2K5SA

Ymoa
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
GTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Modulating protein ymoA
publication title The high-precision solution structure of Yersinia modulating protein YmoA provides insight into interaction with H-NS
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transcription regulator
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2k5sA00
2MW2A 1JW2A 2K5SA 4ICGC 2JQTA
chains in the Genus database with same CATH superfamily
4JRPA 2LF6A 1XU3E 4GAMC 3NGIA 2RCUA 4HCCA 4FJNA 1FZHE 4KHSA 4J2AA 4FVMA 2DTUA 3UO3A 4EYWA 2JH9A 4KI4A 2ATQA 3TJYA 2P1NB 1MHYG 3OGLB 3KD1E 3KD5E 4AKGA 4M3RA 2P5OA 1FZ1E 3LZJA 2MW2A 4HCBA 4FJXA 2K5SA 3K2OA 1FZ4E 3HL8A 1P22A 3SUQA 3SUPA 3SQ0A 4KI6A 3LDBA 3C6OB 3HP9A 3J27A 3SCXA 3LDSA 3LD8A 3MKSB 3QETA 1XU5E 4KHQA 3RMBA 4FJ8A 3OGMB 4RL5A 2PFTA 1MHZG 3NHGA 3TABA 1MMOG 2P5GA 4DTOA 4FJ5A 3SJJA 1XVGE 2P1PB 3WSOA 4J2EA 1XVCE 4M3UA 1FZ9E 4EPHA 3L0MA 4FJIA 3N1EA 4DU3A 4DTNA 2QXFA 3SVIA 2P1OB 4DTSA 4AKHA 3QESA 1FZ5E 3L2OB 4FK4A 1FZ6E 1XVFE 3NDKA 3NCIA 4DTXA 4M3YA 4ICGC 3TAFA 4DTMA 3SPZA 4FJLA 3CQ8A 4DU4A 4FJ7A 3SQ1A 2MZWB 4ADOA 4DTJA 1FPOA 1Q9YA 4X5MA 3QNNA 2JHPA 4DTRA 3SI6A 2JH8A 1FZ8E 3TAGA 2JHCA 3NE6A 2OZSA 3UIQA 3C6PB 3TL8B 2H4TA 4I9LA 4QNDA 1MTYG 3CFRA 4KHNA 1FYZE 1FS1A 5H37A 3TAEA 3OGKB 3SNNA 3L1NA 3C94A 1WAJA 3QEWA 4DU1A 4RNGA 1XMHE 1FZ0E 4M3XA 3CFOA 2PFVA 4JS4A 4KHUA 1FZ3E 1WAFA 4FK0A 2B7MA 2VJ5A 1JW2A 4AKIA 2OVQB 3QNOA 4E4BA 3RMDA 2RKHA 4KHWA 1FZ2E 1N1CA 3J2PA 5IBKB 4KHYA 2DY4A 3V7DB 3SQ4A 4DTUA 1XVEE 3SQ2A 2OYQA 3QEVA 4M3ZA 4I6JB 3C95A 4X5NA 3L8BA 4ADNA 2OVPB 3HGLA 1XMGE 1Q9XA 2JPNA 3CFPA 2HD0A 3RMCA 2P1QB 4FJMA 3N1BA 3LZIA 4M41A 4M45A 2FW3A 2DEBA 3RMAA 3BVOA 1FXXA 5IZ7A 2E32A 2VJ4A 4J2BA 2OVRB 3QEPA 4AI6A 3SPYA 4B08A 2YB5A 3SUOA 1XVBE 4FJKA 4I9QA 4DTPA 1XVDE 4M3WA 1IH7A 2JQTA 2B8IA 3NAEA 3HGKE 4FJ9A 3QEXA 2FYOA 3C6NB 3SUNA 4M3TA 1XMFE 1XL3C 3E4WA 4EP9A 4J2DA 3QERA 4RG8A 1NEXB 2E31A 1CLQA 4FJJA 2JHAA 4JS5A 2B1EA 2P1MB 4IT5A 1IG9A 2OZMA 3RWUA 1FZ7E 1LDKE 4FJHA 4E3SA 1FZIE 2MMBA 4QNCA 4JRQA 3UO2A 3QEIA 3S9HA 3E4YA 5IREA 4FJGA 4FK2A 4M42A 2VIXA 2LF3A
chains in the Genus database with same CATH topology
2MW2A 1JW2A 2K5SA 4ICGC 2JQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  1JW2 A;  2K5S A;  4ICG C;  2JQT A; 
#chains in the Genus database with same CATH topology
