2K5UA

Solution structure of myirstoylated yeast arf1 protein, gdp-bound
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
180
structure length
180
Chain Sequence
GLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Membrane Interaction of Myristoylated ARF1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor 1
total genus 42
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2k5uA00
4C0JA 2CCKA 1YHNA 1Z47A 4DCVA 3K70B 1N6PA 4PZLA 1LNZA 2WOJA 3HR8A 3TE6A 1MABA 3K0CC 2OBMA 4TWZA 3T06B 3UWKA 4G5QA 3FB4A 2J87A 3QXSA 5J4KA 1P4SA 1R5NA 3H84A 2W6JA 1YRAA 2DFKB 4XJXA 3VTKA 2C8VA 1MT0A 4AIIA 4JT2A 5AWFC 2ZUCA 4IDHA 3QEJA 3P4XA 4HUQA 3QKTA 4BFYA 1NMYA 4IFEA 3T35A 2V8OA 3WRXC 1XCGB 4TT3D 3DVLA 3MAAC 1QZXA 4ACAA 4Q9JA 4ZCIA 3T1QA 1NSTA 1W0KA 4JSTA 1G7CA 4DLYA 4JL6A 3LBNA 5KDOA 2F55A 5HE9A 4H1UA 4UNPA 2ZR0A 4OI4A 1RYHA 4KHZA 1JI0A 5KUTA 1Z5ZA 4QGFA 2JGNA 4NMMA 4OJQA 3KTAB 4L9SA 2IYQA 3QXHA 2RGGA 1OXXK 2BJWA 1IHUA 4HSEA 1ZUHA 1HY3A 1S96A 2XOKD 1E0AA 2XZPA 1KYIA 2QORA 2F7SA 1AS0A 3OHMA 3WHLA 1KY3A 2QMUA 1YZKA 4FMBB 4B32A 3KKOA 3FTQA 1F6BA 5FOXA 4FWIB 4KYUA 4DIDA 2O52A 4LDJA 2JLRA 5KSOA 2O0JA 3FOZA 1E99A 4LSGA 3ZDQA 2OM2A 1GRRA 4KV9A 4DDTA 3J81k 1QRAA 5DO9A 1II0A 2G1KA 1U9IC 4C9BA 5EXXA 4DB4A 2ZJYA 2AWOA 1D6JA 4OI0A 3RC8A 1E9RA 4A0FA 1YR8A 5M04A 4S2EA 5KTYA 4JL5A 2BWJA 2QL6A 1HT2E 4LYJA 5GVSA 3THWA 3THYA 2GWHA 2AWNA 2NG1A 1VCMA 3D7MA 1OKKD 2WVJA 1NY5A 1YZQA 4ZDIA 1UF9A 3P4YA 1SKQA 4EPYA 4BZXA 2EWVA 1XEFA 3VFDA 4XD7A 3UIEA 1XF9A 1AQYA 4DEXA 4W7SA 3SJBA 5GJVC 3TR0A 1ZYUA 4YC7A 3B2EA 1QHYA 3EC1A 5LB4A 3SR0A 3A4MA 4ACBA 5F3WB 2IS1A 3QKRA 5FOUA 2GEUA 5F9FA 4OQXA 4IRUB 1Z83A 1QVRA 5CB6A 4TL8A 1YJ5A 3QY0A 3TQFA 3KFVA 4OHVA 1XBTA 3K9GA 4IVQA 3B1VA 3THWB 2IT1A 1GWNA 2VHCA 3LW7A 3VQTA 2FGJA 2C96A 5HTKA 2J3EA 4TSFD 2WHXA 1XP8A 4TMVA 1IBRA 2VLIA 3CBQA 3O8BA 1UKVY 4RZ3A 4US1R 1KI8A 4LHXA 1CKEA 5JJKA 3BH6A 2QM8A 3DZ8A 4MDEA 3CPHA 3VKHA 1W0JA 1OE0A 2WJGA 4Q1BA 4HYYA 5FOWA 1RRGA 4ZIRB 2FSHA 1W44A 5HR5A 1S3SA 2IF2A 5JJIA 4F4CA 1LW7A 4AK9A 3KQLA 1CTQA 1E2PA 3BS4A 2GA8A 3AQ4A 5CJPA 4OI1A 4CEIA 2XB2A 5G40A 4QJ3A 1NN1A 4JT4A 3CZQA 1NLZA 5TVKA 3MRSA 4LBYA 4QHTA 1XPUA 1DARA 4Q9HA 3FDIA 2GESA 4YXWA 2V7QD 2HEIA 5IHPA 4P4SA 3PV0A 1EGAA 1CJMA 2A5DA 1TUIA 1RE0A 3U7EB 2FEOA 2OCPA 4M21A 1FNNA 2CNWA 4JLOA 5FPKA 1VG1A 2B7CA 1E0JA 2IUSA 1FOEB 4JBWA 2OCAA 1II9A 1OFHA 2HLDA 5JWHA 1XX6A 1E1QA 5AUQA 4YMWA 5L3SB 3TUZC 2ZE7A 1YU9A 2FV8A 2ZI4A 5KSPA 1CR0A 3M4YA 4NKRA 2PEZA 2WKRA 1DAKA 3G82C 5EE0A 1G64A 3E2IA 2YZ2A 3I92A 4FMCB 3I61A 2V1XA 2ZRNA 2D7DA 4AURA 5B30A 1RW4A 3SNHA 3W9YA 2CHGA 1D9ZA 2NO9A 1KTVA 3T15A 3U2QA 1W2GA 4HDCA 4TTQA 2OAP1 2VH5R 3KUCA 3U7FB 1OB2A 1OIVA 2EFGA 3GLIA 5J4HA 3CPEA 2VA8A 3PQCA 5FPYA 3F3YA 5EQTA 2BMEA 3SS8A 4M8NE 2FX3A 3PCRB 3AKYA 4YXWD 1ZUNB 4QBIA 2B6HA 4MRPA 4Q7JB 1OFUX 2UVQA 2VSOA 3QE0A 4UXHA 2RGAA 1W36C 2W2XA 1OXTA 1Q12A 1Z6XA 4AYWA 2NZJA 2F1RA 5FBVB 2GRJA 4RFVA 1E0SA 1S1CA 3CB4A 3LAWA 1NN3A 4JLPA 1FQJA 3VU9B 2ONKA 3GLFA 1Z63A 3AF3A 4LV8B 2W6ID 1W2HA 4P32A 3BC1A 4QFMA 5BQ5A 2BCGY 3EA5A 3LX8A 3BXZA 1JQLB 1KK0A 1U99A 2GK7A 2ZYVX 3UK6A 1SVLA 3F5FA 4G5GA 5HPYB 1QF9A 2NOAA 3TUIC 4BZPA 1KKLA 1FFHA 4QOSA 5GVRA 3WHKA 4QM7A 1VG8A 2ZSFA 2A30A 1G5PA 2ZUBA 3KL4A 4KAXA 1FTNA 2FJUA 1JECA 1FX0A 2OE2A 1P3JA 1T8TA 3AKEA 4PAQA 5E7JA 4D4JA 4TZ6A 3OIWA 4JLJA 3FWYA 1TQ4A 1KO7A 3BIFA 3EASA 4RD4A 1CJVC 4Z8XA 2EWWA 2QRNA 1KJYA 1U8YA 2IYRA 4B2IA 2W00A 4XWKA 1GVNB 1UBCA 1VTKA 3M6AA 2IYYA 1E2HA 1GILA 2HLDD 3GEEA 2P6NA 1AKYA 3AF2A 4YDHB 1E2EA 5DHAA 3DPUA 3SZRA 1M74A 3KQNA 4LJAA 3KXIA 4V0KA 2ZI7A 2GVZC 1IAQA 3ADDA 5HZHA 3W6NA 1F2UB 1WDTA 2ASEA 2HT6A 1CR2A 3A4NA 4IDPA 4BFZA 1MV5A 3X1YA 4D80A 1OXVA 4JVSB 1Z08A 1Z6TA 2H16A 5A5GA 1T5LA 1J2JA 1FTSA 1FMJA 5E7MA 2FMXA 3I73A 2W0SA 4KI0A 2D2EA 1T8UA 1K8RA 4QGAA 2R6GA 2HXSA 1R6BX 3FHOA 2ZU0C 1TUEA 3WP1B 2CL0X 1G8YA 2ZTSA 4FMDB 2AL7A 4QG7A 1MRNA 3OIUA 1Z0FA 1Q3HA 2JDIA 4LJ4A 1Z6GA 4OQNA 1CLUA 4V02A 1IJEA 1P75A 4EPWA 5FUXA 2KWIA 4ARZA 3S1AB 2J45A 4G01B 4LK2A 3PEUA 1R8QA 2PCLA 1W4CA 3GJXC 2C03A 4O2LA 4PZYA 3U6KA 3AVQA 4C0BA 2VHUA 2J41A 1IXZA 1Q44A 3OE7A 4Q9LA 1JNYA 2IWHA 4AWXA 3A1SA 3RWMB 4BLTA 5CDFE 3TNFA 2DWQA 1IOZA 2IXGA 2JASA 3BFVA 3RSOA 2Q9AA 3MWLA 2E9SA 2QG6A 4GNKA 1KK1A 1KMHB 4EDHA 3EX7C 1DAGA 3TJZA 1ELOA 2QM7A 3G0HA 5LPNA 1KI9A 2Q21A 1NVVQ 3UANA 1EWRA 2JLWA 3NH6A 3TK1A 1AGRA 1W0KD 2G1JA 4RSGA 1NL3A 3MJHA 1N6HA 1RRPA 3IKJA 1NVVR 4BZQA 4F93B 2J7PD 2GXAA 4HZUB 1II8B 5UKDA 1AKEA 1FX0B 2PMDA 2YNMA 5G3ZA 2IXEA 2VP4A 3VU9A 4EPRA 3LRPA 1XPOA 2GXQA 1DAHA 1E98A 3VKGA 1P73A 1SVSA 3TSWA 1SHZA 1E2FA 1L4YA 2QUZA 4Q9IA 3EPJA 5JWOA 4WZ6A 1US8A 2JDID 4A6XA 4ZV4A 1ODFA 4I1UA 1P6XA 2HT1A 3IILA 3R7WA 2AX4A 4MITA 4FMDF 4RZXA 1XJ0A 1CF4A 5J47A 1I4LD 3OEEA 2BBSA 5IF9A 4KCGA 1NIPA 2A3RA 4M1OA 1BYIA 4DLSA 3K0EA 1IXSB 3LX5A 3KB2A 1Q57A 2WWFA 4I1OA 4IDOA 3TW4A 5K8TA 3OIYA 3AVYA 2ZUDA 1P62B 1CJTC 4LCBA 1DG1G 2ZU6A 4UQOA 4B73A 1KO8A 1S9DA 2DPXA 4KLZA 1LS1A 2Z5FA 1E6CA 5DN6D 5EXTA 3ZYCA 4HAYA 3TQCA 1HE8B 2ZM5A 3AVVA 3I5YA 1XFAA 2C98A 3U7GA 