2K5UA

Solution structure of myirstoylated yeast arf1 protein, gdp-bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
180
structure length
180
Chain Sequence
GLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Structure and Membrane Interaction of Myristoylated ARF1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 42
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2k5uA00
4B34A 3O47A 1P73A 3QKUA 2W83A 2FPLA 2RMKA 5EE9A 3V00A 1W4CA 3KJGA 2WOJA 2Q21A 4PSKA 2VYFA 4LYFA 4XVQA 1Z0IA 3B7GA 1VG8A 1XZQA 3C4JA 2FEOA 4UXJA 3EIQA 1QRAA 5TY0A 4DIDA 1Q12A 4W5WA 1N6RA 4LJ9A 4H1UA 2MSEB 3A4LA 4V0OA 1BMFA 3IBYA 4DCTA 2XAUA 3HYTA 1I4LD 4QFMA 1A82A 1FUUA 4AI6A 3K0AA 5DN6A 5D3QA 5JI2E 1EFRA 1GKIA 1G17A 2JLZA 1KDOA 1LS1A 1SHZA 2GDJA 3LBIA 3SU8A 2JLUA 2QP9X 5J5CA 1ESNA 1ZRHA 2C99A 2REOA 3LXRA 3QXSA 3VKWA 4W5JA 4GOXA 4M53A 2G77B 4KYUA 5JFGA 2FSIA 1CRQA 4C0AC 1E94E 2OCYC 1DAFA 4LI0A 1DPFA 2QTFA 5LD2B 1ZP6A 1QHXA 4DZZA 2WM9B 2QQEA 3B78A 3VNUA 4URYR 1E9AA 4QGHA 2X77A 3E2IA 3EPJA 3W8RA 1OKKD 4B3FX 3QXHA 3AF3A 2AD1A 2FU5C 4LHXA 4C7OB 4ZCMA 3BWDD 3VR2A 4PPQA 1UF9A 3THXB 2RH5A 4IHQA 4PAQA 3RDPA 3AVYA 2BM0A 4MKGA 2A5DA 5FBRB 5JS8A 1E2NA 1EGAA 3IO5A 3THYB 4D80A 5A4JA 4NP6A 1MKYA 5DE3A 4TWZA 5IDVA 3I5YA 4LJ4A 2YVUA 1G7SA 5EUMA 4LRWA 4EJSA 4TT3A 1TQ4A 4UKDA 4M1TA 4AG6A 1SQ5A 3ND9A 4IOKA 1JXMA 5DHAA 5HKKD 1X1SA 4PC6A 4UNNA 5TB5A 1NY5A 1JEDA 4DRZA 2WOOA 2REXB 4XIGS 2G0NA 1E3MA 2TMKA 2ORWA 5FUXA 3CR8A 2FFBA 3GJXC 1IJFA 1QF9A 4LGMA 3O8BA 2NGRA 4V0LA 2EVWX 4C0HA 1E2FA 3A6PC 3TQCA 1H8EA 4NMMA 4A15A 1R0YA 2J3EA 1NF3A 1T0JB 1J7KA 4Z51A 2R44A 2QY9A 3EX7C 2ZRFA 3U5ZB 3EARA 2ZREA 3CRMA 4HLQB 1N6KA 4KBFA 2BJWA 4JYCA 4JZKA 2E1RA 2ATVA 4BLPA 1SKQA 4LV8B 3ZH9B 3BH7A 1KHTA 4LK2A 2H8KA 2IWHA 2YWFA 2XNDD 1CULC 1WXQA 1ZNXA 3HU3A 4RFSA 1GSIA 2J0UA 4H1VA 1S3SA 3BGWA 2R6AA 4BLOA 4WZAE 5JHGB 4C0LA 1KSFX 2AL7A 2OO7A 4NHOA 4XVUA 1O3YA 4FMCB 1P62B 3WHLA 2FFAA 3KFXA 1E69A 3RRNA 2J0QA 1J70A 3TRFA 3K70C 2RGGA 3B85A 3V9PA 2ZE6A 3LW7A 1XPUA 2IF2A 2B92A 3LO5A 2C8VA 5J4YA 2IHBA 2GAAA 2VSFA 2FA9A 1E2MA 4L5BA 1D8TA 2ZAOA 2FEMA 4M22A 3JVUA 4NU0A 1Q3HA 4YQFA 4DVGA 1PLKA 1W48A 3M0EA 4FI3C 1DAEA 1E9BA 2H16A 2OCBA 4KFSA 4RJLA 2RHMA 1ZC3A 2W00A 2NTYC 5BXQC 1DAHA 1FW6A 1Z6TA 4HDOB 2RGNA 2C78A 3QY0A 1G8PA 3WYGA 1TMKA 4EPWA 3QSYA 1COWA 3SFZA 3ZZTA 3CWZA 4MRRA 2G1KA 1FL9A 1G18A 4TLAA 2ODNA 3RS0A 4BZXA 5KSZA 1G64A 4C30A 4TYWA 1XRJA 2IUSA 4Q4JB 1BS1A 4PFSA 2XOKD 5EE3A 2Z43A 2ZI5A 1UAAA 2YC2C 4IDOA 4ZIRA 4PHFA 4BZQA 4IDNA 4XWKA 3W9YA 3AH8A 2QGZA 3IQWA 1KMHA 1TU4A 4LHVA 2ZIAA 5EP3A 4JSTA 3FKSD 3HU1A 2OBNA 4A6PA 1GL6A 2Q9AA 3WP0A 2Q3HA 1II8B 1E1RD 1ZM2A 2OUKA 3CH4B 4FCVA 1CJVC 1KK3A 2LKDA 4G5RA 1UBEA 3AEZA 1C4OA 3I1FA 3OEED 4MYCA 5G40A 1ZM9A 2PBRA 3BBPA 2E87A 1W36C 1E32A 4FWIB 2YOFA 2DWQA 2FGKA 5LB2A 1E2QA 3VR5A 3GLIB 3WRYC 1FFHA 3HYRA 1B23P 3NKVA 1VECA 1E79D 3EIEA 3OHMA 5EZ6B 5JJIA 4IXMA 3I4LA 2XGJA 3IILA 1VMAA 5E4FA 1CS4C 2GWHA 4PC2A 1FQKA 3X1XA 1SVKA 4DKXA 2VL7A 2PT5A 2MSCB 1P6XA 1Z0FA 2XSZD 3R8FA 5DNYB 2ATXA 2Q0HA 3CF2A 2OM2A 3CPJB 4MGYR 3HPQA 4WZBE 1SULA 4IFBA 3BFVA 5EXXA 4UNQA 1G21E 2PEYA 2VEDA 3TR0A 3ZLJA 3GJ3A 2HCJB 5D3MB 4EFNA 3R9IA 3VR3A 4IFEA 2WPDA 4O0MA 1EG7A 2HLDA 1IN4A 2C2HA 2FJUA 4P0TA 4D0NA 2CEAA 4Y0AA 3RRYA 5JMTA 4U7DA 4CDGA 1JR6A 2V54A 4HLUA 4Q1CA 4XD7A 5GJVC 3ZS9A 1GZSA 4BFXA 2NO1A 4ZO4A 1LVGA 1N5JA 1ZCBA 4Q19A 5DLQC 4F4IA 2OBLA 1N6PA 1XD8A 1X8KA 2Q9CA 2RKOA 2JLRA 3UWOA 1WMSA 3LNCA 4Q48A 3SYNA 2FSGA 1E2GA 3SDZA 4C0JA 2GKSA 4CZ2A 2JAQA 2XB4A 2ONJA 3CWQA 3MD0A 3V4FA 2GK7A 4X8HA 1HUQA 3SJBA 1DAIA 2ZYTX 4AYXA 4PQYA 2ZI4A 4KBGA 4BFVA 2DHRA 3FOZA 2GK6A 4LJYA 5ANRB 3PJRA 2JLVA 1Z63A 3X1YA 2FMXA 2JJ1D 3QKRB 1XCGB 4QGGA 1FZQA 2W0MA 1N6OA 4UNPA 3BFKA 2O8FB 2GA8A 4XTCS 2W6JD 1KI9A 3BAFA 3F5FA 4ZCIA 1R5BA 2QORA 1YZUA 1C9KA 2ZUBA 1UJ2A 3THYA 1XTQA 2DPXA 2I1VB 1D9ZA 3KQKA 4YXWA 4GP6A 4TL8A 3RWOA 2QT1A 2YZ2A 2ZI7A 4Q03A 4PQRA 1XB2A 4PC1A 4A4DA 2QPAA 1TQ6A 2GJKA 3DEFA 4PC3A 4U02A 1OT3A 1PVOA 4D0LB 3B1VA 4I4LA 3FHOA 4JVNA 3AVUA 2X2FA 4CEJB 1QHGA 3UMSA 3Q8XB 3A36A 1TPZA 1ZD9A 2CNWA 2ORIA 2WWXA 3PR1A 3QJYA 3CPEA 5EXTA 2VHTA 4O2LA 1VG0B 3ADBA 2IUTA 1CXZA 1RRPA 3P32A 4Q9LA 2R62A 1W1WA 3WYAA 5A5GA 2QP4A 4M0LA 4NCIA 2WKPA 1G1MA 3I8SA 5JRZA 4B76A 1WRBA 2GNOA 4C0BA 5K8TA 2W6ID 1SXJA 1YJ5A 1F3OA 2IYQA 1G16A 2ZJOA 3CIOA 1QDEA 1G7CA 2OFOA 4JLPA 1W36D 4V0KA 3EW9A 1CBUA 3BRWD 3OIWA 3AVWA 5EQTA 3LBHA 3U3MA 2C5LA 3R9WA 1BH2A 1N6IA 4QHYA 1WBDA 1P9NA 1EFTA 3SJAA 4TQAA 1P5ZB 2WMNB 1IONA 1D9XA 2O0KA 1T3SA 1Z3IX 2CCGA 3M1IA 3SOPA 2VLIA 2IYXA 4D0GA 1F48A 3FTQA 5FBQB 3IO3A 4X8LA 2GJ8A 4MKFA 4HLCA 4NYJR 3PV0A 4KFUA 1G8FA 3AVVA 3KB1A 3ZIAD 4BFZA 4A0FA 1GNRA 2QRNA 3K9GA 4PPFA 4PTLA 1SXJE 2HCBA 4P4SB 1LF0A 4Q4HB 4HZUB 4TL6A 5L3QA 3QPUA 3U3JA 1QG2A 4BLTA 2KWIA 1RJ9B 3U3OA 1MRNA 3QXJA 3MG9A 2EFHB 1IN5A 2J87A 4NYMR 5G3ZA 1GRQA 1PLLA 1T5IA 4PANA 1XTSA 2HXSA 1KNXA 4QBFA 2VO1A 4WW0A 5F3WB 2WSSD 4BFSA 4KAXA 2WJGA 4EQ6B 3M6AA 3GFTA 2QPTA 1Q1ZA 1U99A 3T15A 4EIWA 4DCSA 1P9WA 1XJCA 1OFIA 3QXCA 3REGA 2A9KA 1QZXA 