 1L1OB 4DR4Q 2NVTH 3AFPA 4LFBL 2OTLA 4LF5Q 4DV6L 4DV7Q 3VDYA 1L1OA 3ERSX 4A3EG 4A3GH 4LFAL 2VQEQ 4JI5L 3GTPH 5C0XJ 1NE3A 1TWAH 1R9TH 1IBKQ 2UUBL 2EXDA 1TWHH 1S3OA 3PGZA 5AJ3Q 3JAMi 1Y1WH 2B63G 4BA2I 3CF5A 4B3RL 1PH2A 1N9WA 3HKZG 2UUCL 2CWAA 2DUDA 4RG1A 5IYBG 3IRBA 3T1HQ 1AE2A 1N32L 2VNUD 4IFDG 3M85A 1K8AC 3FKIH 4H02A 1VQBA 4LNQA 3S2HH 2N8NA 4JBJA 2R92H 3TQYA 3K81C 1Q1EA 2K50A 4R4CA 2IX0A 3PUVA 3M4PA 4YWMA 5HGQA 2KCMA 2VQEL 4GLXA 1ASZA 4AYBE 4DR7Q 2OQKA 4YWKA 4IOAA 2RF4A 1KL9A 1WI5A 1LUZA 4Y7NH 4DV1L 1QVGA 4JI4L 2E2IH 4BBSH 3HOZG 4A3BH 5IWAL 1SROA 4IJHA 2OQ0A 2Y0SE 2ZTDA 5J3BA 3UDXA 1L2FA 4AQYL 3RZDH 2UXDL 4P75A 5JJIA 4HJ7A 4DAMA 2RHQB 4B3TL 5IP7H 4X62L 4JI3Q 1VQ5A 3CCUA 2QGQA 4YHHL 4DV0Q 4P72A 3RNUA 1QVFA 5M3MH 5JEAG 5IYDG 1XNQL 3PCOB 2VZAA 4KI0A 4DR2Q 1KD1C 2OTJA 2ZJPA 4GKJQ 1HR0L 1KIXA 1A0IA 3PSIA 4GLVB 3CCVA 2LXKA 1I3QH 4P71A 3I2ZA 2NZHA 1XPUA 2BH2A 1W2BA 1CKOA 4DV5Q 4HJ8A 1CKNB 3RN5A 4WJ4A 5LMNW 1VQJA 1XNRL 1A63A 3PUWA 3DLLA 4LUZA 2HIVA 1KXLA 3GO5A 2IY5B 2AMCB 3HOVH 1CKNA 1LM0A 1PH9A 4JI1Q 1B7YB 4LF9Q 1WYDA 4DR2L 4DUYQ 2R93G 3D0FA 3KLWA 3CXCA 4BA1I 4X64Q 2JA6H 2UXBL 1LTLA 4DV2Q 4PZ7A 4GOPA 4QIWE 3KDFA 1ASYA 2ASBA 2KHJA 1NTGA 4NXNL 5LMNQ 1N36L 4K0KL 4X65Q 1W3SA 1PH3A 1LYLA 3CCMA 3KF6A 1NY4A 3CCEA 4QJFA 1YI2A 1JB7A 2R7ZH 1GVPA 4C3IH 1WJJA 2ZM6Q 2IX1A 3GTGH 4YY3L 4HIOA 2BA0A 3JC66 3GDEA 1A8VA 1YNXA 4BY7H 4DUYL 1PYSB 4XIGS 4MTNA 1N8RC 4DV2L 5C0XG 2HT1A 2CCZA 4A3LH 2R93H 2CKZB 3KJPA 1EQRA 2I5HA 3ER0A 1BBUA 1L0WA 5FJ8G 5FLMH 3HOXH 4LF4L 3HOYH 4JYAQ 2K4KA 2WFWA 4DK3C 1IBMQ 1JJGA 2WAQE 5C44G 4R4OA 1VQCA 3BZCA 5ELNA 1IBLQ 4GN3B 2JEAI 4A3FH 1XJVA 2OCEA 4ME3A 2Z6KC 3CC4A 2H5XA 3AFQA 4DUZL 1FJGQ 1K0RA 3K7AH 3CMEA 1EYGA 3HOWG 1YVCA 2UUAQ 4L5SA 3S1QH 1PYBA 2DGYA 1XMOQ 3CCLA 1RL2A 4BY1H 4A3CH 3A5ZB 3EN2A 4X66L 2K14A 2PQAA 1M1KC 3U50C 1HNWL 3A0JA 5M5YH 1QUQA 1XPOA 2K52A 1VQAA 3RLOA 4IPCA 1EFWA 2NVQH 3RZOH 4LFBQ 2IT1A 4JI8L 3M9BA 4JC0A 4R4IA 4AIMA 5IE8A 2MNAA 1HNXL 4GNXB 1SRUA 3PUZA 4DV6Q 4DR5L 1Q7YC 1PH8A 3GTMH 2UUAL 4LFAQ 5DLQE 4JI5Q 1Q46A 1IZ6A 1SR3A 1YIJA 3GTLH 4IPGA 2EQSA 3NELA 4DR6L 2UUBQ 1HZAA 4DV4L 1VQHA 3EIVA 2JJQA 4B3RQ 3I4MH 4YCUA 4TQUS 2UUCQ 1OTCA 2K75A 1N32Q 4IJLA 1PV4A 3AQQA 5IYCG 1KC8C 1JMCA 2KCTA 4L5RC 3DM3A 1XPRA 2AWNA 1J5EL 2KHIA 2RHSB 5M5WH 1E22A 3FP9A 5IT9c 3L0OA 3H15A 1E7ZA 4HIDA 4GN4B 1Q81C 2WB1E 2B3GA 1OXVA 1YBYA 1VQ8A 3J7ZC 4DV1Q 4HIKA 4JI4Q 5K36G 1VQNA 3J80i 1OXSC 5IWAQ 3OYYA 1EWIA 5GQOA 2YTXA 4OO1G 2JQOA 1HNZL 1HR0W 1CSQA 1UE6A 2JA8G 2VQFL 4AQYQ 4A3DG 2UXDQ 2NN6G 2JEBI 3LGJA 4DR1L 5M5XH 4B3TQ 4A75A 4X62Q 2N3SA 3EBEA 4DR3L 2IHFA 1Y14B 4O0AA 5IYCH 4YHHQ 3G71A 1YITA 1B8AA 1G6PA 2BA1A 1XNQQ 4A3EH 4JOIC 3HOUG 2MO1A 4NXMQ 1HR0Q 1V1QA 1E24A 1PFSA 4AH6A 3J81i 2N49A 3STBC 3KYHC 2B63H 4LWCA 4LF7L 1VCIA 3BZKA 5IYBH 1XNRQ 3S16H 4UY8C 3PIOA 1CUKA 1DGSA 2R6GA 1X6OA 2JA8H 3M4OH 4A93G 5C4XG 4A3DH 4JI7L 1JJCB 5E7NA 4BXXG 3J7A5 1A62A 3I4NG 3K80C 1X3GA 1U0LA 4NXML 3UDGA 3S2DH 4KHPL 2UXBQ 3RLNA 1VQDA 1KRTA 2Z0SA 4K0KQ 4NXNQ 1N36Q 3CMAA 2XGTA 3HOZH 3S15H 3E9HA 4P73A 1UEBA 2K5NA 4B3ML 1K73C 3NBHB 1N34L 4A3KG 4HIMA 1I50H 3T1YL 3S1MH 3TEHB 2Q2HA 3UE1A 1YEZA 4YY3Q 3B6YA 1UE1A 1X55A 3ULJA 4GOPB 1N33L 3KDFB 2R7FA 2BH8A 4A93H 2UXCL 3U4ZA 1MIUA 3GD7A 1UE5A 4A3MG 1MKHA 3KF6B 4PZ8A 5IYDH 3A74A 2AWOA 4C3HH 3I4NH 1P16A 1TWFH 3ULPA 2VUMG 1K3RA 2WB1G 3AYHB 3HFZB 3PIPA 1GM5A 4A3IG 4LF4Q 4OWWB 4IFDI 2MFIA 2WP8J 1I94Q 2JA7G 3I7FA 1WCMG 4B3SL 2E8GA 1X3FA 3KF8B 3OW2A 1TXYA 4NB3A 1S40A 4LW1A 3F1ZA 4APVA 4A3KH 1KQSA 4LFCQ 3RR5A 1I5FA 4OXPA 4DUZQ 3U4VA 1PH1A 2AKWB 1AE3A 3JAMc 1QZHA 3TREA 4JI2L 1XMQL 1C0AA 2LXJA 1C9OA 3PUXA 4AYBG 2C35B 4GN5A 4PG3A 4A3MH 3WWVA 1YJWA 1D8LA 3AEVA 4X66Q 2KBNA 1I94L 1X54A 1I6HH 3G48A 4GNXC 2F4VL 1HNWQ 1FL0A 1P8LA 1PHJA 1YHAA 1UE7A 4EX5A 2Y0SG 4A76A 2K5VA 4DKAC 4JI6Q 4LF6L 2JA7H 5JJLA 1PH5A 1WCMH 4LFCL 5JJKA 1X56A 4R4TA 2PI2E 4JI8Q 4POFA 1Y1VG 2B29A 1HNXQ 1VQ7A 4GKKL 2FXQA 3OTOQ 4DR5Q 4QGUA 2PQAB 1YZ6A 5C3EG 1T9HA 3M4QA 1L1OC 5GAGC 3STBD 3HKSA 1QUQB 1IXRA 4PMWA 3G6EA 3HKZE 4KHZA 1K83H 1Q12A 2JA9A 1GD7A 2L15A 1KRSA 4LF8L 1UWVA 1VQ9A 3ICEA 5M3FG 4DV4Q 4DR6Q 5FJ8H 2PMZE 1D7QA
chains in the Genus database with same CATH superfamily
4DU9A 4JI6L 1Y1VB 4ZYSA 5I2YA 1B9NA 3NENA 3OTOL 1J5EQ 4OEMB 4JI0L 5JEAJ 2NZOA 3H3VC 3GTJB 1TWCH 1BVSA 4TSSA 3J80L 3T4AC 5FLXE 4EQ5A 3GTQH 1VQGA 2E2HH 2ZTCA 1BF4A 4OIJA 3J7AF 2EE1A 1PTOC 2JA5B 3GTOH 3GV3A 5E1FA 4CDEC 3KBXA 2B2UC 3E9IA 3QR8A 5EPJA 4XQNA 1U5KA 3K6OA 5ELFA 1A2UA 1LTGD 3NTHA 1G51A 2Z6KA 2A8VA 1A3UA 3J81L 1BCPC 2EXZA 3MZ5A 1K9MC 2JK8A 2DNEA 2NVYH 3D6WA 4F88A 1TWAB 5DNFA 1JE5A 1R9TB 4JI7Q 4WRDA 1HZCA 5KNBA 5IGEA 4DAYB 2IX3A 4BBSG 1EZ8A 1AZQA 3FKIB 1O7ZA 4L5TA 4RMFA 1MJCA 3KJOA 4DR4L 4FDBA 4B3MQ 1N34Q 2PZUA 1F2YA 4FO2A 5IGCA 5M3MG 5I2XA 2E2IB 5D14A 3NSWA 3J7YW 3CCRA 3TS0A 2FMCA 2PQEA 4A3BB 1SDFA 3LX0A 3F2BA 3CP0A 2UXCQ 2RQXA 1VMPA 4IPDA 4ME5A 1S72A 2VW9A 1IBKL 3MXGA 2V1CC 1O78A 5EAYA 2G9DA 2JSOA 3S1NB 1ENAA 4OX9L 4H0LC 1V9PA 4XXEA 3S14H 4PMCA 4DNTB 1CKMA 4HN7A 3PF4A 1E2VA 2K1BA 1VQ4A 3H3VI 1VQFA 1EIYB 2EYLA 4DR7L 3H0GG 3G7LA 5TSSA 1QB5D 3K7UC 4JI2Q 1XMQQ 1OXXK 3PO3G 2XRSD 4PZ6A 4K6LA 5BR8L 3M7NA 5GAHC 4XTCS 1YNJD 2PNHA 5CBAE 1HQMC 3ZYYX 1STGA 3OWEB 4CKEA 2QILA 4LF6Q 1CK1A 4KKUA 4H13C 2YV5A 2G5DA 4ALPA 2M2LA 4GKJL 3Q8DA 3HOYG 1HH2P 4LF8Q 3ND9A 3I3CA 4KN7C 5E4XA 4C3IB 1HZ9A 1STHA 2VUMH 2CWPA 3FHWA 3J80E 2HQLA 3WOFA 1YJNA 3D4RA 1D5ZC 3SE0A 4JBMA 1QWYA 2SNSA 1A2TA 1ONLA 2EYMA 3W1GA 4JI1L 4WFN3 4LF9L 2MO0A 4DK6C 3HOXB 4JI0Q 4JCVE 1VS0A 2EY1A 2PW7A 3CPFA 3D3RA 2O5IC 3DEPA 3J81E 1JWMD 1A6XA 1KABA 1Q82C 1E2WA 2A19A 2RDFA 4BY1B 5CV6A 3NWSA 2B2TC 3L3OC 1SSOA 4X6AH 3RLFA 3UE0A 3E3XA 5A2QL 2GA4B 1Q86C 4CJ1B 3I4MG 5L37A 4GZYC 1ZXTA 1VQMA 3D31A 2N78A 3BDLA 5M3FH 1VQ6A 1CTMA 4B9WA 3GTMB 1O7IA 1GO3E 3MEHA 2HCCA 2ES2A 4QQBX 2D0PA 2KUMA 4BBRH 1KHIA 5EJWA 4Q5VA 4CKBA 1VQKA 3S17H 2Z9HA 4G7HC 4DR4Q 1AFPA 1TT2A 4LFBL 4CDFC 4N9PA 4EQPA 4DV6L 3VDYA 4A3EG 1RD9D 2D2CC 2VQEQ 1PZID 1TS4A 1KTKA 1IBKQ 4HSVA 1ILPA 3JAMi 3HZXA 4ULLA 4B3RL 2RCFA 4RG1A 1G2TA 1CZWA 4H02A 1XXGA 3S2HH 4NKLA 2N8NA 1ZYRD 4JBJA 3TZDA 3Q23A 2K50A 4R4CA 3V2TA 4IN3A 4YWMA 2KCMA 4GLXA 1B3QA 4DR7Q 2OQKA 2B63B 2K28A 1LUZA 2HDMA 4BBSH 3HOZG 4EQNA 3A8IE 1R4QB 2ZTDA 3UDXA 2UXDL 4P75A 3QG1A 3D4WA 3NPPA 2QGQA 4YHHL 5JPNC 5M3MH 5IYDG 3PCOB 2VZAA 4DR2Q 2OTJA 4X3KA 3K58A 4GKJQ 3S1MB 1XPUA 2NZHA 1CA6A 2EOTA 2BH2A 3CRKC 3K5OA 3ONAB 1H9MA 1A63A 4HJ8A 1WD1A 4L6TB 3GO5A 2AMCB 4KY5A 3I4NB 1CKNA 4OGQC 4C3HB 4JI1Q 1PH9A 1B7YB 4LF9Q 2XSCA 3CXCA 3DXJC 4BA1I 5CBEE 3VA5A 5JEAH 5A2QE 4GOPA 1IKMA 2ASBA 4K0KL 1NTGA 1N36L 1DM0B 4F8MA 1LYLA 3CCMA 1HRJA 4QJFA 4HSPA 3OPOA 1M8AA 2IWHA 2WKDA 4HIOA 1AW7A 2A6EC 3JC66 3GDEA 3U9SA 1YNXA 3LWUA 2DNCA 4DUYL 1QCBD 4MTNA 3IKJA 1PFNA 4X3TA 2CCZA 2B2WC 1L0WA 4DF7A 5FJ8G 4LF4L 3HOYH 2N88A 4O42A 1WCMB 1G2SA 4KTAA 1VQCA 4GN3B 1XJVA 1BDOA 3X3MA 2ICIA 3CC4A 1A3VA 4DUZL 5I9PA 1TS3A 3K5NA 3CMEA 1TS2A 1YVCA 3S1QH 1GUSA 1RF2D 2QF7A 4X66L 1UUPA 1HNWL 2A73B 1CFMA 5M5YH 3MFGA 1VQAA 1F2ZA 4LFBQ 4JI8L 3M9BA 5IE8A 4R4IA 1HNXL 2QW7A 2B8GA 4DV6Q 1TWCB 3FPUB 5DLQE 1S4ZA 1SR3A 3GTLH 1QE6A 4H7BA 4DV4L 1VQHA 3EIVA 1TY0A 1DD2A 3GTQB 2F4IA 2MJ8A 3I4MH 4B3RQ 2E2HB 2Z4HA 1PRTF 3BG3A 3OHXC 1PV4A 3GTOB 1SAPA 2KCTA 2CW0D 4RKBA 3C2PA 2RHSB 3FP9A 5LL6S 4RHRA 1E7ZA 4HIDA 1ICFB 2ENBA 1OXVA 2L0CA 1VQ8A 4OL7A 5K36G 1OXSC 3BDCA 5LHY1 2F0KA 2NVYB 1Y8NB 2F0UA 4EVOA 2EYHA 2UXDQ 2K5WA 5IGGA 4DR1L 2EVBA 1EFID 1NSNS 5CYUA 1AN8A 4O0AA 4YHHQ 3G71A 1JQYD 1F2LA 1UAPA 2BA1A 5NUCA 4A3EH 3HOUG 2RA4A 1CQVA 4AH6A 2LKVA 3KYHC 2L1BA 3S16H 4UY8C 1CUKA 2R6GA 2JA8H 1X6OA 4A3DH 1PYWD 2G9HD 4BXXG 3I4NG 3K80C 4C3HG 2F0PA 2QDBA 3S14B 3S2DH 3FDTA 4K0KQ 1N36Q 4NMZA 2A6HD 3CMAA 3HOZH 3TDQA 1I50H 3TEHB 1YEZA 2NBFA 1LTID 4GOPB 1SYDA 3K59A 4B08A 2X6GA 2SDFA 1EEID 1MIUA 4A3MG 4PZ8A 5IYDH 4KJNA 5C5MA 3AYHB 2MUYA 1QG7A 1KLUD 3PIPA 4A3IG 4LF4Q 1I94Q 2JA7G 1WCMG 3TP8A 4B3SL 3KF8B 1AP0A 2F1MA 4ABNA 1FYCA 4LW1A 3F1ZA 4J6HA 3RR5A 4DUZQ 1AE3A 1STYA 1QZHA 2RBMA 4G57A 4RGOS 2VUMB 4ID6A 2WB1B 3A7LA 2LXJA 5JOBA 1GUOA 3PUXA 1YJWA 1D8LA 4X66Q 4PNYA 4N8FA 4P2CB 1I6HH 3G48A 2F4VL 3O13A 1HNWQ 3MTSA 1P8LA 1YHAA 1UE7A 2Y0SG 5FKAC 4DKAC 1TKWB 4LFCL 1LV9A 1X56A 4JI8Q 4GKKL 1HNXQ 3FMCA 4FF2A 3N52A 4QGUA 5GAGC 3STBD 3HKSA 4PMWA 1K83H 1KNAA 1Q12A 1ENFA 1GD7A 1KRSA 2JA9A 5BN3A 1B4OA 4DV4Q 2FMMA 5FJ8H 1G291 4ZKCB 2AUKA 4DAVA 1JC7A 1NBWA 2F0OA 5IP9G 1PH7A 4C1NI 3L9AX 5M3FB 5FLXc 2A1AA 2DN8A 1WOCA 5D3IB 3GTKB 2HDLA 1GJXA 2UU9L 1VMCA 5DEHA 1L0XB 1QZGA 2NWGA 1Y69U 3AU7A 2F0JA 1Q1BA 3I8ZA 2GVBA 1MSGA 4DR1Q 1HJPA 2IJ0A 4A3GG 3I73A 3L7ZC 1KAWA 5C0XI 4QL5A 1KNEA 2E76C 2KENA 2RCNA 1TIID 4UP7A 4YWLA 3S17B 3LNNA 4TVAB 2F0WA 5HY6A 2HCIA 4CKCA 5C3XA 5BN5A 4MNOA 3GV6A 2EJMA 4DGZA 1QJOA 5IY0A 3W5OA 3H09A 1WTPA 3TRZA 4DA2A 3H3VH 4QF4A 1TWGH 3GQBA 3S2HB 1XTDA 5K36H 1Y8PB 1IW7C 2ZTEA 3S9WA 2NZ1D 2F3IA 2QA4A 5IP7G 1PTOH 4O2DA 