3TAHA 2HJVA 1G3RA 1S4QA 4ESHA 1G8FA 5AUPB 3MG9A 1N6KA 5SZHB 4UJ5A 4QHYA 1OIWA 1XZPA 4HZIA 1QBKC 1C4OA 3KQKA 1ANKA 1PLLA 2OLKA 1Q3TA 3U4QA 3VAAA 1JBKA 1I4TD 2NO7A 4DSUA 4DDWA 4EQ6A 2CMKA 5JJLA 4RJLA 4BFUA 5FOTA 2R6CA 2A9KA 2ANBA 3CRQA 3ONWA 4CRWB 3LA6A 1TPZA 4G0NA 3VR6A 2V1UA 1CBUA 1E94E 3TUJC 3QVUA 1VCOA 1E9EA 1E96A 2OSBA 3W6OA 2BOVA 1KZGB 1TL7C 3ZS8A 5K8UA 5GADl 3UG6A 4NYJQ 5C46F 2ZRFA 3T1OA 1Q1QA 3WYAA 1UADA 2KBEA 1R0YA 2OCYC 2Q3FA 3KXLA 5TY0A 1AM4D 1SULA 3RABA 2O8DB 5JRJA 4KSCA 1KNXA 3AV0B 4NYIQ 1F2TA 4DKXA 1E4YA 1CXZA 5DNYB 4W5HA 5BYKA 4QJ4A 2N46A 4Q47A 1P5ZB 3IO5A 5FTJA 4BQSA 1Q0UA 2YOFA 4JJKA 4MKFA 1G7RA 1Z0DA 1HA3A 5A0FA 2XNDD 3C7KA 3RAPR 4JVLA 2F1JA 5JS8A 2P67A 1U81A 1QHHB 1SXJE 1U0LA 2ZE5A 4Q1CA 1E2IA 5IDVA 2IF0A 3SOPA 1U9IA 2GEDA 5KNBA 3HU2A 1JEEA 2E87A 1IY0A 1SGWA 1E1RA 1Q21A 2J9RA 4MQBA 2PMKA 3CIOA 3QF4A 3VX3A 3SBEA 3Q5EA 2BC9A 4GOKA 4Z1MD 5SZJA 2FFAA 1MABB 3A1TA 4EJSC 4GOJA 5GJWC 2XSZA 1OIXA 4RFSA 1YZNA 2AR7A 1VKJA 2X19A 1R5BA 1E2DA 3UXMA 1G41A 3PUZA 4L15A 1W7AA 2J0SA 4TLCA 3U4QB 1JPNA 3GFTA 3PIRA 4OK5A 3CW2A 1M7BA 2EFDB 4C0KA 1X1SA 4NTZA 4EUNA 3FVQA 1NRJB 1GKIA 4HLUC 4P31A 1A4RA 4P4UA 3DKVA 4MRSA 2O8BB 2IBMA 3BH0A 4MUBA 1TU4A 2FFHA 3AF4A 3GEIA 3LW8A 2CNWD 2ZR7A 2QP3A 1KK2A 3MD0A 4I1VA 5KNCA 1W4RA 2V7QA 4URYR 4YONB 2J7KA 5BYJA 2AKAB 3MGCA 3X1WA 3IEUA 1KSGA 1M7GA 3QKUA 5D3QA 4ZPXA 4B3BA 3QXJA 4ZDWA 4EFLA 2P5SA 1D8TA 4ZO4A 1S8FA 2IUUA 4A2WA 1OYWA 3AKCA 4URVR 2KSQA 2DFTA 2XITA 3X1DA 3SJZA 1UKZA 5IK2D 2F3RA 3R20A 4IW3B 2G0TA 2JIZD 1QG4A 2R2AA 3L82B 5FFMA 4ZI2A 3D31A 5J4YA 3R7WB 2NZ8A 4G5RA 4URUR 2IA5A 1GUAA 1GRQA 1W0JD 2D06A 3A58B 1JR3E 4MRVA 4EFMA 1G291 3P20A 3JVUA 4R2HA 1T4GA 5CLLA 5B2ZA 3RC3A 2AN9A 4M2LA 1HT1E 1N6RA 3ZZTA 2ZJZA 2FSIA 1WRBA 4HB2A 1G3IA 3NWJA 3UMFA 4CEIB 4QJ5A 3I32A 2NO6A 4KBFA 4X8OA 3R9XA 2O8CA 4S35A 4G5OA 3UMSA 1KIMA 1UEIA 4G5SA 5G41A 1RJ9A 3KFXA 2XSZD 3LV8A 4B44A 2D3WA 1T5IA 1VG9B 2RB4A 4L16A 1WXQA 4HB3A 2WIAA 2Z43A 1G6HA 1ZNXA 3GFOA 4TLAA 2CLSA 2JEOA 2XB4A 3M0EA 4KYIB 3Q8XB 2J1LA 3GQBA 4Q7MB 4P0TA 3AH8A 4V0MA 3RS2A 4NONA 4JL8A 4KU4A 4Q48A 2XAUA 1GITA 3KJHA 4FCVA 3B8HA 2YOHA 4GZMA 5L3RA 4ABYA 2QAGA 3A8TA 3BB4A 1Q1BA 2CLDX 3DDCA 5L3QA 2DFLA 2EVWX 3B6EA 3GJ8A 3Q85A 2ZQ5A 4BRUA 1E2QA 1N6NA 3EZ9A 4NHOA 2JJ2A 1IY2A 4D0GA 1SZPA 2VP5A 5E4FA 1T6NA 1KO4A 4B3GA 4ZDKA 4LWZA 3REGA 4D0LB 4MYHA 3U3RA 2D2FA 3CWQA 1BMFD 4URZR 3WYFA 3QJYA 3NEYA 4C2TA 4A82A 2QENA 3MWKA 4IEIA 1NVUQ 3ZGXA 2XJ4A 2YVUA 4BFTA 2NIPA 2ZJ8A 4BRWA 1W4AA 4Q1DA 1KI7A 2W2TA 2HCBA 3ZH9B 2CVFA 2XOKA 3T5GA 2WV9A 1L8QA 4QGHA 4JMPA 2HV8A 2QP9X 3BERA 1K5GA 2QMHA 4B3DA 3ZVRA 4FD2A 2CVHA 3WNBA 1VYUA 4C7OA 1NY6A 4PHGA 5DI3B 1AZTA 4PPQA 4BEBA 1TQDA 1F3OA 1KSJA 2HYDA 2FPLA 1G3MA 1KO5A 2FN4A 3NVAA 3U61B 4JLVA 4OHWA 2V6IA 2O8FA 4GT1A 4HB0A 4PPNA 2GAAA 3ND9A 4IFBA 3K70C 1KAGA 3SEAA 5JFGA 4E09A 5B64A 3BGWA 4MKGA 4MGKR 1G3QA 4QL3A 4Q03A 5A4JA 1L2TA 4F7WA 2QN6A 2QPOA 4POAA 1DAEA 1X1RA 1O3YA 2Z83A 2PJZA 4IXNA 4PC6A 2G88A 3GMTA 2REBA 3L43A 3T5DA 2ZETA 1WCV1 5FUWA 3SBDA 3PITA 3L0OA 5L8VA 2BKEA 1YQTA 1ZP6A 3CNNA 1MRSA 4NDZA 5EP2A 2VHTA 2TMKA 2OLJA 4JKIA 1RVDA 3NHBA 1T91A 1Z22A 4LZZA 2QGNA 5DE3A 4Q02A 4BFWA 5F98A 1OLOA 4US0R 1VECA 1XJCA 1S1MA 4GP6A 5KDLA 5TXGA 2B92A 4Q4HA 1OF1A 1NBME 3BJIC 1FUUA 4KFRA 1GOTA 5LDDC 1J99A 1OXUA 4TLBA 3QBVA 4BFXA 2CE7A 1R0WA 1TF7A 2XGJA 4DLRA 4CT5A 3IUYA 5JI3E 1CP2A 4NPHA 4GZLA 3PUXA 2GJ8A 4OJKA 4ESVA 3DM9B 4PPGA 1E3MA 2X77A 3NHAA 5FOSA 3TH5A 4YDSA 3AUXA 3C41J 3WMFA 2A2ZA 3C14C 2DFNA 1JR3D 3QKRB 1W5SA 4XVUA 2BMFA 821PA 5JRZA 3K09A 5J4VA 2IHYA 3CR7A 3OIVA 4EJSB 1GL9B 3GJ3A 4E07A 2BIFA 2HF8A 2W58A 2GNOA 3H1TA 3MWYW 2WJYA 4IHQA 4M1MA 3OAAD 4CDGA 1XD2B 2BM1A 4TT3A 4FI3C 2RMKA 4ON9A 5CITA 3AVPA 3B1YA 4ERNA 2GCPA 3A4LA 3O8CA 2V3CC 2A78A 2JA1A 4DT1B 2R62A 4AY2A 5CJ2A 4LC0A 4KFUA 4KVGA 3T61A 2EFEB 4M4SA 2UZIR 2ZJ2A 4LJ7A 1JJ7A 1GSIA 1BO6A 2XNDA 2IYZA 2WSSA 3ETLA 4CGZA 1Z6AA 3EIEA 3BFXA 4KBGA 1YKSA 1YRBA 5AJVB 2PJRA 3C16C 1EG7A 1MO6A 2GHIA 1KOFA 3V9PA 4N0EA 3ZVMA 2ZRKA 2ZROA 3PEWA 1EESA 2QQ0A 4FXPA 5CB8A 1XXHE 2C9OA 2FDCA 1M8PA 3AP3A 3JZMA 4D6PA 3V4RA 2PL3A 1EFUA 2NO1A 2OT3B 2DY1A 2RH5A 2Q9BA 4F92B 1UKEA 4O25A 4V03A 3U5ZB 3O8RA 1E9SA 4EJSA 3PEYA 1S2MA 1PZNA 4OHXA 3W90A 4WXRA 3GLFB 1RYFA 1H8ED 1JAHA 1ZD9A 4I4LA 1KI6B 4XIGS 2ODWA 2FWRA 2YHSA 1VCNA 2B21A 2IEZA 1ZM9A 4II7A 4OL0A 1KMHA 2IX3A 4OHZA 4X8HA 4DLVA 1D2NA 3DZDA 3PJRA 2QQEA 2QU8A 2HXYA 2OFOA 1QHIA 2F1IA 2ZJBA 5FPTA 1DEKA 1G1MA 4LRWA 3V00A 2G77B 4AC9A 4PSVA 3GLHB 2VSXA 4R9UC 4B3FX 2JLXA 1R0ZA 2IHBA 4GBMA 1ZINA 2JCSA 3DEFA 1XNJA 3ZS9A 3BBPA 5H8WA 3OE7D 2RHMA 1J70A 2ZJAA 4C7OB 4ARZB 5D3MB 4FWTA 4IDQA 4HI0E 1GAJA 3CX6A 2XZLA 2V54A 2ZR9A 3A37A 1VIAA 2JIZA 3B78A 2RGNA 2XTNA 4V0OA 1OKKA 1E2JA 3THOA 4DSOA 1U94A 4NE2A 2X8AA 4TMTA 2H7VA 4EPVA 3NIBA 3CUEF 3W8NA 1FP6A 2GJKA 2CCJA 3N5CA 3NC1C 5HE8A 4AKEA 4LHWA 3TVTA 4AYTA 2WWXA 2VO1A 3C8UA 3K1JA 1YZGA 1KY2A 1TF5A 3TVDA 3X1ZA 1RPZA 2J5XA 1IM2A 2D7CA 4IXMA 2KJQA 2PCJA 3PVSA 4HZUA 4TMWA 3SHWA 4RKFA 2OHFA 5CK4A 4HAUA 3QF4B 1XMIA 3SYNA 4KO8A 