2K60A

Nmr structure of calcium-loaded stim1 ef-sam
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
GSHMASSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (Stromal interaction molecule 1)
total genus 45
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k60A02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2k60A01
1OXJA 4PZOA 4RQMA 1OW5A 2B6GA 4NL9A 2EAPA 2KG5A 2K4PA 1PK1A 1JI7A 1V38A 2E8NA 5L1MA 3HILA 2Y9TA 2D8CA 2DL0A 2JV3A 1COKA 1Z1VA 1X66A 2KIVA 5KNIA 3BS5B 5J8YC 3H8MA 4NJ8A 4RQNA 2D3DA 4MHVA 4PZNA 2F44A 5JTIA 3TACB 1LKYB 5F3XB 2E8PA 1SGGA 3SENA 2Y9UA 2EANA 2QB0A 1SXEA 3BQ7A 1V85A 2QB1A 1DXSA 2KE7A 1SV4A 2YTUA 4IS7A 2KSOB 2LPEA 1X9XA 2ESEA 3TADA 2KSOA 2F8KA 3IDWA 1WWUA 1X40A 2FE9A 1PK3A 2EAOA 1RG6A 2K60A 5JRTA 2DKZA 1F0MA 3K1RB 2QARB 1WWVA 1UQVA 3SEIA 2ES6A 1SV0A 5JU5A 1KW4A 2GLEA 3TADC 1B0XA 2EAMA 2E8MA 1B4FA 3KKAC 1PK1B 2QB0B 3KKAA 2LMRA 1SV0C 2QKQA 2KMDA 2DKXA 2E8OA 1UCVA 2L5YA 3BS7A 2F3NA 3BS5A 1LKYA 1SXDA 5J8YA 4NL9C 2QARA
chains in the Genus database with same CATH superfamily
1DGJA 1COOA 4M6WB 2BL0C 1DK2A 5KG0A 2BL0B 4MZLA 2E6WA 3DVEA 5FP0A 1B4CA 3T5KA 2LVIA 3RJJA 2W3RA 3RJFA 8ICQA 4L9MA 3OSNA 1TKDA 3TDZA 3I5IB 2LLSA 1LKJA 2LHLA 3JPSA 2QPTA 5KTYA 4HRHA 4EBDA 2ZJ8A 2QEOA 5B5EU 3TUYC 4TUPA 5D46A 1N60A 4RQ5A 2D3DA 3GK1A 3E2EA 3G6XA 4UAVA 3AEVA 2LVKA 1L7MA 3AKBA 1QVIY 4GLXA 3BUNB 1QQ6A 3S0FA 1SIJA 5AKYA 1E8AA 1RJVA 2WC8A 4IQTA 5KU1A 4MLWA 4ECSA 4PHNA 1QATA 4C4RA 4ECVA 3BUWB 4PPXA 3FS7A 1DJYA 1NYAA 1Y1UA 3GOFA 2W9BA 2EHBA 3CR4X 2LM4A 3GIMA 3L4LA 4AOMA 2GV5A 2K7BA 1NPQA 7ICMA 1S6CA 1YX8A 3EK7A 1P7DA 1EJ3A 5HLOA 2D8NA 5EE0A 1KK7Z 1ZQQA 2HHTA 1DRGA 1LV5A 4YGCB 2W04A 2JTTA 3R1VA 1K1SA 4PHEA 4BY4A 3MABA 3LVVA 4CFRA 2G2BA 2J6UA 2BCRA 5CPVA 1L3UA 4YP3A 2BDPA 2H61A 3SAHA 1FFVA 5KFXA 1DC1A 1VJ5A 3DY9A 2NRTA 4AQJA 3PW0A 4I2CA 9ICMA 1NK4A 3EWAA 1N61A 2JEGA 8ICMA 4YGBB 1XSNA 2KYCA 4RQ3A 2HOIA 8ICWA 1QXPA 1XNSA 4M9JA 3E58A 3HKZF 3PM2A 9ICJA 4PL2A 4EENA 2JT3A 4QWCA 1CRXA 3NVZA 3ZDDA 2KFNA 2HSZA 1SL0A 3DVJA 4RPZA 1XC9A 3KO0A 3LLEA 2M9NA 1YVLA 2DGZA 3WKEA 1AJ4A 1SKTA 1OOIX 4O0IA 1SZHA 2PFQA 3ETRA 1OSAA 4UB6U 4O3PA 5KT6A 2D8CA 2JV3A 1UURA 3OB1B 1XSLA 1ZACA 3NSIA 3LK9A 4I28A 4I2FA 1SRAA 2OXOA 1IRJA 1RXVA 2ERBA 1TNWA 1WDCB 4JWMA 5ALKA 3KHLA 3NRZA 4QWDA 3H0MB 2PI4A 4OV2A 1AP4A 1SPYA 2LE9B 2HBJA 4RQNA 1F5SA 3AU2A 4PH5A 3SAGA 1J2NA 3EPGA 3CZTX 5ALQA 8ICUA 4EX6A 9ICTA 1UT5A 5KG2A 4OKHA 1MWNA 2NLNA 2IOFA 3S0EA 4I29A 1JFJA 3AMZA 1SXEA 1X9MA 2WCMA 5KG5A 2A1AA 5AKKA 3PATA 3MR5A 1D9FA 5J0XA 1QCKA 1QWVA 2J6SA 5J2EA 5J0TA 4P5OE 1HEKA 2PALA 5ER5A 4J9QA 2XO7A 1BT6A 2KNEA 3WKAA 2FLPA 1DJWA 4JKTA 2Q91A 3WK4A 1NJZA 2RDJA 4YR2A 2KD1A 1SZPA 1NSHA 5J2KA 2MAXA 4RUCA 2RRDA 2LP3A 5K4LA 1XK4A 5HKYA 3RB3A 3TS5C 1NCYA 4C0KA 1RYSA 5AKEA 1S0VA 2K8MB 1BOCA 2K7DA 5AM1A 4PL1A 4FO6A 3FM9A 8ICNA 3KHRA 3PLFB 1NNLA 1NKBA 4O3OA 3OGUA 4C8LA 2BBMA 2M9GA 3NHTA 2YB1A 3IP4B 4A8EA 1JX4A 1IH0A 1ZQJA 3PSPA 2CXYA 4QIWF 5F9LA 4GXIA 3SIBA 2W03A 2AJQA 3GILA 3C29A 3OHMB 3ZNIA 1SV0C 1DF0A 2ZN8A 4IQUA 4Y2SA 4EYHB 2Y0SF 4CNQA 2OH2A 4DSEA 5DG9A 9ICCA 3WKBA 2P6UA 1BPXA 1TN4A 3B88A 3BZCA 1D1OA 2MJWB 2QEVA 2F2PA 1V97A 1ZD2P 3L47A 1OW5A 3AQEA 3O0FA 2E30A 2I2RE 1QTXA 5TNCA 5BOLA 3GQCA 2PSRA 7ICFA 4F4ZA 2D6FC 4QNLA 5AM2A 5AM3A 2P66A 4B9UA 1S26D 4B6JA 4MRYA 7ICPA 1AVSA 1ZQEA 3OX6A 3I28A 3PMLA 1TUJA 3PN7C 3RZSA 3TANA 2CCMA 1MN8A 4DUQA 3BXKA 5KNIA 5KFUA 3OJUA 4IL6U 2WHEA 5CRXA 2RGIA 3CZ1A 1ZFSA 1OMDA 4F91B 5A0LA 5C0YA 4ORCB 2JT8A 4YRUA 2BZFA 3LVWA 5AFPA 3Q8MA 3D0YB 3EVVA 1D9DA 1HJPA 5EE3A 1ZRNA 3KPXA 3SENA 1IQ3A 3B87A 5B8IB 3D6JA 3V6KA 1PK0D 2G5IB 3DZTA 4F5PA 3BJHA 1YR5A 1PRWA 1KWOB 4JMUA 5EOZA 2WOSA 5J0PA 2K8BB 5L1KA 2BCUA 1S0NA 4O5KA 4GBAA 4F4XA 4O5CA 4FE3A 4U6PA 5KFWA 1RTP1 2KP7A 4YD2A 1V1FA 1RECA 3DD4A 2AGPA 2MA2A 2JEFA 4DS4A 2JPTA 4FBUA 4D1EA 4FZMA 2F3ZA 4UPGA 1DGSA 2JRFA 1QSSA 2LP2A 4F4WA 2CT9A 4OJPA 1ZYQA 2K8AA 4ZOHC 2ASDA 4BJQA 5DQIA 1JBAA 3R9KA 3F45A 4P4PA 2BQ3A 1UHIA 3C21A 1ALWA 2NRXA 4YVZA 3EKJA 5IIOA 2KFHA 1CB1A 3NUQA 4GUKA 1YTZC 1ZQWA 1B0XA 1EG3A 1UHJA 2HBKA 4M2YA 4M47A 2PVBA 3Q8PB 3D2SA 1A77A 1CKKA 4KN7A 2NRVA 2KHNA 1DGUA 3ICBA 1ZQPA 4QJFB 3TAPA 2QKQA 4UB2A 5CSNA 1ZQKA 4EX7A 4DFMA 3N7SC 3DYEA 4C7YA 3S0DA 5ALJA 2B0CA 3JPTA 3D75A 5EE9A 3TS5B 2OS8C 3CTNA 4OO1J 3SR6A 2ZIUB 4YGAA 3GV8B 1S36A 2LI6A 4C4TA 5KFPA 3SS4A 3UQ2A 3PX0A 3OP0A 4FS2A 1UPHA 1J7PA 3H0RB 4Y2PA 2Y4QA 4RZRA 2HOFA 5KG4A 3KZXA 4NDBA 4OJ5A 1LA0A 4I2GA 1KQMC 3PR4A 2JXCA 2WC5A 3FWCA 4KLGA 1T4GA 2B1UA 1F8HA 5HR7A 5CSJA 3TARA 5DICA 3VGOA 3RR7A 1Z3EB 4DCKA 3EPIA 1BR1B 2F44A 3QU9A 3UPQA 3IG5A 1IXRA 1URJA 1Z00B 7ICIA 2H2KA 2NRZA 5ALGA 5ALYA 5DB6A 3KHHA 5KT7A 7ICVA 1X6JA 2I5HA 9ICEA 4BXOA 1MQ1A 2YTUA 3KEVA 2M97A 2A19A 3ETLA 3LYSA 1X6IA 4BY5A 2WCFA 4I2AA 1K9PA 4XRHA 4I5KA 2VIXA 1F4OA 3AL0B 2L4IA 1NOMA 1KSPA 1KN5A 1SL8A 3K1ZA 1V9PA 2BCAA 1IV8A 3HT3A 5KFNA 1SKSA 4E0DA 5AI5A 1PZNA 2WAQF 4RT2A 2FMPA 1SMGA 3GV5B 1DJIA 2C28A 4F8RA 3SMVA 1KQQA 2WCHA 2OEHA 2HHXA 3RJKA 4Z6DA 3I5HB 3NGDA 4UARA 1TIZA 1M46A 3K1EA 4IC9A 3B0XA 1S6JA 1A0PA 2KJ5A 2VA8A 2YQEA 2AGQA 4J03A 2F3YA 3A4UB 3HW8A 3CWGA 3EK8A 2W43A 4DQSA 1T8EA 3KD3A 5DB8A 2MUTA 4O3RA 3SS3A 2G07A 4UB5A 4RUAA 5KL1B 4P4OA 4UATA 1W7JB 1BF5A 2YMQA 2CN1A 3Q8QB 4PZOA 4RQMA 1SR6C 4NL9A 4KMOB 1BPYA 5EWFA 1LVCD 3NSOA 1F71A 4YN4A 4UB1A 4QJ3B 3IRUA 2KKVA 5FYXA 3DF0A 3KTQA 2JT0A 1K96A 3C1VA 9ICRA 3V7KA 2NCPA 3N4MB 1X66A 3BOWB 2KHVA 5ALXA 5KG7A 1J7OA 5G08A 2W9BB 2MHHA 2XCPA 2BHNA 2L98A 2FMQA 3OHAA 5AIAA 3DVMA 1IGVA 1UHKA 5J0RA 9ICXA 5IIMA 1QS7A 3F2BA 5BOMA 5DKRA 3TACB 1ZOTB 3V6HA 1M45A 4DF4A 3NS1A 1J1DA 3ONNA 1U45A 3TZ1A 4QZEA 2QDIA 3NASA 4XYNA 2EDUA 3OHBA 4KITB 1B9AA 1T94A 3BQ7A 1Z1BA 1L2OB 2DQNB 1SV4A 1B22A 1ORGA 2JH1A 1Y1XA 4DL7A 3RJEA 3WHTB 4EZ9A 1F70A 1JSAA 1L5UA 9ICAA 2LMTA 2KSOA 2PI5A 1HQVA 3RJGA 1OZOA 2ZG6A 4PCWA 4YFKA 1K1QA 1NZPA 2Q0ZX 2KTQA 1DJHA 4ED2A 4YR3A 4F7FA 2QARB 2BCXA 3SD7A 4GFTA 4I5LB 1V1GA 4OCIA 1NX1A 5J3XA 1WRLA 3JVTC 2KZMA 1Q80A 3I5GB 1YUSA 4I2BA 1NJYA 3H8SA 2JC2A 5D7FA 3SG4A 2AHOB 1YRTB 1KDHA 