4DNIA 4LF5L 3I70A 4K5VA 4DV7L 4BBSB 4I65A 2F0VA 1BBXC 3S1RH 2KVMA 3BVZA 3HOUH 2OXPA 5GADC 2TSSA 1S5DD 2VY3A 2K5HA 2OWOA 2DY8A 4B3SQ 5M3MB 2GVAA 3HOVG 4IURA 1YHBA 1PA6A 1ZEQX 2F0HA 2JA6G 4BXXH 1H95A 5ELDA 4C2MH 2VS1A 2R7ZG 4IPHA 4R4QA 3BVMA 3K0XA 5KEEA 2F4VQ 1PTOD 2ZJRA 2O4XA 3R93A 4BY7G 2MQHA 1WTRA 4K8JA 4GKKQ 4JOIA 2F52A 3U58A 5G3LD 3F2DA 1X3QA 3J80c 1DCZA 4OHJA 1VQPA 4KK7A 1BCPD 2YYZA 4LAAA 1PFMA 4DV5L 1B44D 5IGBA 4A3FG 2VB3X 5GAEC 4A3IH 3M7GA 1SE3A 2LS01 3HP3A 1NR2A 4ZQ3A 2LSSA 4FF1A 3HOYB 4KKSA 1STBA 2BDOA 5COYA 2F3WA 3D4DA 3J81c 3I4OA 1H9RA 1BBWA 1SE2A 2UU9Q 3RD4A 3HGBA 1S5FD 2F0TA 3CAMA 3ZJYC 2ZM6L 2EYFA 3MHBA 3OMCA 2ALYB 3SR1A 3CHBD 3S1QB 2D62A 2E74C 2PNRC 2AUJD 4BBRG 5KGUA 1BQQT 2FINB 3FPPA 1JR0D 4KKTA 4ZUIA 3L2PA 4CJ0B 5M5YB 4JYAL 1EYAA 3MEFA 3AB9A 1U4LA 1IBLL 2K6AA 5ISRA 3MC0B 5FO9B 4XT1B 3KFUA 3GTLB 4NPSA 2L4NA 2HQEA 5T1GA 4V190 1Q8KA 4UPAA 3I4MB 1QOHA 2F0QA 5IP9H 1B53A 5EPLA 3PMFA 2F0NA 3CCQA 1WTHA 4FXGC 1EU3A 3FRPB 4OONA 2NVTH 3MVVA 3URYA 4LF5Q 4DV7Q 4DAPA 1LACA 1TY2A 4A3GH 1D5MC 5C0XJ 1TWHH 3U9OA 4BA2I 5LL6X 1BR9A 3CF5A 2MGSA 1D5XC 1X3PA 2CWAA 1EY0A 2DUDA 5IYBG 3IRBA 1CI3M 1ICWA 1N32L 3SHLA 5ELCA 3M85A 1DXMA 4LNQA 4A3EB 3VYSA 3K81C 3PUVA 2VQEL 5HGQA 2L55A 3OIQA 1KL9A 1M4VA 1WI5A 4DV1L 3S16B 5IWAL 4IJHA 2Y0SE 2IL8A 1WD0A 2I46A 4AQYL 3RZDH 4RWSC 2PPBC 2RHQB 5IP7H 4X62L 3S2DB 5EBCA 2B2UA 3TP5A 5JEAG 1XNQL 4KI0A 1MI2A 1KD1C 3HOZB 1SYEA 2ZJPA 4MN3A 1D1KA 1LTSD 4V0BA 1I50B 4M1UB 2SEBD 4DV5Q 3MA2B 3RN5A 4WJ4A 1STEA 1T5XD 1VQJA 3EA6A 4PMBA 2RVLA 3DLLA 4NDXA 3FEWX 3DMUA 3HOVH 1DONA 3HG9A 4DR2L 5HGTA 3A56A 3D0FA 2AQ2B 2JA6H 3IAYA 3WOEA 4ZCKA 1LTLA 1O7LA 3KDFA 2KHJA 4NXNL 4XYQA 2CH4A 4JVZA 5ELBA 1YI2A 1SNPA 4IUTA 3CCEA 2R7ZH 1GVPA 3R3OA 2ZM6Q 1NR4A 1HQRD 4BY7H 1DYQA 1EY5A 1RHPA 3ITPA 1N8RC 1I6HB 5C0XG 1STNA 2HT1A 2KA7A 2R93H 3KJPA 1EQRA 4JYAQ 3NUCA 4QUFA 1WTXA 2WFWA 1SNOA 5C44G 4R4OA 1IBLQ 5JJZA 2JEAI 4A3FH 3TSSA 1ENCA 5DM73 2X69A 3AFQA 1K83B 3K7AH 5AFWA 4LMQD 3NWTA 4RCNA 1TQOA 4L5SA 1PYBA 3CCLA 1RL2A 4DXFA 3A5ZB 3OMGA 4FVMA 3U50C 3K5MA 2KHSA 3E6ZX 1STAA 4G7OC 2PYKA 4IQZA 4JC0A 5CV9A 2MNAA 1XYIA 1Q7YC 4DR5L 1PH8A 3T53B 3D8GA 4BS9A 5KIXA 1LT3D 5ELEA 4G7ZC 1YIJA 2WIIB 1HZAA 2KQ3A 4TQUS 3JAML 1OTCA 1EYDA 5IGFA 1N32Q 4IJLA 5JVG3 3AQQA 1JMCA 1KC8C 4L5RC 4DN4M 2RDGA 3NXWA 5M5WH 1E22A 5IT9c 2PZTA 4ZAIA 2L5TA 2NTTA 4EQOA 2WB1E 4I7ZC 4DV1Q 1DOMA 4QIWB 1LTAD 2NUCA 4TKOB 1VQNA 3KK7A 5KYIA 3OYYA 5IWAQ 3NP8A 2YTXA 4RKLA 2A6ED 1SNDA 2F0EA 2JA8G 1HXYD 1V8QA 2VQFL 4AQYQ 4A3DG 2B2TA 1EYCA 1TWGB 4A75A 4L8JA 4X62Q 2RSNA 3QJYA 1G6PA 3BYTB 3W3AA 1XNQQ 4CBVA 1WTVA 1V1QA 1PTOB 2JYOA 4WJWA 3TN2A 4LWCA 1VCIA 5IYBH 5C5LA 1HUMA 1DGSA 4IUQA 3M4OH 3S1RB 5IODA 1CHQD 1JJCB 1E0BA 5E7NA 3HOUB 3DHQA 4M8AA 1U0LA 1BCPB 4KHPL 4C3JG 5CV5A 1VQDA 1IYUA 1KRTA 5IT9L 4NXNQ 5K5PA 3E9HA 1JORA 5CV4A 4HIMA 3NQIA 2Q2HA 4ODGA 3NBIA 1X55A 1N33L 1NCVA 3KDFB 4C2MB 4A93H 4X3UA 1SYGA 1UE5A 3SK8A 1CHPD 1CM9A 1MKHA 1U9RA 1SNQA 3A74A 2AWOA 1TWFH 1D6EC 4FXKC 2C9OA 3ULPA 1K3RA 4HAEA 1GM5A 5C4ZA 4IFDI 1B2TA 1CQFA 5EPKA 1TXYA 2EPBA 1K8MA 4NB3A 2F0SA 1S40A 1KQSA 1RTOA 4A3MB 4OXPA 3KF8A 1PH1A 4EGVA 3TREA 4A3IB 1BNZA 1C9OA 1AEXA 4AYBG 4GN5A 3WWVA 2JA7B 1I94L 2V4DA 1X54A 4HEDA 4NP5A 3JAME 4GNXC 2ZXOA 4ILWA 4QMGA 1QNKA 3HS0C 1PH5A 2PI2E 4Q0FA 3KLRA 1RCVD 1BOSA 2F03A 4DR5Q 1J9OA 1YZ6A 2H1EA 2YU9H 1L1OC 3G6EA 4HTHA 4KHZA 2L15A 3ICEA 5C0XH 1VQ9A 1KDBA 2PMZE 2Y0SB 1JT8A 1SYCA 4K2LA 4KD3A 1WFQA 2KEDA 5C44H 4A3JG 5FOBB 1B50A 4GLAC 3SK6A 2B2VC 2Z1CA 1GKHA 1K8GA 3F2UA 1WTWA 5ELOA 1C4QA 1Z9FA 3E0JA 1S5CD 3C1EA 3RN2A 3CC2A 2DJFC 3VYRA 2JE6I 4MZ9A 5C3EH 1C7YA 1KAAA 5FK9C 3G6JB 5EBDA 2YTYA 2VQFQ 4FXDA 2XTIA 2A68C 3P75A 2FJ2A 3A8KE 3I55A 3HEJA 1ET6A 3OWFA 2B2WA 1QNUA 2I07B 1JJ2A 3PO2H 2E5LL 2WACA 1Y1WG 3E0EA 2XN9C 5IT9E 3TP7A 2NVTB 2MPMA 1L0YB 4MTKA 4GS3A 3DWQA 4FNFA 4X3SA 4A3GB 1X9NA 2R92G 2WAQG 3Q22A 1I4XA 2AQ3B 2LMCB 5C6AA 1I6VC 4QUCA 2J4XA 1TWHB 1E2ZA 2ID0A 3S24A 1PLFA 2SNMA 3RUZA 5LMUL 3CC7A 3IFDA 4KHPQ 4LUVA 1NJIC 3CCJA 1FD7D 2CQAA 1MBYA 3IL8A 1U4RA 1MJEA 1UNSA 2QKIC 4IALA 1N33Q 4J1MA 1ML0D 1EQTA 3MFYA 2PZWA 1OXTA 4L63B 3SEBA 3M3YH 3GP7A 2XNAC 2PI2A 3RZDB 1RIPA 4ZKBB 1I4QA 3T1HL 3TS2A 1HFGA 1PH6A 1V1OA 2Q2TA 2DJGC 1VF5C 3S1NH 1E1TA 3PUYA 3PF5A 3QOLA 1PRTC 4G4KA 4OO1I 1O7YA 2KJXA 1LTRD 4C3JH 1MD2D 1TS5A 3T16A 3HOVB 5EKIA 4R1JA 1NMGA 2KECA 2KOLA 4JI3L 2JA6B 2RDHA 5CC4A 1YJ9A 1A3TA 4A3LG 4UP8A 2NVXH 5FLMG 2R7ZB 5I9OA 1YNNC 3PIP3 3ERQA 5CV7A 1FNVA 4HCSA 2D0OA 4C1NK 4BY7B 4IFDJ 2BCOA 4K14A 3A5UA 1F9QA 1ESFA 4UAIA 1GUGA 2R93B 1ESRA 2ZJQA 2I5LX 2R3ZA 1IW7D 4HJ5A 4XQQA 5LMNL 4A4IA 4X65L 4A3FB 4JBKA 3ND8A 2B2YC 1OXUA 4JG2A 3K7AB 4RH6A 1EOVA 2VXWA 3KLSA 4JBWA 4P74A 3I56A 1E1OA 2I5MX 4YCWA 2E5LQ 5M9OA 3J81j 1SMXA 3DEOA 1E3PA 1IBML 4S3SA 1CZGA 4QCLA 1EEFD 2A69C 1IL8A 1JE4A 2AQ1B 2Z8LA 1SNCA 4BBRB 1SN8A 2XIWA 1DOLA 4A3JH 1RKNA 1RODA 3Q0AA 5LMUQ 1CSPA 1TU2B 2CH4W 3EROA 2LFNA 4QY7A 1X32A 1HTPA 1PH4A 3BU2A 5M5WB 4KHVA 1L1OB 3NTKA 3AFPA 3ERSX 1FR3A 4JI5L 2L11A 5A35A 3GTPH 2DY7A 2UUBL 4UHVA 1F77A 4R8IA 1Y1WH 1Z7TA 1PH2A 1N9WA 3HKZG 2QCPX 3T1HQ 1AE2A 2VNUD 4IFDG 1ZKOA 1SE4A 4KN4C 2R92H 3C3LA 1EOTA 2IX0A 1C8CA 3I90A 1ASZA 3KUPA 4AYBE 1O80A 4YWKA 2RF4A 4Y7NH 1U4MA 1BXTA 2A74C 3M4OB 1SMYC 2PMZB 1RDPD 5J3BA 5E3FA 2CHBD 2OEOA 4HMJA 4B3TL 1EY4A 4JI3Q 1T5EA 1W6KA 3H91A 4IUVA 1QVFA 5EKKA 4F87A 1HR0L 3VR6A 3K0YA 3PSIA 4XQJA 1F9PA 1I3QH 4CGYB 4P71A 3I2ZA 2JN4A 3A8JE 5EKLA 4DK0A 2OT2A 2XVSA 4RGNA 4DXGA 4OIKA 3DWPA 4A93B 2HIVA 1F9SA 1KXLA 1JOQA 4ZRZA 1TWFB 3J7AV 4UDUC 2R93G 3KLWA 1Q8IA 2UXBL 3OOCA 4DV2Q 1GUTA 4KJOA 4PZ7A 4QIWE 1G8ZD 5C4HA 5I6WA 2K33A 5LMNQ 2NB0A 4R8NA 4X65Q 1PTOF 1JWUD 3KF6A 1WJJA 4K5XA 3GTGH 1F2MA 1DZ1A 2BA0A 1HUNA 1LO5D 1A8VA 5G3LF 1VF7A 3M4YA 2K5DA 1BCPF 4A3LH 2IW3A 2QEJC 3ER0A 5FLMH 4JW0A 2K4KA 4DK3C 1IBMQ 2WAQE 3BZCA 5ELNA 1PXUA 2D9UA 2OCEA 2Z6KC 3P1HA 2YU9B 1S5BD 5I4DA 1EYGA 5CMDA 3HOWG 4TRDA 2UUAQ 2DGYA 2L9HA 3QIAA 5C44B 2PQAA 1M1KC 2EDGA 3A0JA 1EU4A 2K52A 4O1NA 2NVQH 3RZOH 4AIMA 1SRUA 5C3EB 3PUZA 4KV6A 3EQLC 3Q6SA 4JI5Q 4IPGA 3RMHA 4DR6L 2UUBQ 1EQVA 2JJQA 4IZ8A 3VYTA 4YCUA 1EY7A 1V1PB 1Q3LA 1LTBD 1TVXA 1PFBA 4LK1C 3FVQA 3PO2B 4RCOA 1XPRA 2AWNA 3H15A 1WTOA 2B3GA 1YBYA 4HIKA 1TR5A 2XWBB 2VB2X 3J80i 5GQOA 1EWIA 4OO1G 1HNZL 3OW7A 1CSQA 3QB3A 1UE6A 1K8OA 2JEBI 4B3TQ 5M5XH 4DR3L 5IYCH 1H9JA 2RKSA 1YITA 1B8AA 5D65A 4NXMQ 1HR0Q 3SXHA 3QOJA 5IIFA 2BE5C 1PFSA 2JA8B 1FGBD 3J81i 4A3DB 2KCCA 4K6DA 3Q24A 4LF7L 3BZKA 3PIOA 4IFDH 3EJIA 4A93G 5C4XG 3M3YB 2N55A 1WTQA 2ICEC 1A62A 2JXMB 1I4GA 2NN6H 4R9WA 1K28A 1X3GA 2XRQD 2UXBQ 2Z0SA 4MHEA 1EIHA 2XGTA 3S15H 4P73A 1UEBA 1K73C 5KRUA 1B1ZA 3T1YL 1IHZA 3KLSX 3UE1A 3PIO3 2EJGC 3B6YA 1G6ZA 3ULJA 2XWJB 2PCFB 2R7FA 1FNWA 3U4ZA 4C3JB 3GD7A 3IFTA 3KF6B 1PDQA 2SOBA 3PQIA 1P16A 3MXNA 2F0FA 3TP6A 1LLRD 4OWWB 2MFIA 2WINB 2WP8J 2X6LA 4FF4A 4K2KA 1X3FA 1VDZA 3OW2A 3VA7A 2NVXB 2K5QA 4APVA 2J7ZA 4A3KH 1I5FA 3DM1A 3JAMc 5CV8A 5J39A 1EWCA 3AEVA 1SEBD 1NAPA 2KBNA 2R61A 1FL0A 1NNXA 1PHJA 1FNUA 4A76A 2K5VA 4JI6Q 2K04A 1VQ7A 4POFA 1Y1VG 4HMIA 2EY2A 3MWYW 4HR7B 3OTOQ 1HA5A 4AYBB 2PQAB 5C3EG 1T9HA 2ZXPA 3C46A 5JJIA 1JJGA 1IXRA 3HKZE 4CHTB 5DM63 4DR6Q 4K8IA 2EY6A 1SLJA 1K0SA 2LY7A 2HIXA 1SFOH 4OELB 3EVQA 2GN5A 3VYUA 3PO2G 1EIFA 2CQOA 2QEXA 4YCVA 2M9VA 4LJZC 5GROA 2JA5G 3HOWH 3TMEA 1QVCA 4MIUA 2YTVA 3CU7A 1MSHA 4A3JB 1HNZQ 3GTKH 1EY6A 1MGSA 4U68A 3SVMA 2E2JH 3NHHA 4IUPA 4IO9A 1KDCA 1YNJC 1X65A 2Z4IA 4DR3Q 3UDIA 1S5ED 3CRLC 2I0QA 2WKCA 1HFNA 2ZT9C 3I72A 1KLGD 1EY9A 3VR2A 2PW5A 4HJ9A 4H44C 2HHHL 4OWXB 3FKIG 4HJAA 1SBBB 3H94A 1GHJA 4LF7Q 3F8TA 3CQZH 1AH9A 3GTPB 2KEEA 4DPGA 4KY7A 4UP9A 1Y1WB 2HUGA 4JV5L 4KLKA 2L12A 4A3BG 4KMUC 2E2DC 1VQIA 5H1SE 4GOPC 5D3DA 4DV3L 2R92B 2WAQB 4OX9Q 3F2CA 1HPCA 4IOCA 3A54A 5KYLA 4OO1H 1X3EA 2AHOB 1M90C 3T1YQ 2PO4A 4Y7NB 1VQOA 3HRZC 3PV0A 5J1ZA 1LT6D 3CD6A 5AJ3L 3C1FA 2EIFA 1PVOA 4OWTB 3VR4A 1V43A 1YHQA 1UEAB 5BR8Q 1FVIA 4HCEA 2Q2UA 4FF3A 2ATWA 1JOOA 3G4SA 2F0IA 1PZKD 1FGUA 2K05A 5EQ0A 5C4XH 3MXNB 4Z9CB 1I3QB 1OO9B 5C3WA 3VR3A 3KBGA 3K8AA 2A68D 4C3IG 2IHEA 3NQTA 2Q2IA 3CKIB 2NN6I 1SE8A 1SJED 2MP1A 4WORA 1D2BA 1Q90A 3NTIA 1EY8A 4DV0L 2CVRA 3T56B 3K5LA 3HOXG 5CORA 3H0GH 1RTNA 4CDDC 3GTGB 3QO2A 4U673 1LT4D 4WJ3M 1PMRA 3PO3H 4QB4A 1VQEA 1A15A 4RFBA 1U4PA 3CW2C 4N9TA 2ZXRA 1GHKA 4LUOA 3TZUA 5FO8B 4BY1G 4X64L 1ZYRC 4A3CG 1ILQA 1IL2A 2VL6A 1NMFA 3CPWA 5C4JH 3BJUA 1EUJA 3UDFA 3H6MA 1J6QA 3BYYB 3EFXD 4KY6A 3BDOA 5F2DA 2R7DA 3TBIB 3BS1A 1Y1VH 2F0DA 4XDXA 1B70B 1EL0A 4POGA 1EQQA 4KD4A 4Y52H 4ZK9B 2MHVA 3W1BA 2NVQB 3RZOB 3WDNA 4FP5D 2HHHQ 1C48A 1I4HA 1DJRD 3ULLA 2EJFC 3GTJH 4L5QA 1HZBA 1Z47A 1PRTD 1SYBA 3NEMA 4J15A 5I6YA 1FJGL 3SGIA 3CCSA 4JV5Q 2F3VA 1XMOL 2IPKD 1BKBA 3KOJA 4JPBW 4GNXA 2JA5H 2D5DA 1VQLA 1QILA 1IYJB 1NUCA 3SK5A 5BN4A 4DV3Q 5CR3A 2CFMA 3D6CA 2KCNA 1DOKA 1BO0A 3R8BA 2OTLA 1R4PB 1L1OA 1YNND 1JICA 4LFAL 3BZDB 2EYPA 1NE3A 1TWAH 4BWGB 1R9TH 