3TMKA 3S1AA 3U3OA 4TYYA 1DG3A 1E0KA 2ZPTX 4Q7LA 3IEVA 2QEQA 5EP3A 2ZYTX 4Q01A 1CIPA 3IGFA 1ZU5A 3HPQA 2QGZA 2RKOA 3HR7A 1TAGA 3QOFA 4QKQA 5FTLA 2EFHB 2WJVA 4UKDA 1UDWA 3VR2A 1HQCA 4B35A 4A15A 1F48A 3GLGE 2FSGA 2I3BA 3H4MA 3AUYA 3FYHA 2IYWA 3I8XA 1NBMD 2H17A 4LJ9A 4M1WA 4R2IA 5HCNA 3GLIB 2NO0A 2Z4RA 1V43A 4X8LA 2XXAB 4HAWA 1KMQA 4Q18A 1OHHD 2AXPA 3OZXA 4NP6A 4PSKA 1IN8A 2R6FA 4F91B 4JLKA 4B75A 5JCPA 3GLGB 4DHEA 3KKQA 3O47A 3L0IB 2J0VA 3AVWA 4LGMA 2QAJA 1HE1C 2C2HA 4L4UA 2CCGA 1QHNA 4A0GA 4LBZA 1T3HA 4PO8A 4Q4AA 3SQWA 5JHGB 1G17A 1N5LA 1WF3A 3VMFA 2ZRJA 3FMPB 4ZKEA 4QXAA 2O8DA 1KI6A 2AHOA 4HAXA 5TDHA 1NVXQ 3AGPA 2D74A 3MWJA 3RLFA 5L3VA 3R9IA 1BIFA 1G4AE 2W0MA 2W2VA 3K09C 1IQPA 4L5BA 4RCZA 3B7GA 2OXCA 1TU3A 2RGDA 4YMUA 3RRNA 1C1YA 1DAMA 1R7RA 4P3YA 1MOZA 1Z0KA 3I8SA 1ZD1A 2QBYB 4LHYA 1XTJA 2C99A 1G16A 4DSNA 3WYGA 3ECCA 3FFAA 4EAQA 2FG5A 2JLUA 4WZBE 2IYVA 4DCTA 5JLJA 1R5OA 2ORIA 5LB2A 1TMKA 2IL1A 621PA 1VYVA 2F1HA 3VHLB 5KOYA 1LS6A 1AK2A 3ADBA 1CRQA 4JLDA 3QF7A 4DVGA 3B60A 2F43B 1IN7A 2PT7A 3BK7A 3QQ5A 5ELXA 4A4DA 3HP1A 4AKHA 2JJ1D 1Z0JA 2FFBA 2F6RA 4QBGB 2KB0A 4DUGD 1N5JA 3KJEA 5JI2E 1E69A 5FL7D 1UFQA 1SXJD 2GEVA 4C4PA 3NBYC 2MSCB 5CIWA 1Z07A 3ND8A 3NKVA 4LHVA 3LBHA 2C5LA 4TMZA 5EXSA 3I62A 1PV4A 5FR1A 1G8GA 1KKMA 1N0UA 2R9VA 4GL2A 4Z8YA 1J8MF 3GLHE 2OFWA 4XD7D 4LV6A 1UBEA 5DIFA 1DAIA 1DAFA 5FBLB 2R6AA 5DYIA 4CT4B 1TX4B 5DI9A 3I72A 3H86A 3HYRA 1KSHA 1HUQA 3X2SA 2ZE8A 4WAUA 3BFKA 3OF5A 2BBTA 1X6VA 2C9YA 4GRAA 2ZAOA 5FTMA 2H1LA 1VDZA 1SVKA 3MJRA 4WA7A 4US2R 3GLGA 2LKDA 2GXSA 3W8RA 2OESA 3DOFA 1CJUC 3CRMA 1RIFA 2JLQA 4N1AA 4J0QA 4JZKA 3GLIE 2CL7X 3BORA 1F5NA 4NH0A 1Z8FA 2QNRA 3FFBA 1DADA 4M1TA 4R71A 3A1WA 3PXGA 1ZM3A 4EKDA 1SVOA 2ZRBA 3WNDA 5BN4A 1TEXA 8OHMA 1P9NA 2BKUA 2ZRGA 3A36A 3I4LA 5FH9A 1AJEA 3C5HA 2BMJA 1RFLA 5FTKA 1YR9A 2QRZA 2FPMA 2IYUA 4TTPA 2J7PA 2ORWA 3PG5A 1ZM7A 3AVUA 3EPHA 1NKTA 2OCBA 4TZ0A 4AKIA 1D9XA 1X8JA 5FOVA 3QVVA 1W36D 2BEJA 3CO5A 2GXUA 1CS4C 2QE7D 1MO5A 4WIAA 5CK5A 2XTZA 3RRZA 1P7CA 2FU5C 5AJZA 4NCKA 4QGGA 5HCIA 1WB9A 1CU1A 1W47A 1Z29A 5KHOC 4NZYA 2VHQA 4CEJA 4IEEA 4B3XA 2X2FA 4TL9A 3O8DA 2CEAA 4M1YA 3GCGA 4LJ5A 2VTKA 2O8BA 3V4FA 1TNDA 3GJ5A 4QHSA 3DM5A 5JHHB 1F60A 3CRVA 2QTHA 2P0EA 3QPVA 2JLZA 1VYTA 3QPWA 4Q1EA 1E4VA 3NBXX 2EW1A 1E9CA 1BMFA 1P2SA 2GF9A 1IN5A 2F9MA 1U8ZA 5EE5B 1HURA 4LYAA 1SXJC 2FSFA 2GJSA 4TL6A 2QP4A 1PUIA 3SC3A 4LPSA 5FPSA 2CK3D 3UPUA 2EU8A 3AF0A 2VF7A 3T12A 5K8LA 1ZJ6A 2VYFA 1IY1A 3BB3A 4QNMA 3PEVA 4A8JC 4CEJB 3AM1A 1KI3A 1R8SA 3FKSA 2HJGA 2YWHA 2RGXA 4LPKA 5EUQB 4CEHB 4A1FA 4EFNA 4U5XA 1P2VA 1WE2A 4FN5A 3DMNA 2GF0A 4BFVA 4PHHA 1AS2A 1KI1A 3LBIA 2ZRMA 3P1JA 4DDUA 1NNEA 4DC9A 5KO2A 1GNQA 2ZANA 3AB3A 3IIJA 1W49A 1JPJA 1M7HA 4KVAA 4TYPA 1W4BA 3ICEA 3IQWA 5G53C 4IVPA 5IRCD 2CLCX 2FH5B 4Z54A 5F9HA 721PA 1SVMA 5AJWA 4C0AC 2DB3A 1KSFX 4FCTA 1GIAA 4GPTA 1R2QA 3I3SR 1E1QD 3K0AB 2AD5A 2CJWA 2ZI6A 2WBLC 1GG2A 3X1XA 4DLZA 4TYQA 3KTAA 2ZSEA 3BB1A 5JS7A 3CRRA 5FL7A 1OB5A 1OV4A 3N70A 4AYXA 4B33A 2SHKA 5J4LA 3EW9A 1IXRC 3THYB 2RGBA 1E2KA 2PLFA 2O8EA 1DOAA 1X8LA 4LI0A 4LOAA 3FMOB 1SHKA 3AGQA 5JZVA 5KSYA 2ODNA 3E5HA 2WWGA 3RDPA 3ASZA 4KITB 1XXHB 2H57A 1KDPA 2IYTA 4L8GA 2XNSA 4JBXA 1Z28A 2GAOA 4HATA 4NBSA 1XRJA 2ZRLA 3N2IA 4PC7A 2E1RA 5DI3A 1KNQA 1LB1B 2QA5A 3LDAA 3W3ZB 3K70D 3LY5A 3QUSA 2X2EA 4UNQA 4PHFA 3TKLA 1N25A 3NG1A 2FEMA 4NCIA 4UXJA 1HEIA 3UG7A 2DCUA 3U44A 4Q7KA 4HUTA 1D5CA 2WWHA 5AJXA 3EZ6A 1S3GA 2G0NA 3IPXA 3LQRA 2EYUA 4LBWA 2WMNB 5DGXA 2DYKA 1E9DA 1OW3B 2YJTD 3QG1A 1IONA 2ZYUX 3EZFA 4ITRC 6Q21A 3DKPA 3AEZA 1NKSA 1X8KA 1MR3F 4PANA 4QM6A 4HUQB 4OQFA 4MH0R 4A0RA 4N3NA 2PX3A 4MUAA 3UATA 2FOLA 5EZ6B 3MCAA 4V0LA 4ASUD 5EJEA 2QZ4A 1ONBA 4F4IA 2BMDA 2O0HA 2XJ9A 3EARA 5EP4A 2N1BA 3GFPA 4MKIA 1W5TA 4M1SA 3CZPA 4Z1MA 4B74A 2R8RA 3K9LA 3OEHA 1PUJA 4D26A 1FPMA 3QXXA 4LJYA 2I1QA 3GJ4A 3U44B 2ZRPA 3U60B 4UXIA 4ZCMA 3B5JA 4HLQB 1NVWQ 4MRNA 1TF2A 1PLJA 3FMIA 3BOSA 5AJYA 4IDNA 2ERXA 1MO3A 4A9AA 1HYQA 2YINC 1CEEA 1CR4A 2UZ3A 3VR1A 2ZE6A 3UWOA 2J46A 1BS1A 4UNNA 1XB2A 2ZJOA 1E2LA 1TTTA 1NF3A 2A5FA 4C3ZA 1HV8A 4XVQA 4MDFA 4NYJR 2GKSA 1XDBA 4IVRA 2Y8EA 5JEDA 3T34A 2VRWA 3W5IA 1J7KA 1N5IA 2FPKA 2JAQA 5C2JB 3U3KA 2ZXUA 3U3JA 2FZLA 3SFZA 2OEPA 5AUNB 1XEXB 2QTVB 3IBGA 3QENA 3KKNA 4KXFB 4CYMA 3CF2A 2QSZA 3WNCA 2RCNA 3RS4A 2BJVA 4PTLA 4YQFA 1L7VC 4CW7A 2K5UA 5JCZA 4DLXA 3T1TA 4A0HA 3TRFA 4JYBA 1WBDA 3WMEA 3KQHA 5P21A 1DBSA 1GNRA 1CULC 3K9NA 3VR5A 2WWWA 1OHHA 3CX8A 4CIDA 4E22A 4Q1AA 2B8WA 2NPIA 2YV5A 5BXQC 5L3SA 1OH6A 1Z3IX 1ETUA 2OV2A 4RD3A 1YR6A 3EAQA 3CLVA 2BBWA 1AN0A 1XPRA 2XZOA 5CM9C 3KQUA 4D2IA 2N42A 3THXA 1EWQA 1WP9A 2WMOB 5CLQA 1E9FA 5CYOA 3REFA 4G3XA 1C9KA 2ZITA 1KJWA 4P4SB 1EX7A 3IQXA 1M2OB 2H92A 4Q4JA 3QI2A 2V6JA 2YWEA 1M34E 4Q4LA 1H8HA 1H8EA 3EG5A 1TQ6A 1DS6A 5HZKA 2AKYA 2BV3A 3GJ7A 2H5EA 4OYHA 3UKDA 4OQLA 2BBOA 2W6JD 2WAYA 3GJ6A 5F2EA 4JLAA 4NYMR 4WZAE 2ZEJA 4JYCA 2J0UA 4EIWA 2BCJQ 2CE2X 4M22A 4TTRA 3EWSA 1UM8A 4C30A 3GLFE 1T3LA 1OSNA 4H1VA 4X8MA 4NYMQ 1UBFA 1YVDA 2IUTA 1XD8A 2WSSD 4PC3A 2JLYA 2AD1A 5AR1A 