2M7LA 4RQ2A 4DEZA 2H8VA 2W9MA 2EAMA 3OTQA 1N62A 1NK0A 3EK4A 1UT8A 2TN4A 3ORYA 1IWQA 1ZQFA 2JOJA 4F5OA 4DL6A 3OBVA 2ZNDA 1K2HA 3BS7A 2HHVA 2WTFA 3KHEA 2C2EA 7ICSA 4DRWA 1OOJA 1LVHA 3O4YA 1Z4NA 2H3QA 4O3MA 3EG5B 3ISBA 2LLTA 1FI6A 1QQ5A 5AK5A 2O6KA 2B21A 2AU0A 2ZIXA 1TK5A 2OHFA 1A75A 4KLDA 4CRXA 2DL0A 4I2EA 1DTLA 9ICOA 8ICPA 4DFKA 1SBJA 3HPOA 4QIWC 1KTQA 3QU7A 4YGDB 3GIIA 1NK9A 5KFKA 8ICZA 3T5HA 3BZKA 1S5LU 4Z6EA 1KWOC 1Z4HA 3QUTA 4FBTA 5EWEA 2L2CA 3UO9A 4DQRA 4QWAA 2OPOA 2PRUA 4ORAB 2LMVA 1WUDA 1ZRMA 2RHFA 5J0OA 4YR0A 4QJ5B 2CRXA 4J9SA 5F3XB 4KYNA 2R18A 4C8NA 4DS5A 1BPEA 5HHIA 4DSLA 3DVKA 3QNMA 1Y88A 2IA6A 2JEIA 4WQ3A 2H3FA 1NZBA 1FW4A 3CGAA 1CMFA 1Y1AA 2LC5A 3I76A 1TCOB 3MR2A 2LUXA 4WQ2A 3ZWHA 2HVIA 2EZZA 1QLNA 4EEKA 4FZLA 2KFZA 2FDRA 1B8CA 5ER4X 5AKHA 1ZD4A 5AERA 7ICNA 2RQ5A 2H61C 4C4SA 3QUQA 4YMNA 4DLEA 1OUQA 1BVSA 3IDWA 1RWYA 1X40A 3QX7A 2VKQA 3M7DA 1ZETA 1UHNA 3UNWA 2ATLA 2WAQC 4RPYA 2VA3A 2KGRA 2P6BB 2K60A 5GTHU 3QXGA 2IHNA 2DKZA 1YUUA 1BNPA 2EH9A 2M1KB 3V6JA 2G5HB 1PVQA 4DSIA 2KLEA 4IJ7A 4DQQA 4DS7A 9ICBA 2BBNA 4INWA 3Q8SB 1GQMA 2I18A 2OYYA 3S6JA 1A6SA 1LXFC 1HIWA 4Y2TA 3UMGA 3TI0A 2IOHA 2K89A 5KFLA 5CJ7A 2DPJA 1A29A 8ICVA 5KFMA 1JXEA 3BUOB 2GLEA 1QJTA 1MA7A 5IBWA 2HHSA 2KIWA 4GC6A 2BPGA 1FPWA 3PV8A 2UVUA 2V4RA 2RLTA 2LM1A 3EW9A 3M6KA 1U9LA 1FFUA 4NLKA 2ALZA 1ZMZA 3BFBA 1K95A 1TAMA 8ICOA 3AU6A 3JTDC 2ZUCA 4KX5A 4ED0A 2BKEA 4JD9A 3WK9A 5J0QA 3LWMA 1MHOA 1QV1A 1WYGA 5J0WA 2F2OA 3S0BA 5KFJA 3PR5B 4EBEA 2M49B 4UB4A 2PFOA 1BGXT 1OXJA 2BQUA 2F77X 2W9AA 2G08A 1Q46A 9ICHA 1LA3A 2KOTA 2EC6B 4Y2UA 1C3YA 8ICGA 2F2AB 3ZDEA 2LAPA 1C20A 3PO4A 4TQRA 1A76A 3PFVA 1QX7A 2FLLA 4QZCA 4DQIA 2JQ6A 3BQ3A 1ZQDA 2BCQA 3LCPC 1DK3A 5CP2A 3DV9A 8ICCA 3RBDA 3PX6A 2K0JA 2BNXA 2H3VA 5AI6A 4F4YA 4J9MA 1KSMA 3NTUA 4BX9C 2PKEA 3I1YA 2K61A 1BPBA 5HHHA 5JOLA 4RT3A 3MGVA 4PZNA 4FS1A 4OZDA 1ZQZA 2HBMA 1EXNA 1D8YA 5CA7A 3NVWA 1OZSA 2BGWA 1DQEA 5ALEA 1M39A 2JZBA 3M9OB 2KQ6A 5AIBA 5AKGA 1L3SA 1O08A 1SSEB 9ICUA 2ISPA 5CSFA 2BQRA 4QWEA 5B66U 1V85A 2QLTA 2QB1A 3IQOA 4BDPA 1LB2B 2LLUA 4NWIA 3CLNA 1FIQA 4RU9A 3L5KA 2JPOA 2KSOB 3H7IA 3SG3A 4ELVA 2ZIUA 4R1EA 5I8NA 4XQ8A 3ZD9A 2OTGC 4M9HA 1OQPA 4K4HA 4YD1A 2JEJA 3SIAA 1OOHA 1U5IB 4DO9A 2KV2A 3K21A 1CDLA 4EEYA 4XUSA 3CNHA 1FO4A 2WORA 3NGVA 3GIJA 1HT9A 1ZQGA 4GIBA 1JMSA 8ICIA 4MF2A 3RM1A 4YG2A 3V7LA 2P35A 4KMUA 4YI9A 4ZCUA 5FI2A 4JWNA 2MAZA 4F93B 3SJSA 1L7PA 3O6BA 2WCLA 3ZDCA 4CF5A 2AQ4A 3ZD8A 3HKZC 2ZKMX 5ALNA 4F50A 5KL8B 9ICQA 4RPXA 1VDVA 2HETA 3HX0A 4UW9A 5ALPA 2NXQA 2AQ0A 2ZXHA 5D4BA 3WK6A 2MBXA 4Y2JA 2FCDA 2VA2A 1UHUA 2KVCA 4Y2VA 1JUDA 5KT5A 2EAPA 1N2DA 1TWOA 3BFHA 4DFDA 9ICNA 2BE4A 4WJ3B 4J9NA 1CFDA 4PHMA 3C5FA 5EWGA 1C7YA 2XI9A 3WKCA 3PW4A 3D76A 3H4BA 3LL8B 3ZI4A 4R64A 7ICLA 1K93D 1M63B 5HNKA 4N1FA 4XJKA 4AP9A 3VRQA 3EYZA 1OOGA 4P0PB 1SCVA 4HYKA 4N1GA 3FAHA 1NJXA 3E0FA 3I5IC 1DJZA 2HHQA 3I5HC 4F2RA 1YZ6A 7ICKA 3RLZA 4O3SA 3MGHA 1PSBA 4JPZB 2O5GA 2ZTCA 2DFLA 4GXKA 7ICRA 9ICPA 1TNPA 1XO5A 1LINA 3ALRA 4PGQA 8ICFA 3S0GA 1C7VA 2RDIA 2QB0A 3RB0A 1DXSA 4NL9C 3O4XA 4PJ0U 4IR1A 1L7OA 4P2HA 3TUYB 5T14A 4DOBA 4PE1A 2YN4A 1WRKA 3NXAA 3H8JA 1Z2CB 2WC6A 4DL3A 5FI6A 1DF0B 4NY8A 1XFYO 1X9XA 2VJ5A 5G5GA 1L8LA 1WWUA 2ODGA 2JULA 3QEBZ 1PVRA 2WF8A 2GGMA 3WK7A 2F8PA 5JRTA 2KI4B 4CPVA 2YMPA 4IR9A 1R2UA 1EL4A 1YUTA 1EH2A 5CWRA 3CR5X 1ZQVA 1H8BA 5IIKA 3JPQA 4HSZA 4A4BA 5KTQA 4ECZA 1X42A 4ED7A 2I94A 4NLCA 4OVNF 2HMXA 2I1QA 3UQ0A 1K9UA 2VJ4A 1DJGA 2AAOA 5AI9A 3QU4A 2LVVA 5J0YA 5DKWA 1XFVO 3KKAC 4M0AA 1PK1B 5ALSA 1CM1A 5ALWA 2WF6A 5KFFA 5IIJA 5KFZA 4M6WA 2W9CA 4M9GA 4QZFA 2GO7A 2LMRA 2PMZF 4GGFC 8ICKA 2H3ZA 4ECXA 1EXRA 5IIIA 4FQTA 2JZIA 2HBLA 3CZ2A 3THVA 1LKYA 2WF5A 3V72A 5D69A 3TQ1A 4DL4A 1IQ5A 3FC4A 2P70A 4XA5A 2HW3A 2WCEA 4QZ9A 5KFDA 4C0LA 2KAXA 3M8RA 1OMRA 2PFPA 2F1IA 5J2JA 2FJYA 4GC7A 1N48A 1TK0A 1JRPA 3PMNA 3D74A 5I94A 4KLEA 2L50A 3F5AA 3HILA 4J9RA 8ICSA 2XGPA 1AQ6A 1YX7A 1XFZO 4B9LA 2OCEA 1RQNA 1S76D 3KF9A 5K89A 2MRLA 2AMIA 2A1JB 3QYPA 3CRXA 3BUXB 2V4QA 1ZQHA 2JGAA 2ISDA 3TDUA 3Q8KA 3UXPA 1QQ7A 1GJYA 5AKZA 1RFJA 5GQQC 1CMGA 1A4PA 1QVIZ 3E3RA 4KLJA 2WCBA 1GGWA 4YBHB 1KCYA 4F72A 1RZTA 4JQ0D 3WNXB 2JTZA 1J7QA 7ICJA 2W8LA 5DLFA 1SW8A 4RQ1A 2E8PA 3DEEA 1SGGA 4F5QA 4P2YB 4DSJA 1S5GZ 4ED8A 5AM5A 3PVXA 4MF8A 5AKXA 4QZGA 1J97A 5L1IA 3PSFA 2FPLA 4IS7A 4IRDA 1T7PA 5ALFA 4UAWA 3D2QA 8ICXA 1A2XA 1CFFA 3D10A 4M2OA 2FE9A 1S5GY 2R8KA 3HRDD 1ZQTA 2PFNA 4IQWA 2VRGA 4NQGA 4KTQA 1JC2A 3CS1A 2LYHA 4PALA 3SG2A 4AQIA 2MRDA 4F2SA 2ZJAA 3M8SA 4IRKA 1AROP 2JXLA 5KT2A 1S3PA 3K4GA 2Z7JA 1CFPA 1CDNA 1YVHA 4YXJA 1KK8C 5JU5A 1KW4A 2SCPA 4J9OA 1BJFA 1T14A 2LNKA 3MBYA 1H38A 3OX5A 2IOFK 1KK7Y 3IV6A 5J2GA 4JWQA 4CE6A 3Q8LA 1X9SA 3MC1A 3C1YA 5ALMA 5ALUA 4F71A 5HKWA 1MF8B 1QLKA 4Q04A 3WKDA 5PALA 4O3QA 4YXMA 8ICAA 2WFAA 2E5SA 4OD0A 4JUZA 2CNPA 3GFKB 3M0WA 1KEJA 4M9NA 1ECWA 3H4DA 4B9SA 1FF1A 1YURA 4BWJA 4US8A 2Q4TA 3QU5A 5HR6A 3LK0A 2KK0A 5AHXA 1JWDA 2B6GA 2KJ8A 2M29A 3PW5A 4KLTA 1TK8A 5L1MA 1BODA 3PNCA 1BNOA 3QU2A 3C2KA 2F1JA 4UASA 1B43A 2UVRA 1SL7A 4JV1A 2JMGA 5EL2A 5J29A 4ELUA 1A03A 5DG8A 3NSLA 5DBAA 4KLOA 2NO4A 2K4HA 2HI0A 1DMOA 3D73A 3AAJA 1YZ7A 1FBVA 4PHPA 1KFXS 2LBOA 1VRKA 1TOPA 1XFRA 3H8MA 2DPIA 2A1JA 1XFXO 4DOCA 2QEBA 1VLBA 5AKLA 1ZQIA 1CTRA 1CNPA 3A0HU 4QZDA 4UBCA 1TUZA 1SYMA 8ICLA 4XJKB 4HREE 3B9JA 5KFYA 1NKEA 2KBIA 5AICA 1DEKA 1Z4OA 4MFAA 4ECUA 5DBBA 2EZXA 2MU2A 3PY8A 4USLA 5AI8A 3SI8A 1F44A 2C2RA 5DDYA 2P6RA 3PZPA 5KFCA 3PSTA 3L4AA 3TADA 2BR0A 3O78A 4YGEB 3S0AA 2W7PA 1R6PA 3UXNA 4HAIA 4P0QA 2AGOA 2Y1JA 3D78A 4MRXA 2YMLA 2DWQA 3K1RB 3HP6A 4KLLA 2KBMA 3FE6A 1GO3F 1MSWD 3SV4A 4ECRA 1ZQNA 3N97B 2PQLA 1D8BA 2G06A 4IQVA 1MQ2A 5IILA 2HHUA 2XY5A 1RYRA 2KQYA 4PHAA 4QZ8A 1XSPA 1UHHA 1U47A 2BCBA 2FOTA 5F9NA 3PO5A 4GFJA 5KFEA 4DSKA 1L8OA 1KFTA 2CTNA 3TADC 2GH1A 1IKUA 1AK8A 5CB1A 1L7NA 1Q8KA 2ZNEA 5I2QA 2ZIWA 3KKAA 3RRHA 4KLHA 9ICLA 4QWBA 4Y2RA 1ZD3A 1U4BA 1CEZA 3IN5A 2JWWA 4KLSA 5KFSA 2KLDA 7ICTA 3EZ5A 1RXWA 4N5XA 2LKYA 2BDUA 4ECTA 4O5EA 3TFSA 1QLSA 8ICBA 4PT1A 4M9LA 1W9ZA 5TZVA 3GV7B 1BMOA 