2ZRPA 1HURA 2KSQA 4Q4JA 3HU2A 3KKNA 4B48A 1VCOA 1Z47A 4OI4A 1Q57A 2IEZA 1ZNZA 3A4NA 2QMOA 5KU1A 1Z28A 4TSFD 3X1DA 3ZD6A 4ZDJA 3CRW1 5E3HA 1JEEA 3JZAA 1RC8A 5L3RA 4Q7LA 2NZ8A 2VP6A 4C3ZA 5EE1A 4E22A 4MYUA 1GG2A 2ZJ5A 4ABYA 1R0XA 1IXSB 3DOEA 1II8A 1SVOA 4RCYA 3O8DA 4M1SA 2CVFA 1F6BA 5FUYA 1M2OB 4YMUA 3UIEA 4OHVA 5DSZA 4B33A 1J8YF 3TMKA 1J90A 1YR9A 3U61B 2QUZA 4NH0A 2ZU0C 1KIMA 4FN5A 1ZBDA 2IL1A 1E96A 3NC1C 4QNMA 2B6HA 3K0AB 1T3LA 1XF9A 2IXEA 1P75A 4O3MA 1KI8A 2RB4A 2V7QD 4UXHA 3GLIA 4DBLC 2F1HA 3VR6A 3QEJA 1E98A 3KXLA 2WJJA 1NNEA 3ND8A 4TMVA 2ZJ8A 1FTNA 1ZUHA 1ESMA 5SZIA 1AGRA 2ZE5A 5FPTA 2A7QA 4LJ7A 3B60A 2ANCA 5DI3B 3GEIA 2QT0A 4Z8XA 2PZEA 2VSOA 3FMPB 4HYYA 3RWMB 4GFDA 3TLXA 1N5LA 3K9NA 5D3MA 3BJIC 2QAGA 2NO6A 1OE0A 4A8JA 2PMKA 2QE7A 4I1UA 4XWAA 2ZRGA 2WJIA 3F3YA 3OIYA 1GL7A 1S2MA 1EWRA 4HAWA 4Q00A 4TLCA 3SN6A 2J7PD 2KB0A 1KI2A 1N0WA 1ZNYA 4DEXA 1Z22A 3MUFA 5L3VA 3DZ8A 2CLDX 4TMWA 3H86A 5FL7D 3GLIE 1OB2A 5BQ5A 1U8AA 2FNAA 3D8BA 1UKYA 4LJ8A 1WBBA 3AUXA 1ZYUA 1S0UA 1DO2A 1TTTA 1XTJA 1Z2CA 2OLKA 1KKLA 2R65A 3K70B 1TU3A 1YZTA 4EJSB 4Q1BA 4LPSA 4RD1A 1PUIA 1T9HA 4LWZA 3NIBA 5IRCD 1CJMA 4YONB 5CYOA 1ZU4A 3PVSA 1OIXA 5CM8B 2W2VA 1XPOA 2IK8A 4K81B 1T0HB 1OXXK 3DL0A 3NWJA 5B64A 2O8FA 2FSFA 5AJXA 1Q20A 4RCZA 4W7SA 3SHWA 2IC5A 4V02A 3IHWA 4A92A 3AUYA 3OF5A 4JBXA 1KGDA 2ZSEA 2ZAMA 3KKOA 4B3XA 1OIVA 1DEKA 2EYUA 3Q7QA 4HZIA 3W6OA 4QM6A 1NL3A 4PPNA 1XFAA 1W0KA 2D3WA 2PJZA 2BCJQ 1L2TA 3T34A 2A5YB 2OAQ1 1U8ZA 4HDCA 1DOAA 5CB8A 1I4TD 2OBMA 2UZ3A 3K0SA 4CGZA 2IF0A 2Q9BA 2H57A 1QHNA 1E2JA 4JJKA 3C5HA 3NBYC 1NVUQ 2A5GA 1WF3A 1XNJA 4XWOA 4RFSB 2Y8EA 2J0UB 3GLFB 2IUUA 221PA 2Q3MA 4DLXA 2XZLA 2JATA 1YQTA 1TADA 2HJGA 5SZHB 1NRJB 1IN8A 2PEZA 4JLVA 2GJSA 2VF7A 3K0CA 1G8GA 2G0TA 4KVAA 2UZIR 4BEBA 2F6RA 4LYAA 2HUPA 2ZR0A 5KDOA 2G6BA 4GNKA 4JL6A 5FR2A 1Z2AA 2VH5R 1GWNA 4IDQA 3I32A 1N2CE 5CK4A 1S96A 2ZRLA 3UK6A 3MRSA 4LHWA 4Q47A 1XU4A 1QVAA 3QUSA 4ON9A 3MMPA 3CPHA 5CK5A 3EZ9A 4GL2A 2ZRJA 4LHZA 5CLLA 3T1OA 4KITB 4PZZA 3SZRA 3AP2A 5LB4A 2V9PA 4MKIA 2ANBA 3BORA 3N2IA 1PV4A 1W0JA 1UBFA 4R7ZA 4Z1MA 4AKEA 1DO0A 3RS2A 1EESA 3H0KA 5AJYA 3KKMA 4RD3A 5IK2D 5ELXA 3B13B 3I8XA 1D6JA 1GAJA 3VR4A 1NN5A 1E9SA 4P4SA 2ZSDA 4HZUA 5J4KA 3SNHA 4LPKA 1NN1A 3EPLA 4NYJQ 1RZ3A 4GOJA 2NO7A 2QQ0A 1IY1A 1RJ9A 4I81A 4TLBA 4QNRA 1T8UA 1JR3D 4Q9HA 3FGNA 2PT7A 3QI2A 5FTJA 4YDHB 4AYTA 3UKDA 4JBYA 4UNRA 3FDIA 2F3TA 4OYHA 3LDAA 1NVWQ 4NTZA 2OCAA 2QMHA 1MO3A 4TL9A 4DSUA 1Z8FA 4EQ6A 4RVCA 1RYFA 1KY2A 2R6DA 4D4KA 3VHLB 4NYIR 1CU1A 2A30A 2BV3A 2WVJA 3AKYA 5L3SA 3RVBA 3TK1A 2JDIA 1UDXA 2GJAA 5EUQB 3ZVNA 3CLVA 2WWFA 2BBTA 2FG5A 1UFQA 3GQBA 4JLNA 5EZ5A 5K8UA 4P31A 3CNNA 1CR4A 4OK6A 3ICQB 4ASUD 1LY1A 2JASA 3MSXA 1WP9A 1DAGA 5AJWA 1S3GA 3Q3JB 3W3ZB 1NY6A 4A0HA 2H18A 4GOKA 3IQXA 2JIZA 5E7MA 1VCIA 4GZLA 4PC7A 1KAGA 4LZZA 3U7GA 5GADl 2IYZA 4PO1A 4C9BA 1A1VA 2PL3A 2B8WA 3TW8B 421PA 1E2IA 1ZUNB 2A3RA 3VAAA 1ZD1A 4G5OA 4OBEA 3HR8A 4QHTA 4AC9A 1KSGA 1KO4A 4G3XA 4JLMA 2JGNA 1KKMA 3T5GA 3THOA 1P2UA 2JJ2A 4C0KA 1WA5A 3QG1A 1D2NA 2FH5B 4QRHA 3IIKA 3L0PA 1NKTA 2I4IA 2Z0MA 3EPHA 3PEUA 3GLHB 3OFNA 5F9FA 1JXOA 4M8NE 1E4VA 5HZKA 1CTQA 4O25A 2NZJA 4Z54A 3GJ5A 5DI3A 2DFLA 2LWIA 1H8HD 1NI3A 3KQLA 1AS3A 4BLQA 3WMFA 3MFYA 4BLRA 3PEVA 3ZVLA 2C9CA 3WXMA 3SYLA 3T12A 1N3BA 3DMNA 1E2EA 1D2MA 1P9RA 5C46F 4L15A 1OFHA 1XMJA 3GJ8A 1KK1A 1US8B 4IVPA 3B5JA 2IW3A 2ODBA 1XBTA 2FX3A 1NLFA 2AXPA 3N70A 2O0HA 3CH5A 1N0UA 2P6RA 1ELOA 2QTVB 1OJLA 1VG1A 1Z07A 1R6BX 2QN6A 5BN4A 1ZW6A 2KBEA 1SGWA 3QQ5A 3BFXA 5HCIA 1Z6AA 1VCMA 3A1VA 1HA3A 1W4BA 5FH9A 2OFWA 3OEHA 1X8LA 2EFGA 2RGEA 1X6VA 3BE4A 5H1YA 3QBTA 3FFBA 2DB3A 1E4YA 1M34E 2EW1A 2J45A 3RRMA 2FWRA 5F98A 3K8YA 2XJ4A 1OHHA 4FMBB 3LWNA 3DPUA 2AR7A 2C95A 3MWYW 1F2TA 5KYKA 4Q18A 3VX4A 1Z29A 4PSVA 4KHZA 4DDTA 1E1QD 2O8BB 3OIVA 1Q1QA 4JIMA 3VTKA 2ZE8A 4Q1DA 4D26A 4OI2A 1JB1A 2P6NA 3PENA 1GKYA 1KO8A 1P2SA 2OXRA 3AKCA 1SXJB 3NEJA 4LOAA 4LC0A 3EZFA 1G3IA 4N0DA 4DT1A 4JVSB 1YZGA 4ZI2A 5CJPA 4LHYA 2DR3A 4JLAA 4UQOA 1J99A 2P0EA 4PAOA 5EP2A 3IBGA 3AVPA 3CNOA 1NLYA 3B82A 1M1YE 3GLFA 2EU8A 1GITA 2I1QA 3L0OA 5FTMA 2XITA 4UJ3A 2A78A 4N0EA 4QKQA 1WB9A 4FINA 1HEIA 3CRQA 4PR0A 3T1VA 3VNVA 3EZ7A 4D82A 4YMVA 1DARA 4MGZR 5K8LA 4FMDB 2ZRHA 4M1YA 2KI5A 5IF9A 2C96A 3FHCB 3TBKA 4DUGA 5CDFE 3DKPA 4XJXA 3WRXC 5IHPA 3P4XA 1A5TA 3H4MA 4D4JA 5L3QB 2O52A 1TQ2A 3MJHA 1JQLB 3RS4A 1Z83A 4C0QC 1MR3F 3FYHA 4DLTA 4OHYA 3I62A 3FMOB 4GP7A 2KE5A 1TEXA 4POAA 4B43A 1JALA 4DSOA 4B6EA 3EXAA 1WCV1 3ZS8A 1Z6XA 4DLWA 1XJQA 2FGJA 4E07A 4F4JA 3GLFE 2QMUA 1JNYA 3NDPA 1AZSC 5AWFC 1KJYA 3RRZA 4G1UC 1H65A 5JEDA 2BMJA 2HDNB 2ZJYA 2CL0X 1TF2A 1PJRA 2V8OA 5J4VA 1E9CA 4M1WA 3AF1A 4JSYA 1N0VC 2ZTSA 1ZIPA 1S9DA 1E0AA 5G3YA 4QGFA 2H5EA 2IWRA 3RC3A 2ZITA 3PFIA 4F93B 4A6XA 1IXRC 5DYIA 3EA5A 5FTLA 4D4MA 3KKQA 3Q7PA 4NL4H 4CT4B 1AM4D 1DTSA 1YZNA 3OE7A 1JECA 4IRUB 3LY5A 2CHQA 3NTUA 2QBYA 3AM1A 3KJIA 3K0FA 5DO9A 4IJMA 3NXSA 4JL8A 3PUVA 4DB2A 2HT6A 3MLEA 1NN0A 4GT1A 4JMPA 5FOUA 2ZJZA 3QF7A 4EPVA 1U81A 4F4CA 5KPDA 4NCKA 3CB4A 1KMQA 2C9YA 2VP0A 