2EXDA 3DUZA 1F9RA 1S3OA 2B8FA 1JB3A 3PGZA 5AJ3Q 2B63G 1Y8OB 2UUCL 4NW2A 4J8QA 5M5XB 5E4WC 5IOCA 2H4OA 2B2VA 1K8AC 3FKIH 1VQBA 4PV1C 3TQYA 1Q1EA 1LTTD 2K01A 3M4PA 1HHVA 2NTSA 1XTCD 4IOAA 1QVGA 4JI4L 1KDAA 2F0GA 3HKZB 2E2IH 4A3BH 1SROA 2OQ0A 1K3BC 1L2FA 4XT3B 1IYVA 4HJ7A 4DAMA 1VQ5A 3CCUA 3T13A 4P72A 4DV0Q 3RNUA 3K57A 3S15B 1KIXA 1A0IA 2A69D 3A7AB 4GLVB 2Q8IB 2LXKA 3CCVA 5JAVA 3E5SA 4IUUA 1W2BA 1CKOA 1WVLA 1CKNB 5LMNW 1XNRL 3PUWA 4LUZA 1I4RA 2IY5B 5J22A 4RGMA 5KNCA 1LM0A 2J0TD 1WYDA 3MXUA 4DUYQ 3NBHA 1XX8A 4XYOA 4X64Q 2CW0C 3AMUA 1G91A 1ASYA 1W3SA 1PH3A 3MXPA 5DAUA 1NY4A 4A3KB 1JB7A 3QWNA 4C3IH 2IX1A 4YY3L 4PQXA 2Q8TA 1PYSB 4XIGS 3SDZA 4DV2L 1JOKA 1JCKB 2CKZB 2I5HA 1BBUA 1EIGA 3HOXH 5JPMC 3NK9A 4ME3A 1JWSD 2H5XA 3N6RA 2M00A 1FJGQ 1K0RA 1SXTA 4F7XA 1SMYD 4DNRB 5EGTA 4E6IA 1XMOQ 4BY1H 2E75C 4A3CH 3EN2A 1PZJD 2K14A 5CGKA 1SFOB 1H9SA 2TMPA 1GUNA 1AZPA 1QUQA 4CJ2C 1XPOA 3V05A 3RLOA 4IPCA 1EFWA 1B9MA 2A6HC 2F0LA 2IT1A 4YIJA 3HOWB 4GNXB 3GTMH 4I7AA 2UUAL 4LFAQ 1Q46A 1IZ6A 4RGTA 2EQSA 3NELA 1EWHA 4B9XA 3X3NA 2E2JB 5T1IA 3R2IA 2UUCQ 2K75A 2O2LD 4RAUC 1HTLD 4DFAA 1CA5A 5IYCG 2A5HA 3DM3A 3DWAA 1J5EL 1V1PA 2KHIA 1HCZA 3L0OA 2WV6D 4GN4B 2EZVA 1Q81C 4K5WA 3J7ZC 3P20A 2FFKB 4JI4Q 2NYZD 2B2YA 4RA8A 3MAQA 3CQZB 2JQOA 1HR0W 2HD3A 1LABA 2NN6G 3LGJA 2N3SA 3EBEA 2BDNA 2IHFA 1Y14B 4FYDA 3W2DA 1RJTA 1SNMA 4JOIC 2MO1A 3BVGA 1E24A 1EZ6A 4CDCC 4DAYA 2N49A 3STBC 2B63H 2FHTA 1J8IA 5FLXL 1XNRQ 3A55A 4N8X1 1BUVT 2K03A 3UI2A 4JI7L 1ET9A 2EYJA 3J7A5 2K32A 2EYOA 1GUWA 4NXML 3UDGA 1SJHD 3RLNA 4ZUJA 2P5ZX 2Q8RE 1H9KA 3I91A 1XWEA 1I4PA 2K5NA 5C4XB 4B3ML 2QDLA 5IGDA 3NBHB 3R2TA 4A3KG 1N34L 3S1MH 2C5CA 2O5JC 4YY3Q 3OSOA 4RHSA 1UE1A 2BH8A 2UXCL 4C56C 3I4NH 4C3HH 2B39A 2VUMG 2WB1G 3HFZB 1MHWC 4ZLTF 3I7FA 2E8GA 3P7JA 1IKLA 2EY5A 4LFCQ 3H0GB 2BOSA 4IUNA 1II3A 3U4VA 2AKWB 3PO3B 4JI2L 1XMQL 1C0AA 2C35B 5FO7B 4PG3A 4DK1A 5KNDA 4A3MH 1GOZA 5JVH3 1PRTB 3OIPA 1Z6HA 2K7VA 4EX5A 4LF6L 5HURA 5JJLA 2OF1A 2JA7H 3I4LA 4JK1C 1WCMH 1HA6A 5JJKA 3LWEA 2Z6BA 4R4TA 3VR5A 2B29A 3V96A 2JP1A 1LT5D 2FXQA 1SYFA 1W6JA 1D1IA 2BE5D 1H9SB 5C4JB 1GXDC 3M4QA 3SK4A 1QUQB 4LF8L 3T51B 1CT1D 1UWVA 5M3FG 3NE5B 2RSOA 2F0MA 1B3AA 1D7QA
chains in the Genus database with same CATH topology
1SLJA 4JI6L 2HIXA 1WFQA 5C44H 4A3JG 1SFOH 4GLAC 1NBWA 1GKHA 1G291 3NENA 1K8GA 3OTOL 1J5EQ 2GN5A 3PO2G 1EIFA 2CQOA 2QEXA 4JI0L 5IP9G 5JEAJ 5ELOA 1PH7A 1Z9FA 4YCVA 3RN2A 5FLXc 3CC2A 2A1AA 1WOCA 2NZOA 5GROA 2JA5G 2JE6I 3HOWH 4MZ9A 5C3EH 2UU9L 1C7YA 1QVCA 1TWCH 1BVSA 2YTVA 1HNZQ 3GTKH 1QZGA 2YTYA 4EQ5A 2VQFQ 2E2JH 1Q1BA 1VQGA 2XTIA 2E2HH 2ZTCA 2GVBA 4IO9A 3GTQH 4DR1Q 1HJPA 3I55A 4A3GG 1X65A 3L7ZC 3UDIA 4DR3Q 1KAWA 5C0XI 4QL5A 2I0QA 1JJ2A 2KENA 2RCNA 3GTOH 4UP7A 2E5LL 3PO2H 3E9IA 1Y1WG 4YWLA 3E0EA 4TVAB 1U5KA 1G51A 4HJ9A 5HY6A 2HHHL 4OWXB 3FKIG 2Z6KA 4GS3A 4HJAA 2A8VA 4MNOA 1X9NA 4LF7Q 2R92G 2WAQG 3F8TA 3CQZH 1K9MC 2JK8A 1AH9A 5IY0A 2NVYH 3W5OA 1JE5A 3S24A 4DPGA 2ID0A 4UP9A 4JI7Q 1HZCA 3TRZA 4DAYB 3H3VH 4KLKA 5LMUL 3CC7A 4BBSG 4JV5L 1TWGH 4A3BG 4KHPQ 4LUVA 1NJIC 1VQIA 3CCJA 1XTDA 5H1SE 4GOPC 4L5TA 4RMFA 4DV3L 1MJCA 2ZTEA 4OX9Q 3KJOA 2F3IA 3F2CA 2QA4A 4IOCA 4DR4L 4FDBA 1X3EA 2AHOB 1M90C 4B3MQ 5IP7G 4O2DA 1N34Q 3T1YQ 1MJEA 4DNIA 1VQOA 4LF5L 5M3MG 4DV7L 1N33Q 3CCRA 3TS0A 3F2BA 1OXTA 3CP0A 2UXCQ 3PV0A 4IPDA 3S1RH 1S72A 1IBKL 2VW9A 3CD6A 3M3YH 2V1CC 2PI2A 5AJ3L 3HOUH 5EAYA 1RIPA 2EIFA 1PVOA 4OWTB 5GADC 4OX9L 1V9PA 1V43A 2VY3A 2K5HA 1YHQA 5BR8Q 3T1HL 2OWOA 3S14H 1FVIA 2Q2UA 2ATWA 1CKMA 4B3SQ 3G4SA 3PF4A 3TS2A 1PH6A 2GVAA 3HOVG 1VQ4A 3H3VI 1FGUA 2Q2TA 3S1NH 1VQFA 1YHBA 1EIYB 1PA6A 1E1TA 5C4XH 3MXNB 3PUYA 3PF5A 2JA6G 4DR7L 3H0GG 4BXXH 3K7UC 4JI2Q 1XMQQ 1OXXK 1H95A 4C2MH 3PO3G 4PZ6A 4OO1I 2VS1A 4C3JH 5BR8L 2R7ZG 3M7NA 3K8AA 4IPHA 4R4QA 5GAHC 3K0XA 4XTCS 2IHEA 2F4VQ 2Q2IA 2PNHA 2NN6I 4R1JA 1NMGA 2ZJRA 4LF6Q 1SE8A 4JI3L 4BY7G 2MQHA 2YV5A 4ALPA 4DV0L 4GKKQ 1YJ9A 4JOIA 2F52A 3U58A 3F2DA 3J80c 4A3LG 4UP8A 2NVXH 4GKJL 3Q8DA 5FLMG 3HOXG 1VQPA 3HOYG 1HH2P 3H0GH 4LF8Q 1HZ9A 2YYZA 4WJ3M 3PO3H 2VUMH 4DV5L 2CWPA 3FHWA 4A3FG 2D0OA 5GAEC 1VQEA 2HQLA 4A3IH 1YJNA 4IFDJ 4JBMA 3A5UA 3W1GA 4JI1L 3CW2C 2LSSA 4LF9L 2MO0A 4DK6C 4LUOA 1JT8A 4X64L 4BY1G 4JCVE 4JI0Q 2ZJQA 2I5LX 3J81c 4A3CG 1IL2A 1VS0A 3I4OA 4HJ5A 5LMNL 2VL6A 4A4IA 4X65L 1BBWA 1NMFA 2UU9Q 3CPWA 4JBKA 3CPFA 5C4JH 3BJUA 1EUJA 1OXUA 3UDFA 1J6QA 4JG2A 3CAMA 3ZJYC 2ZM6L 1EOVA 4JBWA 2R7DA 2ALYB 4P74A 3I56A 1E1OA 1Q82C 2I5MX 2D62A 2A19A 4BBRG 1Y1VH 1B70B 4X6AH 3RLFA 4POGA 2YU9H 3L2PA 3UE0A 1EQQA 4Y52H 4YCWA 2E5LQ 4JYAL 1Q86C 3J81j 3I4MG 1SMXA 3W1BA 1E3PA 3MEFA 1VQMA 3D31A 2N78A 1IBML 5M3FH 1VQ6A 2HHHQ 1IBLL 3ULLA 3GTJH 1O7IA 4L5QA 1HZBA 1GO3E 1SN8A 1Z47A 3KFUA 3NEMA 4J15A 4A3JH 4NPSA 2ES2A 1FJGL 4QQBX 2D0PA 3SGIA 3CCSA 1Q8KA 4UPAA 4JV5Q 4BBRH 5LMUQ 1XMOL 1CSPA 5IP9H 1KHIA 1BKBA 3KOJA 4GNXA 3CCQA 4QY7A 2JA5H 1VQLA 1IYJB 1PH4A 4DV3Q 3BU2A 1VQKA 2CFMA 4OONA 3S17H 1L1OB 4DR4Q 2NVTH 3AFPA 4LFBL 2OTLA 4LF5Q 4DV6L 4DV7Q 3VDYA 1L1OA 3ERSX 4A3EG 4A3GH 4LFAL 2VQEQ 4JI5L 3GTPH 5C0XJ 1NE3A 1TWAH 1R9TH 1IBKQ 2UUBL 2EXDA 1TWHH 1S3OA 3PGZA 5AJ3Q 3JAMi 1Y1WH 2B63G 4BA2I 3CF5A 4B3RL 1PH2A 1N9WA 3HKZG 2UUCL 2CWAA 2DUDA 4RG1A 5IYBG 3IRBA 3T1HQ 1AE2A 1N32L 2VNUD 4IFDG 3M85A 1K8AC 3FKIH 4H02A 1VQBA 4LNQA 3S2HH 2N8NA 4JBJA 2R92H 3TQYA 3K81C 1Q1EA 2K50A 4R4CA 2IX0A 3PUVA 3M4PA 4YWMA 5HGQA 2KCMA 2VQEL 4GLXA 1ASZA 4AYBE 4DR7Q 2OQKA 4YWKA 4IOAA 2RF4A 1KL9A 1WI5A 1LUZA 4Y7NH 4DV1L 1QVGA 4JI4L 2E2IH 4BBSH 3HOZG 4A3BH 5IWAL 1SROA 4IJHA 2OQ0A 2Y0SE 2ZTDA 5J3BA 3UDXA 1L2FA 4AQYL 3RZDH 2UXDL 4P75A 5JJIA 4HJ7A 4DAMA 2RHQB 4B3TL 5IP7H 4X62L 4JI3Q 1VQ5A 3CCUA 2QGQA 4YHHL 4DV0Q 4P72A 3RNUA 1QVFA 5M3MH 5JEAG 5IYDG 1XNQL 3PCOB 2VZAA 4KI0A 4DR2Q 1KD1C 2OTJA 2ZJPA 4GKJQ 1HR0L 1KIXA 1A0IA 3PSIA 4GLVB 3CCVA 2LXKA 1I3QH 4P71A 3I2ZA 2NZHA 1XPUA 2BH2A 1W2BA 1CKOA 4DV5Q 4HJ8A 1CKNB 3RN5A 4WJ4A 5LMNW 1VQJA 1XNRL 1A63A 3PUWA 3DLLA 4LUZA 2HIVA 1KXLA 3GO5A 2IY5B 2AMCB 3HOVH 1CKNA 1LM0A 1PH9A 4JI1Q 1B7YB 4LF9Q 1WYDA 4DR2L 4DUYQ 2R93G 3D0FA 3KLWA 3CXCA 4BA1I 4X64Q 2JA6H 2UXBL 1LTLA 4DV2Q 4PZ7A 4GOPA 4QIWE 3KDFA 1ASYA 2ASBA 2KHJA 1NTGA 4NXNL 5LMNQ 1N36L 4K0KL 4X65Q 1W3SA 1PH3A 1LYLA 3CCMA 3KF6A 1NY4A 3CCEA 4QJFA 1YI2A 1JB7A 2R7ZH 1GVPA 4C3IH 1WJJA 2ZM6Q 2IX1A 3GTGH 4YY3L 4HIOA 2BA0A 3JC66 3GDEA 1A8VA 1YNXA 4BY7H 4DUYL 1PYSB 4XIGS 4MTNA 1N8RC 4DV2L 5C0XG 2HT1A 2CCZA 4A3LH 2R93H 2CKZB 3KJPA 1EQRA 2I5HA 3ER0A 1BBUA 1L0WA 5FJ8G 5FLMH 3HOXH 4LF4L 3HOYH 4JYAQ 2K4KA 2WFWA 4DK3C 1IBMQ 1JJGA 2WAQE 5C44G 4R4OA 1VQCA 3BZCA 5ELNA 1IBLQ 4GN3B 2JEAI 4A3FH 1XJVA 2OCEA 4ME3A 2Z6KC 3CC4A 2H5XA 3AFQA 4DUZL 1FJGQ 1K0RA 3K7AH 3CMEA 1EYGA 3HOWG 1YVCA 2UUAQ 4L5SA 3S1QH 1PYBA 2DGYA 1XMOQ 3CCLA 1RL2A 4BY1H 4A3CH 3A5ZB 3EN2A 4X66L 2K14A 2PQAA 1M1KC 3U50C 1HNWL 3A0JA 5M5YH 1QUQA 1XPOA 2K52A 1VQAA 3RLOA 4IPCA 1EFWA 2NVQH 3RZOH 4LFBQ 2IT1A 4JI8L 3M9BA 4JC0A 4R4IA 4AIMA 5IE8A 2MNAA 1HNXL 4GNXB 1SRUA 3PUZA 4DV6Q 4DR5L 1Q7YC 1PH8A 3GTMH 2UUAL 4LFAQ 5DLQE 4JI5Q 1Q46A 1IZ6A 1SR3A 1YIJA 3GTLH 4IPGA 2EQSA 3NELA 4DR6L 2UUBQ 1HZAA 4DV4L 1VQHA 3EIVA 2JJQA 4B3RQ 3I4MH 4YCUA 4TQUS 2UUCQ 1OTCA 2K75A 1N32Q 4IJLA 1PV4A 3AQQA 5IYCG 1KC8C 1JMCA 2KCTA 4L5RC 3DM3A 1XPRA 2AWNA 1J5EL 2KHIA 2RHSB 5M5WH 1E22A 3FP9A 5IT9c 3L0OA 3H15A 1E7ZA 4HIDA 4GN4B 1Q81C 2WB1E 2B3GA 1OXVA 1YBYA 1VQ8A 3J7ZC 4DV1Q 4HIKA 4JI4Q 5K36G 1VQNA 3J80i 1OXSC 5IWAQ 3OYYA 1EWIA 5GQOA 2YTXA 4OO1G 2JQOA 1HNZL 1HR0W 1CSQA 1UE6A 2JA8G 2VQFL 4AQYQ 4A3DG 2UXDQ 2NN6G 2JEBI 3LGJA 4DR1L 5M5XH 4B3TQ 4A75A 4X62Q 2N3SA 3EBEA 4DR3L 2IHFA 1Y14B 4O0AA 5IYCH 4YHHQ 3G71A 1YITA 1B8AA 1G6PA 2BA1A 1XNQQ 4A3EH 4JOIC 3HOUG 2MO1A 4NXMQ 1HR0Q 1V1QA 1E24A 1PFSA 4AH6A 3J81i 2N49A 3STBC 3KYHC 2B63H 4LWCA 4LF7L 1VCIA 3BZKA 5IYBH 1XNRQ 3S16H 4UY8C 3PIOA 1CUKA 1DGSA 2R6GA 1X6OA 2JA8H 3M4OH 4A93G 5C4XG 4A3DH 4JI7L 1JJCB 5E7NA 4BXXG 3J7A5 1A62A 3I4NG 3K80C 1X3GA 1U0LA 4NXML 3UDGA 3S2DH 4KHPL 2UXBQ 3RLNA 1VQDA 1KRTA 2Z0SA 4K0KQ 4NXNQ 1N36Q 3CMAA 2XGTA 3HOZH 3S15H 3E9HA 4P73A 1UEBA 2K5NA 4B3ML 1K73C 3NBHB 1N34L 4A3KG 4HIMA 1I50H 3T1YL 3S1MH 3TEHB 2Q2HA 3UE1A 1YEZA 4YY3Q 3B6YA 1UE1A 1X55A 3ULJA 4GOPB 1N33L 3KDFB 2R7FA 2BH8A 4A93H 2UXCL 3U4ZA 1MIUA 3GD7A 1UE5A 4A3MG 1MKHA 3KF6B 4PZ8A 5IYDH 3A74A 2AWOA 4C3HH 3I4NH 1P16A 1TWFH 3ULPA 2VUMG 1K3RA 2WB1G 3AYHB 3HFZB 3PIPA 1GM5A 4A3IG 4LF4Q 4OWWB 4IFDI 2MFIA 2WP8J 1I94Q 2JA7G 3I7FA 1WCMG 4B3SL 2E8GA 1X3FA 3KF8B 3OW2A 1TXYA 4NB3A 1S40A 4LW1A 3F1ZA 4APVA 4A3KH 1KQSA 4LFCQ 3RR5A 1I5FA 4OXPA 4DUZQ 3U4VA 1PH1A 2AKWB 1AE3A 3JAMc 1QZHA 3TREA 4JI2L 1XMQL 1C0AA 2LXJA 1C9OA 3PUXA 4AYBG 2C35B 4GN5A 4PG3A 4A3MH 3WWVA 1YJWA 1D8LA 3AEVA 4X66Q 2KBNA 1I94L 1X54A 1I6HH 3G48A 4GNXC 2F4VL 1HNWQ 1FL0A 1P8LA 1PHJA 1YHAA 1UE7A 4EX5A 2Y0SG 4A76A 2K5VA 4DKAC 4JI6Q 4LF6L 2JA7H 5JJLA 1PH5A 1WCMH 4LFCL 5JJKA 1X56A 4R4TA 2PI2E 4JI8Q 4POFA 1Y1VG 2B29A 1HNXQ 1VQ7A 4GKKL 2FXQA 3OTOQ 4DR5Q 4QGUA 2PQAB 1YZ6A 5C3EG 1T9HA 3M4QA 