2Y0SC 1X9WA 1CLBA 2M0RA 2OWOA 3C23A 1BU3A 2WB1F 3L4PA 1UA0A 5J2DA 3K75D 4MFFA 4FQOA 2C2DA 5TISU 1W7IB 2HQWA 2M8UA 2BKHB 1PULA 5BPCA 3I5FB 1X2IA 4RNOA 1ZQCA 2KSPA 3RH5A 5DKNA 4M2PA 4GPLB 2XVTA 2JH7A 5KG6A 1JALA 4DFPA 2LM5A 3NVVA 9ICGA 1YT3A 1CI4A 3RH4A 2OS8B 3TKAA 1J2MA 4OR9B 1TAQA 2DOQA 3BQTA 2JNFA 3OB2B 1YRUB 1GM0A 3LDAA 1KL9A 3C28A 3EKHA 1Y0VH 4OJ6A 3VRPA 3A8RA 1ZJNA 2YY6A 2AH5A 3MR3A 1XO0A 2KEYA 2XIDA 1KKXA 4FTGA 2WCJA 1WLZA 2KZZA 1N65A 1DELA 4C7ZA 3BJYA 4B9MA 3SAFA 3A0BU 4F92B 2BCSA 2WCKA 2PYQA 4NDDA 5HLVA 2J6TA 5DQHA 1ED1A 2JNXA 4ICAA 2I6XA 9ICKA 3MSEB 2F8KA 8ICTA 3I5FC 1G4YR 1NIWA 3L3FX 2COLB 1KQVA 2MLEC 2W9CB 5DG7A 2VANA 4DL2A 3JPOA 2NV3A 3H8WA 4R63A 1NK6A 1ZJMA 4NDCA 3ISCA 2E1FA 4PGYA 4PHKA 2PMYA 2Q4UA 4G9BA 4MZKA 3C1ZA 4OJLA 3I5GC 3RJHA 1ZQ1C 3Q8RB 2ASJA 4QW8A 1B8LA 4UB8U 1ZQMA 2ZIVB 3UM9A 1B4FA 4R8UB 2ZIXB 1NK7A 1KLNA 2FJUB 2QB0B 2L0PA 3ZDBA 1WDCC 1WY9A 5KT4A 3BDPA 5GTIU 4CLNA 3H40A 2Y1NA 9ICFA 1QX5B 3CYMA 1NK8A 2F3NA 5I2LA 4Y2XA 3J81j 1B7TZ 2QARA 4NM2A 3ZDAA 4Q45A 2YX8A 2KJ9A 3KOOA 3GIKA 1ZQLA 1F4QA 3CZ0A 1ZUZA 1U49A 2ZUDA 1AHRA 1JI7A 1FI5A 2EZYA 3IVTA 1O03A 3BFAA 3VRNA 1B7TY 1JIHA 2BPCA 1ODBA 2GGZA 2ISOA 1B1GA 2PMZC 3QMEA 2KIVA 4ED3A 1NX0A 3RRGA 4MFCA 3RTVA 2F76X 1ZQOA 1NX3A 1F54A 3D0YA 4IRCA 3RB4A 3QZ7A 3QRXA 5HYDA 1IIPA 3KZIU 3QUCA 5AK6A 1CUKA 2BECA 1QH9A 2NYVA 4Y2QA 1FEZA 4UQGA 1NX2A 1XVJA 3VC8A 2LMUA 2LV7A 4U8DA 5AXIA 3EVRA 2KHQA 3M6ZA 2R8GA 1QIVA 3OSPA 1NUBA 2F33A 2XY6A 1X02A 2GTEA 3HJEA 3T5JA 3UMBA 1L3TA 4PE0A 2ZFDA 2WF9A 1QX2A 1KK8B 3UMCA 1N2XA 5L1LA 3SZ2A 1ZXIA 5G5HA 2G0AA 2W54A 2KFFA 2KGBC 4LZDA 3QEAZ 1KRPA 2H5XA 4QJ4B 1CFCA 3V7JA 1IM4A 2FMSA 1L3VA 3AAKA 3ISDA 4MBEA 4YCXA 4K4GA 2K4EA 2K2AA 5E79U 7ICQA 3MDAA 1CM4A 3C2MA 3C5GA 1L6NA 3PN7B 4QW9A 3RAQA 3RF9A 2OTGB 1SWVA 4YMMA 4CGZA 2XY7A 1RQLA 4DSFA 1JROA 4DCCA 3KBBA 5HMMA 1WCLA 4DFJA 1IG5A 3BYAA 2KYFA 2ZTDA 9ICIA 1RROA 4I5NB 4Q8EA 2LYBA 4M2QA 2KMDA 1MUXA 1Q3VA 4JB3A 1UCVA 2Y5IA 4F5NA 4FZNA 2NRWA 5HL1A 3JPRA 3CDNA 1WRZA 5KG1A 1JF0A 4CF3A 3BOWA 3UXOA 3EVUA 2HDOA 4JV2A 1BR4B 2KG5A 5J2IA 2K4PA 2OM6A 3BQ0A 3PW7A 2M1UA 2ZXIA 1PK1A 1SK6D 4ICBA 2E8NA 2IS9A 4GNKB 4NM1A 3PSRA 2Y9TA 2XCAA 1TE2A 5KFTA 3R1OA 2W55A 2WNDA 1C3ZA 5AK3A 1Z1VA 4DOAA 2XICA 2MLFC 4JK1A 4CIDA 4KLMA 5EE1A 5J0SA 8ICYA 2M3WA 3VCBA 7ICGA 3GU3A 5CSIA 2W11A 2R2IA 3N7PD 2HOQA 5ALRA 4C8OA 4DQPA 4MHVA 4Q44A 4I5JA 3DDHA 1S1EA 3PJIA 4OCZA 1RPLA 1CLLA 1TNXA 1SY9A 4AYBC 1DJXA 3JTDB 3SG5A 4FFDA 1GGZA 5I2OA 4I2DA 1OOFA 1ZQUA 3FYHA 2P71A 4TURA 5KFGA 2V53A 1BG1A 1OE9B 5D3OA 1K5OA 2LPEA 5AM4A 1TRFA 4GGNA 4WRIA 4DL5A 1JF2A 2KPHA 1C7WA 3AM9A 3FIAA 2KI6C 4KN4A 2BCVA 4INXA 3M1YA 4HRGA 1TAUA 2ZIWB 5ALTA 5CR0A 5D49A 1UA1A 4MN0A 5FI7A 1L2OC 1Z19A 1F0MA 2W7OA 3IM1A 5KFBA 1KSOA 4PE7A 1WWVA 1OMVA 1NK5A 3BQ1A 1UQVA 4DF8A 4YMOA 4BUGA 4B9VA 1CDMA 5KFQA 1MXLC 1N56A 4OJOA 4PGXA 2ES6A 2I7AA 1IJ6A 1SV0A 1SL9A 2F8LA 3RJIA 1XFUO 5KFIA 4CCHA 4EZ6A 3QUBA 1J7RA 4M04A 4P4MA 4A4CA 2JRZA 1UP5A 2YB4A 1PSRA 3DF0B 5DB9A 1Y6WA 2XGQA 4ZCVA 3H4SE 2KNJA 1KQMB 4Z6CA 3CR2A 4ZH4A 2L5YA 3RR8A 4US9A 3OJSA 1MR8A 2KDHA 1BPZA 1G33A 1UUSA 2ZIVA 2NCOA 2K4IA 5AK4A 5KFVA 4DIRA 1ALVA 3F2DA 3T5LA 4Q8FA 4LJXA 2R8HA 2MA1A 2Y1MA 1PUZA 4UAYA 1J1EA 5CEHA 1V38A 4BXOB 4JV0A 3M9MB 2ZN9A 4J9LA 3D2NA 4KX3A 1CDPA 3LWLA 1SL2A 4KLQA 2F1HA 1S0MA 3SG7A 4C8KA 2K7CA 3IHQB 1S10A 3B86A 1J55A 2DF4B 4ACOA 1NKCA 3JPPA 1N5XA 3HWTA 4QZAA 2O60A 4RQ7A 3BS5B 2IHMA 1ZD5A 4BWMA 1ZQYA 2JR5A 1A75B 5J8YC 1NCZA 4PHDA 2SASA 4ORBB 2ZRTA 1XYDA 3EUB2 3HX4A 4GXJA 1AJ5A 5J2FA 5KT3A 1SCMC 2KFGA 4Y2YA 1ZOLA 2Y1IA 4F3OA 3FE9A 1M31A 5CHGA 3GDXA 4ECQA 1XK4C 5ALIA 1AUIB 1WLMA 1RDFA 2NZ0A 2JZBB 2KE7A 4MZJA 1RK9A 4I27A 5JJGA 2DUYA 2KVSA 5J2AA 5KFOA 3HCMA 3R1PA 1HUZA 1IIOA 1N0YA 2ESEA 2WF7A 5C5JA 1QSLA 3F5EA 1G8IA 2MUTB 5F6TA 1KFDA 5KFRA 4ELTA 2W8KA 2L5XB 3QE9Y 7ICOA 4K4IA 1K94A 1RG6A 4MEWA 1NI3A 1QIWA 1XFWO 2KAYA 3PM8A 2DBYA 4B9NA 4P0QB 2KI4C 4AYBF 4C8MA 5KAFU 4TUQA 2BPFA 2EGDA 3IF7A 2K7OA 2UVWA 2MSNA 2M7NA 1PVPA 4ED1A 2HF5A 2JHDA 3O2PA 1SCMB 2H3IA 3PSIA 5L9XA 4I2HA 1BPDA 9ICWA 3F2CA 3GK2A 4RNMA 2G09A 2KI6D 8ICRA 1D8LA 5DGAA 3FE8A 4GAOA 2E8MA 2BAPA 4BGDA 2HPSA 1U5IA 4QZIA 3VB1A 5J2BA 1JXLA 5KFHA 3NSKA 2GOLA 3NVYA 4R66A 5ALLA 3T79A 4IL1A 3PW2A 2DKXA 4F4KA 4RNNA 1SXDA 1XU4A 5ALVA 4J9KA 1K9KA 2KICA 2LVJA 3F53A 4U7CA 2QEHA 2EQYA 2JU0A 3G6VA 2JXJA 1SWWA 3ED5A 1ZQSA 4UAZA 3VROA 2QACA 1KFUS 4EYIB 3PX4A 1TV9A 1T3QA 1WG8A 1KFXL 1NJWA 1OW4A 3DXLA 1S97A 4I2JA 1NCXA 1SKWA 1N63A 2N1RA 5DBCA 4NXZA 1JN3A 1N5WA 3MFIA 3CP8A 4LZGA 4NLNA 3N7HA 5ALDA 3SV3A 2KN7A 4QZBA 4C0JA 1SR6B 2G9BA 2ZTEA 1C07A 2L2EA 2LHIA 3NHIA 2FCEA 1LKYB 4B9TA 4QZHA 4UBBA 1DOQA 3FDSA 4EBCA 1CLMA 1QASA 3OPXA 4C0ZA 4R65A 2EC6C 3BQ2A 2Y9UA 3SYZA 2AUCA 2HHWA 4UB3A 2EANA 2KAVA 1EG4A 1QTMA 3WK5A 2KZ3A 7ICEA 3RFAA 1JFKA 1L7ZA 4DWIA 4X5VA 1PVAA 2I9GA 1XS9D 5AANA 3SQIA 4P0PA 5HP4A 4RQ4A 1K90D 4YQWA 3D77A 1PVBA 1S6IA 1IG6A 5KAIU 4MVFA 4MSPA 3TAQA 1KFSA 2EAOA 5ALZA 4C80A 3TFRA 1S77D 1HUOA 2ZUBA 8ICEA 1TCFA 2E3TA 5AI4A 3B6XA 4GGFA 3G6YA 2IBKA 1T3NA 1P28A 8ICHA 4ETOA 2L4HA 1KBUA 3SEIA 5AKIA 1TFRA 3N7RC 5KFAA 3WU2U 3KFUF 3RB6A 1M6YA 4NLGA 2R8IA 3H0LB 1DVIA 4RQ0A 3U26A 4NV0A 7ICHA 2XC9A 2KOBA 5ALHA 5DDMA 3AKAA 4PHJA 3LK1A 3TDIA 2PASA 1ZQBA 2NO5A 2BKIB 5J2HA 5DGBA 4ED6A 4R8UA 2CBLA 4Q43A 4CF4A 1F55A 2LCPA 4RQ6A 1RM6C 2BE6A 2UVVA 5L1JA 3FWBA 1TTXA 4ECYA 4TUSA 3RH6A 2RP5A 3QZ8A 3ICXA 4O9MA 3V2LA 4EELA 3C2LA 1WCNA 4CFQA 1TVAA 3T3FA 4NLZA 1PALA 3WK8A 5J0UA 1DT7B 1JUOA 2IMWP 5DB7A 4YI8A 2FPMA 1COKA 2LHTA 1BLQA 2PXIA 2ASLA 4CDGA 2GWSA 5AKJA 1SL1A 2K2FA 5KG3A 3RBEA 4MEYA 5HKZA 4F5RA 2LUCA 4E68A 4TNCA 3IQQA 4KLIA 1QV0A 3NRWA 4NJ8A 4Z6FA 3R72A 3SG6A 1NWDA 2ZJ5A 2A3VA 8ICJA 4G3IA 1RYUA 4UAUA 5JTIA 2HVHA 3B7AA 5KSZA 1ZQXA 2LYAA 4RQ8A 1SB3C 3CW2C 3SS5A 3KHGA 1S9FA 3MDCA 2W3SA 3WHUB 4PE4A 1UWOA 2C22A 2L51A 3VRRA 4PDZA 5J2CA 4J9PA 5AI0A 1NP8A 1ZQAA 2HCFA 2A4JA 5IINA 1S0OA 3AN1A 3OGNA 4ECWA 2HQ8A 4I2IA 1TNQA 3PALA 1K8UA 4F0ZB 5DLGA 1S8OA 5JUMA 3GZFA 2FLNA 1PK3A 3RAXA 2CXJA 1MQ3A 2FI1A 1LS8A 3AUOA 1XA5A 2AXTU 5AM0A 1DGVA 1SNLA 4KLUA 1XO1A 3CYZA 2V9WA 5DKQA 2K8CB 1Q3UA 3JPNA 3M9NB 1MC8A 2FPKA 4USAA 1SKRA 3JVTB 5AEQA 3MR6A 5ALOA 4TQSA 5BPJA 3B0YA 1U48A 7ICUA 2LANA 1ZQRA 3MGIA 9ICSA 2CPRA 3IG8A 5DQGA 3CABA 4NLBA 4MEXA 2KKPA 5HMLA 3BUMB 1H4BA 3GK4X 1Z00A 5H2FU 1QSYA 1XWLA 2R8JA 1IJ5A 1B47A 2E1EA 2E8OA 4DLGA 2ZRSA 2M0NA 3AQFA 3WXAA 3BS5A 2YGUA 1MXEA 9ICVA 5J8YA 1B8RA 2YMMA 2WB1C 2FJ6A 3N28A 4LVSA 1KFUL 3Q8IA 3MFHA 4KLFA 4O3NA