3ZLJA 2YKGA 1VPLA 4OQMA 2GZAA 2WICA 2ZS8A 3CF6R 421PA 1UEJA 2GCOA 2L0XA 4DB2A 3CF0A 2ZYWX 5LD2C 5B57C 3HWSA 5JEEA 2YOGA 3KX2A 3W5JA 2QY9A 1IJFA 1DO2A 1CJKC 1AS3A 5LD2B 3L8ZA 5SZKB 2A5YB 5IT5A 1GL7A 1UKYA 1Z2CA 2I4IA 2WOOA 1U90A 4LX0A 4Q21A 1BH2A 4Q4JB 2F3TA 2KBFA 2IWRA 2CHQA 2JLVA 2ZS9A 2V9PA 2PT5A 1ZC4A 4A8JA 1PLKA 2LWIA 4BFSA 3GP8A 1N0WA 2DWOA 4ASUA 4PC2A 4D4LA 2OZEA 5AK0A 4PC1A 4HDOB 1JAIA 4DWJA 2AXNA 2IEYA 3RS7A 2RGNC 3ZD7A 4A36A 4BE7B 3ASYA 3KKMA 3KZ1E 5GJBA 1RRCA 1NBMA 1Z06A 1XCMA 4TQ9A 4U02A 5ANRB 3LXXA 2HDNB 1PVOA 4Q4AB 3VHXA 1VCIA 2PZEA 2GVDC 3JZAA 3HYTA 4DLTA 3QEOA 1R10A 3ZIAD 5BW8A 2KI5A 4OHYA 1LF0A 3IIMA 1JXMA 5EE9A 4CZ2A 3QPUA 5AUOB 1G9XA 2JLSA 4JIMA 1TADA 3FKSD 4RFSB 4XWAA 2DR3A 3EIQA 3EIHA 4Q4HB 1J90A 3OEED 1I2DA 1ZAKA 4NYIR 4V0ME 4YMSA 1J8YF 1FW6A 1KI2A 1COWD 4TQUS 4CF7A 3IHWA 2GK6A 3MLEA 2XXAA 2ANCA 4FIDA 3VX4A 3K53A 1FMLA 3TIFA 1TEVA 3IBYA 3FE2A 3EPLA 1U98A 2C95A 3N2EA 4HAZA 4DBLC 3ZD6A 1N5KA 2AFHE 1KDTA 3DO6A 1JALA 2C9CA 5C4GB 4B47A 3B85A 4XSGA 1EFTA 4WOPA 4R98A 1NN5A 4PO9A 3VNVA 3SE0A 4QNRA 1YZLA 3IO3A 1XMJA 2WKQA 3CX7A 2PH1A 3WY9A 3ZQJA 1G18A 2PX0A 3PFIA 4KFSA 4TSFA 3LH5A 2GCOB 4D4MA 3CH5A 3CNLA 2D4HA 2WAXA 3SN6A 1UJ2A 3ADKA 2NGRA 4LYFA 5DHFA 2AK3A 1E79A 4KODA 3PUVA 2IXFA 1XU4A 2BVNA 4LYHA 4RD1A 1OH5A 3NDBB 3EA0A 2ZRDA 1T9HA 1XTQA 3B9QA 4NCJA 4C0HA 2YWFA 4DXAA 1IN4A 4QRHA 4GP7A 4A92A 3HU1A 3ICQB 2J59A 1E9AA 1XMVA 1NIJA 2QAGC 4RCYA 1UAAA 5FL3A 2NMVA 2VSFA 5DN6A 1ZBDA 3EZ2A 1G20E 4PAMA 4PQFA 4Y0VA 3LVRE 4GDFA 3KXKA 3NH9A 3IPYA 5JSZA 2ERYA 3AKDA 2WJIA 3LXRA 3QBTA 4PQRA 3Q7QA 4PHTA 3OFNA 1P2UA 1X3SA 3KB1A 3W3AA 2KE5A 4LUCA 4PZZA 3MUFA 4M9XA 1ZMXA 2W83A 4C0QC 2X1VA 2ZI5A 4EPTA 2VHJA 3MSXA 4O0MA 2REXB 3CWZA 1ZM4A 2G6BA 1ZM2A 4URXR 4GI7A 2HUPA 3IIKA 1OH8A 4IOLA 3RSLA 4B43A 1G6OA 3Q5DA 4JJZA 5JMTA 2OG2A 4FW9A 3BWDD 1DVRA 1E2GA 3AVOA 4BUJA 1W48A 3WRYC 1E2MA 5JSZB 1XCPA 4YMVA 1ZU4A 3A1VA 1ZIPA 2WPDA 1LV7A 1D2MA 2NQ2C 3TSZA 1UDXA 3FMFA 4KLNA 4JVMA 3ZZ0A 4DDVA 2GZDA 2A5GA 2P6UA 2ZS7A 5G3YA 4JVNA 3LD9A 4PQYA 4OI2A 1EFRA 4URWR 2FE4A 3GD7A 4WVFA 3ZVNA 3H2YA 4BGDA 4DZZA 2P6RA 2PZFA 2MMGA 1G7SA 1HQYE 2B8TA 3RRYA 2ZSBA 2VIIA 4W9MC 2Z4SA 1WA5A 2QBYA 4TLEA 1I4DD 1YE8A 4DCNA 4ZI3A 4OKSA 4DUGA 4GSYA 2REOA 1QHHA 2JJ1A 2QTFA 1OJLA 1E32A 3VR4A 4BWYA 5C4MA 4CEHA 3GPLA 4MGZR 3CONA 2YC4C 2OAQ1 2ZI3A 2O5VA 3KJIA 2AK2A 4HLDA 4HLCA 5K8IA 2YYZA 1GM5A 3SI7A 1LY1A 1R4AA 2W6IA 4GMDA 4RKEA 4TMXA 2ONJA 1W1WA 1FUKA 3K0SA 2P3SA 4B6EA 1W46A 2CXXA 3U3MA 4M0LA 4B48A 2BEKA 2Q3HA 4DIEA 3LVQE 4WXPA 4M9QA 4E5UA 2H8KA 3E1SA 4BLRA 4XSHA 5JBQA 3NC0C 1N6LA 1VIYA 521PA 4UNSA 5FI0B 4HLUA 1YZUA 3KKPA 2O8FB 2FFQA 4D82A 1T0HB 2F43A 1NSFA 3CM0A 1S9HA 4KSBA 1XEWY 3QKSB 1BOFA 3QKSA 3GJ0A 1JJVA 5EUMA 3PR1A 1U8AA 1KK3A 3PUWA 2NTYC 3FGNA 1KGDA 3RRMA 2RGCA 3K8YA 2WJHA 4AD8A 5FUVA 5FTNA 5KNDA 2DHRA 4ZDJA 2RAPA 3OEHD 4P33A 1ZNZA 3AF1A 4W5WA 4DRZA 4LBVA 5BN5A 4RY2A 1MKYA 1RC8A 4PR0A 1A82A 4G1UC 3SJAA 2WWIA 1XTSA 3FPAA 2Q0HA 1SKYE 4M53A 1EFCA 2CHVA 2OBNA 5EE3A 1GKUB 5DYGA 1LFDB 5KYKA 1ZRHA 3QSYA 4Q00A 4YMTA 5CYPA 1YZTA 4ZCLA 2DWPA 4V0NA 5L3QB 3EPKA 1JB1A 4M9SA 1G5RA 1VMAA 2O8EB 1QHGA 5EE1A 5FPHA 1Z0IA 2C78A 4MA4A 1NMXA 3RS5A 5CM8B 4BASA 1KJZA 1XXHA 3RANA 1ZC3A 1QVAA 1KDOA 1G8PA 221PA 1XJQA 2G3YA 5FI1B 1TQ2A 2QT0A 4I99A 2FA9A 3VR3A 4MYCA 2VP2A 1CRPA 3C4JA 3AVTA 5FBWB 4RD0A 2GDJA 3FHCB 3C5CA 1BKDR 2WSMA 4OK6A 4IJMA 4RVCA 3I1FA 1V5WA 2QT1A 1IN6A 3L0SA 1EK0A 4GFDA 1GKYA 2QPAA 3P27A 4JLNA 3Q7PA 5E3HA 4DSTA 4P4TA 1M6NA 2CJWB 1YR7A 3OFND 2JJ8A 3Q9LA 2O8CB 2Q6TA 1Z0AA 3TLXA 1AQUA 3KDSE 3I5XA 4IOKA 2GJ9A 4E03A 4JS0A 3F0TA 4YLGA 3OAAA 1U2RA 1T0JB 3QNUA 4NCNA 2GJAA 1A7JA 1MH1A 2HCJB 2VL7A 1Q1EA 3QIAA 4LV5B 5LBIA 4BLSA 3AP2A 2O0KA 2EQBA 1K6MA 2Q3MA 4ZIRA 1G21E 1ZCBA 1LTQA 2A5JA 4F38A 2P65A 2C77A 5SZIA 1X86B 3EC2A 4OK3A 1XWIA 1JXOA 5J40A 1OFTA 1UBGA 3LO5A 2GCNA 4BLQA 4GMXA 4PPFA 4A2QA 4TL7A 5TB5A 1GFIA 2VBCA 4LJ6A 1EFRD 2GZHA 3H0KA 4JLBA 5DH9A 4HB4A 3RNLA 4CVNA 4EPXA 3G5UA 4R7ZA 3K0CA 2VPPA 3HJNA 2Z6VA 4B71A 2WTUA 2I1VB 2ZJ5A 3TR5A 4AG6A 4B6FA 2OUKA 2WPDD 3D3QA 4WBSA 4M9ZA 1XD2A 1OFIA 4BEJA 4FINA 5FBQB 3ADCA 4K8OA 1Y63A 4OBEA 4A6PA 3LLUA 1P9RA 5E95A 4DLWA 1AZSC 3LNCA 4AI6A 1N6OA 2UKDA 3LLMA 5KPDA 1KDRA 2BM0A 1PJRA 2ZRHA 3BAFA 1CR1A 1EXMA 2ZVQX 2BHRA 3DOEA 2MSEB 4RZ2A 3U7HB 4Q5IA 5J5CA 3C15C 1NG9A 1NLYA 2GBLC 1L4UA 4XVRA 2ZRAA 2A7QA 2RGEA 4KJZA 1AGPA 2IS2A 4BPBA 2VF8A 3K0AA 4KFTA 1F2UA 1Z6YA 3RVBA 4QC2A 3SDZA 2DBYA 4ILEA 2PEYA 1XTIA 1NJFA 1A5TA 3VKWA 1KO1A 3QG5A 2AFIE 3NXSA 4I1SA 5H70A 5H68A 3LWNA 1EX6A 3BH7A 2VQSA 3BRWD 1G5TA 2C04A 4I81A 2Z0MA 2IW3A 2ZREA 2PLRA 2OFXA 2PBRA 4MYUA 2R44A 3K0FA 3SU8A 3DHWC 1DELA 2J0QA 2MSDB 121PA 4C2UA 1RZ3A 3L2OB 5JWRA 1QG2A 2ZAMA 1QHXA 3A1UA 4MGYR 1XTKA 4B2LA 1AA9A 5FUYA 1WBBA 4TMKA 2XX3A 2G9NA 3WMGA 4DEYA 4B76A 3VNUA 1I2MA 4FCWA 1JR3A 1G8HA 2QE7A 4Q19A 2ZI9A 1HH4A 4B2PA 3F8TA 1GRNA 4D0NA 1GDDA 4RZUA 1LVGA 1T3SA 3B13B 4C0LA 1ZCAA 2H18A 3OESA 1Q22A 3AP1A 1KI4A 3P26A 3FHTA 3EXAA 1B0UA 4IKEA 1FP7A 3WBKA 1ZW6A 3BE4A 2VP0A 4HAVA 4DT1A 1P9WA 