1L1OC 5GAGC 3STBD 3HKSA 1QUQB 1IXRA 4PMWA 3G6EA 3HKZE 4KHZA 1K83H 1Q12A 2JA9A 1GD7A 2L15A 1KRSA 4LF8L 1UWVA 1VQ9A 3ICEA 5M3FG 4DV4Q 4DR6Q 5FJ8H 2PMZE 1D7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLJ A;  4JI6 L;  2HIX A;  1WFQ A;  5C44 H;  4A3J G;  1SFO H;  4GLA C;  1NBW A;  1GKH A;  1G29 1;  3NEN A;  1K8G A;  3OTO L;  1J5E Q;  2GN5 A;  3PO2 G;  1EIF A;  2CQO A;  2QEX A;  4JI0 L;  5IP9 G;  5JEA J;  5ELO A;  1PH7 A;  1Z9F A;  4YCV A;  3RN2 A;  5FLX c;  3CC2 A;  2A1A A;  1WOC A;  2NZO A;  5GRO A;  2JA5 G;  2JE6 I;  3HOW H;  4MZ9 A;  5C3E H;  2UU9 L;  1C7Y A;  1QVC A;  1TWC H;  1BVS A;  2YTV A;  1HNZ Q;  3GTK H;  1QZG A;  2YTY A;  4EQ5 A;  2VQF Q;  2E2J H;  1Q1B A;  1VQG A;  2XTI A;  2E2H H;  2ZTC A;  2GVB A;  4IO9 A;  3GTQ H;  4DR1 Q;  1HJP A;  3I55 A;  4A3G G;  1X65 A;  3L7Z C;  3UDI A;  4DR3 Q;  1KAW A;  5C0X I;  4QL5 A;  2I0Q A;  1JJ2 A;  2KEN A;  2RCN A;  3GTO H;  4UP7 A;  2E5L L;  3PO2 H;  3E9I A;  1Y1W G;  4YWL A;  3E0E A;  4TVA B;  1U5K A;  1G51 A;  4HJ9 A;  5HY6 A;  2HHH L;  4OWX B;  3FKI G;  2Z6K A;  4GS3 A;  4HJA A;  2A8V A;  4MNO A;  1X9N A;  4LF7 Q;  2R92 G;  2WAQ G;  3F8T A;  3CQZ H;  1K9M C;  2JK8 A;  1AH9 A;  5IY0 A;  2NVY H;  3W5O A;  1JE5 A;  3S24 A;  4DPG A;  2ID0 A;  4UP9 A;  4JI7 Q;  1HZC A;  3TRZ A;  4DAY B;  3H3V H;  4KLK A;  5LMU L;  3CC7 A;  4BBS G;  4JV5 L;  1TWG H;  4A3B G;  4KHP Q;  4LUV A;  1NJI C;  1VQI A;  3CCJ A;  1XTD A;  5H1S E;  4GOP C;  4L5T A;  4RMF A;  4DV3 L;  1MJC A;  2ZTE A;  4OX9 Q;  3KJO A;  2F3I A;  3F2C A;  2QA4 A;  4IOC A;  4DR4 L;  4FDB A;  1X3E A;  2AHO B;  1M90 C;  4B3M Q;  5IP7 G;  4O2D A;  1N34 Q;  3T1Y Q;  1MJE A;  4DNI A;  1VQO A;  4LF5 L;  5M3M G;  4DV7 L;  1N33 Q;  3CCR A;  3TS0 A;  3F2B A;  1OXT A;  3CP0 A;  2UXC Q;  3PV0 A;  4IPD A;  3S1R H;  1S72 A;  1IBK L;  2VW9 A;  3CD6 A;  3M3Y H;  2V1C C;  2PI2 A;  5AJ3 L;  3HOU H;  5EAY A;  1RIP A;  2EIF A;  1PVO A;  4OWT B;  5GAD C;  4OX9 L;  1V9P A;  1V43 A;  2VY3 A;  2K5H A;  1YHQ A;  5BR8 Q;  3T1H L;  2OWO A;  3S14 H;  1FVI A;  2Q2U A;  2ATW A;  1CKM A;  4B3S Q;  3G4S A;  3PF4 A;  3TS2 A;  1PH6 A;  2GVA A;  3HOV G;  1VQ4 A;  3H3V I;  1FGU A;  2Q2T A;  3S1N H;  1VQF A;  1YHB A;  1EIY B;  1PA6 A;  1E1T A;  5C4X H;  3MXN B;  3PUY A;  3PF5 A;  2JA6 G;  4DR7 L;  3H0G G;  4BXX H;  3K7U C;  4JI2 Q;  1XMQ Q;  1OXX K;  1H95 A;  4C2M H;  3PO3 G;  4PZ6 A;  4OO1 I;  2VS1 A;  4C3J H;  5BR8 L;  2R7Z G;  3M7N A;  3K8A A;  4IPH A;  4R4Q A;  5GAH C;  3K0X A;  4XTC S;  2IHE A;  2F4V Q;  2Q2I A;  2PNH A;  2NN6 I;  4R1J A;  1NMG A;  2ZJR A;  4LF6 Q;  1SE8 A;  4JI3 L;  4BY7 G;  2MQH A;  2YV5 A;  4ALP A;  4DV0 L;  4GKK Q;  1YJ9 A;  4JOI A;  2F52 A;  3U58 A;  3F2D A;  3J80 c;  4A3L G;  4UP8 A;  2NVX H;  4GKJ L;  3Q8D A;  5FLM G;  3HOX G;  1VQP A;  3HOY G;  1HH2 P;  3H0G H;  4LF8 Q;  1HZ9 A;  2YYZ A;  4WJ3 M;  3PO3 H;  2VUM H;  4DV5 L;  2CWP A;  3FHW A;  4A3F G;  2D0O A;  5GAE C;  1VQE A;  2HQL A;  4A3I H;  1YJN A;  4IFD J;  4JBM A;  3A5U A;  3W1G A;  4JI1 L;  3CW2 C;  2LSS A;  4LF9 L;  2MO0 A;  4DK6 C;  4LUO A;  1JT8 A;  4X64 L;  4BY1 G;  4JCV E;  4JI0 Q;  2ZJQ A;  2I5L X;  3J81 c;  4A3C G;  1IL2 A;  1VS0 A;  3I4O A;  4HJ5 A;  5LMN L;  2VL6 A;  4A4I A;  4X65 L;  1BBW A;  1NMF A;  2UU9 Q;  3CPW A;  4JBK A;  3CPF A;  5C4J H;  3BJU A;  1EUJ A;  1OXU A;  3UDF A;  1J6Q A;  4JG2 A;  3CAM A;  3ZJY C;  2ZM6 L;  1EOV A;  4JBW A;  2R7D A;  2ALY B;  4P74 A;  3I56 A;  1E1O A;  1Q82 C;  2I5M X;  2D62 A;  2A19 A;  4BBR G;  1Y1V H;  1B70 B;  4X6A H;  3RLF A;  4POG A;  2YU9 H;  3L2P A;  3UE0 A;  1EQQ A;  4Y52 H;  4YCW A;  2E5L Q;  4JYA L;  1Q86 C;  3J81 j;  3I4M G;  1SMX A;  3W1B A;  1E3P A;  3MEF A;  1VQM A;  3D31 A;  2N78 A;  1IBM L;  5M3F H;  1VQ6 A;  2HHH Q;  1IBL L;  3ULL A;  3GTJ H;  1O7I A;  4L5Q A;  1HZB A;  1GO3 E;  1SN8 A;  1Z47 A;  3KFU A;  3NEM A;  4J15 A;  4A3J H;  4NPS A;  2ES2 A;  1FJG L;  4QQB X;  2D0P A;  3SGI A;  3CCS A;  1Q8K A;  4UPA A;  4JV5 Q;  4BBR H;  5LMU Q;  1XMO L;  1CSP A;  5IP9 H;  1KHI A;  1BKB A;  3KOJ A;  4GNX A;  3CCQ A;  4QY7 A;  2JA5 H;  1VQL A;  1IYJ B;  1PH4 A;  4DV3 Q;  3BU2 A;  1VQK A;  2CFM A;  4OON A;  3S17 H;  1L1O B;  4DR4 Q;  2NVT H;  3AFP A;  4LFB L;  2OTL A;  4LF5 Q;  4DV6 L;  4DV7 Q;  3VDY A;  1L1O A;  3ERS X;  4A3E G;  4A3G H;  4LFA L;  2VQE Q;  4JI5 L;  3GTP H;  5C0X J;  1NE3 A;  1TWA H;  1R9T H;  1IBK Q;  2UUB L;  2EXD A;  1TWH H;  1S3O A;  3PGZ A;  5AJ3 Q;  3JAM i;  1Y1W H;  2B63 G;  4BA2 I;  3CF5 A;  4B3R L;  1PH2 A;  1N9W A;  3HKZ G;  2UUC L;  2CWA A;  2DUD A;  4RG1 A;  5IYB G;  3IRB A;  3T1H Q;  1AE2 A;  1N32 L;  2VNU D;  4IFD G;  3M85 A;  1K8A C;  3FKI H;  4H02 A;  1VQB A;  4LNQ A;  3S2H H;  2N8N A;  4JBJ A;  2R92 H;  3TQY A;  3K81 C;  1Q1E A;  2K50 A;  4R4C A;  2IX0 A;  3PUV A;  3M4P A;  4YWM A;  5HGQ A;  2KCM A;  2VQE L;  4GLX A;  1ASZ A;  4AYB E;  4DR7 Q;  2OQK A;  4YWK A;  4IOA A;  2RF4 A;  1KL9 A;  1WI5 A;  1LUZ A;  4Y7N H;  4DV1 L;  1QVG A;  4JI4 L;  2E2I H;  4BBS H;  3HOZ G;  4A3B H;  5IWA L;  1SRO A;  4IJH A;  2OQ0 A;  2Y0S E;  2ZTD A;  5J3B A;  3UDX A;  1L2F A;  4AQY L;  3RZD H;  2UXD L;  4P75 A;  5JJI A;  4HJ7 A;  4DAM A;  2RHQ B;  4B3T L;  5IP7 H;  4X62 L;  4JI3 Q;  1VQ5 A;  3CCU A;  2QGQ A;  4YHH L;  4DV0 Q;  4P72 A;  3RNU A;  1QVF A;  5M3M H;  5JEA G;  5IYD G;  1XNQ L;  3PCO B;  2VZA A;  4KI0 A;  4DR2 Q;  1KD1 C;  2OTJ A;  2ZJP A;  4GKJ Q;  1HR0 L;  1KIX A;  1A0I A;  3PSI A;  4GLV B;  3CCV A;  2LXK A;  1I3Q H;  4P71 A;  3I2Z A;  2NZH A;  1XPU A;  2BH2 A;  1W2B A;  1CKO A;  4DV5 Q;  4HJ8 A;  1CKN B;  3RN5 A;  4WJ4 A;  5LMN W;  1VQJ A;  1XNR L;  1A63 A;  3PUW A;  3DLL A;  4LUZ A;  2HIV A;  1KXL A;  3GO5 A;  2IY5 B;  2AMC B;  3HOV H;  1CKN A;  1LM0 A;  1PH9 A;  4JI1 Q;  1B7Y B;  4LF9 Q;  1WYD A;  4DR2 L;  4DUY Q;  2R93 G;  3D0F A;  3KLW A;  3CXC A;  4BA1 I;  4X64 Q;  2JA6 H;  2UXB L;  1LTL A;  4DV2 Q;  4PZ7 A;  4GOP A;  4QIW E;  3KDF A;  1ASY A;  2ASB A;  2KHJ A;  1NTG A;  4NXN L;  5LMN Q;  1N36 L;  4K0K L;  4X65 Q;  1W3S A;  1PH3 A;  1LYL A;  3CCM A;  3KF6 A;  1NY4 A;  3CCE A;  4QJF A;  1YI2 A;  1JB7 A;  2R7Z H;  1GVP A;  4C3I H;  1WJJ A;  2ZM6 Q;  2IX1 A;  3GTG H;  4YY3 L;  4HIO A;  2BA0 A;  3JC6 6;  3GDE A;  1A8V A;  1YNX A;  4BY7 H;  4DUY L;  1PYS B;  4XIG S;  4MTN A;  1N8R C;  4DV2 L;  5C0X G;  2HT1 A;  2CCZ A;  4A3L H;  2R93 H;  2CKZ B;  3KJP A;  1EQR A;  2I5H A;  3ER0 A;  1BBU A;  1L0W A;  5FJ8 G;  5FLM H;  3HOX H;  4LF4 L;  3HOY H;  4JYA Q;  2K4K A;  2WFW A;  4DK3 C;  1IBM Q;  1JJG A;  2WAQ E;  5C44 G;  4R4O A;  1VQC A;  3BZC A;  5ELN A;  1IBL Q;  4GN3 B;  2JEA I;  4A3F H;  1XJV A;  2OCE A;  4ME3 A;  2Z6K C;  3CC4 A;  2H5X A;  3AFQ A;  4DUZ L;  1FJG Q;  1K0R A;  3K7A H;  3CME A;  1EYG A;  3HOW G;  1YVC A;  2UUA Q;  4L5S A;  3S1Q H;  1PYB A;  2DGY A;  1XMO Q;  3CCL A;  1RL2 A;  4BY1 H;  4A3C H;  3A5Z B;  3EN2 A;  4X66 L;  2K14 A;  2PQA A;  1M1K C;  3U50 C;  1HNW L;  3A0J A;  5M5Y H;  1QUQ A;  1XPO A;  2K52 A;  1VQA A;  3RLO A;  4IPC A;  1EFW A;  2NVQ H;  3RZO H;  4LFB Q;  2IT1 A;  4JI8 L;  3M9B A;  4JC0 A;  4R4I A;  4AIM A;  5IE8 A;  2MNA A;  1HNX L;  4GNX B;  1SRU A;  3PUZ A;  4DV6 Q;  4DR5 L;  1Q7Y C;  1PH8 A;  3GTM H;  2UUA L;  4LFA Q;  5DLQ E;  4JI5 Q;  1Q46 A;  1IZ6 A;  1SR3 A;  1YIJ A;  3GTL H;  4IPG A;  2EQS A;  3NEL A;  4DR6 L;  2UUB Q;  1HZA A;  4DV4 L;  1VQH A;  3EIV A;  2JJQ A;  4B3R Q;  3I4M H;  4YCU A;  4TQU S;  2UUC Q;  1OTC A;  2K75 A;  1N32 Q;  4IJL A;  1PV4 A;  3AQQ A;  5IYC G;  1KC8 C;  1JMC A;  2KCT A;  4L5R C;  3DM3 A;  1XPR A;  2AWN A;  1J5E L;  2KHI A;  2RHS B;  5M5W H;  1E22 A;  3FP9 A;  5IT9 c;  3L0O A;  3H15 A;  1E7Z A;  4HID A;  4GN4 B;  1Q81 C;  2WB1 E;  2B3G A;  1OXV A;  1YBY A;  1VQ8 A;  3J7Z C;  4DV1 Q;  4HIK A;  4JI4 Q;  5K36 G;  1VQN A;  3J80 i;  1OXS C;  5IWA Q;  3OYY A;  1EWI A;  5GQO A;  2YTX A;  4OO1 G;  2JQO A;  1HNZ L;  1HR0 W;  1CSQ A;  1UE6 A;  2JA8 G;  2VQF L;  4AQY Q;  4A3D G;  2UXD Q;  2NN6 G;  2JEB I;  3LGJ A;  4DR1 L;  5M5X H;  4B3T Q;  4A75 A;  4X62 Q;  2N3S A;  3EBE A;  4DR3 L;  2IHF A;  1Y14 B;  4O0A A;  5IYC H;  4YHH Q;  3G71 A;  1YIT A;  1B8A A;  1G6P A;  2BA1 A;  1XNQ Q;  4A3E H;  4JOI C;  3HOU G;  2MO1 A;  4NXM Q;  1HR0 Q;  1V1Q A;  1E24 A;  1PFS A;  4AH6 A;  3J81 i;  2N49 A;  3STB C;  3KYH C;  2B63 H;  4LWC A;  4LF7 L;  1VCI A;  3BZK A;  5IYB H;  1XNR Q;  3S16 H;  4UY8 C;  3PIO A;  1CUK A;  1DGS A;  2R6G A;  1X6O A;  2JA8 H;  3M4O H;  4A93 G;  5C4X G;  4A3D H;  4JI7 L;  1JJC B;  5E7N A;  4BXX G;  3J7A 5;  1A62 A;  3I4N G;  3K80 C;  1X3G A;  1U0L A;  4NXM L;  3UDG A;  3S2D H;  4KHP L;  2UXB Q;  3RLN A;  1VQD A;  1KRT A;  2Z0S A;  4K0K Q;  4NXN Q;  1N36 Q;  3CMA A;  2XGT A;  3HOZ H;  3S15 H;  3E9H A;  4P73 A;  1UEB A;  2K5N A;  4B3M L;  1K73 C;  3NBH B;  1N34 L;  4A3K G;  4HIM A;  1I50 H;  3T1Y L;  3S1M