2K60A

Nmr structure of calcium-loaded stim1 ef-sam
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
b'GSHMASSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Stromal interaction molecule 1)
publication title Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k60A02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2k60A01
5JRTA 2KG5A 1JI7A 5J8YC 2Y9TA 2F3NA 1SV0C 1RG6A 2GLEA 2K60A 5JTIA 2EAPA 5JU5A 3HILA 3SEIA 2EAMA 2QB0B 1SXDA 2JV3A 2QB0A 4IS7A 2L5YA 2DL0A 4NL9A 3KKAA 2D3DA 4MHVA 4PZNA 3K1RB 1PK1A 2QARB 2QARA 1WWUA 2F44A 5L1MA 1SXEA 3TADA 2ESEA 1OW5A 3H8MA 2KE7A 4NL9C 1DXSA 1WWVA 2KIVA 5F3XB 2ES6A 3KKAC 2Y9UA 1SV4A 3BS5B 3BS5A 1X66A 1PK3A 3TACB 3BQ7A 2EANA 2EAOA 1PK1B 1SGGA 3TADC 2QKQA 1LKYB 1LKYA 1UQVA 2K4PA 1Z1VA 5KNIA 2FE9A 4NJ8A 2YTUA 3IDWA 1UCVA 1B0XA 4PZOA 4RQNA 2LMRA 2LPEA 1B4FA 1COKA 2E8OA 2E8PA 1X40A 2F8KA 2E8NA 1KW4A 2KMDA 2D8CA 1OXJA 5J8YA 4RQMA 1F0MA 2QB1A 1V85A 1SV0A 2B6GA 2DKXA 3BS7A 1X9XA 1V38A 2DKZA 2KSOB 3SENA 2KSOA 2E8MA
chains in the Genus database with same CATH superfamily
1YUTA 1DJYA 5B8IB 3CGAA 2K8CB 1A75A 3BFHA 1XU4A 2CT9A 2AQ4A 1TFRA 2PFQA 2HMXA 4Q44A 3IM1A 2I5HA 2EAMA 2P35A 1SXDA 3TANA 4MEWA 4JPZB 2RGIA 1S5LU 4F2SA 9ICNA 1D9FA 4BWJA 5B66U 2WF8A 7ICUA 8ICMA 7ICVA 4IRKA 2L5XB 5J0UA 4OJOA 1MA7A 4F71A 2H8VA 4KMUA 2WNDA 4BY4A 4UAYA 2KK0A 1ZQ1C 2E3TA 2KI6C 1K95A 2IOFA 4QZ8A 1OOHA 2K4EA 3D10A 3PALA 4M9HA 1NKEA 1ZOTB 3OB1B 3D6JA 5KG4A 4DL7A 3RJIA 2R18A 5KFJA 3BDPA 1IWQA 3K1ZA 4IR1A 5KTYA 4OJ5A 1XFUO 1ZETA 1DXSA 2DPIA 4YR3A 5AKZA 3LDAA 3RJHA 3V6JA 2OYYA 2LM5A 1IKUA 4XUSA 2HSZA 4B9TA 5J0PA 5KG0A 1DT7B 9ICLA 5KFUA 4DO9A 5KFSA 1SB3C 2GV5A 1Z19A 4DL3A 1ZQFA 3WK6A 2QKQA 1CKKA 3DVMA 3L4LA 1KDHA 1SL2A 3CW2C 5KT2A 1NX0A 1NUBA 1Z1VA 2PMZF 5GTIU 2B1UA 2MA1A 2KZZA 2NCOA 5CWRA 1C7VA 2JEIA 2K4HA 1DJGA 2LM4A 2KAVA 1UHUA 4DSKA 4RQNA 1R2UA 5KFTA 1AROP 4U8DA 3SG6A 2JHDA 4UB3A 2LPEA 1RPLA 1QWVA 4A4CA 3WK7A 3A8RA 1YUUA 8ICUA 1OMVA 5ALZA 4I5LB 3BUXB 3I5HB 1D8LA 4F0ZB 4IQTA 1CFDA 2KIWA 1L7OA 1RYUA 4PE0A 1F0MA 3PZPA 4J9SA 3RJKA 2HHSA 2MRDA 1L3SA 3OHMB 3R9KA 1CDNA 4ECWA 1QX2A 4UASA 4O3NA 3RB4A 2B6GA 2Y1NA 1GGWA 4MEXA 3JVTB 4GUKA 3KZXA 3QYPA 4GFTA 3PW5A 3ETRA 1YR5A 4JV0A 4ECZA 4DQPA 2HHXA 1M63B 4AP9A 3K21A 5J8YC 1QV0A 4M0AA 2GOLA 4FBTA 3L4PA 4B6JA 4C4TA 4N1FA 2BKIB 3Q8SB 2GO7A 5IIMA 3L3FX 2L2EA 1N48A 3OBVA 4M47A 2JV3A 3GIJA 1S5GZ 2HI0A 1S8OA 2L51A 3FE8A 2G9BA 4YMMA 