3DMDA 3ADCA 5EP1A 1HV8A 4IKEA 2QP3A 3GEEA 5M04A 1A4RA 4OK5A 5KOYA 3UPUA 3G0HA 5BWMA 5FOWA 1XXHA 3G82C 1UPTA 4US2R 3U44B 5LBIA 2CE2X 4L8GA 1BMFD 2WJHA 3NHBA 3KFVA 2OESA 2WWYA 1RYHA 3TNFA 3ZZUA 4DDUA 2PZFA 1W4RA 2CDNA 3RS5A 4JT2A 3U2QA 4K8OA 5CIWA 4DLYA 4BECA 4HATA 1IOZA 1GNQA 1N25A 3GD7A 1SVLA 5GVRA 3AVTA 2CVHA 4M9QA 5DN6D 4S35A 3PEYA 1EFRD 3E70C 3IEUA 2A5JA 3QF4B 5DIFA 4BFYA 2QAGB 4TMTA 2GHIA 3CZPA 3OAAA 4A8JB 2ZRNA 3RNLA 1V5WA 3LV8A 2IXFA 4WOPA 2V6JA 4LBWA 1DS6A 4QG7A 3ZGXA 1DAMA 2V7QA 5GVSA 3TVTA 3TIFA 2AFHE 2C9OA 1E0KA 4B73A 1LNZA 1L4UA 1XXHE 2ZS8A 3VU9B 4PHHA 1NBMA 2MMGA 3GLHA 4ZCLA 2ASEA 4PHGA 2J46A 4ZV4A 5EXPA 4DSTA 1UDWA 4A2PA 1T6NA 5AJVB 3T61A 3VFDA 2AX4A 5EXSA 2ZI3A 3BS4A 4TZ6A 1KSHA 2BMEA 4A2WA 2B7BA 2FSHA 3KTAA 4OK3A 2BJVA 4GDFA 4OI1A 1HE8B 4ILEA 2SHKA 1CJUC 1AIPA 4XOIA 5KSPA 4B75A 3L0SA 1P3JA 3TR5A 3TSZA 2YWGA 3U7EB 1LB1B 1JAHA 3W8NA 3KXIA 1US8A 2OFXA 2XZOA 4BE7B 2YC4C 1S8FA 4EDHA 1LFDB 2ZYVX 3A8TA 4NZYA 3RHFA 2ZEJA 3P26A 1CR2A 1U8YA 2CXXA 2GXUA 4TT3D 2VHJA 4BEJA 4IOLA 3ZVMA 1JJ7A 2VBCA 5HTKA 3RABA 1NIPA 3A37A 4URZR 1NBME 3LXXA 4KVGA 4D25A 3GLHE 2D2FA 5KNDA 3CRVA 1XJ0A 4QC2A 1OYWA 1R0WA 3TUIC 3A1SA 4JT4A 3K09C 1MOZA 1R5NA 4QM7A 2VF8A 3FWYA 1H8ED 4YMWA 4RD2A 3U4QA 1SVMA 2A5FA 4LV5B 4HAZA 1KSJA 5FOXA 3WY9A 2XXAB 2IS6A 2O8BA 5JJKA 3VHXA 1YZQA 1G5PA 5FUWA 5EJEA 1PZNA 3SQXA 4ZKEA 2GCPA 4PO8A 2FOLA 3X1WA 4JLOA 3EAQA 1I4DD 4OQLA 1HE1C 1MH1A 1ZM7A 2GCOB 2QA5A 2ZSAA 2CLCX 2PX0A 1IY0A 4Q21A 2L0XA 2ZRMA 4TYPA 3FFAA 1E2LA 4V03A 4Q66C 4Z8YA 4MDEA 1KJWA 1XTKA 3EA0A 4FW9A 3CKLA 4M9SA 1BO6A 4PAMA 4B2IA 2VP4A 4X8MA 2G9NA 1G291 4V0ME 3TAUA 4DLSA 5LPNA 2F55A 5HE8A 1KZ7B 3TJZA 1G5RA 4TYYA 2ERYA 3LA6A 3EG5A 2ZR9A 3A4MA 3PUXA 5LD2C 4KU4A 1XWIA 2I3BA 4RD0A 4S2EA 3BH0A 2LCFA 4KYIB 5SZKB 2Q3FA 1R7RA 4H9GA 5JJLA 4PPGA 1NIJA 5DHFA 3H2YA 4BFUA 1JI0A 2H92A 4A0RA 3L8ZA 5P21A 2D74A 2E9SA 1X3SA 3REFA 3B9PA 3D6TB 3ECCA 2J0SA 1G8HA 2HYDA 3TH5A 2C03A 3RSOA 2ZRIA 1FUKA 4FIDA 1XX6A 1COWD 4DIEA 3B1ZA 3CX8A 2IYUA 1A7JA 1RIFA 2B7CA 3WYFA 2IT1A 3IUYA 2CMKA 4LBZA 2CHGA 3B1XA 3IKJA 4W9MC 5E95A 3X2SA 5DISB 1E9EA 2AFIE 4A36A 2IYLD 2ONKA 4B47A 5L3SB 4X8OA 4Q9JA 1NP6A 1Q21A 1Q44A 2IHYA 1LF5A 1KI6B 1VYTA 2J41A 4R9UC 4BWYA 4IOJA 4G0NA 1JPJA 1ZINA 2KJQA 2JJ8A 2VP2A 2AWOA 3BXZA 1YRBA 4U00A 1G3RA 2CK3A 3B1WA 4XSHA 4E03A 1KO5A 5C18A 3A58B 5FTKA 3TQFA 4B3DA 4AY2A 4DEYA 4JYBA 3KQNA 1U9IC 2RGAA 3AV0B 2O8EA 2BIFA 2OT3B 1II9A 4IXNA 2CLSA 1U98A 3IHLA 2DFKB 1HTWA 3GCGA 1Z6YA 5B30A 3OIUA 1Z0JA 2MSDB 5H70A 5JRJA 1W5TA 2CHVA 3C7KA 4BRWA 2VHUA 3GEHA 4EPYA 1JAIA 4C0SA 2DFNA 3FVQA 5KTYA 5CJ2A 1EFUA 1K6MA 1ZC4A 3ASZA 5FBWB 4B3CA 4O2RA 1IJEA 4LX0A 1JPNA 2X8AA 3C41J 4ZI3A 3MWLA 1CKEA 2F9LA 3U44A 1HT1E 1PUJA 1HQCA 2YJTD 1N5KA 2BBWA 5SZJA 1MO6A 2ZYUX 4Q9IA 1M6NA 4KLZA 1ZM3A 5FPHA 4CT5A 4DWJA 3DO6A 4IW3B 3SBDA 1B0UA 4RKFA 3LX8A 2WPDD 2ZROA 2HLDD 5JS7A 1EXMA 3BB4A 3QF4A 1E9RA 4XD7D 1E99A 5TARA 2O8CA 1M7HA 5JCPA 2C04A 3CRRA 1Z0KA 2WBLC 1RW4A 1QBKC 2YWHA 4OQNA 5AR1A 2VQSA 4KLNA 4AURA 5DGXA 721PA 1R4AA 4QL3A 1E2KA 1P61B 2W2TA 3CNLA 1UBGA 4LYHA 3VU9A 1HYQA 2JCSA 5KSOA 2GESA 2H17A 3TUZC 3SBEA 1W47A 3Q85A 4URUR 4DB4A 2V3CC 1J8MF 1OKKA 2WWWA 1Q1EA 4HI0E 4XSGA 2WIBA 3WBKA 1F2TB 4UJ5A 2ZVQX 3MWJA 2IX3A 4US0R 4CIDA 2QROA 2PCJA 2X19A 3X1ZA 1FNNA 4YXWD 2AKAB 2YOGA 2C98A 3EPKA 3CX7A 1TF7A 4L16A 1DAKA 4OHWA 2LKCA 1IHUA 3DZDA 3EWSA 2OXCA 5AUQA 3LW8A 2P5SA 2NO0A 2ZYWX 1CR1A 1W7AA 1EWQA 1XEXA 1IM2A 4LBYA 1Z08A 4B35A 4DT1B 2XZPA 2CNWD 5HKKA 3LBNA 1BIFA 4GRAA 3DM5A 1Q0UA 4CF7A 1RVDA 1J2JA 1IQPA 2UVQA 2GBLC 2XJ9A 2BEJA 2VHCA 1CJKC 4RD4A 1CLUA 3W3AA 1GILA 4IEEA 1AKYA 2A2ZA 2P5TB 1UKEA 2ORVA 2XXAA 3LFUA 1SXJD 1YU9A 3I5XA 4NCNA 3LQRA 2F1IA 2R2AA 4RY2A 2ZRDA 1AA9A 821PA 4WA7A 1VHLA 2GCOA 2ZRAA 4TN1A 4A1FA 2ZUCA 1LTQA 4EPTA 2IYSA 3B9QA 5CM9C 2VPPA 5H8WA 4ZDKA 1E0JA 3FE2A 2ZVPX 4I99A 1W36B 2IA5A 4V0NA 2V55B 2D4HA 3SE0A 3AQ4A 2XNDA 3CONA 4BFTA 4DSNA 2N46A 3FHTA 1T8TA 1NMZA 3THWB 2YINC 2X2EA 3GLGA 4Q4LA 2WSMA 2YOHA 1JQJC 4MRNA 4K46A 3QPWA 1G3MA 1R5OA 3IIMA 2BWJA 1MV5A 2X1VA 3PUYA 1P4SA 4LBVA 4PZYA 1QG4A 3E5HA 2QGNA 4G5SA 4P3YA 2H1LA 2IYVA 5BN5A 4WIAA 5F2EA 1NMYA 4Q4AA 1N6HA 3ZD7A 3T1QA 3NVAA 1OPXA 3QKSB 1VCNA 1OFUX 4TMXA 2BKUA 2JLWA 4B6FA 1G20E 2ZETA 4II7A 2VHQA 4KSBA 4FXPA 3VR1A 1GNPA 1KDPA 2P2LA 3SJZA 3RAPR 1Z0AA 1KTVA 3BIFA 1U94A 2PMDA 1OH6A 3DHWC 4MA4A 4AKIA 5TXGA 3GJ0A 5B57C 3K9HA 2VP9A 1AN0A 3GLGE 1IY2A 1I2DA 1UBCA 4LDJA 5J40A 1SKYB 3R7WB 1TNDA 5GJCA 5EP4A 2N42A 2PLFA 2QBYB 3K0FB 4WVFA 3AVQA 4NYMQ 1KYIA 4B71A 4MRPA 4XVRA 1WDTA 2AHOA 2Z5FA 3GFPA 2BMDA 2ZXUA 1S9HA 3CR7A 2AXNA 1RPZA 1KI6A 3HJNA 2XOKA 4P33A 3CO5A 1GIAA 3Q9LA 3LQQA 2BM1A 1E2PA 1QHIA 2GRJA 3KQUA 3UANA 1XXHB 3B8HA 4LC1A 4BGDA 4MQBA 2ZRCA 5JWHA 3FKSA 5AUPB 3WP1B 2QSZA 3T1TA 3NEYA 2OILA 1NN3A 5HE9A 3SEAA 1W4AA 3I61A 2PJRA 4OL0A 1E1RA 4EAQA 4BUJA 4MGKR 4FMCF 4F38A 4KJZA 2GAOA 4HUQA 1NSFA 3BC1A 4HAXA 1N6LA 3WMGA 1G4UR 2BOVA 2ZSBA 4N1AA 1IN6A 1JJVA 3OEEA 2W58A 3TSOA 1O87A 2OZEA 1S1CA 5C1BA 2IBMA 3TSWA 3AB3A 5FFMA 4AYWA 1W2GA 2XTMA 1OW3B 