chains in the Genus database with same CATH topology
1OXJA 4PZOA 4RQMA 1W9ZA 1OW5A 2B6GA 4NL9A 2EAPA 2KG5A 2K4PA 1PK1A 1JI7A 1V38A 3SS4A 2E8NA 5L1MA 5I94A 3HILA 2Y9TA 3IVTA 2D8CA 2DL0A 2JV3A 1COKA 1Z1VA 1X66A 2BNXA 2KIVA 5KNIA 3BS5B 1Z4HA 5J8YC 3H8MA 4NJ8A 3UO9A 4RQNA 2D3DA 4MHVA 4PZNA 4I5JA 2F44A 5JTIA 3TACB 1LKYB 3SS5A 5F3XB 4KYNA 2E8PA 1SGGA 3SENA 1DEKA 2Y9UA 2EANA 2QB0A 1SXEA 3BQ7A 1V85A 2QB1A 1DELA 1DXSA 3O4XA 2KE7A 1SV4A 2YTUA 3KEVA 4IS7A 1Z2CB 4GBAA 5D3OA 2KSOB 2LPEA 5FI6A 1X9XA 2ESEA 4I5KA 3TADA 2KSOA 2F8KA 4JKTA 3IDWA 1WWUA 1X40A 2FE9A 3UNWA 1PK3A 2EAOA 4MEWA 1RG6A 5FI7A 2K60A 5JRTA 2DKZA 1F0MA 3K1RB 2QARB 1WWVA 1UQVA 4I5LB 2KLEA 4IJ7A 3SEIA 2ES6A 1SV0A 5JU5A 1KW4A 5FI2A 2GLEA 3TADC 1B0XA 1DC1A 2EAMA 4GAOA 2E8MA 2BAPA 1B4FA 3KKAC 1PK1B 2QB0B 3KKAA 4I5NB 2LMRA 1SV0C 2QKQA 2KMDA 3OBVA 2DKXA 2E8OA 1UCVA 2L5YA 3BS7A 2F3NA 3PM2A 3SS3A 3BS5A 1LKYA 1SXDA 2YGUA 2KLDA 5HL1A 5J8YA 4NL9C 2QARA 3EG5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXJ A;  4PZO A;  4RQM A;  1OW5 A;  2B6G A;  4NL9 A;  2EAP A;  2KG5 A;  2K4P A;  1PK1 A;  1JI7 A;  1V38 A;  2E8N A;  5L1M A;  3HIL A;  2Y9T A;  2D8C A;  2DL0 A;  2JV3 A;  1COK A;  1Z1V A;  1X66 A;  2KIV A;  5KNI A;  3BS5 B;  5J8Y C;  3H8M A;  4NJ8 A;  4RQN A;  2D3D A;  4MHV A;  4PZN A;  2F44 A;  5JTI A;  3TAC B;  1LKY B;  5F3X B;  2E8P A;  1SGG A;  3SEN A;  2Y9U A;  2EAN A;  2QB0 A;  1SXE A;  3BQ7 A;  1V85 A;  2QB1 A;  1DXS A;  2KE7 A;  1SV4 A;  2YTU A;  4IS7 A;  2KSO B;  2LPE A;  1X9X A;  2ESE A;  3TAD A;  2KSO A;  2F8K A;  3IDW A;  1WWU A;  1X40 A;  2FE9 A;  1PK3 A;  2EAO A;  1RG6 A;  2K60 A;  5JRT A;  2DKZ A;  1F0M A;  3K1R B;  2QAR B;  1WWV A;  1UQV A;  3SEI A;  2ES6 A;  1SV0 A;  5JU5 A;  1KW4 A;  2GLE A;  3TAD C;  1B0X A;  2EAM A;  2E8M A;  1B4F A;  3KKA C;  1PK1 B;  2QB0 B;  3KKA A;  2LMR A;  1SV0 C;  2QKQ A;  2KMD A;  2DKX A;  2E8O A;  1UCV A;  2L5Y A;  3BS7 A;  2F3N A;  3BS5 A;  1LKY A;  1SXD A;  5J8Y A;  4NL9 C;  2QAR A; 
#chains in the Genus database with same CATH topology
 1DGJ A;  1COO A;  4M6W B;  2BL0 C;  1DK2 A;  5KG0 A;  2BL0 B;  4MZL A;  2E6W A;  3DVE A;  5FP0 A;  1B4C A;  3T5K A;  2LVI A;  3RJJ A;  2W3R A;  3RJF A;  8ICQ A;  4L9M A;  3OSN A;  1TKD A;  3TDZ A;  3I5I B;  2LLS A;  1LKJ A;  2LHL A;  3JPS A;  2QPT A;  5KTY A;  4HRH A;  4EBD A;  2ZJ8 A;  2QEO A;  5B5E U;  3TUY C;  4TUP A;  5D46 A;  1N60 A;  4RQ5 A;  2D3D A;  3GK1 A;  3E2E A;  3G6X A;  4UAV A;  3AEV A;  2LVK A;  1L7M A;  3AKB A;  1QVI Y;  4GLX A;  3BUN B;  1QQ6 A;  3S0F A;  1SIJ A;  5AKY A;  1E8A A;  1RJV A;  2WC8 A;  4IQT A;  5KU1 A;  4MLW A;  4ECS A;  4PHN A;  1QAT A;  4C4R A;  4ECV A;  3BUW B;  4PPX A;  3FS7 A;  1DJY A;  1NYA A;  1Y1U A;  3GOF A;  2W9B A;  2EHB A;  3CR4 X;  2LM4 A;  3GIM A;  3L4L A;  4AOM A;  2GV5 A;  2K7B A;  1NPQ A;  7ICM A;  1S6C A;  1YX8 A;  3EK7 A;  1P7D A;  1EJ3 A;  5HLO A;  2D8N A;  5EE0 A;  1KK7 Z;  1ZQQ A;  2HHT A;  1DRG A;  1LV5 A;  4YGC B;  2W04 A;  2JTT A;  3R1V A;  1K1S A;  4PHE A;  4BY4 A;  3MAB A;  3LVV A;  4CFR A;  2G2B A;  2J6U A;  2BCR A;  5CPV A;  1L3U A;  4YP3 A;  2BDP A;  2H61 A;  3SAH A;  1FFV A;  5KFX A;  1DC1 A;  1VJ5 A;  3DY9 A;  2NRT A;  4AQJ A;  3PW0 A;  4I2C A;  9ICM A;  1NK4 A;  3EWA A;  1N61 A;  2JEG A;  8ICM A;  4YGB B;  1XSN A;  2KYC A;  4RQ3 A;  2HOI A;  8ICW A;  1QXP A;  1XNS A;  4M9J A;  3E58 A;  3HKZ F;  3PM2 A;  9ICJ A;  4PL2 A;  4EEN A;  2JT3 A;  4QWC A;  1CRX A;  3NVZ A;  3ZDD A;  2KFN A;  2HSZ A;  1SL0 A;  3DVJ A;  4RPZ A;  1XC9 A;  3KO0 A;  3LLE A;  2M9N A;  1YVL A;  2DGZ A;  3WKE A;  1AJ4 A;  1SKT A;  1OOI X;  4O0I A;  1SZH A;  2PFQ A;  3ETR A;  1OSA A;  4UB6 U;  4O3P A;  5KT6 A;  2D8C A;  2JV3 A;  1UUR A;  3OB1 B;  1XSL A;  1ZAC A;  3NSI A;  3LK9 A;  4I28 A;  4I2F A;  1SRA A;  2OXO A;  1IRJ A;  1RXV A;  2ERB A;  1TNW A;  1WDC B;  4JWM A;  5ALK A;  3KHL A;  3NRZ A;  4QWD A;  3H0M B;  2PI4 A;  4OV2 A;  1AP4 A;  1SPY A;  2LE9 B;  2HBJ A;  4RQN A;  1F5S A;  3AU2 A;  4PH5 A;  3SAG A;  1J2N A;  3EPG A;  3CZT X;  5ALQ A;  8ICU A;  4EX6 A;  9ICT A;  1UT5 A;  5KG2 A;  4OKH A;  1MWN A;  2NLN A;  2IOF A;  3S0E A;  4I29 A;  1JFJ A;  3AMZ A;  1SXE A;  1X9M A;  2WCM A;  5KG5 A;  2A1A A;  5AKK A;  3PAT A;  3MR5 A;  1D9F A;  5J0X A;  1QCK A;  1QWV A;  2J6S A;  5J2E A;  5J0T A;  4P5O E;  1HEK A;  2PAL A;  5ER5 A;  4J9Q A;  2XO7 A;  1BT6 A;  2KNE A;  3WKA A;  2FLP A;  1DJW A;  4JKT A;  2Q91 A;  3WK4 A;  1NJZ A;  2RDJ A;  4YR2 A;  2KD1 A;  1SZP A;  1NSH A;  5J2K A;  2MAX A;  4RUC A;  2RRD A;  2LP3 A;  5K4L A;  1XK4 A;  5HKY A;  3RB3 A;  3TS5 C;  1NCY A;  4C0K A;  1RYS A;  5AKE A;  1S0V A;  2K8M B;  1BOC A;  2K7D A;  5AM1 A;  4PL1 A;  4FO6 A;  3FM9 A;  8ICN A;  3KHR A;  3PLF B;  1NNL A;  1NKB A;  4O3O A;  3OGU A;  4C8L A;  2BBM A;  2M9G A;  3NHT A;  2YB1 A;  3IP4 B;  4A8E A;  1JX4 A;  1IH0 A;  1ZQJ A;  3PSP A;  2CXY A;  4QIW F;  5F9L A;  4GXI A;  3SIB A;  2W03 A;  2AJQ A;  3GIL A;  3C29 A;  3OHM B;  3ZNI A;  1SV0 C;  1DF0 A;  2ZN8 A;  4IQU A;  4Y2S A;  4EYH B;  2Y0S F;  4CNQ A;  2OH2 A;  4DSE A;  5DG9 A;  9ICC A;  3WKB A;  2P6U A;  1BPX A;  1TN4 A;  3B88 A;  3BZC A;  1D1O A;  2MJW B;  2QEV A;  2F2P A;  1V97 A;  1ZD2 P;  3L47 A;  1OW5 A;  3AQE A;  3O0F A;  2E30 A;  2I2R E;  1QTX A;  5TNC A;  5BOL A;  3GQC A;  2PSR A;  7ICF A;  4F4Z A;  2D6F C;  4QNL A;  5AM2 A;  5AM3 A;  2P66 A;  4B9U A;  1S26 D;  4B6J A;  4MRY A;  7ICP A;  1AVS A;  1ZQE A;  3OX6 A;  3I28 A;  3PML A;  1TUJ A;  3PN7 C;  3RZS A;  3TAN A;  2CCM A;  1MN8 A;  4DUQ A;  3BXK A;  5KNI A;  5KFU A;  3OJU A;  4IL6 U;  