2LVJA 5J2JA 2MLEC 5AM4A 1QVIY 4GPLB 3KPXA 3MDCA 1ZRNA 3K1RB 2GTEA 3PY8A 7ICNA 2HOQA 1OOFA 4HRHA 4AOMA 4GGFA 1J7OA 5IIOA 3TDZA 2HW3A 2KPHA 1FPWA 1V97A 1S6JA 3M6ZA 5KFOA 3T5KA 4C7YA 2AHOB 5J0WA 1X42A 2F1HA 2ZJAA 4F4WA 3OP0A 3WK4A 1JIHA 2BKHB 2W9BA 3OGNA 5KFAA 5L1LA 2FCDA 1PK3A 4YD2A 2LHLA 1CDMA 1SPYA 4FS2A 2VA3A 4RQ3A 4RQ1A 4MFFA 1WDCC 3PFVA 3SV3A 1ECWA 4UPGA 2KI4C 4KLEA 5AKKA 2OXOA 4Q43A 4MZKA 5ALYA 4R66A 3D0YB 5ALLA 1MSWD 2A1JA 3WKCA 2LMVA 5EOZA 2NCPA 8ICWA 2KGBC 2LLSA 4ETOA 5DB7A 1SL9A 5IIIA 5KFRA 3U26A 1KK8B 2ZNDA 3IDWA 5JUMA 1UCVA 2LMRA 1KFUS 3F5AA 3TFSA 4ECVA 3AAKA 4O3MA 4C80A 5HP4A 3PMNA 4JD9A 1NX1A 1OMDA 1SR6B 1F4OA 3BUOB 5BOMA 1MXLC 5KG5A 1ZJNA 2L0PA 3WK5A 4PCWA 2JNFA 4C4RA 2W9CB 3BQ3A 3RRGA 1JBAA 1A29A 4IL6U 2HHWA 3CR5X 5D3OA 4Y2YA 1EL4A 2UVVA 5ALUA 1DQEA 3RRHA 4I5JA 3S6JA 4M6WB 2WB1C 1CMFA 1MC8A 2LANA 5KAFU 2CNPA 2KAYA 3TDUA 1ZQXA 3H0RB 1QTMA 3PSPA 1PVPA 4RU9A 3GDXA 1TUJA 4PGQA 3RH6A 4DFJA 3D78A 3PX0A 4DL5A 1S0VA 1BNOA 4J9NA 4ECRA 2PVBA 2ZG6A 2XY7A 2NRXA 1ZD3A 3SS4A 5AKEA 4F2RA 1KFTA 4ZH4A 3WNXB 2HOFA 4J9QA 5AFPA 1A03A 4DOAA 2H3ZA 5I2LA 2LVVA 2GWSA 4GXIA 2P66A 4RQ8A 4UAZA 3R1OA 2AU0A 2JWWA 3HJEA 1MUXA 1JXEA 4RUAA 1J7QA 2XGQA 3UNWA 4EZ6A 3OGUA 2NZ0A 4US8A 5AI8A 4PH5A 4O3SA 3CZ2A 4DIRA 1AHRA 1Y1XA 4E68A 5KG3A 5KFEA 2UVWA 3IQQA 9ICOA 3SG7A 1PK1A 2QARA 3GV5B 3HX0A 3CS1A 5J2IA 2F2AB 3RFAA 3M9MB 1TAMA 3AL0B 5HHIA 1Y88A 1CUKA 3A0HU 1WY9A 4OV2A 1LXFC 1ZQPA 2QEOA 4ORCB 3PSFA 4YGDB 1NP8A 3EVRA 3IF7A 3GV8B 4KLIA 1C7WA 3WHUB 3QX7A 2BCSA 3R1VA 3HPOA 1Q8KA 3EPIA 4F7FA 4EEKA 4YVZA 3CP8A 2ZIUB 4MF2A 4DS5A 2Q4UA 3SV4A 1PK1B 3QXGA 4I2HA 4UW9A 2LP3A 2KBIA 5ALKA 1FF1A 1XO1A 1K9KA 2F77X 2G0AA 1ZQVA 2H3IA 8ICSA 4MFCA 2RP5A 1YRUB 3TS5B 3G6XA 2KN7A 3MABA 4AQJA 2RQ5A 2FPLA 1YT3A 3AU2A 1AJ4A 4PHMA 2F1IA 1PZNA 5CJ7A 3ZDBA 2E8OA 4QWCA 2E8PA 4M2QA 4WQ2A 2HOIA 3F53A 2KMDA 3PATA 1K1QA 2WF7A 4P0QB 1T8EA 3F5EA 5L1KA 3N7PD 2E1FA 2FPMA 2C2RA 2QB1A 1XYDA 3QU2A 4I28A 1V85A 3AKAA 1NK0A 1RJVA 5AM1A 2M97A 7ICMA 2XVTA 4Y2UA 1ZACA 2M9NA 2WFAA 2MLFC 2KSOB 3EUB2 4JV2A 3I5HC 2KJ9A 1NJWA 2F1JA 2Y4QA 4DSFA 5AKJA 1DGJA 2YMMA 2OS8B 1BGXT 4P4MA 4USLA 5KT7A 3B7AA 3NGDA 4PHEA 1YX8A 2ZRTA 3CNHA 2ZIXB 1ZQRA 1RDFA 4CF5A 3JVTC 4PHDA 2BE4A 3GK4X 4N1GA 2V9WA 1KQMC 2M9GA 4DCCA 4GIBA 2R8KA 3OHBA 3I5IB 4O0IA 1NX3A 1DF0A 2LE9B 5DG7A 4QJ4B 1EXNA 2LAPA 4RZRA 3CYZA 4PPXA 2K2AA 1F71A 3HRDD 1XVJA 3FM9A 1ZQGA 3PVXA 8ICJA 1X9SA 4ZCUA 