2G83A 2WWIA 1I2MA 1XMSA 3L43A 2D06A 3QNUA 4QBIA 1ETUA 2D62A 2F9MA 2HEIA 3H84A 4IDHA 4WBSA 3BB1A 4GZMA 3SYKA 3W5IA 5J4LA 1QHYA 1E79A 1S1MA 1QHSA 3L0IB 3PCRB 4NONA 3CF6R 2IXGA 1G4AE 4JJZA 3CZQA 3N5CA 1Q22A 5GJWC 2ZS7A 3FMIA 4ESVA 4RSGA 2XSZA 4C2TA 4JS0A 5C2JB 4M9ZA 4RZXA 4A0GA 4BASA 4KI0A 4PX9A 2HYIC 3WNBA 4RD6A 3ZVRA 3KTAB 4MYTA 2NPIA 2QE7D 4L4UA 1AKEA 3NH9A 3VX3A 3RC8A 5FOSA 3FKQA 3NH6A 3AKDA 1ZD8A 2NO9A 5HZHA 2J0VA 3C14C 1NKSA 1YE8A 4EFMA 2OLJA 1U0JA 3PG5A 5HPYB 2EFEB 1LW7A 2EYQA 1W49A 2GF9A 3JVVA 4ARZA 2ZRKA 4JKIA 1MO4A 5TVKA 2ZI9A 4GMDA 2CE7A 2ODEA 1AZTA 3BK7A 2PLRA 3C16C 4AK9A 1NJFA 2FFQA 3E1SA 621PA 1W46A 2XEXA 4KO8A 2OG2A 2J1LA 3LD9A 2RGBA 4BLSA 1U0LA 2C77A 1G3QA 5FBLB 4A82A 3CF0A 1G3UA 2P6UA 3QENA 2XB2A 1RRGA 2WIAA 2QPOA 1GFIA 1RRFA 2ZJ2A 3A1UA 5AJZA 1G41A 1R0ZA 4E5UA 3EASA 2Z4RA 1P2TA 3TW4A 1M7BA 4AKHA 3P27A 3KUCA 3NDBB 3D31A 3LX5A 2JJ1A 2FZLA 1FP6A 2REBA 2GJ9A 5JZVA 1EFHA 2ZS9A 1DVRA 4TMZA 3U4QB 1AQUA 3QOFA 2W6JA 2HT1A 2WJVA 4MRSA 3SI7A 3GPLA 2QENA 3WHKA 1W0KD 4QOSA 3IPXA 5JWRA 4NBSA 3RYTC 5F9HA 4GPTA 4OJKA 2O5VA 2FV8A 5CDFA 1IBRA 1TF5A 1CEEA 2CBZA 1T5LA 4MITA 1EK0A 2FPKA 4KFRA 3TE6A 3VQTA 3P20A 4XH9B 2VP5A 3H1TA 1KI1A 4BPBA 4L9SA 4KCGA 1W2HA 4QHSA 4US1R 2OV2A 3U7HB 1IAQA 4YDSA 5FR1A 3CW2A 4HLDA 4OHXA 3QEOA 4OQXA 2IS1A 2WKQA 3QVVA 1WE2A 4TTQA 3ZZ0A 1KI7A 5LDDC 2DCUA 4TYQA 1F5NA 1TX4B 4GMXA 2CL6X 2BKEA 3AKEA 1N6NA 2DY1A 3IDQA 1SHKA 1FPMA 3KDSE 5G41A 4ACBA 2W6IA 4FCWA 4Q1FA 4JLDA 1UKZA 4GI7A 3LAWA 4YLGA 4UXIA 3B6EA 4HAYA 1CRPA 3KKPA 1T91A 3FB4A 3U3KA 4Q1AA 4Q02A 4GSYA 4DCNA 3Q5DA 4Q7KA 2BEKA 3MJRA 2QM7A 2R6GA 3ONWA 5JI3E 4QBGB 1D2EA 4B44A 4DHEA 2J9RA 1W0JD 1SZPA 3W5JA 4CEIA 1YZKA 2QEQA 4Z1MD 2J5XA 3THWA 1UEIA 3DOFA 4LSGA 4M9XA 5JLJA 4C2UA 4CEHB 1XD2A 1P72A 4EJSC 1NMXA 3ZJYA 2O8DA 4DLZA 1A2BA 1S4QA 3BH6A 4KFTA 1CP2A 3QPVA 5IT5A 3A1WA 1FTSA 3ZIAA 2Z83A 3QKSA 1MABB 4YMSA 4B3BA 5FTNA 3TVDA 4ESHA 3C8UA 3ETLA 1R2QA 1XZPA 1E9FA 1KOFA 4RKEA 1K5DA 1R8SA 1ZNWA 2JLSA 4HUTA 1AS0A 2AKYA 3I3SR 2EFCB 2P65A 6Q21A 1A2KC 2O8EB 5FOVA 2WSSA 1ZCAA 1G7RA 3GJ7A 2ECKA 4NCHA 1UEJA 4PO9A 2R6FA 3R7WA 5AUNB 2R9VA 1OH8A 1Q3TA 4BRUA 1GTVA 2HJVA 1NVXQ 2JDID 3A1TA 2AK2A 2RGCA 3AP3A 1BYIA 5UKDA 2GZHA 4D2IA 3VKGA 2HF8A 5KNBA 2QTHA 8OHMA 4M1KA 3T5DA 1AJEA 5CIQA 1GP2A 1VIYA 3TAHA 3MGCA 5TMPA 4ITRC 4TSFA 1CF4A 4NE2A 2ZRBA 1OH7A 4IEIA 1KO7A 2W0SA 5KNCA 4JLBA 4NYIQ 4DLVA 1W44A 1EX7A 2G88A 5DI9A 4IVRA 2JIZD 1XPRA 2VIIA 4Q9KA 5BYKA 4GBMA 4JBWA 4DDWA 3HWSA 4UNSA 3EWAA 1ZUIA 2CCJA 1Q1BA 2B8TA 4JLKA 4TTPA 3BB3A 4P4TA 1OB5A 1SKYE 2RGXA 1NVVR 4ERNA 4AKGA 2WHXA 3EC2A 4ACAA 4ZDIA 4QJ3A 2JJ2D 5G53C 2GEUA 4TTRA 4YMTA 1NJGA 2O8CB 1BOFA 2GVZC 4AWXA 1CR0A 2ZSFA 3KUDA 2RGNC 3K09A 3QE0A 4TLDA 2UKDA 1X8JA 4IOMA 3O8RA 3K1JA 3OFND 1NG9A 1KDRA 1XTIA 2QM8A 5KSYA 3P1JA 5FI0B 4PSAA 3AVOA 4MYHA 4RFVA 1KNQA 1OLOA 2ERXA 1RRCA 1XP8A 2ZUDA 2OHFA 3PIRA 3C15C 2YYZA 3RANA 1KJZA 3I72A 1VTKA 4R98A 3SS8A 3AVXA 3EZ6A 3NBFA 3VKHA 4QXAA 1VYVA 1OIWA 2QSYA 4WZ6A 2VTKA 5CLQA 2P3SA 5E7IA 1FMJA 3D7MA 4TQ9A 2BBOA 2F7SA 5FI1B 5HCNA 5JSZB 3OZXA 1HH4A 1OFTA 2J7PA 3MAAC 4RZ3A 3CBQA 5AK0A 5FPSA 3ZQJA 4B2LA 1ZIOA 1OF1A 5FL7A 4HAVA 3K70D 3QBVA 2F1RA 3OEHD 4DLRA 3HP1A 1P7CA 1XEXB 2FPMA 3DM9B 4TYNA 1T3HA 1OHHD 4KV9A 4LYJA 4C7OA 3T06B 2V1XA 4OQMA 5EE5B 3U60B 1YZLA 3THXA 4TLEA 4V0MA 3SHFA 4BQSA 1VDZA 1RKBA 1YHNA 2K5UA 1DG1G 4M1OA 1P2VA 4D4LA 5BW8A 2RHDA 3F8TA 5HR5A 5JHHB 3B1YA 1E2HA 3ZQ6A 2NQ2C 4WXPA 2ZJBA 2QU8A 3ASYA 3CX6A 2J7KA 5CB6A 5TV2A 1DBSA 3W6PA 3OESA 1E6CA 1HQYE 2QRZA 3KX2A 1HT2E 4G01B 3WNDA 1KAOA 4DDVA 4MRVA 1FMLA 5DH9A 5DYGA 4DC9A 3FMFA 5J47A 3IPYA 1KI4A 1QVRA 3NC0C 4HLUC 2DFTA 3W34A 5KDLA 3SC3A 2ZQ5A 4IVQA 2JLYA 3ZDQA 5C4GB 1L8QA 2AN9A 1TL7C 3MCAA 2QI9C 3IIJA 3V4RA 3SQWA 4M21A 4DXAA 521PA 2DBYA 3GLGB 4QJ5A 4F7WA 1E2DA 3NBXX 1G6OA 3WNCA 1OXVA 1FX0B 1K8RA 4LJAA 5E7JA 3SFVA 3PXGA 3IEVA 2YHSA 4MKHA 1U9IA 2RCNA 4JLJA 4DUGD 4RZ2A 4ZPXA 4HSEA 4WXRA 4HAUA 2PH1A 2XTZA 1KI3A 2CCKA 2WICA 4Q4AB 5JBQA 4CYMA 3QVUA 2EQBA 2O0JA 4R2HA 3UXMA 4KSCA 1U90A 1F60A 2BDTA 2QZ4A 4URWR 1XCMA 5C4MA 3LLMA 4JVLA 5L8VA 2IS2A 3K0EA 3W90A 3U6BA 1OXSC 1K5GA 1SVIA 2CJWB 4NCJA 1F2UB 1XEWX 3QKTA 4E09A 4CEHA 2VRWA 3UG6A 3J81k 4MGIR 3PITA 3LRPA 4Q01A 4WAUA 1KDTA 4EUNA 2GEDA 1UM8A 5BN3A 4LJ5A 3TGPA 5J4HA 3DDCA 2FE4A 4P32A 1MT0A 5FL3A 5IK2A 3WBJA 2FF7A 1GM5A 5KUTA 2QAJA 1MABA 3S1AB 5JECA 1P60A 2R8RA 2PZGA 3MWKA 1OSNA 4DJTA 1RE0A 1GOTA 2ZANA 3GJ6A 2FFHA 3P4YA 2EWWA 4I1OA 3GP8A 1MO5A 3EIHA 3RS7A 1GRRA 1VG9B 2YNMA 4U5XA 1JR3A 1QHHB 4MUAA 3KQHA 5TDHA 1GL9B 2JA1A 4B74A 2WWGA 3OE7D 3R20A 1VKJA 4NDZA 1SXJC 1OH5A 2F43B 1GUAA 5KPJA 1VYUA 3ADDA 2EFDB 1OXUA 4FD2A 2EWVA 2DYKA 1IN7A 3LVRE 2ZI6A 4HUQB 1FOEB 4Q7JB 2J59A 3GMTA 2GXQA 4URXR 3T35A 1YVDA 1AGPA 2BC9A 1G7TA 1L7VC 2PCLA 3AP1A 3W6NA 2F3RA 1KK0A 1WQ1R 5H68A 1L4YA 2NPFA 1XDBA 1LS6A 2OAP1 2GZDA 1Z5ZA 2WWHA 1YR6A 4HB2A 5AUOB 3JZMA 4F92B 2JLXA 5KO2A 4ZKDA 3I92A 4F91B 2BCGY 4HB3A 4I1VA 3SR0A 1XTRA 4B2PA 4EPRA 4L9WA 4HEJA 4ASUA 1LV7A 1FP7A 1G5TA 1JR3E 5A0FA 1XEWY 1E0SA 1VIAA 3CUEF 2Z4SA 