2WHE A;  5CRX A;  2RGI A;  3CZ1 A;  1ZFS A;  1OMD A;  4F91 B;  5A0L A;  5C0Y A;  4ORC B;  2JT8 A;  4YRU A;  2BZF A;  3LVW A;  5AFP A;  3Q8M A;  3D0Y B;  3EVV A;  1D9D A;  1HJP A;  5EE3 A;  1ZRN A;  3KPX A;  3SEN A;  1IQ3 A;  3B87 A;  5B8I B;  3D6J A;  3V6K A;  1PK0 D;  2G5I B;  3DZT A;  4F5P A;  3BJH A;  1YR5 A;  1PRW A;  1KWO B;  4JMU A;  5EOZ A;  2WOS A;  5J0P A;  2K8B B;  5L1K A;  2BCU A;  1S0N A;  4O5K A;  4GBA A;  4F4X A;  4O5C A;  4FE3 A;  4U6P A;  5KFW A;  1RTP 1;  2KP7 A;  4YD2 A;  1V1F A;  1REC A;  3DD4 A;  2AGP A;  2MA2 A;  2JEF A;  4DS4 A;  2JPT A;  4FBU A;  4D1E A;  4FZM A;  2F3Z A;  4UPG A;  1DGS A;  2JRF A;  1QSS A;  2LP2 A;  4F4W A;  2CT9 A;  4OJP A;  1ZYQ A;  2K8A A;  4ZOH C;  2ASD A;  4BJQ A;  5DQI A;  1JBA A;  3R9K A;  3F45 A;  4P4P A;  2BQ3 A;  1UHI A;  3C21 A;  1ALW A;  2NRX A;  4YVZ A;  3EKJ A;  5IIO A;  2KFH A;  1CB1 A;  3NUQ A;  4GUK A;  1YTZ C;  1ZQW A;  1B0X A;  1EG3 A;  1UHJ A;  2HBK A;  4M2Y A;  4M47 A;  2PVB A;  3Q8P B;  3D2S A;  1A77 A;  1CKK A;  4KN7 A;  2NRV A;  2KHN A;  1DGU A;  3ICB A;  1ZQP A;  4QJF B;  3TAP A;  2QKQ A;  4UB2 A;  5CSN A;  1ZQK A;  4EX7 A;  4DFM A;  3N7S C;  3DYE A;  4C7Y A;  3S0D A;  5ALJ A;  2B0C A;  3JPT A;  3D75 A;  5EE9 A;  3TS5 B;  2OS8 C;  3CTN A;  4OO1 J;  3SR6 A;  2ZIU B;  4YGA A;  3GV8 B;  1S36 A;  2LI6 A;  4C4T A;  5KFP A;  3SS4 A;  3UQ2 A;  3PX0 A;  3OP0 A;  4FS2 A;  1UPH A;  1J7P A;  3H0R B;  4Y2P A;  2Y4Q A;  4RZR A;  2HOF A;  5KG4 A;  3KZX A;  4NDB A;  4OJ5 A;  1LA0 A;  4I2G A;  1KQM C;  3PR4 A;  2JXC A;  2WC5 A;  3FWC A;  4KLG A;  1T4G A;  2B1U A;  1F8H A;  5HR7 A;  5CSJ A;  3TAR A;  5DIC A;  3VGO A;  3RR7 A;  1Z3E B;  4DCK A;  3EPI A;  1BR1 B;  2F44 A;  3QU9 A;  3UPQ A;  3IG5 A;  1IXR A;  1URJ A;  1Z00 B;  7ICI A;  2H2K A;  2NRZ A;  5ALG A;  5ALY A;  5DB6 A;  3KHH A;  5KT7 A;  7ICV A;  1X6J A;  2I5H A;  9ICE A;  4BXO A;  1MQ1 A;  2YTU A;  3KEV A;  2M97 A;  2A19 A;  3ETL A;  3LYS A;  1X6I A;  4BY5 A;  2WCF A;  4I2A A;  1K9P A;  4XRH A;  4I5K A;  2VIX A;  1F4O A;  3AL0 B;  2L4I A;  1NOM A;  1KSP A;  1KN5 A;  1SL8 A;  3K1Z A;  1V9P A;  2BCA A;  1IV8 A;  3HT3 A;  5KFN A;  1SKS A;  4E0D A;  5AI5 A;  1PZN A;  2WAQ F;  4RT2 A;  2FMP A;  1SMG A;  3GV5 B;  1DJI A;  2C28 A;  4F8R A;  3SMV A;  1KQQ A;  2WCH A;  2OEH A;  2HHX A;  3RJK A;  4Z6D A;  3I5H B;  3NGD A;  4UAR A;  1TIZ A;  1M46 A;  3K1E A;  4IC9 A;  3B0X A;  1S6J A;  1A0P A;  2KJ5 A;  2VA8 A;  2YQE A;  2AGQ A;  4J03 A;  2F3Y A;  3A4U B;  3HW8 A;  3CWG A;  3EK8 A;  2W43 A;  4DQS A;  1T8E A;  3KD3 A;  5DB8 A;  2MUT A;  4O3R A;  3SS3 A;  2G07 A;  4UB5 A;  4RUA A;  5KL1 B;  4P4O A;  4UAT A;  1W7J B;  1BF5 A;  2YMQ A;  2CN1 A;  3Q8Q B;  4PZO A;  4RQM A;  1SR6 C;  4NL9 A;  4KMO B;  1BPY A;  5EWF A;  1LVC D;  3NSO A;  1F71 A;  4YN4 A;  4UB1 A;  4QJ3 B;  3IRU A;  2KKV A;  5FYX A;  3DF0 A;  3KTQ A;  2JT0 A;  1K96 A;  3C1V A;  9ICR A;  3V7K A;  2NCP A;  3N4M B;  1X66 A;  3BOW B;  2KHV A;  5ALX A;  5KG7 A;  1J7O A;  5G08 A;  2W9B B;  2MHH A;  2XCP A;  2BHN A;  2L98 A;  2FMQ A;  3OHA A;  5AIA A;  3DVM A;  1IGV A;  1UHK A;  5J0R A;  9ICX A;  5IIM A;  1QS7 A;  3F2B A;  5BOM A;  5DKR A;  3TAC B;  1ZOT B;  3V6H A;  1M45 A;  4DF4 A;  3NS1 A;  1J1D A;  3ONN A;  1U45 A;  3TZ1 A;  4QZE A;  2QDI A;  3NAS A;  4XYN A;  2EDU A;  3OHB A;  4KIT B;  1B9A A;  1T94 A;  3BQ7 A;  1Z1B A;  1L2O B;  2DQN B;  1SV4 A;  1B22 A;  1ORG A;  2JH1 A;  1Y1X A;  4DL7 A;  3RJE A;  3WHT B;  4EZ9 A;  1F70 A;  1JSA A;  1L5U A;  9ICA A;  2LMT A;  2KSO A;  2PI5 A;  1HQV A;  3RJG A;  1OZO A;  2ZG6 A;  4PCW A;  4YFK A;  1K1Q A;  1NZP A;  2Q0Z X;  2KTQ A;  1DJH A;  4ED2 A;  4YR3 A;  4F7F A;  2QAR B;  2BCX A;  3SD7 A;  4GFT A;  4I5L B;  1V1G A;  4OCI A;  1NX1 A;  5J3X A;  1WRL A;  3JVT C;  2KZM A;  1Q80 A;  3I5G B;  1YUS A;  4I2B A;  1NJY A;  3H8S A;  2JC2 A;  5D7F A;  3SG4 A;  2AHO B;  1YRT B;  1KDH A;  2M7L A;  4RQ2 A;  4DEZ A;  2H8V A;  2W9M A;  2EAM A;  3OTQ A;  1N62 A;  1NK0 A;  3EK4 A;  1UT8 A;  2TN4 A;  3ORY A;  1IWQ A;  1ZQF A;  2JOJ A;  4F5O A;  4DL6 A;  3OBV A;  2ZND A;  1K2H A;  3BS7 A;  2HHV A;  2WTF A;  3KHE A;  2C2E A;  7ICS A;  4DRW A;  1OOJ A;  1LVH A;  3O4Y A;  1Z4N A;  2H3Q A;  4O3M A;  3EG5 B;  3ISB A;  2LLT A;  1FI6 A;  1QQ5 A;  5AK5 A;  2O6K A;  2B21 A;  2AU0 A;  2ZIX A;  1TK5 A;  2OHF A;  1A75 A;  4KLD A;  4CRX A;  2DL0 A;  4I2E A;  1DTL A;  9ICO A;  8ICP A;  4DFK A;  1SBJ A;  3HPO A;  4QIW C;  1KTQ A;  3QU7 A;  4YGD B;  3GII A;  1NK9 A;  5KFK A;  8ICZ A;  3T5H A;  3BZK A;  1S5L U;  4Z6E A;  1KWO C;  1Z4H A;  3QUT A;  4FBT A;  5EWE A;  2L2C A;  3UO9 A;  4DQR A;  4QWA A;  2OPO A;  2PRU A;  4ORA B;  2LMV A;  1WUD A;  1ZRM A;  2RHF A;  5J0O A;  4YR0 A;  4QJ5 B;  2CRX A;  4J9S A;  5F3X B;  4KYN A;  2R18 A;  4C8N A;  4DS5 A;  1BPE A;  5HHI A;  4DSL A;  3DVK A;  3QNM A;  1Y88 A;  2IA6 A;  2JEI A;  4WQ3 A;  2H3F A;  1NZB A;  1FW4 A;  3CGA A;  1CMF A;  1Y1A A;  2LC5 A;  3I76 A;  1TCO B;  3MR2 A;  2LUX A;  4WQ2 A;  3ZWH A;  2HVI A;  2EZZ A;  1QLN A;  4EEK A;  4FZL A;  2KFZ A;  2FDR A;  1B8C A;  5ER4 X;  5AKH A;  1ZD4 A;  5AER A;  7ICN A;  2RQ5 A;  2H61 C;  4C4S A;  3QUQ A;  4YMN A;  4DLE A;  1OUQ A;  1BVS A;  3IDW A;  1RWY A;  1X40 A;  3QX7 A;  2VKQ A;  3M7D A;  1ZET A;  1UHN A;  3UNW A;  2ATL A;  2WAQ C;  4RPY A;  2VA3 A;  2KGR A;  2P6B B;  2K60 A;  5GTH U;  3QXG A;  2IHN A;  2DKZ A;  1YUU A;  1BNP A;  2EH9 A;  2M1K B;  3V6J A;  2G5H B;  1PVQ A;  4DSI A;  2KLE A;  4IJ7 A;  4DQQ A;  4DS7 A;  9ICB A;  2BBN A;  4INW A;  3Q8S B;  1GQM A;  2I18 A;  2OYY A;  3S6J A;  1A6S A;  1LXF C;  1HIW A;  4Y2T A;  3UMG A;  3TI0 A;  2IOH A;  2K89 A;  5KFL A;  5CJ7 A;  2DPJ A;  1A29 A;  8ICV A;  5KFM A;  1JXE A;  3BUO B;  2GLE A;  1QJT A;  1MA7 A;  5IBW A;  2HHS A;  2KIW A;  4GC6 A;  2BPG A;  1FPW A;  3PV8 A;  2UVU A;  2V4R A;  2RLT A;  2LM1 A;  3EW9 A;  3M6K A;  1U9L A;  1FFU A;  4NLK A;  2ALZ A;  1ZMZ A;  3BFB A;  1K95 A;  1TAM A;  8ICO A;  3AU6 A;  3JTD C;  2ZUC A;  4KX5 A;  4ED0 A;  2BKE