H;  3TEH B;  2Q2H A;  3UE1 A;  1YEZ A;  4YY3 Q;  3B6Y A;  1UE1 A;  1X55 A;  3ULJ A;  4GOP B;  1N33 L;  3KDF B;  2R7F A;  2BH8 A;  4A93 H;  2UXC L;  3U4Z A;  1MIU A;  3GD7 A;  1UE5 A;  4A3M G;  1MKH A;  3KF6 B;  4PZ8 A;  5IYD H;  3A74 A;  2AWO A;  4C3H H;  3I4N H;  1P16 A;  1TWF H;  3ULP A;  2VUM G;  1K3R A;  2WB1 G;  3AYH B;  3HFZ B;  3PIP A;  1GM5 A;  4A3I G;  4LF4 Q;  4OWW B;  4IFD I;  2MFI A;  2WP8 J;  1I94 Q;  2JA7 G;  3I7F A;  1WCM G;  4B3S L;  2E8G A;  1X3F A;  3KF8 B;  3OW2 A;  1TXY A;  4NB3 A;  1S40 A;  4LW1 A;  3F1Z A;  4APV A;  4A3K H;  1KQS A;  4LFC Q;  3RR5 A;  1I5F A;  4OXP A;  4DUZ Q;  3U4V A;  1PH1 A;  2AKW B;  1AE3 A;  3JAM c;  1QZH A;  3TRE A;  4JI2 L;  1XMQ L;  1C0A A;  2LXJ A;  1C9O A;  3PUX A;  4AYB G;  2C35 B;  4GN5 A;  4PG3 A;  4A3M H;  3WWV A;  1YJW A;  1D8L A;  3AEV A;  4X66 Q;  2KBN A;  1I94 L;  1X54 A;  1I6H H;  3G48 A;  4GNX C;  2F4V L;  1HNW Q;  1FL0 A;  1P8L A;  1PHJ A;  1YHA A;  1UE7 A;  4EX5 A;  2Y0S G;  4A76 A;  2K5V A;  4DKA C;  4JI6 Q;  4LF6 L;  2JA7 H;  5JJL A;  1PH5 A;  1WCM H;  4LFC L;  5JJK A;  1X56 A;  4R4T A;  2PI2 E;  4JI8 Q;  4POF A;  1Y1V G;  2B29 A;  1HNX Q;  1VQ7 A;  4GKK L;  2FXQ A;  3OTO Q;  4DR5 Q;  4QGU A;  2PQA B;  1YZ6 A;  5C3E G;  1T9H A;  3M4Q A;  1L1O C;  5GAG C;  3STB D;  3HKS A;  1QUQ B;  1IXR A;  4PMW A;  3G6E A;  3HKZ E;  4KHZ A;  1K83 H;  1Q12 A;  2JA9 A;  1GD7 A;  2L15 A;  1KRS A;  4LF8 L;  1UWV A;  1VQ9 A;  3ICE A;  5M3F G;  4DV4 Q;  4DR6 Q;  5FJ8 H;  2PMZ E;  1D7Q A; 
#chains in the Genus database with same CATH topology
 4DU9 A;  4JI6 L;  1Y1V B;  4ZYS A;  5I2Y A;  1B9N A;  3NEN A;  3OTO L;  1J5E Q;  4OEM B;  4JI0 L;  5JEA J;  2NZO A;  3H3V C;  3GTJ B;  1TWC H;  1BVS A;  4TSS A;  3J80 L;  3T4A C;  5FLX E;  4EQ5 A;  3GTQ H;  1VQG A;  2E2H H;  2ZTC A;  1BF4 A;  4OIJ A;  3J7A F;  2EE1 A;  1PTO C;  2JA5 B;  3GTO H;  3GV3 A;  5E1F A;  4CDE C;  3KBX A;  2B2U C;  3E9I A;  3QR8 A;  5EPJ A;  4XQN A;  1U5K A;  3K6O A;  5ELF A;  1A2U A;  1LTG D;  3NTH A;  1G51 A;  2Z6K A;  2A8V A;  1A3U A;  3J81 L;  1BCP C;  2EXZ A;  3MZ5 A;  1K9M C;  2JK8 A;  2DNE A;  2NVY H;  3D6W A;  4F88 A;  1TWA B;  5DNF A;  1JE5 A;  1R9T B;  4JI7 Q;  4WRD A;  1HZC A;  5KNB A;  5IGE A;  4DAY B;  2IX3 A;  4BBS G;  1EZ8 A;  1AZQ A;  3FKI B;  1O7Z A;  4L5T A;  4RMF A;  1MJC A;  3KJO A;  4DR4 L;  4FDB A;  4B3M Q;  1N34 Q;  2PZU A;  1F2Y A;  4FO2 A;  5IGC A;  5M3M G;  5I2X A;  2E2I B;  5D14 A;  3NSW A;  3J7Y W;  3CCR A;  3TS0 A;  2FMC A;  2PQE A;  4A3B B;  1SDF A;  3LX0 A;  3F2B A;  3CP0 A;  2UXC Q;  2RQX A;  1VMP A;  4IPD A;  4ME5 A;  1S72 A;  2VW9 A;  1IBK L;  3MXG A;  2V1C C;  1O78 A;  5EAY A;  2G9D A;  2JSO A;  3S1N B;  1ENA A;  4OX9 L;  4H0L C;  1V9P A;  4XXE A;  3S14 H;  4PMC A;  4DNT B;  1CKM A;  4HN7 A;  3PF4 A;  1E2V A;  2K1B A;  1VQ4 A;  3H3V I;  1VQF A;  1EIY B;  2EYL A;  4DR7 L;  3H0G G;  3G7L A;  5TSS A;  1QB5 D;  3K7U C;  4JI2 Q;  1XMQ Q;  1OXX K;  3PO3 G;  2XRS D;  4PZ6 A;  4K6L A;  5BR8 L;  3M7N A;  5GAH C;  4XTC S;  1YNJ D;  2PNH A;  5CBA E;  1HQM C;  3ZYY X;  1STG A;  3OWE B;  4CKE A;  2QIL A;  4LF6 Q;  1CK1 A;  4KKU A;  4H13 C;  2YV5 A;  2G5D A;  4ALP A;  2M2L A;  4GKJ L;  3Q8D A;  3HOY G;  1HH2 P;  4LF8 Q;  3ND9 A;  3I3C A;  4KN7 C;  5E4X A;  4C3I B;  1HZ9 A;  1STH A;  2VUM H;  2CWP A;  3FHW A;  3J80 E;  2HQL A;  3WOF A;  1YJN A;  3D4R A;  1D5Z C;  3SE0 A;  4JBM A;  1QWY A;  2SNS A;  1A2T A;  1ONL A;  2EYM A;  3W1G A;  4JI1 L;  4WFN 3;  4LF9 L;  2MO0 A;  4DK6 C;  3HOX B;  4JI0 Q;  4JCV E;  1VS0 A;  2EY1 A;  2PW7 A;  3CPF A;  3D3R A;  2O5I C;  3DEP A;  3J81 E;  1JWM D;  1A6X A;  1KAB A;  1Q82 C;  1E2W A;  2A19 A;  2RDF A;  4BY1 B;  5CV6 A;  3NWS A;  2B2T C;  3L3O C;  1SSO A;  4X6A H;  3RLF A;  3UE0 A;  3E3X A;  5A2Q L;  2GA4 B;  1Q86 C;  4CJ1 B;  3I4M G;  5L37 A;  4GZY C;  1ZXT A;  1VQM A;  3D31 A;  2N78 A;  3BDL A;  5M3F H;  1VQ6 A;  1CTM A;  4B9W A;  3GTM B;  1O7I A;  1GO3 E;  3MEH A;  2HCC A;  2ES2 A;  4QQB X;  2D0P A;  2KUM A;  4BBR H;  1KHI A;  5EJW A;  4Q5V A;  4CKB A;  1VQK A;  3S17 H;  2Z9H A;  4G7H C;  4DR4 Q;  1AFP A;  1TT2 A;  4LFB L;  4CDF C;  4N9P A;  4EQP A;  4DV6 L;  3VDY A;  4A3E G;  1RD9 D;  2D2C C;  2VQE Q;  1PZI D;  1TS4 A;  1KTK A;  1IBK Q;  4HSV A;  1ILP A;  3JAM i;  3HZX A;  4ULL A;  4B3R L;  2RCF A;  4RG1 A;  1G2T A;  1CZW A;  4H02 A;  1XXG A;  3S2H H;  4NKL A;  2N8N A;  1ZYR D;  4JBJ A;  3TZD A;  3Q23 A;  2K50 A;  4R4C A;  3V2T A;  4IN3 A;  4YWM A;  2KCM A;  4GLX A;  1B3Q A;  4DR7 Q;  2OQK A;  2B63 B;  2K28 A;  1LUZ A;  2HDM A;  4BBS H;  3HOZ G;  4EQN A;  3A8I E;  1R4Q B;  2ZTD A;  3UDX A;  2UXD L;  4P75 A;  3QG1 A;  3D4W A;  3NPP A;  2QGQ A;  4YHH L;  5JPN C;  5M3M H;  5IYD G;  3PCO B;  2VZA A;  4DR2 Q;  2OTJ A;  4X3K A;  3K58 A;  4GKJ Q;  3S1M B;  1XPU A;  2NZH A;  1CA6 A;  2EOT A;  2BH2 A;  3CRK C;  3K5O A;  3ONA B;  1H9M A;  1A63 A;  4HJ8 A;  1WD1 A;  4L6T B;  3GO5 A;  2AMC B;  4KY5 A;  3I4N B;  1CKN A;  4OGQ C;  4C3H B;  4JI1 Q;  1PH9 A;  1B7Y B;  4LF9 Q;  2XSC A;  3CXC A;  3DXJ C;  4BA1 I;  5CBE E;  3VA5 A;  5JEA H;  5A2Q E;  4GOP A;  1IKM A;  2ASB A;  4K0K L;  1NTG A;  1N36 L;  1DM0 B;  4F8M A;  1LYL A;  3CCM A;  1HRJ A;  4QJF A;  4HSP A;  3OPO A;  1M8A A;  2IWH A;  2WKD A;  4HIO A;  1AW7 A;  2A6E C;  3JC6 6;  3GDE A;  3U9S A;  1YNX A;  3LWU A;  2DNC A;  4DUY L;  1QCB D;  4MTN A;  3IKJ A;  1PFN A;  4X3T A;  2CCZ A;  2B2W C;  1L0W A;  4DF7 A;  5FJ8 G;  4LF4 L;  3HOY H;  2N88 A;  4O42 A;  1WCM B;  1G2S A;  4KTA A;  1VQC A;  4GN3 B;  1XJV A;  1BDO A;  3X3M A;  2ICI A;  3CC4 A;  1A3V A;  4DUZ L;  5I9P A;  1TS3 A;  3K5N A;  3CME A;  1TS2 A;  1YVC A;  3S1Q H;  1GUS A;  1RF2 D;  2QF7 A;  4X66 L;  1UUP A;  1HNW L;  2A73 B;  1CFM A;  5M5Y H;  3MFG A;  1VQA A;  1F2Z A;  4LFB Q;  4JI8 L;  3M9B A;  5IE8 A;  4R4I A;  1HNX L;  2QW7 A;  2B8G A;  4DV6 Q;  1TWC B;  3FPU B;  5DLQ E;  1S4Z A;  1SR3 A;  3GTL H;  1QE6 A;  4H7B A;  4DV4 L;  1VQH A;  3EIV A;  1TY0 A;  1DD2 A;  3GTQ B;  2F4I A;  2MJ8 A;  3I4M H;  4B3R Q;  2E2H B;  2Z4H A;  1PRT F;  3BG3 A;  3OHX C;  1PV4 A;  3GTO B;  1SAP A;  2KCT A;  2CW0 D;  4RKB A;  3C2P A;  2RHS B;  3FP9 A;  5LL6 S;  4RHR A;  1E7Z A;  4HID A;  1ICF B;  2ENB A;  1OXV A;  2L0C A;  1VQ8 A;  4OL7 A;  5K36 G;  1OXS C;  3BDC A;  5LHY 1;  2F0K A;  2NVY B;  1Y8N B;  2F0U A;  4EVO A;  2EYH A;  2UXD Q;  2K5W A;  5IGG A;  4DR1 L;  2EVB A;  1EFI D;  1NSN S;  5CYU A;  1AN8 A;  4O0A A;  4YHH Q;  3G71 A;  1JQY D;  1F2L A;  1UAP A;  2BA1 A;  5NUC A;  4A3E H;  3HOU G;  2RA4 A;  1CQV A;  4AH6 A;  2LKV A;  3KYH C;  2L1B A;  3S16 H;  4UY8 C;  1CUK A;  2R6G A;  2JA8 H;  1X6O A;  4A3D H;  1PYW D;  2G9H D;  4BXX G;  3I4N G;  3K80 C;  4C3H G;  2F0P A;  2QDB A;  3S14 B;  3S2D H;  3FDT A;  4K0K Q;  1N36 Q;  4NMZ A;  2A6H D;  3CMA A;  3HOZ H;  3TDQ A;  1I50 H;  3TEH B;  1YEZ A;  2NBF A;  1LTI D;  4GOP B;  1SYD A;  3K59 A;  4B08 A;  2X6G A;  2SDF A;  1EEI D;  1MIU A;  4A3M G;  4PZ8 A;  5IYD H;  4KJN A;  5C5M A;  3AYH B;  2MUY A;  1QG7 A;  1KLU D;  3PIP A;  4A3I G;  4LF4 Q;  1I94 Q;  2JA7 G;  1WCM G;  3TP8 A;  4B3S L;  3KF8 B;  1AP0 A;  2F1M A;  4ABN A;  1FYC A;  4LW1 A;  3F1Z A;  4J6H A;  3RR5 A;  4DUZ Q;  1AE3 A;  1STY A;  1QZH A;  2RBM A;  4G57 A;  4RGO S;  2VUM B;  4ID6 A;  2WB1 B;  3A7L A;  2LXJ A;  5JOB A;  1GUO A;  3PUX A;  1YJW A;  1D8L A;  4X66 Q;  4PNY A;  4N8F A;  4P2C B;  1I6H H;  3G48 A;  2F4V L;  3O13 A;  1HNW Q;  3MTS A;  1P8L A;  1YHA A;  1UE7 A;  2Y0S G;  5FKA C;  4DKA C;  1TKW B;  4LFC L;  1LV9 A;  1X56 A;  4JI8 Q;  4GKK L;  1HNX Q;  3FMC A;  4FF2 A;  3N52 A;  4QGU A;  5GAG C;  3STB D;  3HKS A;  4PMW A;  1K83 H;  1KNA A;  1Q12 A;  1ENF A;  1GD7 A;  1KRS A;  2JA9 A;  5BN3 A;  1B4O A;  4DV4 Q;  2FMM A;  5FJ8 H;  1G29 1;  4ZKC B;  2AUK A;  4DAV A;  1JC7 A;  1NBW A;  2F0O A;  5IP9 G;  1PH7 A;  4C1N I;  3L9A X;  5M3F B;  5FLX c;  2A1A A;  2DN8 A;  1WOC A;  5D3I B;  3GTK B;  2HDL A;  1GJX A;  2UU9 L;  1VMC A;  5DEH A;  1L0X B;  1QZG A;  2NWG A;  1Y69 U;  3AU7 A;  2F0J A;  1Q1B A;  3I8Z A;  2GVB A;  1MSG A;  4DR1 Q;  1HJP A;  2IJ0 A;  4A3G G;  3I73 A;  3L7Z C;  1KAW A;  5C0X I;  4QL5 A;  1KNE A;  2E76 C;  2KEN A;  2RCN A;  1TII D;  4UP7 A;  4YWL A;  3S17 B;  3LNN A;  4TVA B;  2F0W A;  5HY6 A;  2HCI A;  4CKC A;  5C3X A;  5BN5 A;  4MNO A;  3GV6 A;  2EJM A;  4DGZ A;  1QJO A;  5IY0 A;  3W5O A;  3H09 A;  1WTP A;  3TRZ A;  4DA2 A;  3H3V H;  4QF4 A;  1TWG H;  3GQB A;  3S2H B;  1XTD A;  5K36 H;  1Y8P B;  1IW7 C;  2ZTE A;  3S9W A;  2NZ1 D;  2F3I A;  2QA4 A;  5IP7 G;  1PTO H;  4O2D A;  4DNI A;  4LF5 L;  3I70 A;  4K5V A;  4DV7 L;  4BBS B;  4I65 A;  2F0V A;  1BBX C;  3S1R H;  2KVM A;  3BVZ A;  3HOU H;  2OXP A;  5GAD C;  2TSS A;  1S5D D;  2VY3 A;  2K5H A;  2OWO A;  2DY8 A;  4B3S Q;  5M3M B;  2GVA A;  3HOV G;  4IUR A;  1YHB A;  1PA6 A;  1ZEQ X;  