2ZM5A 2XTNA 2WJYA 3FPAA 1Y3AA 2R6CA 4FCTA 2DWOA 2AK3A 2JEOA 3HPRA 1ODFA 4G5GA 2FN4A 2ZPTX 3HDTA 2H7VA 3OAAD 2QMEA 4QBHA 1D5CA 3KB2A 1CIPA 1KO1A 5GJBA 1TUEA 1Z0DA 4R71A 2AWNA 5FBVB 2P67A 1GVNB 2GEVA 5B58C 4ZDWA 1XEFA 4MDFA 2GBLA 4OQFA 3UATA 1NVVQ 4IDPA 1OYYA 4BZPA 4CVNA 2RAPA 3KXKA 5JEEA 1NBMD 4ARZB 5KDDA 3U6KA 3AGPA 3CM0A 3R8CA 1XMVA 4JVMA 2GTPA 3QG5A 5CITA 3L8YA 2NMVA 3F0TA 4TQUS 1DELA 2NIPA 3M4YA 1G8YA 1KY3A 2WZQA 4Q5IA 2ODWA 4B32A 2GVDC 2HF9A 2IYTA 3AGQA 2GF0A 3SJCA 1H8HA 2FZ4A 2GCNA 4A2QA 4J0QA 4HB0A 1YR8A 5FOTA 4I1SA 1SVWA 2BHRA 4EFLA 4FWTA 1FQJA 1Z6GA 2WV9A 5CYPA 3QXXA 2D2EA 1GKUB 4OI0A 2RGDA 2BMFA 2Q6TA 5JSZA 1R10A 2GZAA 4JKYA 1ZAKA 1XCPA 5JWOA 1KK2A 4CW7A 2IS4A 1CJTC 3KJEA 4EKDA 1X1RA 3BOSA 1UKVY 2BVNA 3DVLA 3VMFA 2DWPA 1G9XA 1UADA 1M74A 3N2EA 1E9DA 1AK2A 1II0A 4P4UA 4LCBA 3UWKA 2WTUA 1ZVQA 2JLQA 2G3YA 3PEWA 4LY6A 3IGFA 3LLUA 4QJ4A 3QKRA 4QGAA 1RFLA 1VHTA 4BFWA 1NLZA 2GILA 3ICEA 1XD9A 2ZE7A 2B21A 1V43A 5EE0A 4W5HA 2CL7X 1G6HA 3Q72A 2F1JA 1E1QA 2V6IA 3NHAA 4KODA 5K8IA 3PUWA 3KZ1E 2V4ZA 2Z6VA 2HXYA 4D81A 121PA 4JL5A 3AF0A 4DCUA 5JCZA 3GFOA 3TKLA 1C1YA 1U0HC 2FDCA 2N1BA 2BBSA 2HV8A 2VSXA 2XNSA 3U3RA 2OSBA 3HR7A 3R9XA 2YWEA 4XTRA 1G19A 1EFCA 2QAGC 3C5CA 4A8JC 1TUIA 3AF2A 4MH0R 4CEJA 1ZU5A 1PLJA 4CRWB 2YKGA 4DCVA 5FPYA 5FPKA 3RLFA 2V1UA 1YR7A 2WMOB 2GETA 4PXAA 2MMCA 2NOAA 2QNRA 4Y0VA 1R8QA 2KBFA 2OE2A 4CEIB 2QL6A 1OXTA 2QG6A 1DG3A 3PUZA 4C4PA 4NKRA 3UMRA 4M2LA 1VPLA 4N3NA 2GXAA 2D7DA 4R2IA 4AG5A 3RS3A 3PQCA 1FX0A 1XD2B 1JBKA 3U7FB 2O8DB 1TAGA 2AD5A 1TQDA 2ZR7A 4M1MA 3BERA 1ANKA 2ZJAA 1DADA 1YKSA 2PX3A 5B2ZA 2G1JA 1Z06A 1M8PA 2W2XA 1IXZA 2WKRA 2OEPA 1MRSA 3L2OB 4OKSA 3O8CA 4OHZA 1N5IA 4B3GA 4G5QA 3UG7A 1GRNA 1EX6A 2IYWA 2ZU6A 3RSLA 1KZGB 4AIIA 1TEVA 4D6PA 3D3QA 3QIAA 1GDDA 1AS2A 4PHTA 3GJ4A 3K9LA 1HY3A 4NPHA 1BYUA 2WAYA 3ADKA 1ONBA 1OV4A 2D7CA 2XX3A 4DLUA 4M4SA 5FUVA 1U2RA 1YRAA 1DE0A 2CJWA 4OJQA 1F2UA 3KL4A 2IEYA 4RZUA 5BYJA 3Q5EA 4PQFA 3KJHA 1ZMXA 4YC7A 4TL7A 4URVR 4TZ0A 4HDQB 1NG1A 1T4GA 3I73A 4Q4HA 1XMIA 4A9AA 3EZ2A 3B2EA 1AQYA 3DKVA 3NBZC 4ZIRB 2OCPA 4TMKA 4Q1EA 3S1AA 2CK3D 1BKDR 4PZLA 4AD8A 4LV6A 4LUCA 4KXFB 3K53A 1KMHB 3L82B 3LH5A 1ZM4A 4HB4A 3K0CC 3G5UA 3LVQE 1Y63A 3EC1A 3WMEA 1QHHA 4LJ6A 4MUBA 5KHOC 3UMFA 1ZJ6A 3ZYCA 2VA8A 1NSTA 2F43A 3NG1A 1X86B 1M7GA 1SVSA 3TUJC 2NG1A 2IYYA 2YV5A 2WAXA 4EPXA 1FNMA 2GXSA 2IYRA 1W5SA 3BD9A 4Q7MB 3AF4A 4FMDF
chains in the Genus database with same CATH superfamily
4B34A 5EE9A 3IVCA 4N0QA 4M9RA 4PSKA 2VYFA 1ZR2A 1CUJA 3DTNA 4IDCA 3TQSA 4O2BB 1RQPA 4W4TA 3PGMA 1XZQA 2W2QA 4R0MA 2X8WA 1U0GA 2G5PA 1LK5A 1T43A 2JJQA 1QRAA 1DG9A 3UGQA 4GD3Q 1BC5A 3DW1X 2ZPAA 3QK7A 1GAEO 1N6RA 4LJ9A 5HIJA 3ZCPA 4H1UA 2MSEB 1QUEA 3MFQA 4V0OA 5BR7A 3K32A 4MWDA 3IBYA 5LJLA 2L19A 3RVRA 4IAOA 4O4LF 4X3CA 1TQHA 1A9XA 1ECLA 1EWVA 4EG4A 3IELA 4MR8A 1SD2A 4K88A 5ALGA 1U3UA 1ZXBA 4PSUA 1G1AA 2C82A 4Q6WA 1GKIA 5D3QA 4KKVA 3TYXA 3ZHYA 4D02A 1KDOA 1C3XA 1LDGA 1LS1A 1SHZA 2GDJA 1U4NA 3JU3A 3LBIA 2J6CA 4XI9A 3W8DA 2HN9A 5KMGA 1CE8B 1ZRHA 3LXRA 5D51S 3H5NA 4ME6A 3DFZA 4Y2XA 1AMNA 2PRIA 1Y3HA 1V4VA 2TMGA 3L05A 4GKBA 3HYNA 4TKUB 1CRQA 1MZVA 4C0AC 1C30B 2M6SA 2OCYC 3ZXXA 2HPVA 1BW9A 2QX9A 4CLDA 1DPFA 4LF4B 2D0PB 5LD2B 3FJOA 2QX7A 3FTDA 5B1SA 3B78A 3KV3O 1V2HE 4BQPA 1FNSA 5CBPA 4P80A 1E9AA 1UWVA 1VKRA 4QGHA 2X77A 3E2IA 5KI6A 3W8RA 3EPJA 2XD9A 2NU6B 3N3AC 3AF3A 1FDVA 3GXOA 3RODA 2PUHA 1PX2A 1DXYA 2PVCA 4LHXA 4O5AA 4TVOA 4EMUA 9MHTA 4P5DA 1W6RA 3TD9A 3EXG1 4G84A 2K7FA 2MWMA 4S1PA 3WRXA 4IWXA 3RDPA 3AVYA 4YAGA 2ZB7A 1WIWA 2A5DA 1BXGA 1NV9A 1ZHHA 3LSYA 3TLYA 1R50A 3OWHA 1YAJA 3AY7A 1EGAA 4HGZA 4WCDA 3WGJA 5LNK6 4X71A 2QNBA 3FI9A 1T1SA 4F12A 4RYDA 4NP6A 3E9ZA 4LXQA 5GTDA 3ELWA 5KTNA 4BMZA 4CHTA 1H0RA 4ER0A 3A6LA 2YVUA 1U2SA 1JRLA 2B0CA 1C0IA 3VDQA 4EJSA 3OTWA 4TT3A 3FYUB 5AJHA 4YP7A 4F2PA 1TQ4A 2HK8A 3RC2A 4CM3A 2I7XA 3FZQA 4IIEA 1IZYA 1JXMA 3GR6A 3LWBA 3RJ5A 1NY5A 2JHFA 1JEDA 2Z58A 2REXB 3KRTA 4G56A 1V8OA 4GC5A 4ZHQB 1IBLB 2BTOA 3GJXC 1GADO 1SN7A 4I50A 4PGMA 5KOHA 1Z56C 2YJZA 1W5AA 2AC7A 3BRCA 4Z3OA 2F59A 2WSYB 5L4NA 1TT7A 3JV7A 3A6PC 1H8EA 2R1TB 5JAZA 1KKUA 4KDFA 3FPEA 2Q4DA 1IRXA 2FSVC 3GLQA 3M6XA 4XASA 1MXHA 2R44A 1T4BA 1MDFA 5AKKA 1T9GR 1U0EA 4KJXA 2ZRFA 2EHDA 3U5ZB 2FHSA 2ZREA 4ZU1X 1YI0A 3LT5A 4KN6A 1EUCB 4JZKA 1O6BA 2E4VA 1MO2A 4H4EA 3VSBA 3DLHA 2BP7A 1YR1A 3NT2A 1PJBA 2R96A 3ZH9B 2JFHA 4PW0A 3QMVA 3QW4B 5D6NA 2COEA 2G82A 3HB5X 4ZCPA 5CFNA 1ODLA 3VHQA 1SUWA 1AKWA 1N7HA 3WWZA 1K0UA 1MHPA 1UWCA 2R6AA 3SX4A 5JHGB 1KSFX 1PNTA 3DOOA 4DLNA 1H2XA 3L6BA 2AGVA 5IWCA 3NI2A 4HRXA 1RBQA 3ECSA 4FMCB 4M60A 4HWKA 1WMEA 4U39A 1VJTA 4RIEA 3ZWDA 1E69A 2FR0A 3WBFA 1PR3A 5T64A 2CYCA 3GJSA 1J70A 3ZGNA 4I3FA 2H2FA 4LYYA 3B85A 2CL5A 4R1MA 3AIKA 1PJAA 1XPUA 4OAPA 4R2XA 5D6OA 5K6RA 4JNKA 1S2DA 3I6MA 3D54D 3DE0X 4R40A 4WOKA 3MB8A 3T9BA 2I4NA 5E1MA 3TRIA 1OXKB 1PLKA 3TZEA 2X2OA 1GAWA 3LUHA 3M0EA 4DR2B 1J0BA 3LQ1A 1E9BA 2XQKA 2H16A 4RJLA 4LDPA 3UB3A 3UEOA 3U5TA 3QEAZ 3CEMA 5K0JA 2HQ1A 1D3AA 3ZBUA 2DHQA 4C1NA 1VL0A 4XX0B 2EG9A 5D1HA 2ZUFA 