A;  4JD9 A;  3WK9 A;  5J0Q A;  3LWM A;  1MHO A;  1QV1 A;  1WYG A;  5J0W A;  2F2O A;  3S0B A;  5KFJ A;  3PR5 B;  4EBE A;  2M49 B;  4UB4 A;  2PFO A;  1BGX T;  1OXJ A;  2BQU A;  2F77 X;  2W9A A;  2G08 A;  1Q46 A;  9ICH A;  1LA3 A;  2KOT A;  2EC6 B;  4Y2U A;  1C3Y A;  8ICG A;  2F2A B;  3ZDE A;  2LAP A;  1C20 A;  3PO4 A;  4TQR A;  1A76 A;  3PFV A;  1QX7 A;  2FLL A;  4QZC A;  4DQI A;  2JQ6 A;  3BQ3 A;  1ZQD A;  2BCQ A;  3LCP C;  1DK3 A;  5CP2 A;  3DV9 A;  8ICC A;  3RBD A;  3PX6 A;  2K0J A;  2BNX A;  2H3V A;  5AI6 A;  4F4Y A;  4J9M A;  1KSM A;  3NTU A;  4BX9 C;  2PKE A;  3I1Y A;  2K61 A;  1BPB A;  5HHH A;  5JOL A;  4RT3 A;  3MGV A;  4PZN A;  4FS1 A;  4OZD A;  1ZQZ A;  2HBM A;  1EXN A;  1D8Y A;  5CA7 A;  3NVW A;  1OZS A;  2BGW A;  1DQE A;  5ALE A;  1M39 A;  2JZB A;  3M9O B;  2KQ6 A;  5AIB A;  5AKG A;  1L3S A;  1O08 A;  1SSE B;  9ICU A;  2ISP A;  5CSF A;  2BQR A;  4QWE A;  5B66 U;  1V85 A;  2QLT A;  2QB1 A;  3IQO A;  4BDP A;  1LB2 B;  2LLU A;  4NWI A;  3CLN A;  1FIQ A;  4RU9 A;  3L5K A;  2JPO A;  2KSO B;  3H7I A;  3SG3 A;  4ELV A;  2ZIU A;  4R1E A;  5I8N A;  4XQ8 A;  3ZD9 A;  2OTG C;  4M9H A;  1OQP A;  4K4H A;  4YD1 A;  2JEJ A;  3SIA A;  1OOH A;  1U5I B;  4DO9 A;  2KV2 A;  3K21 A;  1CDL A;  4EEY A;  4XUS A;  3CNH A;  1FO4 A;  2WOR A;  3NGV A;  3GIJ A;  1HT9 A;  1ZQG A;  4GIB A;  1JMS A;  8ICI A;  4MF2 A;  3RM1 A;  4YG2 A;  3V7L A;  2P35 A;  4KMU A;  4YI9 A;  4ZCU A;  5FI2 A;  4JWN A;  2MAZ A;  4F93 B;  3SJS A;  1L7P A;  3O6B A;  2WCL A;  3ZDC A;  4CF5 A;  2AQ4 A;  3ZD8 A;  3HKZ C;  2ZKM X;  5ALN A;  4F50 A;  5KL8 B;  9ICQ A;  4RPX A;  1VDV A;  2HET A;  3HX0 A;  4UW9 A;  5ALP A;  2NXQ A;  2AQ0 A;  2ZXH A;  5D4B A;  3WK6 A;  2MBX A;  4Y2J A;  2FCD A;  2VA2 A;  1UHU A;  2KVC A;  4Y2V A;  1JUD A;  5KT5 A;  2EAP A;  1N2D A;  1TWO A;  3BFH A;  4DFD A;  9ICN A;  2BE4 A;  4WJ3 B;  4J9N A;  1CFD A;  4PHM A;  3C5F A;  5EWG A;  1C7Y A;  2XI9 A;  3WKC A;  3PW4 A;  3D76 A;  3H4B A;  3LL8 B;  3ZI4 A;  4R64 A;  7ICL A;  1K93 D;  1M63 B;  5HNK A;  4N1F A;  4XJK A;  4AP9 A;  3VRQ A;  3EYZ A;  1OOG A;  4P0P B;  1SCV A;  4HYK A;  4N1G A;  3FAH A;  1NJX A;  3E0F A;  3I5I C;  1DJZ A;  2HHQ A;  3I5H C;  4F2R A;  1YZ6 A;  7ICK A;  3RLZ A;  4O3S A;  3MGH A;  1PSB A;  4JPZ B;  2O5G A;  2ZTC A;  2DFL A;  4GXK A;  7ICR A;  9ICP A;  1TNP A;  1XO5 A;  1LIN A;  3ALR A;  4PGQ A;  8ICF A;  3S0G A;  1C7V A;  2RDI A;  2QB0 A;  3RB0 A;  1DXS A;  4NL9 C;  3O4X A;  4PJ0 U;  4IR1 A;  1L7O A;  4P2H A;  3TUY B;  5T14 A;  4DOB A;  4PE1 A;  2YN4 A;  1WRK A;  3NXA A;  3H8J A;  1Z2C B;  2WC6 A;  4DL3 A;  5FI6 A;  1DF0 B;  4NY8 A;  1XFY O;  1X9X A;  2VJ5 A;  5G5G A;  1L8L A;  1WWU A;  2ODG A;  2JUL A;  3QEB Z;  1PVR A;  2WF8 A;  2GGM A;  3WK7 A;  2F8P A;  5JRT A;  2KI4 B;  4CPV A;  2YMP A;  4IR9 A;  1R2U A;  1EL4 A;  1YUT A;  1EH2 A;  5CWR A;  3CR5 X;  1ZQV A;  1H8B A;  5IIK A;  3JPQ A;  4HSZ A;  4A4B A;  5KTQ A;  4ECZ A;  1X42 A;  4ED7 A;  2I94 A;  4NLC A;  4OVN F;  2HMX A;  2I1Q A;  3UQ0 A;  1K9U A;  2VJ4 A;  1DJG A;  2AAO A;  5AI9 A;  3QU4 A;  2LVV A;  5J0Y A;  5DKW A;  1XFV O;  3KKA C;  4M0A A;  1PK1 B;  5ALS A;  1CM1 A;  5ALW A;  2WF6 A;  5KFF A;  5IIJ A;  5KFZ A;  4M6W A;  2W9C A;  4M9G A;  4QZF A;  2GO7 A;  2LMR A;  2PMZ F;  4GGF C;  8ICK A;  2H3Z A;  4ECX A;  1EXR A;  5III A;  4FQT A;  2JZI A;  2HBL A;  3CZ2 A;  3THV A;  1LKY A;  2WF5 A;  3V72 A;  5D69 A;  3TQ1 A;  4DL4 A;  1IQ5 A;  3FC4 A;  2P70 A;  4XA5 A;  2HW3 A;  2WCE A;  4QZ9 A;  5KFD A;  4C0L A;  2KAX A;  3M8R A;  1OMR A;  2PFP A;  2F1I A;  5J2J A;  2FJY A;  4GC7 A;  1N48 A;  1TK0 A;  1JRP A;  3PMN A;  3D74 A;  5I94 A;  4KLE A;  2L50 A;  3F5A A;  3HIL A;  4J9R A;  8ICS A;  2XGP A;  1AQ6 A;  1YX7 A;  1XFZ O;  4B9L A;  2OCE A;  1RQN A;  1S76 D;  3KF9 A;  5K89 A;  2MRL A;  2AMI A;  2A1J B;  3QYP A;  3CRX A;  3BUX B;  2V4Q A;  1ZQH A;  2JGA A;  2ISD A;  3TDU A;  3Q8K A;  3UXP A;  1QQ7 A;  1GJY A;  5AKZ A;  1RFJ A;  5GQQ C;  1CMG A;  1A4P A;  1QVI Z;  3E3R A;  4KLJ A;  2WCB A;  1GGW A;  4YBH B;  1KCY A;  4F72 A;  1RZT A;  4JQ0 D;  3WNX B;  2JTZ A;  1J7Q A;  7ICJ A;  2W8L A;  5DLF A;  1SW8 A;  4RQ1 A;  2E8P A;  3DEE A;  1SGG A;  4F5Q A;  4P2Y B;  4DSJ A;  1S5G Z;  4ED8 A;  5AM5 A;  3PVX A;  4MF8 A;  5AKX A;  4QZG A;  1J97 A;  5L1I A;  3PSF A;  2FPL A;  4IS7 A;  4IRD A;  1T7P A;  5ALF A;  4UAW A;  3D2Q A;  8ICX A;  1A2X A;  1CFF A;  3D10 A;  4M2O A;  2FE9 A;  1S5G Y;  2R8K A;  3HRD D;  1ZQT A;  2PFN A;  4IQW A;  2VRG A;  4NQG A;  4KTQ A;  1JC2 A;  3CS1 A;  2LYH A;  4PAL A;  3SG2 A;  4AQI A;  2MRD A;  4F2S A;  2ZJA A;  3M8S A;  4IRK A;  1ARO P;  2JXL A;  5KT2 A;  1S3P A;  3K4G A;  2Z7J A;  1CFP A;  1CDN A;  1YVH A;  4YXJ A;  1KK8 C;  5JU5 A;  1KW4 A;  2SCP A;  4J9O A;  1BJF A;  1T14 A;  2LNK A;  3MBY A;  1H38 A;  3OX5 A;  2IOF K;  1KK7 Y;  3IV6 A;  5J2G A;  4JWQ A;  4CE6 A;  3Q8L A;  1X9S A;  3MC1 A;  3C1Y A;  5ALM A;  5ALU A;  4F71 A;  5HKW A;  1MF8 B;  1QLK A;  4Q04 A;  3WKD A;  5PAL A;  4O3Q A;  4YXM A;  8ICA A;  2WFA A;  2E5S A;  4OD0 A;  4JUZ A;  2CNP A;  3GFK B;  3M0W A;  1KEJ A;  4M9N A;  1ECW A;  3H4D A;  4B9S A;  1FF1 A;  1YUR A;  4BWJ A;  4US8 A;  2Q4T A;  3QU5 A;  5HR6 A;  3LK0 A;  2KK0 A;  5AHX A;  1JWD A;  2B6G A;  2KJ8 A;  2M29 A;  3PW5 A;  4KLT A;  1TK8 A;  5L1M A;  1BOD A;  3PNC A;  1BNO A;  3QU2 A;  3C2K A;  2F1J A;  4UAS A;  1B43 A;  2UVR A;  1SL7 A;  4JV1 A;  2JMG A;  5EL2 A;  5J29 A;  4ELU A;  1A03 A;  5DG8 A;  3NSL A;  5DBA A;  4KLO A;  2NO4 A;  2K4H A;  2HI0 A;  1DMO A;  3D73 A;  3AAJ A;  1YZ7 A;  1FBV A;  4PHP A;  1KFX S;  2LBO A;  1VRK A;  1TOP A;  1XFR A;  3H8M A;  2DPI A;  2A1J A;  1XFX O;  4DOC A;  2QEB A;  1VLB A;  5AKL A;  1ZQI A;  1CTR A;  1CNP A;  3A0H U;  4QZD A;  4UBC A;  1TUZ A;  1SYM A;  8ICL A;  4XJK B;  4HRE E;  3B9J A;  5KFY A;  1NKE A;  2KBI A;  5AIC A;  1DEK A;  1Z4O A;  4MFA A;  4ECU A;  5DBB A;  2EZX A;  2MU2 A;  3PY8 A;  4USL A;  5AI8 A;  3SI8 A;  1F44 A;  2C2R A;  5DDY A;  2P6R A;  3PZP A;  5KFC A;  3PST