2OO7A 2ZIAA 1NP6A 1RJ9B 2IYXA 4QBHA 3ZQ6A 5KDDA 4XOIA 4IOMA 1B23P 1ZIOA 3HU3A 3K9HA 3T1VA 3TBKA 1BYUA 1SQ5A 3CR8A 4JLMA 3SHFA 2V4ZA 4PXAA 1R0XA 4TYNA 1Q1ZA 1N3BA 1EFHA 3KJGA 4TQAA 4UNRA 1NMZA 5C18A 1GL6A 3TAUA 1OPXA 3UMRA 1DPFA 3R8FA 1KZ7B 4AG5A 1H8HD 4O2RA 1G7TA 2QI9C 3M1IA 2CDNA 4AKGA 1JR6A 4H9GA 5H1YA 4MGIR 1ESMA 1QHSA 2ZRCA 3RWOA 4BECA 3SQXA 5EXPA 2BDTA 4RD2A 2IYLD 4M1KA 2G83A 2QSYA 4UJ3A 2WWYA 3CRW1 3Q72A 1FNMA 1XD9A 3B9PA 4LY6A 2GILA 4PSAA 1NG1A 4PX9A 3P32A 2D62A 2CBZA 2QMOA 5FBRB 1A2BA 2RHDA 1Z2AA 3DL0A 2FF7A 4PAOA 1E79D 2ZVPX 3GLHA 1U0JA 1SXJB 3CNOA 3CPJB 2IYSA 4B3CA 1H65A 3THXB 4ZKDA 2VP6A 4DJTA 4L9WA 3NEJA 1OXSC 2XEXA 1E1RD 1US8B 5KU1A 4JSYA 5EP1A 4A2PA 5C1BA 4Q1FA 4WW0A 1GTVA 2ZSDA 2OILA 4N0DA 2P5TB 3ZJYA 2YC2C 1G3UA 1OT3A 1P2TA 2J0UB 4K81B 3B1ZA 2EFCB 4D81A 4LHZA 2HF9A 4XWOA 2P2LA 1E9BA 3NDPA 2LKCA 4TYWA 2JJ2D 1VHLA 1XEWX 1NI3A 2VP9A 3FKQA 4RD6A 3K0FB 3D8BA 2VEDA 4XTRA 5KPJA 2JATA 4TLDA 2CK3A 3MFYA 2ATVA 1D2EA 2MMCA 4MKHA 2PZGA 5FR2A 1GNPA 2V55B 1N2CE 3LFUA 1VG0B 2ATXA 3L0PA 4NL4H 5CIQA 4HDQB 4XH9B 4DCUA 1ZD8A 2ODBA 1GP2A 2QROA 2GETA 1M1YE 1N6IA 1G4UR 1KAOA 4NCHA 2WKPA 2QMEA 3IHLA 3CKLA 5CDFA 3RS3A 3TW8B 5HKKD 3B1WA 3SYLA 1P60A 3ZVLA 3L8YA 3NTUA 1P72A 1W36B 2GTPA 2OBLA 3Q3JB 3KUDA 3JVVA 1WMSA 1DE0A 5HKKA 3PENA 5GJCA 1FQKA 4Q66C 2NPFA 1NLFA 3PUYA 1SXJA 1ZUIA 1HTWA 2ODEA 2R65A 2IK8A 1AIPA 2CL6X 1GZSA 1DO0A 5KSZA 4PO1A 5D3MA 3QXCA 4GOXA 1RRFA 2WZQA 1A1VA 4W5JA 4Z51A 2B7BA 5TV2A 5B58C 1SKYB 5TMPA 3HPRA 2LCFA 1OYYA 1ZNYA 2ORVA 1RKBA 1XEXA 2WJJA 4A8JB 1COWA 3NBZC 2Q9CA 2R6DA 5IK2A 1SVIA 3HDTA 3RS0A 1UPTA 3SFVA 2WM9B 3EWAA 2IS6A 2YWGA 3RHFA 4NU0A 1K5DA 1ZNWA 1KHTA 4LC1A 4LJ8A 2OXRA 1Q20A 3U6BA 2FNAA 1JQJC 1FL9A 3B82A 3SJCA 4EQ6B 3SYKA 5TARA 1A2KC 1NJGA 3ZZUA 4JKYA 2QAGB 1FZQA 3LQQA 3AVXA 3R9WA 3ZIAA 4TN1A 4PFSA 1S0UA 2FZ4A 5E7IA 3W34A 4BLOA 1LF5A 1N0VC 1O87A 3BD9A 4Y0AA 1OH7A 2IS4A 3WP0A 4DLUA 2IC5A 3DMDA 4O3MA 4HEJA 4C0SA 1VHTA 3W6PA 2HYIC 3RYTC 4K46A 1SVWA 2FGKA 2WIBA 3NBFA 4IOJA 4JBYA 4Q9KA 4FMCF 4XTCS 3EZ7A 5DLQC 1MO4A 1XTRA 1G19A 3D6TB 4B34A 4DCSA 1ESNA 3E70C 1DTSA 3TGPA 1ZVQA 2ZSAA 4BLPA 2GBLA 3MMPA 1F2TB 4D4KA 3IDQA 4QBFA 5BWMA 3A6PC 1U0HC 3CH4B 3R8CA 1WQ1R 3WBJA 5DISB 4MRRA 5DSZA 1QDEA 1E2NA 1XMSA 2EYQA 2ZRIA 3B1XA 3GEHA 4F4JA 5BN3A 4MYTA 3WXMA 1Y3AA 4U00A 3TSOA 4D25A 2XTMA 2F9LA 5EZ5A 2QPTA 1P61B 1II8A 1XZQA 1JEDA 5JECA 4U7DA 1NN0A 2ECKA
chains in the Genus database with same CATH superfamily
3WHPA 4DYHA 1ZICA 1YHNA 3EN0A 3PXEA 1C7IA 1N6PA 4FGSA 3VKFA 4OLBA 1GGKA 3K0CC 4BMOB 5CEEA 1CB0A 1SOWA 4J0KA 4PS1A 1CVIA 1AHNA 5JLAA 2IHKA 1YS1X 2ZIGA 3KPUA 1EUQA 1I33A 1LPOA 1R5NA 3EXHB 2W6JA 3H84A 3QLVA 4XJXA 1S3FA 3HI6A 2YHBA 3STYA 2X3UA 4BDSA 2G36A 4JT2A 4QFBA 2C7BA 1RBMA 3Q9UA 1YASA 5SYAA 4XWWA 3P4XA 4MTLA 1L8OA 4I08A 5KNCD 2I6QA 2CHFA 3H8WA 4TTTS 3MD9A 3QKTA 2V8OA 4G6ZA 2JLCA 1U7OA 4KQ9A 3WRXC 5KQSA 2JD0A 4BZWA 2PKEA 1G2PA 4UBOA 1QZXA 3E82A 1MPTA 1W0KA 4JSTA 3W8FA 2QMQA 2WFAA 2C88A 3L0BA 5HBGA 1S2LA 4JL6A 4XA8A 1L5HB 1VI6A 5KDOA 2F55A 5T3UA 2V7GA 2AZTA 2VCHA 1TIPA 2P9YA 3GEPA 4UNPA 1FPQA 2H9IA 3C98A 2I66A 3ETGA 3COPA 3PQ4A 4EM6A 1JI0A 2X14A 5GY7A 3DL7A 3RLIA 1TC1A 4TX1A 5EPOA 3TDMA 3QMMA 4B4OA 2RDMA 5AHWA 4CCYB 5B7GA 3KRTA 4L9SA 4RELA 1KU0A 1FU4A 3K30A 3L6UA 4IZIA 3QXHA 2RGGA 2PKRA 1NWCA 5IPFA 1MJ5A 5KOJA 4YRMA 3HCEA 5G0SA 1XMOB 4MV7A 4G56A 4X90A 1NVDA 1AO3A 2ZB2A 3EODA 1RNLA 1WHSB 1U0GA 1G0OA 5K0NA 2XZPA 1KYIA 3C3CA 2J6IA 4LTNA 1PVDA 2F7SA 1J23A 3N2KA 3U4MA 1KQPA 2G9RA 2PY6A 4MW6A 4OSPA 4G1FA 4MI9A 1I3MA 3JQ8B 3K1YA 1INLA 1D6SA 2I22A 3DQZA 2B30A 4MKRA 4NBNA 5EUBA 5M29A 2CSXA 3CMMA 3AOEA 3R3YA 5CXQA 4OGFA 3BMNA 3N8DA 2O52A 1ZISA 2JLRA 2ZBQA 4BV3A 1N34B 2O0JA 4IIBA 1CQZA 2CYCA 4LSGA 3KT0A 4HTFA 4BRSA 3ZPXA 1CE8A 3ZGLA 4AS3A 1CD5A 4CQMA 2RK3A 4BV8A 2G1KA 1PWZA 4PRKA 1TPYA 4DB4A 2ZJYA 2NXCA 3AC0A 2AWOA 4WY8A 3I0ZA 2J9ZB 4D9GA 4A0FA 2H5IA 2Z5GA 4IO1A 3H87A 5KTYA 3WVNA 2WIJA 4XRRA 2BWJA 2J5BA 2QL6A 5AVSA 2AWNA 4ZK6A 2NG1A 2I91A 1RC1A 1TI7A 1HYBA 5H0IA 4Q4CA 1NY5A 1GAQA 4MWSA 4YRFA 4ZDIA 3S7TA 4EPYA 1G8AA 1MBZA 2PRKA 4D02A 1XEFA 4EUFA 4TTJA 3DC7A 4KWEA 1I32A 5M5BA 5IWCA 1KE2A 4X1IB 4W7SA 2JS7A 5GJVC 1CETA 3SJBA 1ZYUA 4PSCA 4YC7A 3B2EA 4UTZA 1R0KA 4HAIA 1QB7A 3L7YA 4ND4A 3W4JA 1QJCA 1GA6A 2Q4DA 2WJZB 2HQRA 3TQFA 4OMDA 3JQFA 5UKDA 4OHVA 3UK1A 3B1VA 1FU7A 4QIHA 1VLHA 1P0CA 2Q41A 1KKUA 9LDTA 3LW7A 2GD1O 2WFZA 1I94B 2IZ0A 3VQTA 3STHA 5G4KB 2O3JA 2XVXA 4P38A 1JIKA 3GJTA 4E1AA 1U6KA 2WHXA 4OLAA 4J7XA 1YT5A 3MJDA 1Y0BA 2RHTA 2IPLA 2WNSA 3EF0A 4US1R 4ZVOA 3MC1A 4M0DA 4UE2A 3Q8MA 3LQ4A 3U26A 3O75A 2NT3A 3O8LA 4HFRA 2BM9A 5EPEA 4V1CI 3DZ8A 1KYVA 1OGYA 5JAOA 4QREA 4EFKA 1RRGA 3CF4A 5J3JA 1BXRA 1EUCA 2YHAA 5ALEA 1W44A 2IF2A 3TG2A 2JRCA 3FWNA 4YJFA 2IY7A 4RHEA 4I4TA 4MNTA 3I5MA 3T94A 4F4CA 3KQLA 1E2PA 2XIQA 3EWNA 3TPFA 3BS4A 5IUNC 5MFPA 2YRXA 3AQ4A 5CJPA 4CEIA 3V1MA 2XB2A 1SD5A 1CQJB 2YYSA 3VKVA 1B6SA 4F2DA 1JIUA 2G71A 1CUIA 4GWGA 1D3AA 1CUUA 1GPDG 1RQPA 3N8IA 1DARA 3U3DA 1ZI9A 2F3PA 2JAXA 3E9NA 3FDIA 1XPUA 2V7QD 5CXSA 4A0QA 