1KN5A 2KE7A 1NK4A 1KSPA 3ICXA 2BCQA 1Y1UA 2O6KA 3DYEA 1C07A 3BOWB 2JTZA 4UBCA 2AAOA 1JSAA 3FIAA 1QIVA 3NVWA 3ALRA 3BS5B 3KZIU 2NO5A 4PE1A 2FLNA 4QZEA 3V6HA 1X6IA 4C8OA 5HHHA 2ZUDA 4U7CA 3ISCA 2JT3A 1C20A 1OE9B 4OO1J 2DQNB 4JMUA 3V2LA 8ICIA 1ZQEA 5DG9A 2K7BA 3BFAA 3TADC 1J1DA 1LKYA 2WF5A 5HKYA 3VRPA 1LS8A 3CZTX 3AM9A 1Z4NA 2SCPA 4F8RA 1Z1BA 3KHGA 4PHAA 3PJIA 1Y0VH 1EXRA 2HETA 4C8KA 1L3UA 2ASJA 2YTUA 2ATLA 1UP5A 3QMEA 1XO5A 9ICJA 3QRXA 1NI3A 3WU2U 1NKCA 3BFBA 4EX7A 1TK0A 1KW4A 3UXNA 2ISOA 2LBOA 1SL0A 3MFHA 2XY6A 5KFNA 5CHGA 3C2KA 5J8YA 2BQ3A 2J6SA 4P0PA 3QEBZ 3SG2A 1UHHA 4C8MA 4J9LA 4GC6A 3OX5A 4RPXA 2Y1JA 1KK8C 3QUQA 1TCOB 1B22A 1KFUL 1CNPA 2KJ5A 8ICAA 4RNOA 1AJ5A 4FZNA 3WK9A 2MUTA 1L7ZA 4O5EA 5AICA 1WRKA 4A4BA 3WK8A 5IBWA 2NV3A 9ICPA 5HMMA 3KFUF 1FI5A 5EWEA 3RR8A 9ICVA 3HCMA 1DGUA 5ALDA 5BOLA 3HW8A 2M49B 5CPVA 9ICCA 5FP0A 3D77A 1IG6A 1DJHA 1CM4A 4J03A 9ICGA 2LKYA 5KT3A 1A6SA 3A0BU 1N5XA 4YCXA 3AEVA 1NK7A 4DF8A 4DQSA 5GQQC 1IIOA 2KAXA 1RECA 5JOLA 4QWEA 3BUNB 2MJWB 2H2KA 3RF9A 5L1IA 3GK1A 1H8BA 4ECUA 2LVIA 2SASA 2OPOA 2JH1A 1LV5A 4KLHA 3I5FB 1BLQA 1RXWA 2PKEA 3OPXA 1N2DA 4F4ZA 7ICFA 2G06A 1IV8A 2HPSA 1WWVA 4K4HA 1JX4A 2OEHA 1Q3UA 3CRXA 4Y2SA 1BPZA 3D74A 5FI2A 1AQ6A 3LYSA 1UUSA 2ZJ8A 1O08A 2QEVA 4YR2A 1RK9A 1B8LA 3OJSA 1KFDA 1MQ3A 8ICEA 3RB6A 1WDCB 4AQIA 4I2DA 2BNXA 2NO4A 1ZQYA 4BGDA 4QWAA 4UATA 2JEFA 5HR6A 3RR7A 3C2LA 5KNIA 3Q8RB 4B9UA 3B86A 3CWGA 5CSIA 3TUYB 1EH2A 1CFFA 2Y1IA 1FBVA 3NHTA 1KTQA 1WG8A 2EC6B 5I2OA 4MSPA 1SZHA 4RPZA 4JB3A 2M3WA 3D76A 5J2DA 2WOSA 4DCKA 5KL8B 4DSIA 3ZDAA 1X40A 1S0OA 3CR4X 1KFSA 4Y2XA 1K93D 1NK5A 8ICCA 2ZFDA 4FZLA 1PK0D 3RTVA 4RQ0A 2ZTDA 4L9MA 1N5WA 4Z6DA 3T3FA 2OCEA 3TS5C 1RM6C 4PE7A 4LJXA 4G9BA 4IQUA 3H40A 1N63A 9ICKA 2NLNA 1HUZA 1F70A 2KZMA 2W3RA 1OQPA 2KHNA 2DKZA 2ZN8A 1XK4C 1Z00B 3QNMA 3TDIA 2KVSA 2W54A 1QASA 5KFVA 4DOCA 2ZXHA 3QZ7A 2F3NA 1X02A 1ZRMA 1MN8A 4KITB 1SWVA 5KL1B 4PGXA 2QPTA 5HKWA 4ED3A 1RG6A 2WF6A 2WC6A 3GOFA 5IILA 3DXLA 4TQRA 4CNQA 2KFNA 3PR5B 4PL2A 1IJ5A 3B6XA 4NLGA 1KKXA 3NVVA 2QLTA 3VRRA 1N0YA 3SEIA 2QB0B 1B43A 4ACOA 4M9LA 3IV6A 5J0XA 3KTQA 2L5YA 5DB6A 2K7DA 2K7CA 3H0LB 2LCPA 2JT8A 2BE6A 3JPPA 3EVVA 4PALA 4F5OA 4KLFA 2YMLA 5DQIA 1DGVA 1CFCA 8ICLA 1QQ6A 2OS8C 4F93B 1JRPA 3HWTA 2DOQA 1DEKA 3M6KA 2AUCA 2BCAA 3BUWB 4O3OA 4I2FA 4DS4A 2E6WA 1B7TY 1YVLA 4YR0A 2KOBA 3NS1A 4UB4A 3DVEA 3H8MA 2BPGA 2KHVA 4XRHA 5KFHA 2UVRA 1M6YA 4YMOA 