4OLHA 1MV8A 1RZRD 4DXHA 1YF3A 3ZHSA 1QTNA 4MIKA 1VM6A 5BN1A 2ZZNA 2FLWA 2QRUA 4HDOB 2QG4A 3QY0A 1G8PA 4O0LA 4WECA 4MS4A 5CVTA 3IR5A 3KHSA 3FPBA 3GGGA 1YFJA 3CWZA 2WYVA 1Y98A 2G1KA 1FL9A 1G18A 4TLAA 4FYVA 4DC0A 1D1TA 4ALJA 3FGZA 4TYWA 4BNFA 2QTCA 4R01A 2W70A 3ET5A 3EG9B 4MMXB 2Z43A 4MUNA 1UAAA 2DBVO 3FFTA 1U2PA 3PBKA 5NLLA 1SB8A 2JIMA 3INTA 3AH8A 4D4HA 2QGZA 3GCDA 3IQWA 2XYGA 2EJTA 1TU4A 4LHVA 3WJ1A 5EP3A 3R5SA 4PLPA 1S2IA 2B5WA 2R1VB 3FKSD 4NFYA 5FULA 3HDQA 2RGUA 3C3BA 2OBNA 2Q9AA 2ID9A 3GMIA 2C9BA 3GUZA 3HB1A 2BONA 1F4VA 3CH4B 4JOQA 4DLAA 1U8FO 2LKDA 2VF4X 4BUZA 1FVXA 1GGFA 1U2DC 3ADOA 1C8LA 3KR1A 3WK6A 3UK0A 5ITWA 4KR7A 2PBRA 3GLKA 4PV7A 3OE5A 4N01A 1KPHA 2QD5A 1CUVA 1E32A 4EBBA 1C4KA 2WILA 4GVXA 1P1HA 1TM2A 1YB4A 2WF9A 3HA5A 4QUHA 3AG5A 1YJQA 1UT6A 3ZV5A 3WAGA 3GLIB 3E48A 1IL0A 1K88A 3UJBA 3W0LB 2FN7A 2WM3A 4M0FA 4OKIA 3PXBA 4YREA 4JI7B 1B23P 1H2ZA 1VJGA 1DC6A 1FNDA 2RG7A 1L7MA 2IUFA 2XGJA 1K5PA 1VMAA 2OB2A 2WYOA 1BE8A 4BJ6A 1E3QA 1U5BA 1H4VB 2WUVA 3O03A 4Q6BA 3GFSA 4H7FA 4U2KA 2G4VA 4U2BA 1Z0FA 4LVUA 4NJEB 1EA5A 1DC8A 1L4GA 1SK9A 2Q0HA 1PYOA 2XXJA 1OX4B 2ZTMA 3OM9A 3QOWA 4KAJA 2QIOA 1H1LB 1P8AA 2YHIB 3FFXA 2CGEA 4IFBA 2A9FA 4UNQA 2IYPA 2PEYA 2GR9A 2VEDA 1ENOA 3TR0A 4N03A 1ESCA 2BW0A 1RWXA 4K5QA 4ND5A 3WQHA 2A92A 1O0CA 4C6TA 1WKVA 3AFOA 5A0TA 1QH1B 2YV2A 2HTFA 2JGAA 1C7FA 3TW8A 3I2JA 1JZSA 1KU6A 1X77A 2EW8A 2V8BA 4IZOA 4IIHA 3EXEA 4QICA 5AK5A 2CEAA 3OLXA 1NF8A 1CQXA 3DOCA 3RRYA 1H2WA 2M9MA 3OTGA 3WIVA 2TS1A 4CM9D 1O95A 1X80A 1JR6A 4HLUA 1U2EA 1W25A 1KVTA 3EQZA 3UUEA 4BFXA 5IWAB 3T5PA 1LTHR 3R40A 1WSAA 1N5JA 3FVRA 3P9KA 5LDHA 1TK2A 5BW5A 1JQ5A 3CUTA 2Q9CA 2RKOA 1SD1A 4YO7A 3RKRA 2AHRA 4GAEA 1WMSA 2Y1CA 4L3WA 4N47A 2FSGA 4PYOA 3UWOA 3VZBA 2XB8A 4JGIA 2IP4A 2C84A 2JAQA 1QPBA 4XIJA 4MV0A 2REQB 5K20A 1UH5A 4OXKA 3V4FA 4P6VF 4H27A 1EVEA 2P1ZA 1ACJA 1B8VA 3M82A 1IUPA 1PZXA 3NS7A 4PICA 4ZRNA 5FXMA 4FILA 4QVIA 2O1WA 4NATA 3OCUA 2FZEA 1WQ4A 3AJ9A 3KHUA 3PQ3A 1W88B 2CNKA 3L7IA 1GU7A 2GK6A 2YICA 3HKCA 4KBGA 2GPWA 3C1TA 2LVBA 5ANRB 1V5IA 4IZIA 2FMXA 5CA0F 2WQ6A 4JA0A 1GT91 2YCBA 4NESA 2CDBA 1GXSB 4J4HA 1RXVA 3H5TA 3U9SA 2O8FB 2BFBA 3C3MA 4R2MA 3KEOA 4J6FA 2A9PA 1NBEA 1C9KA 3WADA 1HSZA 1VHWA 3OPYB 5C80A 1IG3A 4FZ3A 4EEKA 2FQXA 3KEMA 3KQKA 4XXHA 3B51X 4KQJA 2R1ZA 1V8PA 2YZ2A 1JKJA 2ZI7A 1P17A 4PC1A 1U6IA 3HY6A 3ABRB 3KV1A 8GPBA 1OT3A 5JNUA 4ZA2A 3CY6A 3R0XA 2JIRA 3QHQA 5DM2A 1U1FA 4JUCA 1DQNA 1KJJA 3K6JA 3UMSA 4TV9B 4N9WA 4B6RA 1TPZA 5GOTA 1IJBA 1NVTA 3K20A 4EHHA 2X3UA 1JDZA 1NJ8A 1OI2A 2H2AA 2HHLA 4J16A 4M0CA 3ZU2A 3PC8A 3QJYA 1HYEA 5EXTA 2QMQA 1SUBA 3LT1A 3MS7A 4HP8A 2IUTA 1CXZA 3UW1A 3OJ0A 2V0NA 1I3CA 4Q9LA 1XNGA 1HL3A 4RQUA 1A9OA 1PK8A 3BDIA 1EX1A 1QU3A 2G08A 4NCIA 2VUHB 3Q6IA 2JZCA 5A03A 1RTTA 4ZQHA 2BZ0A 2ZSHA 4MCJA 3DEZA 4UMDA 2NUAB 3CTMA 3M4ZA 1GHTA 1Q7RA 3DDOA 1F3OA 4KBYA 1K8ZB 3QBDA 2BKVA 2Z6AA 1TDJA 5L6LB 1N32B 3PC4A 5AVOA 1YCGA 4UFOA 1JDUA 2OFOA 3HZOA 4JLPA 3C3CA 4BBJA 5FX2A 1L8OA 3OIWA 4LXYA 1YD7A 3TI9A 1FRFS 3QV2A 3UHPA 1PNVA 1BH2A 1JHDA 4UHHA 1EGVB 2B1IA 2MR5A 3DAHA 4Q24A 4QHYA 4PCLA 1YRQA 2VNIA 3ZY5A 4C7BA 4QM7A 3ZDAA 1MEEA 1F20A 4FZVA 3RTAA 3W2IA 2OZPA 2GEBA 5BQ3A 1P5ZB 2PBLA 5BPFA 2WMNB 5BOVA 1YVUA 3PFNA 4QDTA 5TF0A 1QGUA 5J1SB 3UB2A 2IFTA 3M1IA 4UUAA 1P1KA 4EW2A 1X94A 1Y4DE 2VLIA 1YGPA 2IYXA 1Y8RA 3DLCA 3R74A 3U80A 5FBQB 4AY4A 4H0FA 1PEDA 2GJ8A 4HLCA 4E0BA 2D5CA 2LDBA 3EY9A 3PV0A 3UQZA 1G8FA 2ZTLA 1WPXA 1G8KA 4OM7A 3GLTA 4EA6A 4A0FA 1P4JA 1GNRA 4TS3A 1BE1A 1FFEA 2ENWA 3DDHA 3K9GA 2IYOA 4X00A 1RQRA 1QYVA 1CD5A 2HZBA 4HZUB 4BWVA 3FOEC 4BDSA 4UHFA 1P7VA 4FHGA 3U3JA 4AULA 3TRHA 1Z5WA 3U3OA 3MG9A 3GMSA 2CFIA 2N1MA 2PO5A 1K06A 4D5GA 3IRVA 3UQYS 3QI7A 1XTSA 5I7HA 3THXB 3I04M 1KNXA 4QBFA 4ZVUA 1FRNA 3B8EA 4Z2AA 4PX2A 4K9DA 1E3DA 3R7AA 1J09A 1XTZA 4EQ6B 2Y9PB 3M6AA 1DFHA 2QPTA 2W6NA 3T3EA 2ZBDA 1U99A 5JJ5A 1JDNA 1OZ0A 1G8SA 4XUDA 3RUIA 3T15A 1VB3A 2Q2WA 2IU0A 4N4AA 2OQVA 5EHIA 5CW1A 2DZDA 1GTZA 3HP4A 5JIBA 3RUHA 1XL1A 4MI1A 1V6AA 2KSQA 4MS1B 4WCFB 5F5NA 4B48A 4UQLA 2GZSA 4FSDA 4W7IA 3TIXB 4OI4A 1FTWA 1OFUA 2ZB4A 2GA9A 2QMOA 4BAZA 1CUZA 2ZJ1A 1BEZA 3X2EA 4P7JA 3DPIA 2A3NA 1FVHA 3BN3A 2CN1A 3HB0A 4GLOA 5K0LA 3WWEA 4ETNA 4QYMA 3FHLA 5A9TA 3OX2A 5L3RA 1JT9A 1FLDA 1HDXA 1XQWA 3ACCA 5DKFA 3DKKA 3R6DA 1SC4A 1GG2A 3IMFA 3DZHA 1T1JA 1R0XA 1IXSB 1E8DA 3FN4A 3HADA 2RHWA 4IDAA 4D8TA 2Q0QA 2O5EA 4CMHA 5FNVA 4GOOD 4IV8A 4XFDA 1F6BA 5FUYA 2YYAA 1ZD3A 2QLNA 4TZKA 3MEQA 1QCDA 1WP4A 1YBVA 2A88A 2R87A 2GAFA 5LDGA 3UIEA 3WIEA 4B33A 1J90A 4Y30A 5HVNA 2B35A 3U61B 1SUDA 2QUZA 3H2KA 1R16A 3L8DA 5AOAA 3UAXA 1GPH1 4BNDA 2CSXA 2G76A 3UKOA 1ZBDA 4LWQA 1E96A 1DIGA 3TD6A 3ILSA 2B6HA 3K0AB 3TXAA 3ZK9A 1T3LA 2BUBA 5JPCA 1WUKS 3L7JA 4DLBA 5FEUA 4I55B 3EF0A 4MVWA 4IMJB 3MWFA 5K3OA 4IUDS 3VR6A 1NE7A 2VPQA 1ZGAA 2NZYA 3KE9A 1M5RA 3IT2A 2WJJA 3EEYA 4XKJA 5EHNA 5A62A 1OA0A 3ND8A 2D6FA 5CD9A 3TBFA 1XELA 4GOMD 1ZUHA 4YAOA 1CY6A 2PD6A 2ZE5A 3QRWA 4LE2A 1UPBA 4XW2A 4DSTA 4HVCA 2AEMA 3QPBA 5ITVA 4KQGA 2VLBA 3Q6MA 3QHPA 3UYKA 5T6MA 1NMSA 3I09A 4Z8XA 4YRNA 