5ITZA 5IHPA 3C8DA 1R4MB 2D8MA 4KPUA 2P6OA 1EGAA 3TCKA 3OIGA 1KXZA 2DG2A 4I50A 4BNUA 1GZ3A 1MCZA 4Z2YA 3GPIA 2Q8QA 3V46A 3U7EB 1PJ2A 1ZCZA 1EIZA 1XTZA 2O2CA 1KORA 4BRZA 3ICPA 2RFLA 3DMYA 5FPKA 5EQFA 4R2JA 1SIBE 1EB8A 3FCYA 1E0JA 1HPLA 1FOEB 1MMFB 1JLLA 1X7XA 1I0LA 1ZUWA 2IRWA 2IUSA 1I0ZA 2OCAA 3HNRA 2FW0A 1L7AA 2WIKA 3DZJA 4ISBA 5SY9A 3NC4A 3OETA 3C6QA 3CVOA 5JWHA 2WZBA 3D6UA 3QLVC 3R6LA 5H16A 3OTOB 4ZOLB 1QU3A 3P96A 3FG9A 4L4ZA 5KYXB 2QLJA 3A3OA 4ZQIA 2VPZA 4G5XA 3SHQA 3RIGA 1P0MA 3IT0A 3L40A 3THSA 3KHUA 1I6KA 5GV7A 2WKRA 2WIDA 4N5MA 5HQ3A 3G82C 5EE0A 5BY2A 3B2QA 3I92A 4YY3B 3HZHA 2CXPA 4C14A 2ONYA 4ZXPA 1JG2A 1HC7A 2RI0A 2C2XA 1ZRNA 1EDZA 1RHMA 2FQQA 4G9BA 4XFKA 4X20B 3RBVA 2EP8A 2YN4A 4TTQA 4Y6GB 4KXMA 1DQYA 1H2HA 2J9FA 2EFGA 4JJEA 2JF0A 1RKVA 5HDQA 1F9EA 1BU5A 3RFFA 2R1VA 1QUFA 4ETMA 5L7WA 1U0FA 2FX3A 4GRIA 2X5KO 3PCRB 4YXWD 5T5QA 4TUYB 3RF6A 1DHRA 4QBIA 3KB6A 2GO7A 4D43A 5K2MA 4KG7A 3T0FA 3V8QA 4DMKA 3KSAC 2Q07A 4MRPA 4TVBA 3GELA 2I55A 4Q7JB 5D87A 3ZW9A 3D54D 2B37A 3QE0A 3RC2A 5ISMA 3G17A 2VRCA 2BZ1A 1YJBA 4RGVA 3MGKA 2NZJA 3L8DA 1F20A 5TQVA 3WKDA 4ALNA 5EJ4A 5B3JC 4PZ9A 1NF8A 1QRDA 1CNMA 2C20A 5L6LB 2E1PA 4JI6B 2IOFK 3ICCA 3G2KA 3ZDCA 1ETHA 4MMZB 1BMQA 5AK4A 3FXAA 3V4LA 1Z2EA 2ZVDA 3AF3A 3DVQX 4QXOA 3RC1A 1J0DA 1W2HA 2W48A 4P32A 4QFMA 4WBNF 1V16B 2BCGY 3GYGA 4I8XA 4ID3A 4M54A 3BXZA 2A9JA 4EUHA 2VPIA 1Q2XA 2GUWA 4L8YA 4OG2A 2GNPA 3GRZA 3JATA 1IZZA 1EK1A 3UK6A 1SVLA 3R41A 1U2GC 4G5GA 3N0XA 4XM1A 2ADMA 3G2MA 4IDFA 4N9QA 1BE6A 5GVRA 1NUSA 1XAJA 2Y1EA 2ZSFA 2G63A 4DG5A 1G5PA 5KHAA 1BQEA 2ZUBA 2FUKA 1XDSA 1JECA 1FX0A 1TT5A 1YGYA 3AKEA 4R8SA 4MQLA 4R1QA 4TLMB 3EGIA 2EDAA 5C34B 2C9BA 3VVMA 3WOHA 5A05A 3ZZNA 4ZOQI 1TQ4A 2RHBA 2P9JA 1HYGA 3SNKA 3BIFA 4LZWA 4RD4A 2I3AA 5EKTA 5PNTA 1RCTE 1D4FA 1XPJA 1HDIA 2IYRA 4FHEA 3G2OA 4IJ5A 4XWKA 2OMKA 2WTBA 4GLFA 1N2GA 3LP6A 3EFEA 2EJUA 5DCWA 2OBFA 5DHAA 3NANA 2B1GA 3TXAA 3A9CA 4PN3A 3KXIA 2ZI7A 2FLWA 2GVZC 5E2BA 5CVVA 3F73A 5LN1A 1WDTA 3A4NA 4BFZA 3PE3A 2VP3A 1W29A 4RGYA 1MV5A 4JUBA 1J2YA 2VNAA 4LECA 5CGQB 4Y6OA 3REOA 5TS2A 3S40A 3R7LA 1Z6TA 2JD2A 3PA8A 4I6GA 4F4HA 1J2JA 3IR7A 4QT0A 3KVRA 1V7ZA 4G0OA 1RBYA 2JPDA 1QIEA 3A25A 3F47A 4KI0A 5KWSA 1T8UA 4XWTA 2WRZA 2VQ3A 2R6GA 4XGKA 4CKBB 1KARA 2P9CA 3B6KA 2HXSA 2X0KA 3RS9A 2A6PA 3FHOA 1TUEA 4L27A 2PUGA 5G4LA 2FPWA 3MXOA 5LOVF 4G23A 3G89A 2EDCA 2ZTSA 3NW9A 4FMDB 3ZY5A 1CYDA 4QG7A 5HKBA 4DSZA 1FSSA 1Q3HA 1T1GA 1VL2A 1Z6GA 1OGJA 2JDIA 2Q45A 3FVVA 4OQNA 1TO1E 5IXSA 4JOSA 4P36A 3S1AB 1XZKA 4D57A 4DF3A 4U9UA 4LK2A 3JD0A 4QVGA 1RLUA 2PCLA 4NG5A 1N5OX 5FA8A 4UAJA 4YMLA 4O2LA 4Z9AA 2H7CA 3MCTA 1J2EA 4I55A 5T6MA 2VAWA 5JMOA 2QPLA 1Q44A 4GUAA 2E7ZA 1CUDA 1AXRA 2HC9A 1UOEA 3IALA 3CH6A 3TNFA 4BJHB 1VJGA 2IXGA 2JASA 3BFVA 3BXFA 3OZTA 4M8LA 4HAOA 3BCSA 4TZTA 5K0BA 2EZUA 4C22A 5AVYA 2E9SA 2GFQA 3B3FA 4ZOCA 5BSRA 1GFWA 4EDHA 4UFPA 4CWAA 3TJZA 4IHJA 3MJSA 4KK4A 4YRLA 4KN5A 4FX2A 1PNRA 5LPNA 1EINA 3Q6IA 5EJ9A 1GQSA 1V6CA 3U40A 2HPZA 5DHPA 4TKLA 4RSGA 2GBPA 4CBVA 2BGGA 3IKJA 1NVVR 1ZA1A 2J7PD 5H59A 1TYEB 3E5NA 3PXUA 1AKEA 2XYPA 4WOCA 4LYYA 2PMDA 2YNMA 3EJWA 1PW7A 4PIPA 4PNPA 1PJTA 3CH7A 2IXEA 1NMEA 3DEIA 1JV2B 5ALSA 3VU9A 4MO2A 3LRPA 1DRKA 1XCBA 1UDCA 4JLUA 1E98A 3FYUB 5HX7A 1XPOA 3VKGA 3EPPA 1T2UA 1Y5IA 3H2JA 1E2FA 4K8RB 4JJ7A 1Z16A 8AT1A 4AG3A 1M5RA 3C45A 3I1YA 5BSMA 1ODFA 2Q5CA 1NTRA 3LOQA 4I1UA 2J3DA 3V8RA 2JFZA 3H2ZA 5BW5A 1XQWA 4UFNA 5LOVB 2AX4A 2OCDA 2PA0A 3OJWA 1ZLXA 1P5FA 4IG4A 1QPBA 3QU4A 5J47A 1I4LD 2IZ6A 3FSEA 4OP3A 1NU6A 1ZGJA 4WKPA 3UK7A 4RVUA 4KCGA 1MTOA 1Z2NX 3SEFA 3ZWMA 4F1WA 3SVTA 1LQUA 2GN9A 3LYLA 1G8KA 3L7LA 1J1IA 3LUDA 3LX5A 3OY2A 2C5AA 3QV1A 4I1OA 3M2TA 3OIYA 2V65A 3AWDA 5JISA 2ZXEA 1P62B 4FXOA 4A8TA 5CMLA 3CUWA 3F5DA 1DG1G 2ZU6A 1DAPA 3DOUA 3LP5A 4KQJA 4YALA 1E3DA 2A0KA 4IZ6A 1YQDA 4YREA 2QV7A 3RTBA 4B6GA 2DPXA 1DXHA 4HMOA 4C4SA 4I4NA 4NQZA 2BEWA 3D7RA 3V1YA 4DUZB 3R3WA 5G1PA 3SZ3A 1QE3A 4IH9A 1KEZA 4H7PA 1D1TA 2AI3A 1S4QA 1A76A 3H97A 2C2GA 1QTRA 3QMVA 4IIHA 1K92A 4OB8A 3MG9A 4OGWA 5LP6C 4Y18A 1W85A 4MEAA 1M2HA 4HEA6 1XZPA 1O54A 3DPIA 4HZIA 3NAMA 1C4OA 5EMJA 2WF8A 4JUDX 5AXAA 1CY0A 1PLLA 5JJ5A 2OLKA 2OHVA 5TX7A 3VUEA 3IDSA 1ISJA 1UEXC 2Q3JA 3SQMA 2RC6A 2YMQA 4UBKA 3ONEA 4DCCA 4KW7A 5FKJA 4K7JA 3R6WA 2PNJA 4R1LA 3OG9A 4GI2A 4JJ4A 5JJLA 2RBGA 3QVOA 3VPGA 5FOTA 1L3BA 1Y1TA 2JL1A 2PMWB 1MFPA 4MVJF 1ZH6A 3M4JA 2ZIXA 4I4IA 4D9BA 3LA6A 3O3NB 1ABFA 1TPZA 2PFSA 3UJ8A 5B1YA 5ITSA 1CBUA 4MJLA 4MQUA 4O4LF 3TUJC 3QV2A 2WZCA 4CTNA 5ECWA 4NV1A 3SE7A 5A9SA 1T0PA 1C9MA 3CKKA 3TD6A 5TQJA 3W6OA 3WB1A 4PYJA 2TSYB 5K8UA 5DGIA 4NYJQ 2VXOA 3LC0A 2P9HA 3UG6A 2CT8A 4M1ZA 1Q1QA 1MX1A 2NM0A 3TLGB 4KDCA 2Q3FA 3D3KA 4MQEB 4TPKA 5TY0A 4C07A 4RY0A 4JKOA 5JRJA 5REQA 4KSCA 4ZEVA 2DT5A 4DKXA 1F2TA 4C2BA 4KR0A 3OPQA 1BEUB 1F0NA 5A9TA 4Y0NA 4Q47A 5FTJA 3TLYA 4JAVC 1F4LA 1OBOA 1G7RA 1TCAA 5HQJA 4FSDA 5A0FA 4BLVA 2XNDD 2WI8A 2F1JA 5AI5A 2P67A 3LHIA 1OASA 1Z5VA 1H9AA 1NBHA 1U0LA 1BH6A 1EEHA 1NONA 1RAFA 3UHAA 1HKHA 2X2OA 3C3YA 3VJKA 1PO7A 4YRNA 5FI5A 2LD4A 3HU2A 2GM3A 