1Z3EB 4NY8A 3I5IC 3SD7A 1FW4A 2JPTA 5AKLA 2ASDA 4IRDA 5HL1A 4KN4A 3B87A 1YTZC 5EE0A 2KFGA 3VROA 3UXOA 4JWQA 1TAUA 1FEZA 1SZPA 2FI1A 3MBYA 2R2IA 4EYHB 5ALSA 5KFXA 2JXCA 2FJ6A 3KHRA 2YMQA 5KFQA 5CSNA 4HYKA 3H8JA 1ZFSA 5KFBA 1ZQTA 3HKZF 2FLLA 2JC2A 2WCEA 2K4IA 4BUGA 1UA1A 1DMOA 4F4YA 2FLPA 2YY6A 4DQQA 1PUZA 3T79A 1TAQA 5AIBA 2KNEA 4FS1A 1MR8A 5ALFA 3RAQA 5L1JA 3ZNIA 3JTDB 3AN1A 5ALGA 4DLEA 5DGAA 5J2AA 2I9GA 1ZQMA 2L2CA 3A4UB 2JZBB 3VRQA 4NQGA 4UB1A 3EK7A 3HP6A 2F76X 4JV1A 1B47A 1SSEB 4KN7A 2A3VA 1S1EA 1S0MA 1K94A 4ED6A 3NRWA 1XFRA 1A76A 4GC7A 2Y5IA 2PXIA 1TK8A 1CTRA 1G33A 1UHJA 2K8MB 1W7IB 7ICHA 2FOTA 1SWWA 4YGBB 2HBMA 1MXEA 3UMBA 4UB6U 1ALVA 5JRTA 5J2KA 1N2XA 1XFZO 1M31A 2ZUBA 3ZWHA 1XO0A 2BHNA 3LVWA 3IHQB 2KOTA 2B0CA 3UXPA 1ZMZA 4GNKB 4N5XA 1UURA 1QQ5A 5DQGA 2P71A 4YRUA 4QNLA 2F33A 3BZKA 2EZZA 2QDIA 2G2BA 1RFJA 2XI9A 4JUZA 1IXRA 4IS7A 2XCPA 3SI8A 4J9KA 1NZPA 5KG2A 1G8IA 7ICOA 2JMGA 2ZIVB 4EBCA 5A0LA 1KQMB 4UARA 4NDDA 5TISU 4EX6A 2ZIWB 3ZDEA 4YFKA 5ER5A 3SYZA 2BECA 3T5HA 3HT3A 1JALA 3FC4A 4EENA 2WAQC 1TTXA 1WWUA 2COLB 2HVHA 4IRCA 5FYXA 2K2FA 3JPTA 3TAQA 3TADA 1SCMB 3H8SA 3M1YA 1OW5A 4F5RA 5ALIA 1PSBA 5B5EU 3CABA 3LLEA 1Q3VA 3RBEA 2BZFA 2GGZA 4NXZA 3KD3A 2W7PA 1ZQDA 2BBNA 2JOJA 2HDOA 4TNCA 1ZQUA 3GV7B 4DUQA 3PW0A 2DFLA 3J81j 3E3RA 3VC8A 1J2MA 3EZ5A 3L5KA 4ICBA 1D1OA 5DB8A 2LLUA 3MFIA 3S0AA 3FE6A 3I5FC 1CEZA 1BR1B 1QLSA 2KLDA 5FI6A 2KFZA 3I76A 3D0YA 4F92B 3RM1A 1NIWA 4C0ZA 4DS7A 2I94A 1KK7Z 1RWYA 4DL6A 2FE9A 3CYMA 4GAOA 4UAVA 1BJFA 5KFMA 2KKVA 1NOMA 1L7PA 1QQ7A 2H5XA 2IS9A 2XCAA 1DVIA 4IQWA 3EPGA 5EWFA 1COKA 1T14A 2PFOA 4ELTA 4F5PA 4DL2A 3GK2A 3JPSA 3UM9A 1BNPA 4Z6CA 4HSZA 2W9CA 3NTUA 2BCVA 4KX3A 3DEEA 1N61A 3TUYC 3GFKB 9ICSA 1M45A 2V4RA 1YVHA 1NX2A 1TCFA 4MN0A 1BR4B 3NUQA 2OWOA 2EC6C 4M6WA 5AKHA 1N65A 1MHOA 1ZQBA 3DF0B 2KJ8A 2MAZA 2C2EA 3PSTA 1WCNA 5DGBA 1NJYA 1DJWA 4F4XA 4QIWF 3UMCA 4ZOHC 1OW4A 3ZD9A 3C29A 3LL8B 4UB8U 1S6CA 1AVSA 4C0JA 4QJFB 2YQEA 4YMNA 3LK1A 2M1UA 3HILA 4YBHB 1BT6A 1V1GA 4P5OE 5AI6A 2BGWA 1B8CA 3VGOA 2EQYA 3PM8A 1KEJA 4X5VA 4P4OA 3SS5A 3RJEA 2XICA 3WKAA 4B9VA 2CXYA 1ORGA 5J29A 4INWA 4QWDA 3C21A 5DKWA 2R8IA 1TNXA 4BJQA 4O3RA 3H4SE 5TZVA 4M04A 1NJXA 5J0QA 2BPFA 1WRLA 4Q8FA 5F3XB 5TNCA 2WC5A 3LCPC 4C0LA 2MU2A 3IRUA 1WLMA 4DEZA 2ZIUA 1CM1A 3ETLA 4CGZA 2I7AA 2M0RA 2IHMA 3DZTA 1Z4OA 1JFKA 1SCVA 2HBKA 4DLGA 1JMSA 4CDGA 2XY5A 4OVNF 1ODBA 3C28A 2BPCA 4J9OA 5KTQA 3NSKA 