2F0H A;  2JA6 G;  4BXX H;  1H95 A;  5ELD A;  4C2M H;  2VS1 A;  2R7Z G;  4IPH A;  4R4Q A;  3BVM A;  3K0X A;  5KEE A;  2F4V Q;  1PTO D;  2ZJR A;  2O4X A;  3R93 A;  4BY7 G;  2MQH A;  1WTR A;  4K8J A;  4GKK Q;  4JOI A;  2F52 A;  3U58 A;  5G3L D;  3F2D A;  1X3Q A;  3J80 c;  1DCZ A;  4OHJ A;  1VQP A;  4KK7 A;  1BCP D;  2YYZ A;  4LAA A;  1PFM A;  4DV5 L;  1B44 D;  5IGB A;  4A3F G;  2VB3 X;  5GAE C;  4A3I H;  3M7G A;  1SE3 A;  2LS0 1;  3HP3 A;  1NR2 A;  4ZQ3 A;  2LSS A;  4FF1 A;  3HOY B;  4KKS A;  1STB A;  2BDO A;  5COY A;  2F3W A;  3D4D A;  3J81 c;  3I4O A;  1H9R A;  1BBW A;  1SE2 A;  2UU9 Q;  3RD4 A;  3HGB A;  1S5F D;  2F0T A;  3CAM A;  3ZJY C;  2ZM6 L;  2EYF A;  3MHB A;  3OMC A;  2ALY B;  3SR1 A;  3CHB D;  3S1Q B;  2D62 A;  2E74 C;  2PNR C;  2AUJ D;  4BBR G;  5KGU A;  1BQQ T;  2FIN B;  3FPP A;  1JR0 D;  4KKT A;  4ZUI A;  3L2P A;  4CJ0 B;  5M5Y B;  4JYA L;  1EYA A;  3MEF A;  3AB9 A;  1U4L A;  1IBL L;  2K6A A;  5ISR A;  3MC0 B;  5FO9 B;  4XT1 B;  3KFU A;  3GTL B;  4NPS A;  2L4N A;  2HQE A;  5T1G A;  4V19 0;  1Q8K A;  4UPA A;  3I4M B;  1QOH A;  2F0Q A;  5IP9 H;  1B53 A;  5EPL A;  3PMF A;  2F0N A;  3CCQ A;  1WTH A;  4FXG C;  1EU3 A;  3FRP B;  4OON A;  2NVT H;  3MVV A;  3URY A;  4LF5 Q;  4DV7 Q;  4DAP A;  1LAC A;  1TY2 A;  4A3G H;  1D5M C;  5C0X J;  1TWH H;  3U9O A;  4BA2 I;  5LL6 X;  1BR9 A;  3CF5 A;  2MGS A;  1D5X C;  1X3P A;  2CWA A;  1EY0 A;  2DUD A;  5IYB G;  3IRB A;  1CI3 M;  1ICW A;  1N32 L;  3SHL A;  5ELC A;  3M85 A;  1DXM A;  4LNQ A;  4A3E B;  3VYS A;  3K81 C;  3PUV A;  2VQE L;  5HGQ A;  2L55 A;  3OIQ A;  1KL9 A;  1M4V A;  1WI5 A;  4DV1 L;  3S16 B;  5IWA L;  4IJH A;  2Y0S E;  2IL8 A;  1WD0 A;  2I46 A;  4AQY L;  3RZD H;  4RWS C;  2PPB C;  2RHQ B;  5IP7 H;  4X62 L;  3S2D B;  5EBC A;  2B2U A;  3TP5 A;  5JEA G;  1XNQ L;  4KI0 A;  1MI2 A;  1KD1 C;  3HOZ B;  1SYE A;  2ZJP A;  4MN3 A;  1D1K A;  1LTS D;  4V0B A;  1I50 B;  4M1U B;  2SEB D;  4DV5 Q;  3MA2 B;  3RN5 A;  4WJ4 A;  1STE A;  1T5X D;  1VQJ A;  3EA6 A;  4PMB A;  2RVL A;  3DLL A;  4NDX A;  3FEW X;  3DMU A;  3HOV H;  1DON A;  3HG9 A;  4DR2 L;  5HGT A;  3A56 A;  3D0F A;  2AQ2 B;  2JA6 H;  3IAY A;  3WOE A;  4ZCK A;  1LTL A;  1O7L A;  3KDF A;  2KHJ A;  4NXN L;  4XYQ A;  2CH4 A;  4JVZ A;  5ELB A;  1YI2 A;  1SNP A;  4IUT A;  3CCE A;  2R7Z H;  1GVP A;  3R3O A;  2ZM6 Q;  1NR4 A;  1HQR D;  4BY7 H;  1DYQ A;  1EY5 A;  1RHP A;  3ITP A;  1N8R C;  1I6H B;  5C0X G;  1STN A;  2HT1 A;  2KA7 A;  2R93 H;  3KJP A;  1EQR A;  4JYA Q;  3NUC A;  4QUF A;  1WTX A;  2WFW A;  1SNO A;  5C44 G;  4R4O A;  1IBL Q;  5JJZ A;  2JEA I;  4A3F H;  3TSS A;  1ENC A;  5DM7 3;  2X69 A;  3AFQ A;  1K83 B;  3K7A H;  5AFW A;  4LMQ D;  3NWT A;  4RCN A;  1TQO A;  4L5S A;  1PYB A;  3CCL A;  1RL2 A;  4DXF A;  3A5Z B;  3OMG A;  4FVM A;  3U50 C;  3K5M A;  2KHS A;  3E6Z X;  1STA A;  4G7O C;  2PYK A;  4IQZ A;  4JC0 A;  5CV9 A;  2MNA A;  1XYI A;  1Q7Y C;  4DR5 L;  1PH8 A;  3T53 B;  3D8G A;  4BS9 A;  5KIX A;  1LT3 D;  5ELE A;  4G7Z C;  1YIJ A;  2WII B;  1HZA A;  2KQ3 A;  4TQU S;  3JAM L;  1OTC A;  1EYD A;  5IGF A;  1N32 Q;  4IJL A;  5JVG 3;  3AQQ A;  1JMC A;  1KC8 C;  4L5R C;  4DN4 M;  2RDG A;  3NXW A;  5M5W H;  1E22 A;  5IT9 c;  2PZT A;  4ZAI A;  2L5T A;  2NTT A;  4EQO A;  2WB1 E;  4I7Z C;  4DV1 Q;  1DOM A;  4QIW B;  1LTA D;  2NUC A;  4TKO B;  1VQN A;  3KK7 A;  5KYI A;  3OYY A;  5IWA Q;  3NP8 A;  2YTX A;  4RKL A;  2A6E D;  1SND A;  2F0E A;  2JA8 G;  1HXY D;  1V8Q A;  2VQF L;  4AQY Q;  4A3D G;  2B2T A;  1EYC A;  1TWG B;  4A75 A;  4L8J A;  4X62 Q;  2RSN A;  3QJY A;  1G6P A;  3BYT B;  3W3A A;  1XNQ Q;  4CBV A;  1WTV A;  1V1Q A;  1PTO B;  2JYO A;  4WJW A;  3TN2 A;  4LWC A;  1VCI A;  5IYB H;  5C5L A;  1HUM A;  1DGS A;  4IUQ A;  3M4O H;  3S1R B;  5IOD A;  1CHQ D;  1JJC B;  1E0B A;  5E7N A;  3HOU B;  3DHQ A;  4M8A A;  1U0L A;  1BCP B;  4KHP L;  4C3J G;  5CV5 A;  1VQD A;  1IYU A;  1KRT A;  5IT9 L;  4NXN Q;  5K5P A;  3E9H A;  1JOR A;  5CV4 A;  4HIM A;  3NQI A;  2Q2H A;  4ODG A;  3NBI A;  1X55 A;  1N33 L;  1NCV A;  3KDF B;  4C2M B;  4A93 H;  4X3U A;  1SYG A;  1UE5 A;  3SK8 A;  1CHP D;  1CM9 A;  1MKH A;  1U9R A;  1SNQ A;  3A74 A;  2AWO A;  1TWF H;  1D6E C;  4FXK C;  2C9O A;  3ULP A;  1K3R A;  4HAE A;  1GM5 A;  5C4Z A;  4IFD I;  1B2T A;  1CQF A;  5EPK A;  1TXY A;  2EPB A;  1K8M A;  4NB3 A;  2F0S A;  1S40 A;  1KQS A;  1RTO A;  4A3M B;  4OXP A;  3KF8 A;  1PH1 A;  4EGV A;  3TRE A;  4A3I B;  1BNZ A;  1C9O A;  1AEX A;  4AYB G;  4GN5 A;  3WWV A;  2JA7 B;  1I94 L;  2V4D A;  1X54 A;  4HED A;  4NP5 A;  3JAM E;  4GNX C;  2ZXO A;  4ILW A;  4QMG A;  1QNK A;  3HS0 C;  1PH5 A;  2PI2 E;  4Q0F A;  3KLR A;  1RCV D;  1BOS A;  2F03 A;  4DR5 Q;  1J9O A;  1YZ6 A;  2H1E A;  2YU9 H;  1L1O C;  3G6E A;  4HTH A;  4KHZ A;  2L15 A;  3ICE A;  5C0X H;  1VQ9 A;  1KDB A;  2PMZ E;  2Y0S B;  1JT8 A;  1SYC A;  4K2L A;  4KD3 A;  1WFQ A;  2KED A;  5C44 H;  4A3J G;  5FOB B;  1B50 A;  4GLA C;  3SK6 A;  2B2V C;  2Z1C A;  1GKH A;  1K8G A;  3F2U A;  1WTW A;  5ELO A;  1C4Q A;  1Z9F A;  3E0J A;  1S5C D;  3C1E A;  3RN2 A;  3CC2 A;  2DJF C;  3VYR A;  2JE6 I;  4MZ9 A;  5C3E H;  1C7Y A;  1KAA A;  5FK9 C;  3G6J B;  5EBD A;  2YTY A;  2VQF Q;  4FXD A;  2XTI A;  2A68 C;  3P75 A;  2FJ2 A;  3A8K E;  3I55 A;  3HEJ A;  1ET6 A;  3OWF A;  2B2W A;  1QNU A;  2I07 B;  1JJ2 A;  3PO2 H;  2E5L L;  2WAC A;  1Y1W G;  3E0E A;  2XN9 C;  5IT9 E;  3TP7 A;  2NVT B;  2MPM A;  1L0Y B;  4MTK A;  4GS3 A;  3DWQ A;  4FNF A;  4X3S A;  4A3G B;  1X9N A;  2R92 G;  2WAQ G;  3Q22 A;  1I4X A;  2AQ3 B;  2LMC B;  5C6A A;  1I6V C;  4QUC A;  2J4X A;  1TWH B;  1E2Z A;  2ID0 A;  3S24 A;  1PLF A;  2SNM A;  3RUZ A;  5LMU L;  3CC7 A;  3IFD A;  4KHP Q;  4LUV A;  1NJI C;  3CCJ A;  1FD7 D;  2CQA A;  1MBY A;  3IL8 A;  1U4R A;  1MJE A;  1UNS A;  2QKI C;  4IAL A;  1N33 Q;  4J1M A;  1ML0 D;  1EQT A;  3MFY A;  2PZW A;  1OXT A;  4L63 B;  3SEB A;  3M3Y H;  3GP7 A;  2XNA C;  2PI2 A;  3RZD B;  1RIP A;  4ZKB B;  1I4Q A;  3T1H L;  3TS2 A;  1HFG A;  1PH6 A;  1V1O A;  2Q2T A;  2DJG C;  1VF5 C;  3S1N H;  1E1T A;  3PUY A;  3PF5 A;  3QOL A;  1PRT C;  4G4K A;  4OO1 I;  1O7Y A;  2KJX A;  1LTR D;  4C3J H;  1MD2 D;  1TS5 A;  3T16 A;  3HOV B;  5EKI A;  4R1J A;  1NMG A;  2KEC A;  2KOL A;  4JI3 L;  2JA6 B;  2RDH A;  5CC4 A;  1YJ9 A;  1A3T A;  4A3L G;  4UP8 A;  2NVX H;  5FLM G;  2R7Z B;  5I9O A;  1YNN C;  3PIP 3;  3ERQ A;  5CV7 A;  1FNV A;  4HCS A;  2D0O A;  4C1N K;  4BY7 B;  4IFD J;  2BCO A;  4K14 A;  3A5U A;  1F9Q A;  1ESF A;  4UAI A;  1GUG A;  2R93 B;  1ESR A;  2ZJQ A;  2I5L X;  2R3Z A;  1IW7 D;  4HJ5 A;  4XQQ A;  5LMN L;  4A4I A;  4X65 L;  4A3F B;  4JBK A;  3ND8 A;  2B2Y C;  1OXU A;  4JG2 A;  3K7A B;  4RH6 A;  1EOV A;  2VXW A;  3KLS A;  4JBW A;  4P74 A;  3I56 A;  1E1O A;  2I5M X;  4YCW A;  2E5L Q;  5M9O A;  3J81 j;  1SMX A;  3DEO A;  1E3P A;  1IBM L;  4S3S A;  1CZG A;  4QCL A;  1EEF D;  2A69 C;  1IL8 A;  1JE4 A;  2AQ1 B;  2Z8L A;  1SNC A;  4BBR B;  1SN8 A;  2XIW A;  1DOL A;  4A3J H;  1RKN A;  1ROD A;  3Q0A A;  5LMU Q;  1CSP A;  1TU2 B;  2CH4 W;  3ERO A;  2LFN A;  4QY7 A;  1X32 A;  1HTP A;  1PH4 A;  3BU2 A;  5M5W B;  4KHV A;  1L1O B;  3NTK A;  3AFP A;  3ERS X;  1FR3 A;  4JI5 L;  2L11 A;  5A35 A;  3GTP H;  2DY7 A;  2UUB L;  4UHV A;  1F77 A;  4R8I A;  1Y1W H;  1Z7T A;  1PH2 A;  1N9W A;  3HKZ G;  2QCP X;  3T1H Q;  1AE2 A;  2VNU D;  4IFD G;  1ZKO A;  1SE4 A;  4KN4 C;  2R92 H;  3C3L A;  1EOT A;  2IX0 A;  1C8C A;  3I90 A;  1ASZ A;  3KUP A;  4AYB E;  1O80 A;  4YWK A;  2RF4 A;  4Y7N H;  1U4M A;  1BXT A;  2A74 C;  3M4O B;  1SMY C;  2PMZ B;  1RDP D;  5J3B A;  5E3F A;  2CHB D;  2OEO A;  4HMJ A;  4B3T L;  1EY4 A;  4JI3 Q;  1T5E A;  1W6K A;  3H91 A;  4IUV A;  1QVF A;  5EKK A;  4F87 A;  1HR0 L;  3VR6 A;  3K0Y A;  3PSI A;  4XQJ A;  1F9P A;  1I3Q H;  4CGY B;  4P71 A;  3I2Z A;  2JN4 A;  3A8J E;  5EKL A;  4DK0 A;  2OT2 A;  2XVS A;  4RGN A;  4DXG A;  4OIK A;  3DWP A;  4A93 B;  2HIV A;  1F9S A;  1KXL A;  1JOQ A;  4ZRZ A;  1TWF B;  3J7A V;  4UDU C;  2R93 G;  3KLW A;  1Q8I A;  2UXB L;  3OOC A;  4DV2 Q;  1GUT A;  4KJO A;  4PZ7 A;  4QIW E;  1G8Z D;  5C4H A;  5I6W A;  2K33 A;  5LMN Q;  2NB0 A;  4R8N A;  4X65 Q;  1PTO F;  1JWU D;  3KF6 A;  1WJJ A;  4K5X A;  3GTG H;  1F2M A;  1DZ1 A;  2BA0 A;  1HUN A;  1LO5 D;  1A8V A;  5G3L F;  1VF7 A;  3M4Y A;  2K5D A;  1BCP F;  4A3L H;  2IW3 A;  2QEJ C;  3ER0 A;  5FLM H;  4JW0 A;  2K4K A;  4DK3 C;  1IBM Q;  2WAQ E;  3BZC A;  5ELN A;  1PXU A;  2D9U A;  2OCE A;  2Z6K C;  3P1H A;  2YU9 B;  1S5B D;  5I4D A;  1EYG A;  5CMD A;  3HOW G;  4TRD A;  2UUA Q;  2DGY A;  2L9H A;  3QIA A;  5C44 B;  2PQA A;  1M1K C;  2EDG A;  3A0J A;  1EU4 A;  2K52 A;  4O1N A;  2NVQ H;  3RZO H;  4AIM A;  1SRU A;  5C3E B;  3PUZ A;  4KV6 A;  3EQL C;  3Q6S A;  4JI5 Q;  4IPG A;  3RMH A;  4DR6 L;  2UUB Q;  1EQV A;  2JJQ A;  4IZ8 A;  3VYT A;  4YCU A;  1EY7 