2K5SA

Ymoa
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'GTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVKHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Modulating protein ymoA
publication title The high-precision solution structure of Yersinia modulating protein YmoA provides insight into interaction with H-NS
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transcription regulator
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 2k5sA00
2MW2A 1JW2A 2JQTA 2K5SA 4ICGC
chains in the Genus database with same CATH superfamily
2DTUA 4I9QA 1XU3E 2PFTA 3RMDA 4I9LA 2JH8A 3LZJA 2MW2A 3TL8B 2FYOA 3UO2A 3TJYA 1NEXB 3E4YA 2P5GA 3SPZA 3BVOA 2B1EA 3UO3A 4M3YA 2JPNA 1JW2A 1FZ4E 3HGKE 3WSOA 2OZSA 4KHUA 4ADNA 2OZMA 4EYWA 3J2PA 3QEXA 3RWUA 2DY4A 3NAEA 4J2DA 4RNGA 1MTYG 3V7DB 3QNNA 3QEPA 3QESA 1XVBE 1Q9YA 3L2OB 3QEVA 2P1NB 1FZ0E 3LD8A 3SPYA 1FYZE 1FZ7E 2B7MA 2JHPA 1IH7A 3QEIA 3HP9A 2P5OA 3SCXA 3NDKA 4M3TA 3L1NA 4RL5A 1XVGE 4JS4A 3SQ1A 4M45A 3NCIA 3E4WA 2RCUA 1FZ1E 3CFOA 1XU5E 2RKHA 4DTNA 4FJHA 4FJ7A 3C95A 4DTXA 2MMBA 4ADOA 2JHCA 2YB5A 3C6NB 3HGLA 3SUOA 2QXFA 4I6JB 3SI6A 4B08A 3QETA 2OYQA 3NGIA 3UIQA 4AKIA 2K5SA 4FJIA 4ICGC 4DU4A 2HD0A 2OVQB 3SUPA 4HCBA 1P22A 2OVRB 4QNCA 4JRPA 4KHNA 1Q9XA 3LDBA 1MHYG 3N1EA 2VJ4A 1XVFE 4QNDA 4DTMA 4J2BA 4KI6A 4M3XA 1XMGE 3LZIA 3RMBA 3CFPA 1XMHE 3TAEA 1FZ3E 1FZ5E 4FJJA 4M42A 3SQ4A 4DTRA 4AI6A 4DTPA 4IT5A 3L8BA 4FK2A 1CLQA 3TABA 4RG8A 4FJLA 4X5NA 3C94A 4DTJA 1FZHE 2P1OB 3SUNA 3RMAA 3KD1E 3N1BA 4FK4A 4KHQA 3TAGA 3TAFA 1FZIE 2VJ5A 1FPOA 2ATQA 4JRQA 4M3UA 3C6PB 4DU1A 4KHWA 3S9HA 1WAJA 2LF3A 4M3WA 4M3ZA 4KHYA 1FZ6E 1WAFA 5IZ7A 3CQ8A 4AKGA 3LDSA 4JS5A 4FJ8A 2DEBA 3SNNA 2LF6A 5IREA 3SQ2A 3NHGA 2MZWB 4FJGA 4DTSA 2FW3A 4AKHA 2JQTA 4DU3A 2VIXA 2E31A 3OGLB 2P1PB 4M41A 1FS1A 4FJNA 4FK0A 4FJ9A 2E32A 1XMFE 3SQ0A 3QNOA 4X5MA 2JH9A 3J27A 3SVIA 1LDKE 3QEWA 4FJ5A 1FZ9E 1XL3C 4DTUA 3L0MA 4FJMA 3SUQA 4KI4A 1N1CA 4KHSA 3HL8A 2PFVA 5IBKB 4J2AA 4FVMA 1MHZG 1XVDE 1FZ2E 1FXXA 3K2OA 4GAMC 4E4BA 3CFRA 4E3SA 1XVCE 2OVPB 5H37A 3RMCA 3OGKB 4EP9A 3NE6A 4EPHA 4DTOA 3QERA 2P1MB 1MMOG 1IG9A 1FZ8E 2B8IA 3OGMB 4M3RA 4J2EA 4FJKA 3C6OB 2JHAA 1XVEE 3SJJA 4FJXA 3MKSB 4HCCA 2P1QB 2H4TA 3KD5E
chains in the Genus database with same CATH topology
2MW2A 1JW2A 2JQTA 2K5SA 4ICGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  1JW2 A;  2JQT A;  2K5S A;  4ICG C; 
#chains in the Genus database with same CATH topology