4OD0A 1N62A 2O60A 3C5GA 1BPYA 1OOGA 1Z2CB 2KQYA 5IINA 2IHNA 3QZ8A 1QSSA 4M9NA 1KQVA 4RQ7A 3PV8A 4Q45A 5AHXA 4QZAA 4FQTA 4C8LA 3N7RC 3TQ1A 2CBLA 1NJZA 4XJKB 8ICYA 1D9DA 1XK4A 1Y1AA 5ALRA 5HYDA 1OXJA 4P0QA 2PASA 1RROA 1NSHA 1IM4A 4OCZA 3VCBA 1S9FA 4ORAB 4LVSA 1K90D 2JXJA 5ALPA 2NRZA 3H0MB 4RT2A 2FCEA 3R72A 3JTDC 4EBEA 1IH0A 2PSRA 4DSJA 4XA5A 2XC9A 2KHQA 2KSOA 1TNQA 2LP2A 2IBKA 3KF9A 1WRZA 1JC2A 1ZQQA 1U45A 4O5KA 5KFLA 1E8AA 2YB4A 1ZQOA 4EZ9A 2KLEA 4KTQA 3QUCA 3RJGA 1QX7A 2WCJA 1QSLA 2DF4B 7ICSA 1S36A 1Q46A 1MQ1A 4Z6FA 2BQRA 1S76D 1KCYA 1JF0A 2KTQA 2ZIXA 3E2EA 5ALHA 4OJ6A 5AANA 2M0NA 4DOBA 3PSRA 1HQVA 2DL0A 2KGRA 4NLKA 4YI9A 1F8HA 2W8KA 5GTHU 1XFVO 1OMRA 1L7MA 4QWBA 5DICA 1BOCA 4MHVA 1JUOA 1COOA 3SG5A 2DPJA 5C0YA 2LMTA 2R8JA 1U5IB 4DQIA 2AQ0A 5ALJA 1OUQA 2BQUA 2L4HA 4ELVA 3H4BA 3LWMA 2P70A 2HHVA 2MBXA 3V7JA 5AI0A 2KFHA 3JPRA 5KG1A 3MSEB 2ESEA 1FFUA 1AK8A 1CFPA 2F2PA 2VA2A 3ED5A 5HR7A 1U49A 1LVHA 5ALTA 3GQCA 2WAQF 3BOWA 1S6IA 2ODGA 1DJXA 3AAJA 4PDZA 1PULA 3BS5A 4YI8A 3QUBA 4QW8A 1X6JA 4MBEA 1BF5A 2G5IB 3D2SA 3RB3A 4K4GA 4Y2RA 1UHKA 2NRWA 1AP4A 1SCMC 2ZTEA 1ZJMA 3QU9A 2K4PA 2GH1A 4DL4A 1VJ5A 2J6TA 5KFPA 1OZSA 4KX5A 4YG2A 4PHPA 4QZGA 3D73A 2M7LA 4OJLA 1ZQJA 1J2NA 9ICAA 1SYMA 7ICLA 4I2AA 4F3OA 4JK1A 1MQ2A 3B0YA 2KD1A 5J2BA 2VJ4A 4ED8A 1H38A 3F45A 2EGDA 5EE1A 2H61C 2ZKMX 3UO9A 4MFAA 3NVZA 4CE6A 1IQ5A 5D69A 1SK6D 3RLZA 3HKZC 3B0XA 2CPRA 4I2CA 3SG3A 3PX6A 3FWBA 2AJQA 2F3ZA 4GBAA 1D8YA 4DWIA 3MGHA 4JWNA 1NKBA 1ZQZA 3IQOA 4P2HA 3SS3A 4RNNA 1TRFA 3AKBA 2RLTA 1X9XA 5CP2A 1V38A 1QH9A 2G07A 4BWMA 1T94A 1B4CA 3O4XA 4QZDA 2I18A 1AUIB 3CZ0A 1J7RA 3SG4A 5AKYA 2AMIA 4J9PA 2E5SA 1XFXO 2JZIA 3O0FA 3IG8A 1CDPA 2Q0ZX 5KT5A 1SL1A 2GLEA 2QEHA 5JJGA 3CZ1A 4LZGA 1QLKA 1K9UA 3JPOA 5L9XA 3B9JA 2XIDA 5AKXA 3Q8KA 2IMWP 2V53A 4WRIA 4I5NB 1A2XA 2VA8A 1HUOA 2R8HA 5DDMA 3PNCA 1U47A 4MF8A 1KL9A 1F44A 2H3VA 5BPJA 1KBUA 2LC5A 3NXAA 5C5JA 3NSOA 3O6BA 5HLVA 3ZD8A 5DKRA 3RH4A 1KLNA 1KRPA 3BQTA 4TUQA 5KAIU 1JN3A 4HRGA 5AK5A 4B9SA 2WCLA 3HX4A 2ZNEA 3DVKA 1GQMA 9ICMA 5ALEA 1NYAA 2W43A 3BQ0A 2A1AA 5D7FA 2NXQA 2ES6A 1SBJA 3KKAC 2Y9UA 2AGOA 1SV4A 5KFDA 1M46A 2BCXA 1X66A 4TURA 5H2FU 1YZ7A 1ZQHA 1DTLA 4IC9A 3NSIA 3VRNA 2A19A 4AYBC 1FFVA 1HEKA 5ALWA 4F5QA 1PRWA 1IIPA 1GO3F 4EEYA 4QW9A 3OSNA 5CEHA 3OTQA 3EKHA 1DRGA 4OR9B 2KKPA 3F2CA 2RDJA 4YGAA 4PHJA 1C7YA 1QJTA 2EZYA 2Y1MA 5EE3A 1S3PA 4XYNA 4KLGA 7ICPA 3SZ2A 1TIZA 2JQ6A 2XGPA 