A;  1V1P B;  1Q3L A;  1LTB D;  1TVX A;  1PFB A;  4LK1 C;  3FVQ A;  3PO2 B;  4RCO A;  1XPR A;  2AWN A;  3H15 A;  1WTO A;  2B3G A;  1YBY A;  4HIK A;  1TR5 A;  2XWB B;  2VB2 X;  3J80 i;  5GQO A;  1EWI A;  4OO1 G;  1HNZ L;  3OW7 A;  1CSQ A;  3QB3 A;  1UE6 A;  1K8O A;  2JEB I;  4B3T Q;  5M5X H;  4DR3 L;  5IYC H;  1H9J A;  2RKS A;  1YIT A;  1B8A A;  5D65 A;  4NXM Q;  1HR0 Q;  3SXH A;  3QOJ A;  5IIF A;  2BE5 C;  1PFS A;  2JA8 B;  1FGB D;  3J81 i;  4A3D B;  2KCC A;  4K6D A;  3Q24 A;  4LF7 L;  3BZK A;  3PIO A;  4IFD H;  3EJI A;  4A93 G;  5C4X G;  3M3Y B;  2N55 A;  1WTQ A;  2ICE C;  1A62 A;  2JXM B;  1I4G A;  2NN6 H;  4R9W A;  1K28 A;  1X3G A;  2XRQ D;  2UXB Q;  2Z0S A;  4MHE A;  1EIH A;  2XGT A;  3S15 H;  4P73 A;  1UEB A;  1K73 C;  5KRU A;  1B1Z A;  3T1Y L;  1IHZ A;  3KLS X;  3UE1 A;  3PIO 3;  2EJG C;  3B6Y A;  1G6Z A;  3ULJ A;  2XWJ B;  2PCF B;  2R7F A;  1FNW A;  3U4Z A;  4C3J B;  3GD7 A;  3IFT A;  3KF6 B;  1PDQ A;  2SOB A;  3PQI A;  1P16 A;  3MXN A;  2F0F A;  3TP6 A;  1LLR D;  4OWW B;  2MFI A;  2WIN B;  2WP8 J;  2X6L A;  4FF4 A;  4K2K A;  1X3F A;  1VDZ A;  3OW2 A;  3VA7 A;  2NVX B;  2K5Q A;  4APV A;  2J7Z A;  4A3K H;  1I5F A;  3DM1 A;  3JAM c;  5CV8 A;  5J39 A;  1EWC A;  3AEV A;  1SEB D;  1NAP A;  2KBN A;  2R61 A;  1FL0 A;  1NNX A;  1PHJ A;  1FNU A;  4A76 A;  2K5V A;  4JI6 Q;  2K04 A;  1VQ7 A;  4POF A;  1Y1V G;  4HMI A;  2EY2 A;  3MWY W;  4HR7 B;  3OTO Q;  1HA5 A;  4AYB B;  2PQA B;  5C3E G;  1T9H A;  2ZXP A;  3C46 A;  5JJI A;  1JJG A;  1IXR A;  3HKZ E;  4CHT B;  5DM6 3;  4DR6 Q;  4K8I A;  2EY6 A;  1SLJ A;  1K0S A;  2LY7 A;  2HIX A;  1SFO H;  4OEL B;  3EVQ A;  2GN5 A;  3VYU A;  3PO2 G;  1EIF A;  2CQO A;  2QEX A;  4YCV A;  2M9V A;  4LJZ C;  5GRO A;  2JA5 G;  3HOW H;  3TME A;  1QVC A;  4MIU A;  2YTV A;  3CU7 A;  1MSH A;  4A3J B;  1HNZ Q;  3GTK H;  1EY6 A;  1MGS A;  4U68 A;  3SVM A;  2E2J H;  3NHH A;  4IUP A;  4IO9 A;  1KDC A;  1YNJ C;  1X65 A;  2Z4I A;  4DR3 Q;  3UDI A;  1S5E D;  3CRL C;  2I0Q A;  2WKC A;  1HFN A;  2ZT9 C;  3I72 A;  1KLG D;  1EY9 A;  3VR2 A;  2PW5 A;  4HJ9 A;  4H44 C;  2HHH L;  4OWX B;  3FKI G;  4HJA A;  1SBB B;  3H94 A;  1GHJ A;  4LF7 Q;  3F8T A;  3CQZ H;  1AH9 A;  3GTP B;  2KEE A;  4DPG A;  4KY7 A;  4UP9 A;  1Y1W B;  2HUG A;  4JV5 L;  4KLK A;  2L12 A;  4A3B G;  4KMU C;  2E2D C;  1VQI A;  5H1S E;  4GOP C;  5D3D A;  4DV3 L;  2R92 B;  2WAQ B;  4OX9 Q;  3F2C A;  1HPC A;  4IOC A;  3A54 A;  5KYL A;  4OO1 H;  1X3E A;  2AHO B;  1M90 C;  3T1Y Q;  2PO4 A;  4Y7N B;  1VQO A;  3HRZ C;  3PV0 A;  5J1Z A;  1LT6 D;  3CD6 A;  5AJ3 L;  3C1F A;  2EIF A;  1PVO A;  4OWT B;  3VR4 A;  1V43 A;  1YHQ A;  1UEA B;  5BR8 Q;  1FVI A;  4HCE A;  2Q2U A;  4FF3 A;  2ATW A;  1JOO A;  3G4S A;  2F0I A;  1PZK D;  1FGU A;  2K05 A;  5EQ0 A;  5C4X H;  3MXN B;  4Z9C B;  1I3Q B;  1OO9 B;  5C3W A;  3VR3 A;  3KBG A;  3K8A A;  2A68 D;  4C3I G;  2IHE A;  3NQT A;  2Q2I A;  3CKI B;  2NN6 I;  1SE8 A;  1SJE D;  2MP1 A;  4WOR A;  1D2B A;  1Q90 A;  3NTI A;  1EY8 A;  4DV0 L;  2CVR A;  3T56 B;  3K5L A;  3HOX G;  5COR A;  3H0G H;  1RTN A;  4CDD C;  3GTG B;  3QO2 A;  4U67 3;  1LT4 D;  4WJ3 M;  1PMR A;  3PO3 H;  4QB4 A;  1VQE A;  1A15 A;  4RFB A;  1U4P A;  3CW2 C;  4N9T A;  2ZXR A;  1GHK A;  4LUO A;  3TZU A;  5FO8 B;  4BY1 G;  4X64 L;  1ZYR C;  4A3C G;  1ILQ A;  1IL2 A;  2VL6 A;  1NMF A;  3CPW A;  5C4J H;  3BJU A;  1EUJ A;  3UDF A;  3H6M A;  1J6Q A;  3BYY B;  3EFX D;  4KY6 A;  3BDO A;  5F2D A;  2R7D A;  3TBI B;  3BS1 A;  1Y1V H;  2F0D A;  4XDX A;  1B70 B;  1EL0 A;  4POG A;  1EQQ A;  4KD4 A;  4Y52 H;  4ZK9 B;  2MHV A;  3W1B A;  2NVQ B;  3RZO B;  3WDN A;  4FP5 D;  2HHH Q;  1C48 A;  1I4H A;  1DJR D;  3ULL A;  2EJF C;  3GTJ H;  4L5Q A;  1HZB A;  1Z47 A;  1PRT D;  1SYB A;  3NEM A;  4J15 A;  5I6Y A;  1FJG L;  3SGI A;  3CCS A;  4JV5 Q;  2F3V A;  1XMO L;  2IPK D;  1BKB A;  3KOJ A;  4JPB W;  4GNX A;  2JA5 H;  2D5D A;  1VQL A;  1QIL A;  1IYJ B;  1NUC A;  3SK5 A;  5BN4 A;  4DV3 Q;  5CR3 A;  2CFM A;  3D6C A;  2KCN A;  1DOK A;  1BO0 A;  3R8B A;  2OTL A;  1R4P B;  1L1O A;  1YNN D;  1JIC A;  4LFA L;  3BZD B;  2EYP A;  1NE3 A;  1TWA H;  4BWG B;  1R9T H;  2EXD A;  3DUZ A;  1F9R A;  1S3O A;  2B8F A;  1JB3 A;  3PGZ A;  5AJ3 Q;  2B63 G;  1Y8O B;  2UUC L;  4NW2 A;  4J8Q A;  5M5X B;  5E4W C;  5IOC A;  2H4O A;  2B2V A;  1K8A C;  3FKI H;  1VQB A;  4PV1 C;  3TQY A;  1Q1E A;  1LTT D;  2K01 A;  3M4P A;  1HHV A;  2NTS A;  1XTC D;  4IOA A;  1QVG A;  4JI4 L;  1KDA A;  2F0G A;  3HKZ B;  2E2I H;  4A3B H;  1SRO A;  2OQ0 A;  1K3B C;  1L2F A;  4XT3 B;  1IYV A;  4HJ7 A;  4DAM A;  1VQ5 A;  3CCU A;  3T13 A;  4P72 A;  4DV0 Q;  3RNU A;  3K57 A;  3S15 B;  1KIX A;  1A0I A;  2A69 D;  3A7A B;  4GLV B;  2Q8I B;  2LXK A;  3CCV A;  5JAV A;  3E5S A;  4IUU A;  1W2B A;  1CKO A;  1WVL A;  1CKN B;  5LMN W;  1XNR L;  3PUW A;  4LUZ A;  1I4R A;  2IY5 B;  5J22 A;  4RGM A;  5KNC A;  1LM0 A;  2J0T D;  1WYD A;  3MXU A;  4DUY Q;  3NBH A;  1XX8 A;  4XYO A;  4X64 Q;  2CW0 C;  3AMU A;  1G91 A;  1ASY A;  1W3S A;  1PH3 A;  3MXP A;  5DAU A;  1NY4 A;  4A3K B;  1JB7 A;  3QWN A;  4C3I H;  2IX1 A;  4YY3 L;  4PQX A;  2Q8T A;  1PYS B;  4XIG S;  3SDZ A;  4DV2 L;  1JOK A;  1JCK B;  2CKZ B;  2I5H A;  1BBU A;  1EIG A;  3HOX H;  5JPM C;  3NK9 A;  4ME3 A;  1JWS D;  2H5X A;  3N6R A;  2M00 A;  1FJG Q;  1K0R A;  1SXT A;  4F7X A;  1SMY D;  4DNR B;  5EGT A;  4E6I A;  1XMO Q;  4BY1 H;  2E75 C;  4A3C H;  3EN2 A;  1PZJ D;  2K14 A;  5CGK A;  1SFO B;  1H9S A;  2TMP A;  1GUN A;  1AZP A;  1QUQ A;  4CJ2 C;  1XPO A;  3V05 A;  3RLO A;  4IPC A;  1EFW A;  1B9M A;  2A6H C;  2F0L A;  2IT1 A;  4YIJ A;  3HOW B;  4GNX B;  3GTM H;  4I7A A;  2UUA L;  4LFA Q;  1Q46 A;  1IZ6 A;  4RGT A;  2EQS A;  3NEL A;  1EWH A;  4B9X A;  3X3N A;  2E2J B;  5T1I A;  3R2I A;  2UUC Q;  2K75 A;  2O2L D;  4RAU C;  1HTL D;  4DFA A;  1CA5 A;  5IYC G;  2A5H A;  3DM3 A;  3DWA A;  1J5E L;  1V1P A;  2KHI A;  1HCZ A;  3L0O A;  2WV6 D;  4GN4 B;  2EZV A;  1Q81 C;  4K5W A;  3J7Z C;  3P20 A;  2FFK B;  4JI4 Q;  2NYZ D;  2B2Y A;  4RA8 A;  3MAQ A;  3CQZ B;  2JQO A;  1HR0 W;  2HD3 A;  1LAB A;  2NN6 G;  3LGJ A;  2N3S A;  3EBE A;  2BDN A;  2IHF A;  1Y14 B;  4FYD A;  3W2D A;  1RJT A;  1SNM A;  4JOI C;  2MO1 A;  3BVG A;  1E24 A;  1EZ6 A;  4CDC C;  4DAY A;  2N49 A;  3STB C;  2B63 H;  2FHT A;  1J8I A;  5FLX L;  1XNR Q;  3A55 A;  4N8X 1;  1BUV T;  2K03 A;  3UI2 A;  4JI7 L;  1ET9 A;  2EYJ A;  3J7A 5;  2K32 A;  2EYO A;  1GUW A;  4NXM L;  3UDG A;  1SJH D;  3RLN A;  4ZUJ A;  2P5Z X;  2Q8R E;  1H9K A;  3I91 A;  1XWE A;  1I4P A;  2K5N A;  5C4X B;  4B3M L;  2QDL A;  5IGD A;  3NBH B;  3R2T A;  4A3K G;  1N34 L;  3S1M H;  2C5C A;  2O5J C;  4YY3 Q;  3OSO A;  4RHS A;  1UE1 A;  2BH8 A;  2UXC L;  4C56 C;  3I4N H;  4C3H H;  2B39 A;  2VUM G;  2WB1 G;  3HFZ B;  1MHW C;  4ZLT F;  3I7F A;  2E8G A;  3P7J A;  1IKL A;  2EY5 A;  4LFC Q;  3H0G B;  2BOS A;  4IUN A;  1II3 A;  3U4V A;  2AKW B;  3PO3 B;  4JI2 L;  1XMQ L;  1C0A A;  2C35 B;  5FO7 B;  4PG3 A;  4DK1 A;  5KND A;  4A3M H;  1GOZ A;  5JVH 3;  1PRT B;  3OIP A;  1Z6H A;  2K7V A;  4EX5 A;  4LF6 L;  5HUR A;  5JJL A;  2OF1 A;  2JA7 H;  3I4L A;  4JK1 C;  1WCM H;  1HA6 A;  5JJK A;  3LWE A;  2Z6B A;  4R4T A;  3VR5 A;  2B29 A;  3V96 A;  2JP1 A;  1LT5 D;  2FXQ A;  1SYF A;  1W6J A;  1D1I A;  2BE5 D;  1H9S B;  5C4J B;  1GXD C;  3M4Q A;  3SK4 A;  1QUQ B;  4LF8 L;  3T51 B;  1CT1 D;  1UWV A;  5M3F G;  3NE5 B;  2RSO A;  2F0M A;  1B3A A;  1D7Q A; 
#chains in the Genus database with same CATH homology
 1SLJ A;  4JI6 L;  2HIX A;  1WFQ A;  5C44 H;  4A3J G;  1SFO H;  4GLA C;  1NBW A;  1GKH A;  1G29 1;  3NEN A;  1K8G A;  3OTO L;  1J5E Q;  2GN5 A;  3PO2 G;  1EIF A;  2CQO A;  2QEX A;  4JI0 L;  5IP9 G;  5JEA J;  5ELO A;  1PH7 A;  1Z9F A;  4YCV A;  3RN2 A;  5FLX c;  3CC2 A;  2A1A A;  1WOC A;  2NZO A;  5GRO A;  2JA5 G;  2JE6 I;  3HOW H;  4MZ9 A;  5C3E H;  2UU9 L;  1C7Y A;  1QVC A;  1TWC H;  1BVS A;  2YTV A;  1HNZ Q;  3GTK H;  1QZG A;  2YTY A;  4EQ5 A;  2VQF Q;  2E2J H;  1Q1B A;  1VQG A;  2XTI A;  2E2H H;  2ZTC A;  2GVB A;  4IO9 A;  3GTQ H;  4DR1 Q;  1HJP A;  3I55 A;  4A3G G;  1X65 A;  3L7Z C;  3UDI A;  4DR3 Q;  1KAW A;  5C0X I;  4QL5 A;  2I0Q A;  1JJ2 A;  2KEN A;  2RCN A;  3GTO H;  4UP7 A;  2E5L L;  3PO2 H;  3E9I A;  1Y1W G;  4YWL A;  3E0E A;  4TVA B;  1U5K A;  1G51 A;  4HJ9 A;  5HY6 A;  2HHH L;  4OWX B;  3FKI G;  2Z6K A;  4GS3 A;  4HJA A;  2A8V A;  4MNO A;  1X9N A;  4LF7 Q;  2R92 G;  2WAQ G;  3F8T A;  3CQZ H;  1K9M C;  2JK8 A;  1AH9 A;  5IY0 A;  2NVY H;  3W5O A;  1JE5 A;  3S24 A;  4DPG A;  2ID0 A;  4UP9 A;  4JI7 Q;  1HZC A;  3TRZ A;  4DAY B;  3H3V H;  4KLK A;  5LMU L;  3CC7 A;  4BBS G;  4JV5 L;  1TWG H;  4A3B G;  4KHP Q;  4LUV A;  1NJI C;  1VQI A;  3CCJ A;  1XTD A;  5H1S E;  4GOP C;  4L5T A;  4RMF A;  4DV3 L;  1MJC A;  2ZTE A;  4OX9 Q;  3KJO A;  2F3I A;  3F2C A;  2QA4 A;  4IOC A;  