2E87A 3Q7EA 1JDTA 1G38A 4YAIA 1XQXA 3QF4A 3VX3A 2CNLA 5ES3A 2HJWA 4Z1MD 2XYHA 3L4EA 2FFAA 2VPQA 4CF4A 4LXXA 5H82A 4EO9A 1ZI8A 2NYAA 1BXKA 4GOJA 4UEWA 2WQ7A 5ABPA 3HFSA 3KTFA 4LZAA 2WTEA 3UJ3X 3P2MA 2OZLA 1R5BA 2WAMA 3D43A 4CQJA 1QK3A 4JHLA 5F5XA 1SU4A 3NNDA 4HRXA 1NAHA 4MR9A 1EFKA 4Q3AA 3NHMA 5AOBA 3F6PA 3PIRA 3O4RA 4G86A 4MVYA 4OK5A 4BNDA 4C0KA 4DLAA 4NTZA 3ACDA 4JYZA 2R7LA 3FVQA 3OCXA 4MRMA 1MOQA 5JYDA 5KYWB 4P31A 1SUEA 2HKIA 1TYCA 2O8BB 4S3MA 3SM3A 4Z4FA 2IBMA 1GTL1 2WG2A 1TU4A 1NP3A 3AF4A 4O08A 1RI3A 1QKIA 1NE7A 5C8VA 5AXBA 4KGDA 2WU0A 1A0OA 1RM5A 3ZWNA 3SLGA 5DK6A 4NMWA 4Z3DA 4E2XA 1XRMA 2LRHA 3HACA 5KNCA 2HSWA 2RONA 4BC0A 5HKAA 1VB5A 4N4AA 2BH9A 1V4NA 3E23A 1J1ZA 3K31A 3MBKA 4EFLA 4H17A 1W76A 4B3BA 5JQGF 1R9GA 3CKMA 4LFBB 1S8FA 1PZEA 5B5SA 1CZNA 1DPGA 2KSQA 2DFTA 5IK2D 4GS5A 1U04A 2R2AA 5ALQA 1QG4A 1SKUA 2GPYA 2LPMA 3ESQA 5FFMA 2C4WA 2FCAA 1JLSA 3HO8A 2P5UA 1XRSB 3SHOA 3CVUA 1PJAA 5LYYA 3W3AH 2JGIA 1X92A 1Y1SA 1WULS 2AOUB 1DUVG 2IA5A 3NHZA 2RHWA 4URUR 3A58B 2D06A 3ZCUA 1ZIDA 1JR3E 1TTPB 2B99A 3COWA 4EFMA 1KZ6A 1ESDA 5C5CA 5GV8A 1G291 3P20A 5EHGA 3GRYA 3JVUA 1QJ4A 4Q6WA 1CF9A 1T4GA 3RC3A 2CMFA 4F9EA 3ZJUA 1NUAA 4M2LA 2O2EA 1HDZA 4E3ZA 4LOLA 5AW6A 4HB2A 3NWJA 2E37A 1I01A 8MHTA 3V4PB 5TNXA 5CYGA 4B4UA 4KBFA 4UE3S 4WZAB 3JASA 2OYSA 2MR6A 2WG1A 4S35A 1GQRA 3UV6A 4BNVA 1DRUA 1FE8A 1T9KA 3PVCA 4G5OA 4LYEA 1L4MA 2LXNA 3KKZA 3MLBA 3V7UA 4EHAA 1CPYA 4XM2A 3FWPA 4G5SA 5G41A 3GVIA 5TEVA 2OBYA 4YMIA 2XSZD 4PVDA 1ZX1A 2EBUA 3VKUA 4BJ5A 1G55A 1RLIA 4UCFA 1FZTA 1T5IA 5MFZA 1JA1A 4TZKA 1R18A 1QIDA 1CQIA 4P5DA 4X92A 2Z43A 1G6HA 3IDOA 4WCVA 1ZNXA 3FX2A 4TLAA 2R00A 3F67A 3G5LA 3M0EA 4KYIB 2DSTA 3HNOA 3ROEA 4CNBA 2C07A 2WZDA 1GUFA 1UBSB 2ENWA 3GQBA 4GBED 1IBSA 5AFSA 3CW8X 1IRIA 1MC4A 1YL5A 2SCUB 4V0MA 4QGSA 2OC9A 2WMYA 2XAUA 3IPLA 2VT3A 5I3CA 4FCVA 2YOHA 2AI1A 4ABYA 4YPVA 3A8TA 3BB4A 3QEMB 1ZJ4A 1Q1BA 1GGHA 3N2LA 5BN5B 1C1DB 1D4OA 1V11B 4PLGA 1ZHOA 4GMFA 2YVKA 2XBLA 4QU0A 3EZ9A 1HL7A 3UUFA 3EPLA 5E6RB 3K8QA 1O5TA 3TZKA 1UH5A 1QNFA 3TB6A 4B3GA 2QL5A 4MYHA 1BMFD 1PL7A 1TJPB 1Z4JA 4URZR 3WGLA 3KEMA 4WK4B 4Y2RA 3WYFA 1DWUA 4PAGA 3MTDA 3T3DA 4ZT4A 3ZGXA 5CA1A 3BMOB 1K7CA 3DFUA 2ZJ8A 4BRWA 2WLTA 2IPOA 3QYJA 4IQFA 3OPNA 5T6BA 4KTVE 3KELA 2O1WA 1CJBA 1NJ2A 1KGSA 2XOKA 4X61A 5CH3A 3CX4A 4JMPA 4QGHA 3N86A 2QP9X 3TKYA 3ZDRA 4FB4A 3BERA 1DV2A 1E61A 4MW4A 1UMCA 1XZCA 2PYDA 1AZTA 1L5WA 3WTCA 1VRCA 4FILA 5JNUA 1BOOA 2NXNA 3FVTA 1BD3A 1QOPB 4CMAA 1RI5A 3CEPB 2FN4A 2VOJA 3H9JA 3Q2OA 4N40A 4JLVA 5HF5A 1K4MA 3ZHVA 1FRVA 2B8JA 2OK7A 3GJZA 2O8FA 2OHHA 1K4KA 4GT1A 1QAMA 4WERA 1XZNA 4PPNA 3Q3IA 1KAGA 3COVA 3FVWA 4FHDA 4QRDA 3BGWA 3MJCA 3BL6A 4RS4A 3JYPA 3WGYA 1YI8A 2WP8J 3QVXA 2OAGA 1AZWA 4ZT7A 3NVKI 3PIDA 2UUOA 3E7PA 4QSMA 4ZZIA 3AR4A 3GARA 2G9QA 5F3DA 4WBNB 1CZOA 1Y3BE 3TCNA 1WPGA 16PKA 1BMDA 1ZH0A 5I9BA 2BFMA 2C57A 10MHA 5ALDA 3L43A 4CIBA 1GUBA 3EDYA 4M7OA 1WCWA 1LPSA 2VT6A 3RCBA 3LK6A 3H9CA 3QRWA 4RJTA 5KVVA 1UJMA 2R8PA 3HNPA 2BW0A 3OMWA 2KX7A 4D3FA 1K7YA 1OZFA 3E48A 4K28A 1C4XA 3G9QA 1MRSA 2NV6A 4OYYA 4AJ4A 2E4AA 2VHTA 1QGAA 2TMKA 4U7HA 3DT8A 2HLPA 1Z22A 1EAYA 1O0SA 1UR5A 2Z09A 4I0WB 4Q02A 1K5PA 1OBCA 5ECYA 4H7JA 3WJ1A 1G8JA 1YOVA 4FFLA 4JXKA 4FYVA 4FFOA 4JQOA 1X39A 4Q4HA 3WGOA 1ID1A 1FUUA 5GINE 3MQFA 2P30A 3FNEA 4PV7A 3ZV6A 3QBVA 4M6WA 4HVCA 3EISA 4EKNB 2Y71A 3CSUA 1TF7A 4PSDA 1CVRA 1QTNA 2DAPA 2GD2A 2EZ8A 2WHRA 4QX6A 1CP2A 4NPHA 3RGWS 3PUXA 1SU6A 4W6ZA 2ZBFA 4CR6A 1E3MA 1QGOA 1QZTA 5IN4A 2X77A 2VF2A 1EMDA 2FQXA 2RHHA 5I7UA 1PD0A 3SMVA 4HDSA 5FPPA 3QNMA 3C41J 3LUGA 2IFTA 3UMVA 4CTJA 1JR3D 3A9VA 3MERA 2FUCA 4AZ0B 821PA 1F8YA 3HSYA 3PHCA 4LDQA 3OIVA 2ZATA 2RBEA 4B84A 5DNCA 2P68A 1LI7A 2RBKA 3D5TA 2W4MA 2GZ1A 2Z8YA 3V32A 1C8BA 2HF8A 1VDMA 1SXIA 3GVPA 4LXUA 3Q0IA 4O4IB 3RJMA 4E6EA 4MPRA 3ONDA 2X9VA 3CLHA 2GCGA 2NU8B 3PDIA 4TT3A 2RMKA 5IZCC 1QH9A 1PT7A 4FFDA 3M33A 1TZKA 2OCXA 4ERNA 5KQPA 1D8AA 3H05A 3OLXA 4BO0A 2R62A 4FHZA 4MVJA 4AJHA 1T9DA 3T61A 5FNZA 2BGMA 2EFEB 5ILQA 2ZJ2A 1YUNA 2JFFA 3FCEA 4H6XA 1E63A 5LZ4A 4YGXB 3H04A 4OGKA 4C3OB 4WOBA 3RVJA 4CGZA 3PVZA 2FDXA 4UOEA 3F1KA 4KNWA 1MH9A 2RKWA 3AFOA 1XNRB 4J8PA 5KX5B 3VBEA 1CUSA 3OWOA 2XWQA 3H9BA 1MO6A 1N3IA 1X74A 4TRMA 3NYWA 5CFRA 3WKBA 1EESA 3QP9A 3NFYA 2WTNA 5CNKA 4NULA 4FZJA 1M8PA 2VQDA 4D1YA 2FDCA 2O2DA 3F7OA 3ZDFA 3B3AA 3ABIA 3KOUA 1DEHA 2PBZA 3KJXA 4MRAA 4F92B 1UKEA 4O25A 1EVZA 2XUZA 3EGCA 3GCWA 4EJSA 3PEYA 1IEQA 1RHUA 1S2MA 1RYFA 4YV7A 1SHUX 4M7WA 4QQFA 4XYBA 2ROQA 3B6IA 2RJ3A 4I4LA 2HRRA 4PIVA 4C03A 5FI3A 2FWRA 1FYXA 3W8DA 4YACA 1KEEA 2IEZA 5JMWA 3RVSA 4OL0A 1L6RA 4LY3A 3V7YA 2IX3A 5BWBA 2E48A 3DCIA 2VUSA 1D2NA 4DLVA 1UODA 2FMUA 3PJRA 1QHIA 4J7CA 1JIXA 4JBHA 5FPTA 2P2GA 3NWEA 3HRIA 3C6MA 3OZEA 2IPXA 4AC9A 3FNGA 5B2EA 3CLSC 3E9EA 4RYDA 4ER0A 4R40A 4X7BA 5BUCA 4DSAA 1HL3A 4DTCA 5K0TA 3AFMA 4PXYA 4I4CA 4MUEA 3VNAA 1GU7A 4GBMA 1YBVA 2BHSA 1F4VA 1XNJA 2ISQA 3BBPA 5H8WA 4ZCTA 1DV1A 1YXMA 2ZJAA 2GN2A 3MTGA 4JELA 3JWIA 4FWTA 4HI0E 2PPVA 4K9LA 4DHWA 1S7CA 2PZMA 1Z68A 1FIUA 4YEDA 4TV8A 1VIAA 2OA0A 2JIZA 