3EYZA 3AQEA 1HJPA 2WCBA 1G4YR 2WTFA 3NVYA 5I94A 4B9MA 4Y2PA 1JROA 2JR5A 4EELA 1C3ZA 4KLMA 2LYBA 4LZDA 3RJFA 2BBMA 3UQ2A 1GJYA 1TOPA 2FPKA 5AM0A 1RQLA 3BQ1A 1UWOA 4QJ5B 5AIAA 4I29A 3BJHA 4PE4A 2J6UA 1FO4A 4CFQA 5ER4X 2K61A 3TZ1A 3S0BA 2KVCA 4HAIA 3WKEA 1Z00A 3BUMB 1JI7A 1SL8A 2OTGB 4CLNA 1ZYQA 3C1YA 4YXJA 4PJ0U 1J1EA 4ORBB 3CLNA 2LYAA 3EW9A 2LHIA 3DD4A 2W04A 4RNMA 1SV0C 4KYNA 5KFZA 4I27A 1JWDA 4MZJA 2ZXIA 3THVA 1P28A 2EAPA 5JU5A 1A4PA 1ZOLA 2QB0A 3KHHA 2FDRA 1ZQIA 8ICNA 4FTGA 5J2GA 4C8NA 1ZD2P 4QIWC 1F55A 2MSNA 2K0JA 1SL7A 5J2CA 3GIKA 1KFXS 4A8EA 1WCLA 1S10A 2N1RA 4YD1A 1K9PA 4F5NA 1RZTA 5ALXA 1SXEA 4DF4A 4O5CA 1XA5A 1X9WA 4MZLA 2KP7A 2W9AA 1LKJA 3WXAA 1SIJA 2KV2A 2KBMA 3CTNA 5KT4A 1T7PA 1UA0A 4M9JA 4C0KA 1KWOC 1QTXA 4USAA 4M2YA 2DUYA 2JNXA 1KSMA 2YMPA 4BXOB 3Q8MA 4R8UB 1FI6A 1VRKA 4CF4A 2MRLA 2F3YA 3TARA 5DQHA 4O3PA 3MDAA 2H3QA 5D46A 3NRZA 2KNJA 5J0OA 1ZXIA 1DOQA 3BZCA 4GFJA 4PL1A 5AI5A 8ICRA 1U4BA 2HHTA 4ECQA 1TN4A 3LK9A 1NPQA 2BCBA 3KHLA 3PMLA 4NV0A 3V7KA 3NGVA 3EVUA 1BODA 2W03A 4PZOA 2YGUA 3L47A 2GGMA 5ALQA 3I5GC 5CSFA 1JF2A 4CRXA 3MR2A 5DKQA 2F8KA 1CDLA 2JZBA 4Q8EA 8ICQA 3N7SC 5HMLA 2FJYA 4ED7A 2E30A 4Y2QA 2D8CA 3WKDA 4NLBA 3G6VA 2PFNA 8ICTA 5D49A 1RYRA 7ICQA 5IIJA 1QVIZ 2IA6A 4MEYA 2C2DA 1PVBA 3ICBA 1TVAA 4FBUA 4WQ3A 1ZQLA 9ICUA 3ISDA 2VIXA 2P6BB 1U48A 1SY9A 7ICGA 2EHBA 4PHKA 1ZQNA 3TAPA 1IJ6A 1NK6A 2C28A 2FMQA 2WCKA 1BPBA 4IL1A 3TKAA 5AEQA 1L3VA 1A75B 1QATA 4BY5A 3F2BA 5AI4A 5DLGA 1UPHA 2DBYA 5KFGA 2KSPA 3QE9Y 2AXTU 4DFDA 2K7OA 1ED1A 2ASLA 1NWDA 2D8NA 3SIAA 2BKEA 7ICIA 2RDIA 3AMZA 1IQ3A 3KOOA 3RAXA 2QEBA 2M1KB 5BPCA 2ZIVA 3EK4A 3RZSA 1TV9A 2ZIWA 1L2OC 2M8UA 4PZNA 2CN1A 3H4DA 1H4BA 1DELA 4J9MA 2DWQA 2V4QA 2PYQA 4UB2A 2F44A 1BVSA 1LVCD 1KSOA 4KLLA 2VJ5A 4QZCA 4RQ5A 1SKSA 2BL0B 1RQNA 4NL9C 3K1EA 1Q80A 5KFYA 1CB1A 5G5HA 8ICZA 9ICRA 3E58A 4Z6EA 9ICWA 5CB1A 5EL2A 1ZD4A 3ORYA 5J2FA 4YP3A 1XSNA 2G5HB 3TACB 4B9LA 3BQ7A 4Y2JA 5K89A 4M9GA 2HCFA 2H61A 2MA2A 1QCKA 2JXLA 1UQVA 2KICA 3NASA 3V6KA 2WCFA 2ZRSA 1A77A 3BYAA 5IIKA 4AYBF 2P6UA 2VKQA 3K75D 3ZDDA 1TE2A 1YZ6A 5E79U 1YURA 2FJUB 8ICBA 3ISBA 2HHUA 4TUPA 2FMPA 1DJZA 5EWGA 4DFKA 1D8BA 4PGYA 3SR6A 4R1EA 7ICTA 3DY9A 3RB0A 1L8OA 1EG3A 1ZQAA 1K2HA 7ICKA 3GU3A 4GXJA 4BX9C 1CLBA 3S0EA 2WF9A 3D2NA 3S0FA 2WHEA 3FAHA 3PSIA 4INXA 1UT5A 3M9NB 9ICHA 4RUCA 3JPQA 3BXKA 4XQ8A 1RTP1 5F9LA 3EK8A 4YGCB 2W7OA 1SKTA 3DF0A 3MGVA 2TN4A 2KG5A 2ISDA 