A;  3L4A A;  3TAD A;  2BR0 A;  3O78 A;  4YGE B;  3S0A A;  2W7P A;  1R6P A;  3UXN A;  4HAI A;  4P0Q A;  2AGO A;  2Y1J A;  3D78 A;  4MRX A;  2YML A;  2DWQ A;  3K1R B;  3HP6 A;  4KLL A;  2KBM A;  3FE6 A;  1GO3 F;  1MSW D;  3SV4 A;  4ECR A;  1ZQN A;  3N97 B;  2PQL A;  1D8B A;  2G06 A;  4IQV A;  1MQ2 A;  5IIL A;  2HHU A;  2XY5 A;  1RYR A;  2KQY A;  4PHA A;  4QZ8 A;  1XSP A;  1UHH A;  1U47 A;  2BCB A;  2FOT A;  5F9N A;  3PO5 A;  4GFJ A;  5KFE A;  4DSK A;  1L8O A;  1KFT A;  2CTN A;  3TAD C;  2GH1 A;  1IKU A;  1AK8 A;  5CB1 A;  1L7N A;  1Q8K A;  2ZNE A;  5I2Q A;  2ZIW A;  3KKA A;  3RRH A;  4KLH A;  9ICL A;  4QWB A;  4Y2R A;  1ZD3 A;  1U4B A;  1CEZ A;  3IN5 A;  2JWW A;  4KLS A;  5KFS A;  2KLD A;  7ICT A;  3EZ5 A;  1RXW A;  4N5X A;  2LKY A;  2BDU A;  4ECT A;  4O5E A;  3TFS A;  1QLS A;  8ICB A;  4PT1 A;  4M9L A;  1W9Z A;  5TZV A;  3GV7 B;  1BMO A;  2Y0S C;  1X9W A;  1CLB A;  2M0R A;  2OWO A;  3C23 A;  1BU3 A;  2WB1 F;  3L4P A;  1UA0 A;  5J2D A;  3K75 D;  4MFF A;  4FQO A;  2C2D A;  5TIS U;  1W7I B;  2HQW A;  2M8U A;  2BKH B;  1PUL A;  5BPC A;  3I5F B;  1X2I A;  4RNO A;  1ZQC A;  2KSP A;  3RH5 A;  5DKN A;  4M2P A;  4GPL B;  2XVT A;  2JH7 A;  5KG6 A;  1JAL A;  4DFP A;  2LM5 A;  3NVV A;  9ICG A;  1YT3 A;  1CI4 A;  3RH4 A;  2OS8 B;  3TKA A;  1J2M A;  4OR9 B;  1TAQ A;  2DOQ A;  3BQT A;  2JNF A;  3OB2 B;  1YRU B;  1GM0 A;  3LDA A;  1KL9 A;  3C28 A;  3EKH A;  1Y0V H;  4OJ6 A;  3VRP A;  3A8R A;  1ZJN A;  2YY6 A;  2AH5 A;  3MR3 A;  1XO0 A;  2KEY A;  2XID A;  1KKX A;  4FTG A;  2WCJ A;  1WLZ A;  2KZZ A;  1N65 A;  1DEL A;  4C7Z A;  3BJY A;  4B9M A;  3SAF A;  3A0B U;  4F92 B;  2BCS A;  2WCK A;  2PYQ A;  4NDD A;  5HLV A;  2J6T A;  5DQH A;  1ED1 A;  2JNX A;  4ICA A;  2I6X A;  9ICK A;  3MSE B;  2F8K A;  8ICT A;  3I5F C;  1G4Y R;  1NIW A;  3L3F X;  2COL B;  1KQV A;  2MLE C;  2W9C B;  5DG7 A;  2VAN A;  4DL2 A;  3JPO A;  2NV3 A;  3H8W A;  4R63 A;  1NK6 A;  1ZJM A;  4NDC A;  3ISC A;  2E1F A;  4PGY A;  4PHK A;  2PMY A;  2Q4U A;  4G9B A;  4MZK A;  3C1Z A;  4OJL A;  3I5G C;  3RJH A;  1ZQ1 C;  3Q8R B;  2ASJ A;  4QW8 A;  1B8L A;  4UB8 U;  1ZQM A;  2ZIV B;  3UM9 A;  1B4F A;  4R8U B;  2ZIX B;  1NK7 A;  1KLN A;  2FJU B;  2QB0 B;  2L0P A;  3ZDB A;  1WDC C;  1WY9 A;  5KT4 A;  3BDP A;  5GTI U;  4CLN A;  3H40 A;  2Y1N A;  9ICF A;  1QX5 B;  3CYM A;  1NK8 A;  2F3N A;  5I2L A;  4Y2X A;  3J81 j;  1B7T Z;  2QAR A;  4NM2 A;  3ZDA A;  4Q45 A;  2YX8 A;  2KJ9 A;  3KOO A;  3GIK A;  1ZQL A;  1F4Q A;  3CZ0 A;  1ZUZ A;  1U49 A;  2ZUD A;  1AHR A;  1JI7 A;  1FI5 A;  2EZY A;  3IVT A;  1O03 A;  3BFA A;  3VRN A;  1B7T Y;  1JIH A;  2BPC A;  1ODB A;  2GGZ A;  2ISO A;  1B1G A;  2PMZ C;  3QME A;  2KIV A;  4ED3 A;  1NX0 A;  3RRG A;  4MFC A;  3RTV A;  2F76 X;  1ZQO A;  1NX3 A;  1F54 A;  3D0Y A;  4IRC A;  3RB4 A;  3QZ7 A;  3QRX A;  5HYD A;  1IIP A;  3KZI U;  3QUC A;  5AK6 A;  1CUK A;  2BEC A;  1QH9 A;  2NYV A;  4Y2Q A;  1FEZ A;  4UQG A;  1NX2 A;  1XVJ A;  3VC8 A;  2LMU A;  2LV7 A;  4U8D A;  5AXI A;  3EVR A;  2KHQ A;  3M6Z A;  2R8G A;  1QIV A;  3OSP A;  1NUB A;  2F33 A;  2XY6 A;  1X02 A;  2GTE A;  3HJE A;  3T5J A;  3UMB A;  1L3T A;  4PE0 A;  2ZFD A;  2WF9 A;  1QX2 A;  1KK8 B;  3UMC A;  1N2X A;  5L1L A;  3SZ2 A;  1ZXI A;  5G5H A;  2G0A A;  2W54 A;  2KFF A;  2KGB C;  4LZD A;  3QEA Z;  1KRP A;  2H5X A;  4QJ4 B;  1CFC A;  3V7J A;  1IM4 A;  2FMS A;  1L3V A;  3AAK A;  3ISD A;  4MBE A;  4YCX A;  4K4G A;  2K4E A;  2K2A A;  5E79 U;  7ICQ A;  3MDA A;  1CM4 A;  3C2M A;  3C5G A;  1L6N A;  3PN7 B;  4QW9 A;  3RAQ A;  3RF9 A;  2OTG B;  1SWV A;  4YMM A;  4CGZ A;  2XY7 A;  1RQL A;  4DSF A;  1JRO A;  4DCC A;  3KBB A;  5HMM A;  1WCL A;  4DFJ A;  1IG5 A;  3BYA A;  2KYF A;  2ZTD A;  9ICI A;  1RRO A;  4I5N B;  4Q8E A;  2LYB A;  4M2Q A;  2KMD A;  1MUX A;  1Q3V A;  4JB3 A;  1UCV A;  2Y5I A;  4F5N A;  4FZN A;  2NRW A;  5HL1 A;  3JPR A;  3CDN A;  1WRZ A;  5KG1 A;  1JF0 A;  4CF3 A;  3BOW A;  3UXO A;  3EVU A;  2HDO A;  4JV2 A;  1BR4 B;  2KG5 A;  5J2I A;  2K4P A;  2OM6 A;  3BQ0 A;  3PW7 A;  2M1U A;  2ZXI A;  1PK1 A;  1SK6 D;  4ICB A;  2E8N A;  2IS9 A;  4GNK B;  4NM1 A;  3PSR A;  2Y9T A;  2XCA A;  1TE2 A;  5KFT A;  3R1O A;  2W55 A;  2WND A;  1C3Z A;  5AK3 A;  1Z1V A;  4DOA A;  2XIC A;  2MLF C;  4JK1 A;  4CID A;  4KLM A;  5EE1 A;  5J0S A;  8ICY A;  2M3W A;  3VCB A;  7ICG A;  3GU3 A;  5CSI A;  2W11 A;  2R2I A;  3N7P D;  2HOQ A;  5ALR A;  4C8O A;  4DQP A;  4MHV A;  4Q44 A;  4I5J A;  3DDH A;  1S1E A;  3PJI A;  4OCZ A;  1RPL A;  1CLL A;  1TNX A;  1SY9 A;  4AYB C;  1DJX A;  3JTD B;  3SG5 A;  4FFD A;  1GGZ A;  5I2O A;  4I2D A;  1OOF A;  1ZQU A;  3FYH A;  2P71 A;  4TUR A;  5KFG A;  2V53 A;  1BG1 A;  1OE9 B;  5D3O A;  1K5O A;  2LPE A;  5AM4 A;  1TRF A;  4GGN A;  4WRI A;  4DL5 A;  1JF2 A;  2KPH A;  1C7W A;  3AM9 A;  3FIA A;  2KI6 C;  4KN4 A;  2BCV A;  4INX A;  3M1Y A;  4HRG A;  1TAU A;  2ZIW B;  5ALT A;  5CR0 A;  5D49 A;  1UA1 A;  4MN0 A;  5FI7 A;  1L2O C;  1Z19 A;  1F0M A;  2W7O A;  3IM1 A;  5KFB A;  1KSO A;  4PE7 A;  1WWV A;  1OMV A;  1NK5 A;  3BQ1 A;  1UQV A;  4DF8 A;  4YMO A;  4BUG A;  4B9V A;  1CDM A;  5KFQ A;  1MXL C;  1N56 A;  4OJO A;  4PGX A;  2ES6 A;  2I7A A;  1IJ6 A;  1SV0 A;  1SL9 A;  2F8L A;  3RJI A;  1XFU O;  5KFI A;  4CCH A;  4EZ6 A;  3QUB A;  1J7R A;  4M04 A;  4P4M A;  4A4C A;  2JRZ A;  1UP5 A;  2YB4 A;  1PSR A;  3DF0 B;  5DB9 A;  1Y6W A;  2XGQ A;  4ZCV A;  3H4S E;  2KNJ A;  1KQM B;  4Z6C A;  3CR2 A;  4ZH4 A;  2L5Y A;  3RR8 A;  4US9 A;  3OJS A;  1MR8 A;  2KDH A;  1BPZ A;  1G33 A;  1UUS A;  2ZIV A;  2NCO A;  2K4I A;  5AK4 A;  5KFV A;  4DIR A;  1ALV A;  3F2D A;  3T5L A;  4Q8F A;  4LJX A;  2R8H A;  2MA1 A;  2Y1M A;  1PUZ A;  4UAY A;  1J1E A;  5CEH A;  1V38 A;  4BXO B;  4JV0 A;  3M9M B;  2ZN9 A;  4J9L A;  3D2N A;  4KX3 A;  1CDP A;  3LWL A;  1SL2 A;  4KLQ A;  2F1H A;  1S0M A;  3SG7 A;  4C8K A;  2K7C A;  3IHQ B;  1S10 A;  3B86 A;  1J55 A;  2DF4 B;  4ACO A;  1NKC A;  3JPP A;  1N5X A;  3HWT A;  4QZA A;  2O60 A;  4RQ7 A;  3BS5 B;  2IHM A;  1ZD5 A;  