1GQRA 3CB2A 3FMPB 1O4WA 2VXYA 1GZVA 3MWEB 1N5LA 1NFRA 5DASA 1AKTA 4I6GA 2NO6A 2ZJ6A 3R7LA 2JI6A 5E6RB 1Y37A 5DULA 5TQ0B 2CB9A 3VOAA 4H1WA 1VL8A 4HAWA 1D2GA 1EWRA 1GLNA 1S2MA 1Y7HA 1LBQA 3A4YA 2KB0A 3R0VA 2YW9A 4YYEA 2W6QA 3D3WB 1QRUA 1ZNYA 3FCXA 1Z22A 4DEXA 4MCIA 4XWWA 2Q1WA 2QQ5A 3DZ8A 4DTIA 3KJZA 4TMWA 1UPAA 3V8QA 4YPOA 1U8AA 5JT1A 3UJ9A 1R4NB 4TUYA 1LLFA 2W2NA 2C3OA 4M9UA 4IQFA 1S0UA 3KAKA 2AUNA 2R65A 2CB0A 1KKLA 3WNVA 3RI3A 2FDRA 3PD0A 3B9BA 4Q1BA 5JQWA 2W6ZA 1Z37A 1NBAA 4RD1A 1PUIA 1FXWF 5EIBC 4HH0A 5L3SA 4PR3A 3VMMA 3I3OA 5IRCD 1M1YB 5F3RA 4YONB 5CYOA 4P3KA 2K2WA 2W2VA 1GQ2A 3QY9A 4BEVA 4C2AA 3NWJA 4FKBA 4GW3A 3OTIA 5IMSA 2P8SA 1QF7A 5DXFA 3DDNA 4W7SA 2OA0A 2IC5A 4QQ8A 3IHWA 4V02A 2IITA 2VDNB 4RWZA 4A92A 4ALMA 2EX0A 5AHOA 1L5MA 4F9FA 1QFZA 1SG6A 3CHYA 3M34A 4MB6A 4DQ0A 1JTVA 1OIVA 3W6OA 5IXYA 1NL3A 4PPNA 3W7AA 1XFAA 1ORTA 2D3WA 1PQ4A 4HHEA 2BCJQ 3AW8A 1U2GC 3O9MA 5C1OA 2A5YB 4D9HA 2P77A 1GRCA 1NYTA 4TLMB 1DOAA 2F8MA 4ZI7A 5LZ2A 1KMMA 4DR6B 3LT0A 2X23A 2UZ3A 1Z4QA 4QUAA 4CGZA 3H8VA 1GPLA 3EZGA 4GI1A 1E2JA 3MT7A 4LW8A 5L9AA 2XNCA 3P0RA 1NVUQ 3SKYA 3V1KA 1HQDA 1S02A 3C43A 1SXHA 3RVSA 4RFSB 3W06A 1SU4A 2WHYA 3KOOA 2Z3WA 4FGKA 4DLXA 221PA 2Q3MA 5KQGA 1WLYA 1H1DA 3CLHA 3LJKA 1H0SA 1QYIA 4J76A 4UE6A 1NRJB 1C1DA 1YC5A 4JLVA 2VF7A 4KVAA 1G8GA 5L7WA 1TIBA 2F6RA 4LYAA 4RZQA 3CV3A 5H3LA 1OU4A 2H59A 4JL6A 3RTCA 1SO8A 4ND8B 3N7AA 1T2DA 1EE1A 2P9QA 5BV7A 3NT5A 3WIBA 3R5FA 4IDQA 4RZHA 5FWXB 5CK4A 4HYTA 4RA9B 1NW4A 3N2KA 4LHWA 4MEBA 5A9SA 2AEEA 1XU4A 1QVAA 1VLMA 3EXIA 4ON9A 1YZVA 3MMPA 1MFZA 3RT7A 3EZ9A 4ISCA 5C1DA 3E7PA 1GGHA 2J30A 3PFGA 2XCSB 4E4RA 3S7TA 4DCPA 4I9GA 3ELYA 3LKDA 1XVIA 5EEGA 2QYSA 4IGKA 4EA9A 2C97A 3G0IA 5AW3A 1JHYA 3PXEA 1Z18A 3N2IA 1Z7EA 1KBZA 1W0JA 2WRZA 1NSYA 2GKGA 4X44A 3FTEA 3MBIA 3W7VA 3TOXA 1WQ3A 1RAHA 3VRHA 4EW6A 4IIGA 5AJYA 1PFWA 4RD3A 3VPBA 3GGCA 1I6MA 4EVSA 3C5EA 2PT6A 5ELXA 1PL0A 2XTAA 4V0QA 1TVCA 3LUDA 1GAJA 3F7NA 1DJNA 2E89A 4YV7A 4V1CA 1NN5A 1E9SA 2XLBA 3LGAA 3QLTA 4BVGA 5J4KA 5L6MB 1UJ5A 5J2UA 5CR9A 3BICA 4P0PB 5TQ2A 3KSRA 2O7VA 2QQ0A 1RJ9A 2RBGA 2QTGA 4IGFA 4Q1VA 3Q9NA 4DQKA 3FGNA 2PT7A 3K8ZA 3BRQA 1U8TA 4UTZA 2P9HA 4YDHB 5I7WA 2PWZA 2Z5LA 4HG2A 2BR5A 3HCEA 4DV4B 4CIBA 2WHPA 3JAWB 3L6RA 4WZBB 1FYXA 1NWCA 2BFDB 1USKA 3HNPA 3I9V6 2OCAA 2QMHA 4NTZA 3U7QB 1YVPA 3G02A 1G21B 1FLAA 4N5LA 2ASVA 2IRWA 2I7TA 3RAGA 4CQLA 4F5ZA 2X8JA 2G09A 1E0DA 1KY2A 4X84A 1BWQA 3RJTA 1CW2B 3IAUA 1FSSA 4OJTA 3P9ZA 4YP9A 3HA3A 3OO1A 2IZOA 2QRVA 3DNPA 2GJAA 1EKXA 3ITNA 2WWFA 2FWAA 2NAPA 3ETNA 4ALIA 3HKBB 2C8LA 2VJMB 5K8UA 3C3AA 1E1KA 3V4OA 4Z5XA 3ICQB 4RVNA 1XMPA 3GEMA 4ASUD 1WDWB 1I3OA 3T5AA 4IP0A 3FAKA 5CYFA 5FI5A 3AJEA 5KCMA 3Q3JB 4PSCA 4PLWA 2BFEB 1CIJA 3TX6A 4ZK6A 4TM8A 1FVOA 4JITA 3TSCA 3MJSA 2JIZA 3U4DA 1T1GA 4QSMA 4GZLA 4PC7A 5TS3A 4AO7A 2HMYB 3HYSA 1QC5B 4XEUA 4RK6A 1I2ZA 2YFQA 4OUKX 4PO1A 4YJ2A 1MB3A 1O77A 5KYWB 3AR5A 421PA 2YIVX 1IHPA 1ZUNB 2A3RA 3HR8A 4FUQA 4P4GA 2POQX 3EUEA 2X2PA 2JLUA 1HLPA 3R3HA 4P84A 4C0KA 1DKOA 1I3LA 3QG1A 3C8MA 4S04A 4UPVA 1OROA 3IQDB 3L0PA 2XQIA 3K8QA 1NKTA 4AN4A 2QWXA 5E9WA 1KA9H 1XZJA 2PZJA 2I4IA 3EPHA 1T9AA 1AH2A 2CNLA 3N74A 3PEUA 2PL1A 4JI0B 4PYQA 3C39A 4Z7NB 3O8NA 2FSVA 4M8NE 1E4VA 4HQOA 2J5KA 1E6EA 3E3AA 4LTDA 4P1ZA 1CTQA 4Z54A 2NZJA 3ZWBA 4EUFA 1L3IA 4QOGA 1Y5LA 3PE3A 1FS4A 3LZCA 1SZDA 1XA3A 2DFVA 3D6UA 3VO9A 3PEVA 3OX1A 2C9CA 4BO6A 2NYUA 4FJ2A 5FWDA 4C01A 4ECAA 3T12A 3CU5A 5GINE 4WN9A 4BC1A 2HTEA 4ZOCA 5JH7F 1D2MA 1L4FA 3RYHA 3FJ1A 4L15A 1XMJA 2VK8A 4ZYZA 3EDCA 4LQDA 4IVPA 3B5JA 1G8JA 1UXHA 2JG3A 1KP2A 4CQNA 2FX3A 1KH2A 3ZU5A 2JLVA 1RVV1 2WNSA 3N70A 1QGZA 3CH5A 3V7YA 1OJLA 1VG1A 5BN4A 3ZQKA 1ZW6A 3RUPA 3N2YA 3PFHA 2DX7A 1RBMA 3V7FA 5FBHA 3QQ5A 1Z6AA 2YVQA 4YT4A 1VCMA 3WGLA 1HA3A 1W4BA 4JP3A 2OHIA 3PYLA 2NTVA 4NMLA 5TSDA 2EFGA 3BDVA 1X6VA 3BE4A 4A6EA 2DB3A 3FFBA 5AOCA 1JXAA 3PUHA 5HG0A 1E4YA 4Q16A 2ZATA 4CM8B 3N2ZB 4MQFA 3EFHA 3RYFA 2MDTA 3AI2A 2Y2VA 1FYWA 1OHHA 2GOYA 2XJ4A 4ZAYA 1USUA 3W2EA 3HDVA 3PGXA 5KYKA 3H17A 4Q18A 3RHZA 3VX4A 3EFEA 4LQCA 3V9AA 1VKZA 3LCUA 4J1TC 4KHZA 2CMHA 4G9GA 3RS9A 4YAKA 5LA6A 5AXCA 1E1QD 3S2SA 3G2MA 4G0MA 6NULA 3OIVA 2HCTA 3VTKA 4UM9B 2ZE8A 3D43A 4D26A 1CP3A 1A7UA 1NF2A 4MVCA 3VYUB 3CPSA 2PR2A 4WFJA 4YUAA 4HEHA 4NY1A 2HAEA 4D92A 2I9KA 3SHOA 4CDRA 1FDUA 5GWXA 3AKCA 5ED4A 2P2NA 4I1YA 1VMDA 2YN2A 3EZFA 2XT0A 2ZBQA 3O8QB 3R7SA 3KOYA 5EWLB 3GELA 3P9PA 2ZULA 2HWXA 4LHYA 5E6SB 1P1IA 4JLAA 4GMHA 4WKCA 1J99A 1V8ZA 1BA2A 2P0EA 5ERYA 1ZJZA 3AVPA 1M66A 1YQDA 4QRDA 3RK0A 1Z3CA 2MSKA 5F23A 5KNDH 5KYNA 5ECYA 3V1MA 2XAAA 4C6RA 4MW9A 4E51A 5JO9A 2XLCA 4L3VA 3D1LA 1HEIA 4AS3A 4RTPA 3CRQA 5BV8A 6ABPA 2PU5A 4OQEA 1CUGA 3TZQA 4MGZR 3NAZA 3SWWA 3JYQA 1P0CA 4MIEA 2Y66A 2KI5A 4Z2YA 5J58A 3V34A 2FMUA 3TBKA 1U2DA 1XTTA 3A9VA 2OENG 2AOTA 5I4KA 5ALUA 3PA8A 3PTLA 3ER6A 1YNSA 1JQLB 3RS4A 5I7AA 4P4NA 1VLQA 1BSVA 2H4ZA 3FYTA 3GYGA 2QYHA 3WYCA 3FMOB 4DNPA 4O4JA 1ZHOA 5E9JA 3CUYA 4MO9A 5BURA 4GP7A 4POAA 2XBMA 1JALA 4WLUA 1ZOIA 1XN4A 1PI3A 2W43A 5CHYA 2PGOA 4ISBA 1XJQA 4BWFB 1I24A 2FGJA 