 4JRP A;  2LF6 A;  1XU3 E;  4GAM C;  3NGI A;  2RCU A;  4HCC A;  4FJN A;  1FZH E;  4KHS A;  4J2A A;  4FVM A;  2DTU A;  3UO3 A;  4EYW A;  2JH9 A;  4KI4 A;  2ATQ A;  3TJY A;  2P1N B;  1MHY G;  3OGL B;  3KD1 E;  3KD5 E;  4AKG A;  4M3R A;  2P5O A;  1FZ1 E;  3LZJ A;  2MW2 A;  4HCB A;  4FJX A;  2K5S A;  3K2O A;  1FZ4 E;  3HL8 A;  1P22 A;  3SUQ A;  3SUP A;  3SQ0 A;  4KI6 A;  3LDB A;  3C6O B;  3HP9 A;  3J27 A;  3SCX A;  3LDS A;  3LD8 A;  3MKS B;  3QET A;  1XU5 E;  4KHQ A;  3RMB A;  4FJ8 A;  3OGM B;  4RL5 A;  2PFT A;  1MHZ G;  3NHG A;  3TAB A;  1MMO G;  2P5G A;  4DTO A;  4FJ5 A;  3SJJ A;  1XVG E;  2P1P B;  3WSO A;  4J2E A;  1XVC E;  4M3U A;  1FZ9 E;  4EPH A;  3L0M A;  4FJI A;  3N1E A;  4DU3 A;  4DTN A;  2QXF A;  3SVI A;  2P1O B;  4DTS A;  4AKH A;  3QES A;  1FZ5 E;  3L2O B;  4FK4 A;  1FZ6 E;  1XVF E;  3NDK A;  3NCI A;  4DTX A;  4M3Y A;  4ICG C;  3TAF A;  4DTM A;  3SPZ A;  4FJL A;  3CQ8 A;  4DU4 A;  4FJ7 A;  3SQ1 A;  2MZW B;  4ADO A;  4DTJ A;  1FPO A;  1Q9Y A;  4X5M A;  3QNN A;  2JHP A;  4DTR A;  3SI6 A;  2JH8 A;  1FZ8 E;  3TAG A;  2JHC A;  3NE6 A;  2OZS A;  3UIQ A;  3C6P B;  3TL8 B;  2H4T A;  4I9L A;  4QND A;  1MTY G;  3CFR A;  4KHN A;  1FYZ E;  1FS1 A;  5H37 A;  3TAE A;  3OGK B;  3SNN A;  3L1N A;  3C94 A;  1WAJ A;  3QEW A;  4DU1 A;  4RNG A;  1XMH E;  1FZ0 E;  4M3X A;  3CFO A;  2PFV A;  4JS4 A;  4KHU A;  1FZ3 E;  1WAF A;  4FK0 A;  2B7M A;  2VJ5 A;  1JW2 A;  4AKI A;  2OVQ B;  3QNO A;  4E4B A;  3RMD A;  2RKH A;  4KHW A;  1FZ2 E;  1N1C A;  3J2P A;  5IBK B;  4KHY A;  2DY4 A;  3V7D B;  3SQ4 A;  4DTU A;  1XVE E;  3SQ2 A;  2OYQ A;  3QEV A;  4M3Z A;  4I6J B;  3C95 A;  4X5N A;  3L8B A;  4ADN A;  2OVP B;  3HGL A;  1XMG E;  1Q9X A;  2JPN A;  3CFP A;  2HD0 A;  3RMC A;  2P1Q B;  4FJM A;  3N1B A;  3LZI A;  4M41 A;  4M45 A;  2FW3 A;  2DEB A;  3RMA A;  3BVO A;  1FXX A;  5IZ7 A;  2E32 A;  2VJ4 A;  4J2B A;  2OVR B;  3QEP A;  4AI6 A;  3SPY A;  4B08 A;  2YB5 A;  3SUO A;  1XVB E;  4FJK A;  4I9Q A;  4DTP A;  1XVD E;  4M3W A;  1IH7 A;  2JQT A;  2B8I A;  3NAE A;  3HGK E;  4FJ9 A;  3QEX A;  2FYO A;  3C6N B;  3SUN A;  4M3T A;  1XMF E;  1XL3 C;  3E4W A;  4EP9 A;  4J2D A;  3QER A;  4RG8 A;  1NEX B;  2E31 A;  1CLQ A;  4FJJ A;  2JHA A;  4JS5 A;  2B1E A;  2P1M B;  4IT5 A;  1IG9 A;  2OZM A;  3RWU A;  1FZ7 E;  1LDK E;  4FJH A;  4E3S A;  1FZI E;  2MMB A;  4QNC A;  4JRQ A;  3UO2 A;  3QEI A;  3S9H A;  3E4Y A;  5IRE A;  4FJG A;  4FK2 A;  4M42 A;  2VIX A;  2LF3 A; 
#chains in the Genus database with same CATH homology
 2MW2 A;  1JW2 A;  2K5S A;  4ICG C;  2JQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...