4BWM A;  1ZQY A;  2JR5 A;  1A75 B;  5J8Y C;  1NCZ A;  4PHD A;  2SAS A;  4ORB B;  2ZRT A;  1XYD A;  3EUB 2;  3HX4 A;  4GXJ A;  1AJ5 A;  5J2F A;  5KT3 A;  1SCM C;  2KFG A;  4Y2Y A;  1ZOL A;  2Y1I A;  4F3O A;  3FE9 A;  1M31 A;  5CHG A;  3GDX A;  4ECQ A;  1XK4 C;  5ALI A;  1AUI B;  1WLM A;  1RDF A;  2NZ0 A;  2JZB B;  2KE7 A;  4MZJ A;  1RK9 A;  4I27 A;  5JJG A;  2DUY A;  2KVS A;  5J2A A;  5KFO A;  3HCM A;  3R1P A;  1HUZ A;  1IIO A;  1N0Y A;  2ESE A;  2WF7 A;  5C5J A;  1QSL A;  3F5E A;  1G8I A;  2MUT B;  5F6T A;  1KFD A;  5KFR A;  4ELT A;  2W8K A;  2L5X B;  3QE9 Y;  7ICO A;  4K4I A;  1K94 A;  1RG6 A;  4MEW A;  1NI3 A;  1QIW A;  1XFW O;  2KAY A;  3PM8 A;  2DBY A;  4B9N A;  4P0Q B;  2KI4 C;  4AYB F;  4C8M A;  5KAF U;  4TUQ A;  2BPF A;  2EGD A;  3IF7 A;  2K7O A;  2UVW A;  2MSN A;  2M7N A;  1PVP A;  4ED1 A;  2HF5 A;  2JHD A;  3O2P A;  1SCM B;  2H3I A;  3PSI A;  5L9X A;  4I2H A;  1BPD A;  9ICW A;  3F2C A;  3GK2 A;  4RNM A;  2G09 A;  2KI6 D;  8ICR A;  1D8L A;  5DGA A;  3FE8 A;  4GAO A;  2E8M A;  2BAP A;  4BGD A;  2HPS A;  1U5I A;  4QZI A;  3VB1 A;  5J2B A;  1JXL A;  5KFH A;  3NSK A;  2GOL A;  3NVY A;  4R66 A;  5ALL A;  3T79 A;  4IL1 A;  3PW2 A;  2DKX A;  4F4K A;  4RNN A;  1SXD A;  1XU4 A;  5ALV A;  4J9K A;  1K9K A;  2KIC A;  2LVJ A;  3F53 A;  4U7C A;  2QEH A;  2EQY A;  2JU0 A;  3G6V A;  2JXJ A;  1SWW A;  3ED5 A;  1ZQS A;  4UAZ A;  3VRO A;  2QAC A;  1KFU S;  4EYI B;  3PX4 A;  1TV9 A;  1T3Q A;  1WG8 A;  1KFX L;  1NJW A;  1OW4 A;  3DXL A;  1S97 A;  4I2J A;  1NCX A;  1SKW A;  1N63 A;  2N1R A;  5DBC A;  4NXZ A;  1JN3 A;  1N5W A;  3MFI A;  3CP8 A;  4LZG A;  4NLN A;  3N7H A;  5ALD A;  3SV3 A;  2KN7 A;  4QZB A;  4C0J A;  1SR6 B;  2G9B A;  2ZTE A;  1C07 A;  2L2E A;  2LHI A;  3NHI A;  2FCE A;  1LKY B;  4B9T A;  4QZH A;  4UBB A;  1DOQ A;  3FDS A;  4EBC A;  1CLM A;  1QAS A;  3OPX A;  4C0Z A;  4R65 A;  2EC6 C;  3BQ2 A;  2Y9U A;  3SYZ A;  2AUC A;  2HHW A;  4UB3 A;  2EAN A;  2KAV A;  1EG4 A;  1QTM A;  3WK5 A;  2KZ3 A;  7ICE A;  3RFA A;  1JFK A;  1L7Z A;  4DWI A;  4X5V A;  1PVA A;  2I9G A;  1XS9 D;  5AAN A;  3SQI A;  4P0P A;  5HP4 A;  4RQ4 A;  1K90 D;  4YQW A;  3D77 A;  1PVB A;  1S6I A;  1IG6 A;  5KAI U;  4MVF A;  4MSP A;  3TAQ A;  1KFS A;  2EAO A;  5ALZ A;  4C80 A;  3TFR A;  1S77 D;  1HUO A;  2ZUB A;  8ICE A;  1TCF A;  2E3T A;  5AI4 A;  3B6X A;  4GGF A;  3G6Y A;  2IBK A;  1T3N A;  1P28 A;  8ICH A;  4ETO A;  2L4H A;  1KBU A;  3SEI A;  5AKI A;  1TFR A;  3N7R C;  5KFA A;  3WU2 U;  3KFU F;  3RB6 A;  1M6Y A;  4NLG A;  2R8I A;  3H0L B;  1DVI A;  4RQ0 A;  3U26 A;  4NV0 A;  7ICH A;  2XC9 A;  2KOB A;  5ALH A;  5DDM A;  3AKA A;  4PHJ A;  3LK1 A;  3TDI A;  2PAS A;  1ZQB A;  2NO5 A;  2BKI B;  5J2H A;  5DGB A;  4ED6 A;  4R8U A;  2CBL A;  4Q43 A;  4CF4 A;  1F55 A;  2LCP A;  4RQ6 A;  1RM6 C;  2BE6 A;  2UVV A;  5L1J A;  3FWB A;  1TTX A;  4ECY A;  4TUS A;  3RH6 A;  2RP5 A;  3QZ8 A;  3ICX A;  4O9M A;  3V2L A;  4EEL A;  3C2L A;  1WCN A;  4CFQ A;  1TVA A;  3T3F A;  4NLZ A;  1PAL A;  3WK8 A;  5J0U A;  1DT7 B;  1JUO A;  2IMW P;  5DB7 A;  4YI8 A;  2FPM A;  1COK A;  2LHT A;  1BLQ A;  2PXI A;  2ASL A;  4CDG A;  2GWS A;  5AKJ A;  1SL1 A;  2K2F A;  5KG3 A;  3RBE A;  4MEY A;  5HKZ A;  4F5R A;  2LUC A;  4E68 A;  4TNC A;  3IQQ A;  4KLI A;  1QV0 A;  3NRW A;  4NJ8 A;  4Z6F A;  3R72 A;  3SG6 A;  1NWD A;  2ZJ5 A;  2A3V A;  8ICJ A;  4G3I A;  1RYU A;  4UAU A;  5JTI A;  2HVH A;  3B7A A;  5KSZ A;  1ZQX A;  2LYA A;  4RQ8 A;  1SB3 C;  3CW2 C;  3SS5 A;  3KHG A;  1S9F A;  3MDC A;  2W3S A;  3WHU B;  4PE4 A;  1UWO A;  2C22 A;  2L51 A;  3VRR A;  4PDZ A;  5J2C A;  4J9P A;  5AI0 A;  1NP8 A;  1ZQA A;  2HCF A;  2A4J A;  5IIN A;  1S0O A;  3AN1 A;  3OGN A;  4ECW A;  2HQ8 A;  4I2I A;  1TNQ A;  3PAL A;  1K8U A;  4F0Z B;  5DLG A;  1S8O A;  5JUM A;  3GZF A;  2FLN A;  1PK3 A;  3RAX A;  2CXJ A;  1MQ3 A;  2FI1 A;  1LS8 A;  3AUO A;  1XA5 A;  2AXT U;  5AM0 A;  1DGV A;  1SNL A;  4KLU A;  1XO1 A;  3CYZ A;  2V9W A;  5DKQ A;  2K8C B;  1Q3U A;  3JPN A;  3M9N B;  1MC8 A;  2FPK A;  4USA A;  1SKR A;  3JVT B;  5AEQ A;  3MR6 A;  5ALO A;  4TQS A;  5BPJ A;  3B0Y A;  1U48 A;  7ICU A;  2LAN A;  1ZQR A;  3MGI A;  9ICS A;  2CPR A;  3IG8 A;  5DQG A;  3CAB A;  4NLB A;  4MEX A;  2KKP A;  5HML A;  3BUM B;  1H4B A;  3GK4 X;  1Z00 A;  5H2F U;  1QSY A;  1XWL A;  2R8J A;  1IJ5 A;  1B47 A;  2E1E A;  2E8O A;  4DLG A;  2ZRS A;  2M0N A;  3AQF A;  3WXA A;  3BS5 A;  2YGU A;  1MXE A;  9ICV A;  5J8Y A;  1B8R A;  2YMM A;  2WB1 C;  2FJ6 A;  3N28 A;  4LVS A;  1KFU L;  3Q8I A;  3MFH A;  4KLF A;  4O3N A; 
#chains in the Genus database with same CATH homology
 1OXJ A;  4PZO A;  4RQM A;  1W9Z A;  1OW5 A;  2B6G A;  4NL9 A;  2EAP A;  2KG5 A;  2K4P A;  1PK1 A;  1JI7 A;  1V38 A;  3SS4 A;  2E8N A;  5L1M A;  5I94 A;  3HIL A;  2Y9T A;  3IVT A;  2D8C A;  2DL0 A;  2JV3 A;  1COK A;  1Z1V A;  1X66 A;  2BNX A;  2KIV A;  5KNI A;  3BS5 B;  1Z4H A;  5J8Y C;  3H8M A;  4NJ8 A;  3UO9 A;  4RQN A;  2D3D A;  4MHV A;  4PZN A;  4I5J A;  2F44 A;  5JTI A;  3TAC B;  1LKY B;  3SS5 A;  5F3X B;  4KYN A;  2E8P A;  1SGG A;  3SEN A;  1DEK A;  2Y9U A;  2EAN A;  2QB0 A;  1SXE A;  3BQ7 A;  1V85 A;  2QB1 A;  1DEL A;  1DXS A;  3O4X A;  2KE7 A;  1SV4 A;  2YTU A;  3KEV A;  4IS7 A;  1Z2C B;  4GBA A;  5D3O A;  2KSO B;  2LPE A;  5FI6 A;  1X9X A;  2ESE A;  4I5K A;  3TAD A;  2KSO A;  2F8K A;  4JKT A;  3IDW A;  1WWU A;  1X40 A;  2FE9 A;  3UNW A;  1PK3 A;  2EAO A;  4MEW A;  1RG6 A;  5FI7 A;  2K60 A;  5JRT A;  2DKZ A;  1F0M A;  3K1R B;  2QAR B;  1WWV A;  1UQV A;  4I5L B;  2KLE A;  4IJ7 A;  3SEI A;  2ES6 A;  1SV0 A;  5JU5 A;  1KW4 A;  5FI2 A;  2GLE A;  3TAD C;  1B0X A;  1DC1 A;  2EAM A;  4GAO A;  2E8M A;  2BAP A;  1B4F A;  3KKA C;  1PK1 B;  2QB0 B;  3KKA A;  4I5N B;  2LMR A;  1SV0 C;  2QKQ A;  2KMD A;  3OBV A;  2DKX A;  2E8O A;  1UCV A;  2L5Y A;  3BS7 A;  2F3N A;  3PM2 A;  3SS3 A;  3BS5 A;  1LKY A;  1SXD A;  2YGU A;  2KLD A;  5HL1 A;  5J8Y A;  4NL9 C;  2QAR A;  3EG5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...