3TJMA 2O57A 3M9XA 4V0OA 2JHAA 4AZ3B 5D1HA 2YMLA 2C31A 1NI4B 2RHGB 3K15A 5EHQA 1N8NA 1TMGE 2X8AA 3AB7A 4LSZA 4PO3X 3OE5A 1JZTA 1XVUA 3JQAD 4TMTA 4NX2A 5I9NA 3W8NA 3TNYA 2YQZA 3K70D 3C4VA 1K89A 3KEQA 2CCJA 3DDOA 3N5CA 3S55A 4AKEA 1U5BB 4LHWA 4IIYA 1JJIA 1A3CA 4YJ3B 5I9MA 2KW5A 3N07A 1JFFB 2VO1A 4CQMD 2VDKB 3ZD8A 1EJ0A 1YZGA 2Z2ZA 1EX9A 3ITEA 4RA9A 1K8YB 3Q6MA 3WGMA 3LTNC 1RPZA 2D7CA 1KEWA 2XVYA 1VJ5A 1L5LA 4XDYA 4HZUA 4RSHA 2Y6UA 3OA2A 1HLGA 3U9LA 5BWLA 3MM4A 1CDZA 3VR6D 1Y8QB 1EZ4A 2VQ6A 1QK4A 4F2HA 1J8VA 1ZFNA 3ZHCA 1UJCA 1NOJA 1CZLA 1U3GA 4UNIA 1MJNA 3PJGA 4KO8A 3TMKA 3U3OA 5CA0B 1XVVA 4F6LA 1XU9A 3EVEA 4KE8A 3T9EA 2FDRA 3HBMA 1CRLA 3BD7A 2QGZA 3IELA 3QOFA 5IVIA 4QKQA 1J2TA 1UDWA 2WR8A 1Y48E 4UREA 1T4DA 2VYCA 2H1SA 1H1TA 5D84A 2I3BA 2G9NA 3DDUA 9MHTA 4K2AA 4R2IA 3R0IA 3WO0A 3N2YA 4NG4A 3WQSB 1UBJS 2NO0A 4L6AA 2Z4RA 1V43A 2XXAB 4MHOA 2AFIA 4HNSA 2PHZA 1ODKA 3W7VA 1A71A 1JWBB 2AXPA 4NP6A 5FNVF 3E3NA 1DXYA 3P2YA 1XYGA 5HSGA 1U9JA 3I9FA 1X1QA 2BGKA 3FM9A 1IXYA 3WFZA 1P5HA 3AU9A 1KQGA 5DNUA 4B75A 1JR4A 1WMDA 4E11A 5LM3A 1NKVA 4DHEA 4ZVTA 4ZTUB 2HA6A 2YJ4A 4LMPA 1XZHA 2C2HA 2BHNA 2CCGA 1BX1A 4IF6A 4L4UA 1FFSA 3QUAA 4QFDA 5HK8A 1T3HA 1XF1A 5AHXA 2NNLD 1ZK2A 5CUQA 3E4CA 1PZFA 1G17A 1N5LA 1R6AA 1UK9A 3C24A 4MLDA 3FMPB 5JAUA 4WCFA 4QXAA 1YFZA 3RARA 2O8DA 2Y99A 1V9CA 3VJRA 1CCWA 2Z56A 1NVXQ 4JWTA 1TZBA 3JR3A 1QIGA 5IASA 4OEHA 3HV0A 1XDUA 3FPFA 4D9KA 4ZRDA 4YRIA 1QYVA 4WHMA 4YHHB 3MINB 5E6UA 2PZLA 1B93A 1IVNA 1C1YA 2CXHA 1R7RA 4P3YA 1Z0KA 1L1QA 1MOZA 3AI1A 1JNXX 3NT2A 4IWYA 4Y6SA 1YB4A 1LPPA 3OMXA 2F62A 4XSVA 3UN1A 4DSNA 4YIKA 2R86A 4JASB 4YI5A 3VPDA 1L8AA 4YYZA 3Q8WA 1NURA 4CLDA 3L0CA 2XWJI 3D8UA 5G0UA 2UAGA 4BBJA 5JZ9A 5JLJA 2DY0A 1SHLA 1THMA 1XLTC 2PZBA 2XT0A 5K0CA 3ADBA 3T9DA 3ELYA 4MIOA 1H2YA 3SXJA 3EY9A 2F43B 2XTAA 3GPDG 5KC9A 5E6RA 3AZOA 4PG8A 4A4DA 3NV9A 4FR0A 4AKHA 1EZ1A 1TRKA 2FFBA 1N2ZA 4Z0TA 1JQEA 4PZDA 4DJEC 1WTCA 3KJEA 5B4UA 2JFVA 4FYWA 5FL7D 1F5SA 1SXJD 2GYYA 1LTHR 5F2NA 4RIGA 1QQBA 1OBFO 3H7AA 3JRWA 1GZ5A 5CFOA 4C4PA 4CM4A 1TJ4A 4JUCA 4CCAA 4PIMA 3L4JA 1JHOA 2BEVA 2QNBA 3Q1LA 5CIWA 3D2AA 4LHVA 3U39A 2ZRQA 4NSNA 5KSWB 1IN1A 4W8GA 1VSQA 5EXSA 4DADA 1JR2A 3ZZ1A 2R7KA 3AEYA 3O8OA 1EYZA 5IVHA 3F3MA 3IVCA 1N0UA 2R9VA 3L18A 4C4XA 5BUZA 3WBFA 3EOAI 4YV2A 3C3WA 1J8MF 4XD7D 4DCGA 4MW7A 4LV6A 5CHEA 5DIFA 5DYNA 1NJ8A 5FBLB 4MRMB 2LW7A 1ZK0A 1TX4B 1TMOA 2WJ4A 3I72A 5KCMA 3OOEA 4BNGA 1HUQA 1O1YA 3AHEA 4B85A 1Z35A 3OF5A 1IJKA 5BQ3A 2I4RA 1D5WA 4GRAA 1U3CA 3AY0A 2H9AA 2ZAOA 5FTMA 2BEUB 1Y81A 3MJRA 3U3ZA 3VH2A 3WJ2A 2UZ4A 1P3DA 2AC7A 5JARA 5SV2A 3WIEA 2IY9A 2C2ZA 4N1AA 3UXYA 1JEQB 4KUGA 5KAPA 3GLIE 3HXLA 3WL3A 2O23A 4PQEA 3U56A 2ZJ4A 4AMUA 3C6XA 4MI3A 4GXTA 1CUEA 3K4QA 3F7MA 3TZBA 1QQ7A 2QW8A 1VPVA 5EKSA 3A1WA 4R71A 3TOXA 5AVVA 4H0CA 2CV0A 3NEAA 2PL1A 2ZRBA 4FSXA 3WNDA 2V7VA 3GAMA 2V6FA 3TRHA 3V97A 5BN4A 2DJ5A 4HDKA 4RFLA 4BAZA 1RFLA 1AV7A 4EG0A 4RAOA 1Q0PA 3R3JA 5BP7A 3PG5A 1YWGO 3NRBA 4I4TB 1NKTA 4MLPA 1DU4A 3L93A 4J2TA 5CT9A 5AW2A 4TZ0A 1D9XA 5FOVA 2VK1A 3QVVA 4G1EB 4KIJA 4M37A 3UTCA 2MU1A 1SUBA 1MO5A 2I6GA 2JFWA 4OB6A 4WIAA 3RRFA 4GBGA 5KKAA 3RRZA 2HL6A 4I6JA 4HQLA 4QOFA 5AJZA 1N1MA 1O89A 4TKVA 2J6BA 4QGGA 3ZHBA 2BHTA 2ZGVA 1CU1A 1V1JA 4DNXA 1NNI1 1SKBA 1YMUA 1I10A 4MDHA 1TA9A 3WIDA 5A9SB 4M1YA 2CEAA 4UU1A 1D2RA 3GCGA 4LVCA 2XOEA 1LW6E 3AERB 2O8BA 3V4FA 4QHSA 3Q6NA 2GM5A 4QLAA 5KNLA 2WDZA 2HQBA 3AESA 1FXSA 1F60A 5JHHB 1IQRA 2AMLA 3AO0B 4DA7A 3JX9A 4GECA 3CX3A 3HN7A 1E4VA 4LMAA 3WGIA 1T24A 1M3SA 3WLIA 5JXGA 3OKCA 1I3OA 2F9MA 1U8ZA 4FYIA 3UMYA 1QP0A 1YACA 1C0PA 5JSQA 4DQLA 3ZEIA 4LYAA 4Z0HO 4AY6A 2B25A 2FSFA 3MN1A 3QVGB 3KPJA 4FFPA 4EVQA 3K2EA 1UXGA 4NICA 2QP4A 5DLPA 5AYVA 1LEHA 2R5NA 2OUIA 3L02A 1YDFA 2ZDQA 1XKXA 2CK3D 3ONVA 3VYWA 3N7TA 4KH1A 1U7HA 1KU6A 3FHJA 5FFNA 1FW8A 3RJZA 5D6NA 3ILXA 2BUAA 5ALKA 3U48A 1AUXA 1QTIA 1ZJ6A 2OO5C 2JA2A 4O4JF 5FO0A 3BB3A 1VKZA 4UU0A 4ZALA 5A1JA 2LCQA 2MINA 3SF0A 4A8JC 2EQAA 4FE7A 2PH3A 1FRQA 3F96A 1R8SA 3PRKE 4CEHB 3GNTA 1MIHA 1XL1A 1QYDA 4NNPA 4XXHA 2Y2UA 5DBGA 1AH2A 2XBUA 3GLQA 3T7KA 4BFVA 4XPIB 4JOBA 1KI1A 3VPHA 3LBIA 2E89A 4N5LA 1DGQA 3MW8A 1RD4A 4CM8A 5KO2A 2ZWIA 3S1SA 2GLXA 3IIJA 1M66A 3HADA 1NDHA 4G1CA 4TYPA 1W1IA 2YHUA 1W4BA 3GXBA 2C7RA 5DEIA 2WUGA 4FHGA 2PXCA 3V4VB 4F3RA 3W8EA 721PA 5KTOA 3F5MA 3CVYA 4CTKA 5I9SA 3JQ9C 3DMRA 4WNYA 4GPTA 1R2QA 3G2NA 8LDHA 5A7HA 2AD5A 3PLRA 1XQYA 4WNAB 1N9KA 1E64A 2C5GA 3FZYA 2JJYA 4WLNA 5GGXA 1H66A 1NJ1A 4JENA 2DJIA 4L5YA 1OB5A 4HJXA 4AULA 3LYHA 3N70A 4YRSA 2JAPA 1XV5A 1IXRC 2VTDA 1KC1A 2H2AA 4OQDA 1M6VA 5CFPA 2UU9B 3NDRA 4S1TA 1X8LA 2HXGA 3EIOA 3V4OA 4BATA 5JZVA 1D0IA 3L5KA 1YS7A 4NQRA 2IP4A 4RQTA 1W19A 2Z2YA 3HXOA 1IPHA 2PYZA 2YWBA 2ZYIA 3BF8A 2CYAA 3GFVA 4IVNA 1UK6A 4NAUA 1IPFA 4Q9AA 1KDPA 4Y2GA 4BU0A 2XNSA 4U2DA 1Z28A 4K9PA 3S29A 1E4OA 4HX5A 4B6QA 4DV6B 1XRJA 2ZRLA 3F8SA 4NJMB 2GBCA 1Q77A 1KNQA 1LB1B 2NSJA 3ET5A 1OAKA 4FEEA 3LSTA 5DI3A 5FNVA 3RAJA 4RVSA 3DYVA 4UNQA 4NOKA 3I9LA 1KC3A 3IE0A 2HOQA 4NDAA 2FEMA 4GEGA 4X41A 1NBAA 3KLOA 2FZGA 5GIOE