4DR4 L;  4FDB A;  1X3E A;  2AHO B;  1M90 C;  4B3M Q;  5IP7 G;  4O2D A;  1N34 Q;  3T1Y Q;  1MJE A;  4DNI A;  1VQO A;  4LF5 L;  5M3M G;  4DV7 L;  1N33 Q;  3CCR A;  3TS0 A;  3F2B A;  1OXT A;  3CP0 A;  2UXC Q;  3PV0 A;  4IPD A;  3S1R H;  1S72 A;  1IBK L;  2VW9 A;  3CD6 A;  3M3Y H;  2V1C C;  2PI2 A;  5AJ3 L;  3HOU H;  5EAY A;  1RIP A;  2EIF A;  1PVO A;  4OWT B;  5GAD C;  4OX9 L;  1V9P A;  1V43 A;  2VY3 A;  2K5H A;  1YHQ A;  5BR8 Q;  3T1H L;  2OWO A;  3S14 H;  1FVI A;  2Q2U A;  2ATW A;  1CKM A;  4B3S Q;  3G4S A;  3PF4 A;  3TS2 A;  1PH6 A;  2GVA A;  3HOV G;  1VQ4 A;  3H3V I;  1FGU A;  2Q2T A;  3S1N H;  1VQF A;  1YHB A;  1EIY B;  1PA6 A;  1E1T A;  5C4X H;  3MXN B;  3PUY A;  3PF5 A;  2JA6 G;  4DR7 L;  3H0G G;  4BXX H;  3K7U C;  4JI2 Q;  1XMQ Q;  1OXX K;  1H95 A;  4C2M H;  3PO3 G;  4PZ6 A;  4OO1 I;  2VS1 A;  4C3J H;  5BR8 L;  2R7Z G;  3M7N A;  3K8A A;  4IPH A;  4R4Q A;  5GAH C;  3K0X A;  4XTC S;  2IHE A;  2F4V Q;  2Q2I A;  2PNH A;  2NN6 I;  4R1J A;  1NMG A;  2ZJR A;  4LF6 Q;  1SE8 A;  4JI3 L;  4BY7 G;  2MQH A;  2YV5 A;  4ALP A;  4DV0 L;  4GKK Q;  1YJ9 A;  4JOI A;  2F52 A;  3U58 A;  3F2D A;  3J80 c;  4A3L G;  4UP8 A;  2NVX H;  4GKJ L;  3Q8D A;  5FLM G;  3HOX G;  1VQP A;  3HOY G;  1HH2 P;  3H0G H;  4LF8 Q;  1HZ9 A;  2YYZ A;  4WJ3 M;  3PO3 H;  2VUM H;  4DV5 L;  2CWP A;  3FHW A;  4A3F G;  2D0O A;  5GAE C;  1VQE A;  2HQL A;  4A3I H;  1YJN A;  4IFD J;  4JBM A;  3A5U A;  3W1G A;  4JI1 L;  3CW2 C;  2LSS A;  4LF9 L;  2MO0 A;  4DK6 C;  4LUO A;  1JT8 A;  4X64 L;  4BY1 G;  4JCV E;  4JI0 Q;  2ZJQ A;  2I5L X;  3J81 c;  4A3C G;  1IL2 A;  1VS0 A;  3I4O A;  4HJ5 A;  5LMN L;  2VL6 A;  4A4I A;  4X65 L;  1BBW A;  1NMF A;  2UU9 Q;  3CPW A;  4JBK A;  3CPF A;  5C4J H;  3BJU A;  1EUJ A;  1OXU A;  3UDF A;  1J6Q A;  4JG2 A;  3CAM A;  3ZJY C;  2ZM6 L;  1EOV A;  4JBW A;  2R7D A;  2ALY B;  4P74 A;  3I56 A;  1E1O A;  1Q82 C;  2I5M X;  2D62 A;  2A19 A;  4BBR G;  1Y1V H;  1B70 B;  4X6A H;  3RLF A;  4POG A;  2YU9 H;  3L2P A;  3UE0 A;  1EQQ A;  4Y52 H;  4YCW A;  2E5L Q;  4JYA L;  1Q86 C;  3J81 j;  3I4M G;  1SMX A;  3W1B A;  1E3P A;  3MEF A;  1VQM A;  3D31 A;  2N78 A;  1IBM L;  5M3F H;  1VQ6 A;  2HHH Q;  1IBL L;  3ULL A;  3GTJ H;  1O7I A;  4L5Q A;  1HZB A;  1GO3 E;  1SN8 A;  1Z47 A;  3KFU A;  3NEM A;  4J15 A;  4A3J H;  4NPS A;  2ES2 A;  1FJG L;  4QQB X;  2D0P A;  3SGI A;  3CCS A;  1Q8K A;  4UPA A;  4JV5 Q;  4BBR H;  5LMU Q;  1XMO L;  1CSP A;  5IP9 H;  1KHI A;  1BKB A;  3KOJ A;  4GNX A;  3CCQ A;  4QY7 A;  2JA5 H;  1VQL A;  1IYJ B;  1PH4 A;  4DV3 Q;  3BU2 A;  1VQK A;  2CFM A;  4OON A;  3S17 H;  1L1O B;  4DR4 Q;  2NVT H;  3AFP A;  4LFB L;  2OTL A;  4LF5 Q;  4DV6 L;  4DV7 Q;  3VDY A;  1L1O A;  3ERS X;  4A3E G;  4A3G H;  4LFA L;  2VQE Q;  4JI5 L;  3GTP H;  5C0X J;  1NE3 A;  1TWA H;  1R9T H;  1IBK Q;  2UUB L;  2EXD A;  1TWH H;  1S3O A;  3PGZ A;  5AJ3 Q;  3JAM i;  1Y1W H;  2B63 G;  4BA2 I;  3CF5 A;  4B3R L;  1PH2 A;  1N9W A;  3HKZ G;  2UUC L;  2CWA A;  2DUD A;  4RG1 A;  5IYB G;  3IRB A;  3T1H Q;  1AE2 A;  1N32 L;  2VNU D;  4IFD G;  3M85 A;  1K8A C;  3FKI H;  4H02 A;  1VQB A;  4LNQ A;  3S2H H;  2N8N A;  4JBJ A;  2R92 H;  3TQY A;  3K81 C;  1Q1E A;  2K50 A;  4R4C A;  2IX0 A;  3PUV A;  3M4P A;  4YWM A;  5HGQ A;  2KCM A;  2VQE L;  4GLX A;  1ASZ A;  4AYB E;  4DR7 Q;  2OQK A;  4YWK A;  4IOA A;  2RF4 A;  1KL9 A;  1WI5 A;  1LUZ A;  4Y7N H;  4DV1 L;  1QVG A;  4JI4 L;  2E2I H;  4BBS H;  3HOZ G;  4A3B H;  5IWA L;  1SRO A;  4IJH A;  2OQ0 A;  2Y0S E;  2ZTD A;  5J3B A;  3UDX A;  1L2F A;  4AQY L;  3RZD H;  2UXD L;  4P75 A;  5JJI A;  4HJ7 A;  4DAM A;  2RHQ B;  4B3T L;  5IP7 H;  4X62 L;  4JI3 Q;  1VQ5 A;  3CCU A;  2QGQ A;  4YHH L;  4DV0 Q;  4P72 A;  3RNU A;  1QVF A;  5M3M H;  5JEA G;  5IYD G;  1XNQ L;  3PCO B;  2VZA A;  4KI0 A;  4DR2 Q;  1KD1 C;  2OTJ A;  2ZJP A;  4GKJ Q;  1HR0 L;  1KIX A;  1A0I A;  3PSI A;  4GLV B;  3CCV A;  2LXK A;  1I3Q H;  4P71 A;  3I2Z A;  2NZH A;  1XPU A;  2BH2 A;  1W2B A;  1CKO A;  4DV5 Q;  4HJ8 A;  1CKN B;  3RN5 A;  4WJ4 A;  5LMN W;  1VQJ A;  1XNR L;  1A63 A;  3PUW A;  3DLL A;  4LUZ A;  2HIV A;  1KXL A;  3GO5 A;  2IY5 B;  2AMC B;  3HOV H;  1CKN A;  1LM0 A;  1PH9 A;  4JI1 Q;  1B7Y B;  4LF9 Q;  1WYD A;  4DR2 L;  4DUY Q;  2R93 G;  3D0F A;  3KLW A;  3CXC A;  4BA1 I;  4X64 Q;  2JA6 H;  2UXB L;  1LTL A;  4DV2 Q;  4PZ7 A;  4GOP A;  4QIW E;  3KDF A;  1ASY A;  2ASB A;  2KHJ A;  1NTG A;  4NXN L;  5LMN Q;  1N36 L;  4K0K L;  4X65 Q;  1W3S A;  1PH3 A;  1LYL A;  3CCM A;  3KF6 A;  1NY4 A;  3CCE A;  4QJF A;  1YI2 A;  1JB7 A;  2R7Z H;  1GVP A;  4C3I H;  1WJJ A;  2ZM6 Q;  2IX1 A;  3GTG H;  4YY3 L;  4HIO A;  2BA0 A;  3JC6 6;  3GDE A;  1A8V A;  1YNX A;  4BY7 H;  4DUY L;  1PYS B;  4XIG S;  4MTN A;  1N8R C;  4DV2 L;  5C0X G;  2HT1 A;  2CCZ A;  4A3L H;  2R93 H;  2CKZ B;  3KJP A;  1EQR A;  2I5H A;  3ER0 A;  1BBU A;  1L0W A;  5FJ8 G;  5FLM H;  3HOX H;  4LF4 L;  3HOY H;  4JYA Q;  2K4K A;  2WFW A;  4DK3 C;  1IBM Q;  1JJG A;  2WAQ E;  5C44 G;  4R4O A;  1VQC A;  3BZC A;  5ELN A;  1IBL Q;  4GN3 B;  2JEA I;  4A3F H;  1XJV A;  2OCE A;  4ME3 A;  2Z6K C;  3CC4 A;  2H5X A;  3AFQ A;  4DUZ L;  1FJG Q;  1K0R A;  3K7A H;  3CME A;  1EYG A;  3HOW G;  1YVC A;  2UUA Q;  4L5S A;  3S1Q H;  1PYB A;  2DGY A;  1XMO Q;  3CCL A;  1RL2 A;  4BY1 H;  4A3C H;  3A5Z B;  3EN2 A;  4X66 L;  2K14 A;  2PQA A;  1M1K C;  3U50 C;  1HNW L;  3A0J A;  5M5Y H;  1QUQ A;  1XPO A;  2K52 A;  1VQA A;  3RLO A;  4IPC A;  1EFW A;  2NVQ H;  3RZO H;  4LFB Q;  2IT1 A;  4JI8 L;  3M9B A;  4JC0 A;  4R4I A;  4AIM A;  5IE8 A;  2MNA A;  1HNX L;  4GNX B;  1SRU A;  3PUZ A;  4DV6 Q;  4DR5 L;  1Q7Y C;  1PH8 A;  3GTM H;  2UUA L;  4LFA Q;  5DLQ E;  4JI5 Q;  1Q46 A;  1IZ6 A;  1SR3 A;  1YIJ A;  3GTL H;  4IPG A;  2EQS A;  3NEL A;  4DR6 L;  2UUB Q;  1HZA A;  4DV4 L;  1VQH A;  3EIV A;  2JJQ A;  4B3R Q;  3I4M H;  4YCU A;  4TQU S;  2UUC Q;  1OTC A;  2K75 A;  1N32 Q;  4IJL A;  1PV4 A;  3AQQ A;  5IYC G;  1KC8 C;  1JMC A;  2KCT A;  4L5R C;  3DM3 A;  1XPR A;  2AWN A;  1J5E L;  2KHI A;  2RHS B;  5M5W H;  1E22 A;  3FP9 A;  5IT9 c;  3L0O A;  3H15 A;  1E7Z A;  4HID A;  4GN4 B;  1Q81 C;  2WB1 E;  2B3G A;  1OXV A;  1YBY A;  1VQ8 A;  3J7Z C;  4DV1 Q;  4HIK A;  4JI4 Q;  5K36 G;  1VQN A;  3J80 i;  1OXS C;  5IWA Q;  3OYY A;  1EWI A;  5GQO A;  2YTX A;  4OO1 G;  2JQO A;  1HNZ L;  1HR0 W;  1CSQ A;  1UE6 A;  2JA8 G;  2VQF L;  4AQY Q;  4A3D G;  2UXD Q;  2NN6 G;  2JEB I;  3LGJ A;  4DR1 L;  5M5X H;  4B3T Q;  4A75 A;  4X62 Q;  2N3S A;  3EBE A;  4DR3 L;  2IHF A;  1Y14 B;  4O0A A;  5IYC H;  4YHH Q;  3G71 A;  1YIT A;  1B8A A;  1G6P A;  2BA1 A;  1XNQ Q;  4A3E H;  4JOI C;  3HOU G;  2MO1 A;  4NXM Q;  1HR0 Q;  1V1Q A;  1E24 A;  1PFS A;  4AH6 A;  3J81 i;  2N49 A;  3STB C;  3KYH C;  2B63 H;  4LWC A;  4LF7 L;  1VCI A;  3BZK A;  5IYB H;  1XNR Q;  3S16 H;  4UY8 C;  3PIO A;  1CUK A;  1DGS A;  2R6G A;  1X6O A;  2JA8 H;  3M4O H;  4A93 G;  5C4X G;  4A3D H;  4JI7 L;  1JJC B;  5E7N A;  4BXX G;  3J7A 5;  1A62 A;  3I4N G;  3K80 C;  1X3G A;  1U0L A;  4NXM L;  3UDG A;  3S2D H;  4KHP L;  2UXB Q;  3RLN A;  1VQD A;  1KRT A;  2Z0S A;  4K0K Q;  4NXN Q;  1N36 Q;  3CMA A;  2XGT A;  3HOZ H;  3S15 H;  3E9H A;  4P73 A;  1UEB A;  2K5N A;  4B3M L;  1K73 C;  3NBH B;  1N34 L;  4A3K G;  4HIM A;  1I50 H;  3T1Y L;  3S1M H;  3TEH B;  2Q2H A;  3UE1 A;  1YEZ A;  4YY3 Q;  3B6Y A;  1UE1 A;  1X55 A;  3ULJ A;  4GOP B;  1N33 L;  3KDF B;  2R7F A;  2BH8 A;  4A93 H;  2UXC L;  3U4Z A;  1MIU A;  3GD7 A;  1UE5 A;  4A3M G;  1MKH A;  3KF6 B;  4PZ8 A;  5IYD H;  3A74 A;  2AWO A;  4C3H H;  3I4N H;  1P16 A;  1TWF H;  3ULP A;  2VUM G;  1K3R A;  2WB1 G;  3AYH B;  3HFZ B;  3PIP A;  1GM5 A;  4A3I G;  4LF4 Q;  4OWW B;  4IFD I;  2MFI A;  2WP8 J;  1I94 Q;  2JA7 G;  3I7F A;  1WCM G;  4B3S L;  2E8G A;  1X3F A;  3KF8 B;  3OW2 A;  1TXY A;  4NB3 A;  1S40 A;  4LW1 A;  3F1Z A;  4APV A;  4A3K H;  1KQS A;  4LFC Q;  3RR5 A;  1I5F A;  4OXP A;  4DUZ Q;  3U4V A;  1PH1 A;  2AKW B;  1AE3 A;  3JAM c;  1QZH A;  3TRE A;  4JI2 L;  1XMQ L;  1C0A A;  2LXJ A;  1C9O A;  3PUX A;  4AYB G;  2C35 B;  4GN5 A;  4PG3 A;  4A3M H;  3WWV A;  1YJW A;  1D8L A;  3AEV A;  4X66 Q;  2KBN A;  1I94 L;  1X54 A;  1I6H H;  3G48 A;  4GNX C;  2F4V L;  1HNW Q;  1FL0 A;  1P8L A;  1PHJ A;  1YHA A;  1UE7 A;  4EX5 A;  2Y0S G;  4A76 A;  2K5V A;  4DKA C;  4JI6 Q;  4LF6 L;  2JA7 H;  5JJL A;  1PH5 A;  1WCM H;  4LFC L;  5JJK A;  1X56 A;  4R4T A;  2PI2 E;  4JI8 Q;  4POF A;  1Y1V G;  2B29 A;  1HNX Q;  1VQ7 A;  4GKK L;  2FXQ A;  3OTO Q;  4DR5 Q;  4QGU A;  2PQA B;  1YZ6 A;  5C3E G;  1T9H A;  3M4Q A;  1L1O C;  5GAG C;  3STB D;  3HKS A;  1QUQ B;  1IXR A;  4PMW A;  3G6E A;  3HKZ E;  4KHZ A;  1K83 H;  1Q12 A;  2JA9 A;  1GD7 A;  2L15 A;  1KRS A;  4LF8 L;  1UWV A;  1VQ9 A;  3ICE A;  5M3F G;  4DV4 Q;  4DR6 Q;  5FJ8 H;  2PMZ E;  1D7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...