3H7IA 1EG4A 5DG8A 3QUTA 4MRXA 2Y9TA 5AKGA 2I6XA 2H3FA 1ALWA 4F50A 3ZDCA 3K4GA 2JPOA 1JXLA 3FYHA 2JH7A 3PO5A 2WCHA 2CCMA 3NSLA 4KLDA 3PM2A 1BU3A 2Y0SC 2KI6D 2LLTA 3O78A 3I28A 3UQ0A 2ZN9A 1T3NA 5KFCA 2OTGC 3KKAA 1F4QA 2AH5A 2CTNA 1BMOA 3KBBA 3QU5A 3H8WA 5L1MA 2LM1A 4FQOA 1XWLA 1SRAA 3N7HA 3OX6A 1TK5A 3S0DA 2JRFA 2K89A 3SAGA 4NDBA 3QU7A 3PN7B 4KLQA 2FMSA 1QX5B 2W9BB 5F9NA 1F54A 1KFXL 2F2OA 2P6RA 8ICPA 1NCZA 2K8AA 1YX7A 2EANA 3PW2A 2PFPA 1OSAA 4CIDA 4UB5A 1N56A 3PW4A 4ECTA 4F91B 2A4JA 1URJA 3T5LA 3Q8LA 4P2YB 5DKNA 5J3XA 3N4MB 1XFYO 5CR0A 1EJ3A 2A1JB 2JTTA 2ERBA 3SIBA 4K4IA 1B0XA 2YN4A 4NDCA 1CLMA 3T5JA 3M8SA 1B9AA 1Z4HA 3SJSA 4XJKA 4ELUA 5J2HA 3CDNA 3SAHA 3D75A 4DQRA 4OKHA 1UHIA 4ECSA 4RPYA 1S5GY 4EYIB 5KFFA 2JULA 5I8NA 4HREE 3S0GA 1SV0A 1XNSA 4NLZA 8ICFA 9ICIA 2VRGA 5AXIA 4QZ9A 1LINA 2MHHA 3BS7A 2NYVA 3SQIA 2Z7JA 4P4PA 1J97A 3SENA 2LUXA 3PO4A 4MVFA 3Q8PB 3LVVA 2W3SA 3QEAZ 5ALMA 2RRDA 1KK7Y 1QS7A 8ICKA 1RXVA 1ZQCA 2D6FC 9ICEA 1YUSA 2BAPA 5DB9A 3BQ2A 3RJJA 2HHQA 2AGQA 2BR0A 7ICJA 5F6TA 4RT3A 3EG5B 4ECXA 3EKJA 1S0NA 8ICGA 2JGAA 1P7DA 1TNPA 4US9A 1CMGA 2AGPA 1X9MA 2EH9A 2D3DA 5HNKA 1SKRA 2PRUA 2E1EA 5AKIA 3G6YA 2QARB 5KFKA 2HF5A 4C4SA 1TNWA 1U5IA 3O4YA 1R6PA 1DGSA 3MC1A 4D1EA 4MRYA 1DC1A 8ICVA 1K96A 4I2JA 1DK2A 5HLOA 4TQSA 5AK6A 1WYGA 2YX8A 2W9MA 3C2MA 8ICHA 1JFJA 4OJPA 4M2PA 1K1SA 2W8LA 2KZ3A 4ED0A 1KWOB 3OHAA 3IVTA 4PT1A 3GZFA 1B1GA 7ICEA 5AK4A 1T4GA 3PLFB 3LWLA 3RBDA 1PVAA 4Q04A 4ECYA 5J0SA 4JKTA 3DVJA 1BPEA 5DBAA 1TWOA 9ICXA 3C5FA 3UMGA 2JU0A 4CFRA 4I2GA 1NCXA 1LB2B 2BL0C 3LK0A 4GGNA 7ICRA 2HVIA 3OB2B 4UAWA 4YN4A 5ALVA 1O03A 2K8BB 1B8RA 1Y6WA 3L4AA 1GM0A 8ICOA 2C22A 3IP4B 3CR2A 1GGZA 3TFRA 2BDPA 4DFPA 1B4FA 2F8LA 4PHNA 5K4LA 5KG6A 5J2EA 5CSJA 5G08A 3UPQA 3I5GB 9ICTA 1CI4A 8ICXA 3DDHA 1TKDA 1WUDA 5KG7A 3OJUA 2BCRA 4IR9A 3KEVA 2JT0A 1PVQA 1M39A 4FZMA 1K5OA 1ZUZA 4NLCA 3M8RA 2I2RE 2DKXA 2QACA 4FE3A 3ONNA 2JEJA 1SNLA 4ED2A 3AUOA 3E0FA 2LMUA 5ALNA 1BPXA 4NM2A 3RH5A 3BJYA 3KO0A 1HT9A 2M29A 2PI5A 1V1FA 2L98A 4M2OA 4RQ4A 2W11A 4O3QA 1N60A 2PI4A 1ZQKA 4KLUA 2LHTA 4J9RA 2ZJ5A 5JTIA 2BCUA 2HBLA 5AM3A 4R65A 5J0TA 2CRXA 2ISPA 2WC8A 4EBDA 2WCMA 4NL9A 3MR3A 3R1PA 4R63A 2WORA 2DGZA 3GIMA 4MLWA 1X2IA 1DF0B 4F72A 5DDYA 2Y0SF 4JWMA 4FO6A 1NK8A 2KFFA 1XSPA 1L2OB 2LI6A 4Y2TA 2VANA 5KU1A 2UVUA 4OZDA 3WHTB 4QJ3B 3FS7A 1T3QA 2KQ6A 1ZQSA 4ED1A 2HBJA 1PALA 3VB1A 4I5KA 1VDVA 3NHIA 3OSPA 4IQVA 1NK9A 3M9OB 