5BSGA 3KC2A 4QTZA 5DK6A 5G1PA 4E07A 3B7PA 4O4LB 1G8MA 3D8UA 1KPIA 1F1JA 3CURA 3P2IA 3HN2A 3NDPA 2XHEA 3T7EA 3U31A 5C8DA 5ICCA 5IXSA 2XCQA 3MIIA 4G1UC 4ZCRA 1MX9A 1C3OA 1L4MA 3E4CA 2HDNB 3AQIA 3OQIB 3TLKA 5EIFA 5JEDA 1YQXA 3KVVA 2UUBB 1TF2A 4LMBA 4KWTA 5EMMA 1E9CA 3R3JA 1V45E 1T2FA 1L1QA 1L4KA 4M1WA 2J9FB 3JRXA 1N0VC 2VZ9A 3WDLA 4JP8A 1GTRA 3H2SA 3ONFA 1NUSA 4FOLA 4U3JB 4QSHA 1YUNA 3AEKB 4F96A 4E08A 1E0AA 1Y1TA 2ON6A 3S2GA 1L6RA 4C0XA 3RC3A 2EX4A 1X13A 4IS2A 4MI3A 2GN2A 4QRIA 2WAAA 3CVJA 1H6DA 4KNWA 4OHBA 2XKJE 5DYIA 3CLUC 1ULUA 4ZTZB 4L6AA 4KQIA 1PT9A 4CODB 2ENUA 2PSEA 3I34X 3Q7PA 3ZJ5A 1SUCA 3H1FA 4CT4B 4JYZA 1AM4D 3AUJB 2C88A 3HUEA 3NEAA 1DTSA 3HFGA 3AUKA 3OE7A 4GM0A 5H80A 2OTCA 5KVQA 4B7XA 2H07A 1EEXB 3MILA 4U2EA 3NXSA 4DB2A 4I3HA 1NN0A 2OZKA 3SIRA 4DQDA 4JMPA 3KAJA 4NHEA 3L8MA 4RAQA 4ROTA 3TLGA 1H2FA 4CWAA 1IK4A 1OC2A 3PUKA 5KC9A 3VSDA 2Q2OA 2VP0A 1F0KA 2P0YA 2C2KA 5LQJA 3CLKA 1JIJA 1L7OA 1OY1A 3L41A 3L77A 3IA7A 1NUPA 4FMPA 3GEEA 1ZA1A 5KOYA 1A4RA 3KUUA 5CIYA 4Z53A 3NQ41 5IABA 4OUDB 4QTTB 5I8WA 3JARB 3CZ4A 4ID3A 5LBIA 2ZJFA 1ZIYA 3U44B 2CE2X 4OHOA 1OYVA 1BMFD 3RC9A 4EAAA 2WWYA 2DR2A 1KMCA 4MP8A 1WOMA 4DDUA 4EBFA 2C2GA 4D6XA 2GAIA 2CBGA 3RS5A 1FP4A 4BMSA 5JANA 3VR0A 1GFWA 1F2VA 3TW0A 2WB4A 3EGXA 5ELLA 3BTUA 2HQOA 3MW8A 5IUJC 2XE6A 5C8YA 2XHZA 5C7OO 5GVRA 5GGXA 1RC0A 3AVTA 1CUFA 4F3TA 4YRDA 5DN6D 2WW8A 3CX3A 3H4TA 3OE1A 4S35A 3IEUA 1V16A 3PEYA 1DTEA 2QAGB 2GHIA 3NONA 1FDIA 3CZPA 3OAAA 2L17A 4IKOA 2M6LA 4I4TF 3RNLA 2AMFA 1V48A 4V0RA 2EL7A 3ZGXA 2JGDA 1DAMA 3A6EA 3T52A 4NPAA 4OLJA 4C4RA 1EK2A 3TIFA 4OM8A 3JQ7B 1SCBA 3IBCA 3HV0A 2AFHE 3JAKA 1E0KA 1YHYA 2P41A 1L4UA 1XXHE 2YN0A 2ZS8A 5JAHA 4WLOA 5F35A 3LUBA 5EINA 2J46A 4L4RA 4TTJA 3IMEA 1FDWA 1UDWA 2X14A 1RTKA 5EXPA 3W4JA 1TMYA 3Q0TA 4MPJA 4A2PA 4EVIA 4R8KA 4TZ6A 3BS4A 2V7XA 5DM1A 4GO1A 4YP6A 4MPPA 5ULLA 5C7IO 4KQWA 3TCKA 3QEBZ 5KTKA 2A14A 3FNFA 2WJPA 4KUEA 3OKAA 1I7PA 1JQBA 2KW5A 1CJUC 1AIPA 2B94A 3LSTA 3PPVA 4U2GA 1RM0A 1A27A 3OKPA 5CPBA 5JS2A 4EUEA 1FDOA 2FZVA 3RIXA 3BQMB 2YWGA 1E63A 4IHJA 3NPMA 1LB1B 4IJVA 1QTQA 3KXIA 1TJYA 4QXMA 3DHYA 4BE7B 1H4TA 1B43A 3PHJA 4G07A 4E4TA 2X13A 4G0WA 5AHKA 1N2CB 2ZEJA 3P26A 4EG6A 1HPLA 4FEGA 4F3NA 4RXMA 2CXXA 1NNLA 1IBCA 1F0NA 1SBYA 2QTVA 2SKEA 1QFYA 3OLCX 2P68A 3ZZNA 2HBQA 1AK1A 3ZVMA 2VBCA 3RABA 3EVAA 4Z3DA 1NIPA 3H3FA 3A37A 5HWSA 1NBME 3LXXA 3H9BA 3GLHE 1QXSA 2DLNA 5KAMA 5AKZA 3CRVA 1GZHB 4QC2A 1OYWA 2R7AA 1R0WA 5IP5A 3PJGA 4PBSA 2H5JA 4PEVA 1YMUA 5T4FA 4GBED 3HVUA 4KLCA 4JOCA 1PFGA 4H35A 1DRJA 1QO7A 3COSA 3K5WA 4FNGA 3SZMA 2A5FA 2QVGA 2X4GA 2J3JA 4LV5B 5TR9A 4BVAA 2O8BA 3G88A 4YT8A 3L1JA 4XCQA 1KYTA 4ND2A 5FUWA 1MU0A 4AT1A 3EXHB 2GCPA 1EVQA 4C2BA 4PO8A 1BVYF 2NT4A 3G1WA 3A9RA 2WIDA 5FA5A 2VJCA 1JLHA 4NZNA 2R68A 1MH1A 1YQGA 1ZM7A 2HFJA 3SICE 2O54A 2XR1A 4IMIB 2PX0A 3D2BA 1JIUA 1IY0A 1J00A 4Q21A 4DQUA 2OAEA 3G8DA 4IDEA 3K1AB 3FUCA 3ILYA 2GN0A 1GQSA 4V03A 4J07A 3WWCA 4JYAB 4Z8YA 3IKVA 1XTKA 1JHMA 7REQA 3LZ6A 4EYEA 2VP4A 1UWLA 4X8MA 4ZAGA 3K7EA 2NVUB 1Y42X 1BZYA 5JD6A 3JWHA 3N2GB 1RWMA 1UC9A 3FR8A 3Q7SA 4C43A 2ZYIA 1W59A 2ZM6B 2FR8C 5MF6A 4EY4A 5LPNA 5HE8A 4JQSA 1EU1A 1MW9X 3RHTA 1ZH2A 2VF2A 2O59A 2XUQA 2ZR9A 3A4MA 3PUXA 5LD2C 4KU4A 5FHRA 2AIRA 3HEBA 3RM3A 1YS2X 1SBIA 3DMFA 4UD2A 5BSKA 5C1IA 1YJCA 1F3LA 2FW1A 2AFIA 2OVFA 4RD0A 4UREA 5FWAA 5J2TA 4Q15A 1KOJA 2NV6A 2G5GX 3COVA 1WDKA 2AN3A 4GPZA 4BFUA 1LPBB 4FZRA 2YWBA 2D74A 2DSNA 2IXBA 2W2KA 3ECCA 5EKSA 1WUYA 3REFA 1IQUA 1N8SA 4A8PA 4OG2A 3WX0A 1P4HA 1VLJA 2VQ6A 1MTZA 4JAVC 5BVHA 1H3NA 2AG6A 1WZUA 1DWUA 1EFVA 2Q8QA 2C9MA 1ZOSA 1F8UA 3MGBA 2QVCA 3CLRD 4V2IA 2HYDA 1OLSB 3TH5A 5AT1A 2FN8A 4FIDA 4H1HA 1COWD 2OBBA 5IAOA 3CX8A 1BS9A 1Y8QB 4IGIA 4OJNA 5LNK1 2B7CA 3HCFA 5C4IA 5JYCA 2CMKA 2RI0A 4BNKA 1CHDA 2V6FA 3B1XA 3WLPA 2FLVA 2YRWA 3X2SA 4AO8A 4W9MC 5DISB 2B30A 1NZFA 3QQPA 4K6KA 2IYLD 2ONKA 2PRYA 4B47A 4EZIA 1Z39A 3V4LA 3OT5A 2HBYA 1NP6A 1U1DA 2VUUA 3QVTA 5P8WA 1KI6B 1VYTA 1TO1E 2HWWA 4L7QA 1X0VA 4G0NA 5KJ1A 4DR7B 1P3DA 2H5LA 2KJQA 2Z04A 2VCYA 5EGSA 4U00A 3GQBB 4EY7A 4D3SA 1ODKA 4XYBA 2QIPA 1NQAO 1LLDA 2CLIB 1KO5A 2G5TA 2V6GA 1COZA 1QIJA 4RHEA 4WOBA 3RJ9A 4E03A 5AVQA 4AY2A 4FFNA 3NFYA 4JYBA 1E64A 4V39A 1N7IA 3MLAA 4YHBA 3U3DA 4BVBA 3KQNA 3DL2A 4MS3A 1XZBA 2BIFA 2I03A 2NTNA 1CB7A 2X0DA 4B83A 5AM5A 3WGOA 4YV0A 1RWNA 4KREA 2IYNA 3BJMA 2GFIA 1BJRE 4JXXA 1W5TA 3RIMA 4X65B 4FDUA 2F8LA 2X22A 3C7KA 4EG1A 4JB8A 3GEHA 3SYRA 1YDFA 3NHFA 1BROA 1N2HA 2DFNA 3VR5D 4D9MA 2FQQA 5CFRA 1GU1A 5CJ2A 1ZC4A 3KCQA 4YUZA 4B3CA 1VMKA 4O2RA 4LX0A 2X8AA 3C41J 1Z88A 1KVRA 2HIAA 2EBFX 2OK8A 3MWLA 4DLPA 1FS5A 1IXKA 5JJCA 1N5KA 3L7OA 3ORFA 3A7DA 1W34A 3PGJA 1M6NA 1A4IA 3HACA 1Z8NA 2Z5GA 4N41A 2JEYA 3LDHA 3BBLA 1M34B 2OLEA 1GR1A 3ZTYA 2E4ZA 3TDMA 4RKFA 1U2GA 3VVBA 2J9XB 2DE0X 3LF2A 3DUWA 1ISMA 3LX8A 4JFRA 4JEIA 1VMIA 2ZROA 4DQXA 1VLZA 2QUHA 1TTPB 2VHYA 2R4TA 1A9SA 1EXMA 4UDYX 2NU8A 4C03A 3NHKA 1XQXA 4XDYA 2ZT7A 4ZYUA 5TPZD 3U4QB 1RWWA 3D7LA 2H48A 2O8CA 1W87A 1ZJYA 2WBLC 4LISA 3OEWA 5AVSA 2I2BA 4OQNA 3I9JA 5TE9A 4IQ8A