 2DTU A;  4I9Q A;  1XU3 E;  2PFT A;  3RMD A;  4I9L A;  2JH8 A;  3LZJ A;  2MW2 A;  3TL8 B;  2FYO A;  3UO2 A;  3TJY A;  1NEX B;  3E4Y A;  2P5G A;  3SPZ A;  3BVO A;  2B1E A;  3UO3 A;  4M3Y A;  2JPN A;  1JW2 A;  1FZ4 E;  3HGK E;  3WSO A;  2OZS A;  4KHU A;  4ADN A;  2OZM A;  4EYW A;  3J2P A;  3QEX A;  3RWU A;  2DY4 A;  3NAE A;  4J2D A;  4RNG A;  1MTY G;  3V7D B;  3QNN A;  3QEP A;  3QES A;  1XVB E;  1Q9Y A;  3L2O B;  3QEV A;  2P1N B;  1FZ0 E;  3LD8 A;  3SPY A;  1FYZ E;  1FZ7 E;  2B7M A;  2JHP A;  1IH7 A;  3QEI A;  3HP9 A;  2P5O A;  3SCX A;  3NDK A;  4M3T A;  3L1N A;  4RL5 A;  1XVG E;  4JS4 A;  3SQ1 A;  4M45 A;  3NCI A;  3E4W A;  2RCU A;  1FZ1 E;  3CFO A;  1XU5 E;  2RKH A;  4DTN A;  4FJH A;  4FJ7 A;  3C95 A;  4DTX A;  2MMB A;  4ADO A;  2JHC A;  2YB5 A;  3C6N B;  3HGL A;  3SUO A;  2QXF A;  4I6J B;  3SI6 A;  4B08 A;  3QET A;  2OYQ A;  3NGI A;  3UIQ A;  4AKI A;  2K5S A;  4FJI A;  4ICG C;  4DU4 A;  2HD0 A;  2OVQ B;  3SUP A;  4HCB A;  1P22 A;  2OVR B;  4QNC A;  4JRP A;  4KHN A;  1Q9X A;  3LDB A;  1MHY G;  3N1E A;  2VJ4 A;  1XVF E;  4QND A;  4DTM A;  4J2B A;  4KI6 A;  4M3X A;  1XMG E;  3LZI A;  3RMB A;  3CFP A;  1XMH E;  3TAE A;  1FZ3 E;  1FZ5 E;  4FJJ A;  4M42 A;  3SQ4 A;  4DTR A;  4AI6 A;  4DTP A;  4IT5 A;  3L8B A;  4FK2 A;  1CLQ A;  3TAB A;  4RG8 A;  4FJL A;  4X5N A;  3C94 A;  4DTJ A;  1FZH E;  2P1O B;  3SUN A;  3RMA A;  3KD1 E;  3N1B A;  4FK4 A;  4KHQ A;  3TAG A;  3TAF A;  1FZI E;  2VJ5 A;  1FPO A;  2ATQ A;  4JRQ A;  4M3U A;  3C6P B;  4DU1 A;  4KHW A;  3S9H A;  1WAJ A;  2LF3 A;  4M3W A;  4M3Z A;  4KHY A;  1FZ6 E;  1WAF A;  5IZ7 A;  3CQ8 A;  4AKG A;  3LDS A;  4JS5 A;  4FJ8 A;  2DEB A;  3SNN A;  2LF6 A;  5IRE A;  3SQ2 A;  3NHG A;  2MZW B;  4FJG A;  4DTS A;  2FW3 A;  4AKH A;  2JQT A;  4DU3 A;  2VIX A;  2E31 A;  3OGL B;  2P1P B;  4M41 A;  1FS1 A;  4FJN A;  4FK0 A;  4FJ9 A;  2E32 A;  1XMF E;  3SQ0 A;  3QNO A;  4X5M A;  2JH9 A;  3J27 A;  3SVI A;  1LDK E;  3QEW A;  4FJ5 A;  1FZ9 E;  1XL3 C;  4DTU A;  3L0M A;  4FJM A;  3SUQ A;  4KI4 A;  1N1C A;  4KHS A;  3HL8 A;  2PFV A;  5IBK B;  4J2A A;  4FVM A;  1MHZ G;  1XVD E;  1FZ2 E;  1FXX A;  3K2O A;  4GAM C;  4E4B A;  3CFR A;  4E3S A;  1XVC E;  2OVP B;  5H37 A;  3RMC A;  3OGK B;  4EP9 A;  3NE6 A;  4EPH A;  4DTO A;  3QER A;  2P1M B;  1MMO G;  1IG9 A;  1FZ8 E;  2B8I A;  3OGM B;  4M3R A;  4J2E A;  4FJK A;  3C6O B;  2JHA A;  1XVE E;  3SJJ A;  4FJX A;  3MKS B;  4HCC A;  2P1Q B;  2H4T A;  3KD5 E; 
#chains in the Genus database with same CATH homology
 2MW2 A;  1JW2 A;  2JQT A;  2K5S A;  4ICG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...