1V9PA 2BDUA 2LYHA 1LA3A 3DV9A 1DK3A 5CRXA 4I2BA 1L3TA 2PQLA 5ALOA 4UBBA 4GGFC 2PMZC 1J55A 2JEGA 1NCYA 1QIWA 1LKYB 2L4IA 2LUCA 3Q8IA 1ZQWA 3KHEA 3QU4A 5D4BA 4KLSA 4UAUA 5DBBA 2OM6A 3F2DA 5DBCA 2Q4TA 3PN7C 1XFWO 4NJ8A 3TI0A 4O9MA 1OZOA 1F5SA 3C1ZA 2NRTA 4IJ7A 5KFIA 1YRTB 5AK3A 1A0PA 1SKWA 2Q91A 2NRVA 2IOFK 3MR5A 1SR6C 3N28A 1MF8B 2CXJA 3M0WA 3SAFA 5EE9A 4QZIA 1K8UA 1ZD5A 2E8NA 2WB1F 5AM2A 4YQWA 2O5GA 2F8PA 4NWIA 4U6PA 4E0DA 4P0PB 3AU6A 2XO7A 1L6NA 2KYFA 4TUSA 1KQQA 1UT8A 4RQ2A 2I1QA 2JRZA 1SW8A 1XSLA 4I2IA 1QSYA 1L8LA 5I2QA 5J0RA 2KDHA 1B7TZ 5G5GA 1HIWA 2G08A 2E8MA 2MUTB 2ZTCA 3V72A 4BDPA 2ALZA 4I2EA 2LNKA 3N97B 9ICBA 1CLLA 3JPNA 1QLNA 1J7PA 3PR4A 1QXPA 4CPVA 1W9ZA 4B9NA 5KSZA 2OHFA 4C7ZA 3MGIA 4DSLA 1W7JB 2PALA 2IOHA 2K60A 3EWAA 1BG1A 3SMVA 4CF3A 4DRWA 4KLJA 3PX4A 4UQGA 4GXKA 5HKZA 4FFDA 3AQFA 5DLFA 2MAXA 4QZHA 1WLZA 3Q8QB 2RHFA 4G3IA 4F4KA 4QZBA 2KEYA 3C1VA 2HQ8A 4KMOB 4YGEB 1S26D 1MWNA 1RYSA 3D2QA 3M7DA 1SMGA 2KI4B 4OCIA 1NZBA 4JQ0D 5AI9A 3IN5A 2B21A 1JUDA 5KFWA 3B88A 2KYCA 1C3YA 2KIVA 2W55A 1NNLA 4BXOA 1IG5A 4R8UA 4NLNA 3GILA 1VLBA 2R8GA 2LV7A 4GLXA 2EAOA 4R64A 5FI7A 1OOIX 5J0YA 1PSRA 5PALA 1SGGA 2EZXA 1L5UA 1UHNA 5CA7A 3GIIA 3C23A 1QV1A 2L50A 3I1YA 3PW7A 4DFMA 4ZCVA 1BPDA 1L7NA 3FDSA 4NM1A 1IGVA 1S97A 9ICFA 3FWCA 3O2PA 5KT6A 2G09A 1FIQA 3IG5A 5AM5A 4KLTA 1U9LA 5T14A 1XS9D 3FE9A 1S77D 3MR6A 1PVRA 4KLOA 4ICAA 4RQMA 1DJIA 2LVKA 3ZI4A 1IRJA 2YB1A 9ICQA 2PMYA 5AERA 3WKBA 1OOJA 4DSEA 1CRXA 1XC9A 1TUZA 2HQWA 2M7NA 2ZUCA 4Y2VA 4RQ6A 4CCHA 2OH2A 4QZFA 3V7LA 4YXMA 2EDUA 4WJ3B 1LA0A
chains in the Genus database with same CATH topology
5JRTA 3O4XA 2KG5A 1JI7A 5J8YC 2KLEA 2Y9TA 2F3NA 3SS4A 2BAPA 1W9ZA 1SV0C 1RG6A 2GLEA 4KYNA 2K60A 5JTIA 2EAPA 5JU5A 3EG5B 3HILA 4I5NB 3SEIA 2EAMA 3OBVA 2QB0B 1SXDA 2JV3A 2QB0A 4IS7A 3PM2A 4MEWA 2L5YA 2DL0A 3UNWA 4NL9A 3KKAA 2D3DA 4MHVA 3SS5A 4PZNA 3K1RB 1PK1A 2QARB 2QARA 1DELA 1WWUA 1DEKA 2F44A 5L1MA 1SXEA 3TADA 2ESEA 1OW5A 1DC1A 3H8MA 2KE7A 4NL9C 1DXSA 4I5KA 1WWVA 2KIVA 5F3XB 2ES6A 3KKAC 2Y9UA 1SV4A 3BS5B 3IVTA 3BS5A 5FI2A 5HL1A 1X66A 1PK3A 3TACB 3BQ7A 2EANA 2EAOA 1PK1B 5FI7A 4JKTA 1SGGA 3TADC 2QKQA 1LKYB 1LKYA 2KLDA 1UQVA 2K4PA 5FI6A 2BNXA 1Z2CB 1Z1VA 5KNIA 2FE9A 4GAOA 4NJ8A 2YTUA 3IDWA 1UCVA 4IJ7A 1B0XA 4PZOA 4RQNA 2LMRA 2YGUA 2LPEA 1B4FA 1COKA 2E8OA 1Z4HA 3UO9A 2E8PA 1X40A 2F8KA 2E8NA 4I5LB 5I94A 1KW4A 2KMDA 2D8CA 1OXJA 5J8YA 4RQMA 1F0MA 3KEVA 5D3OA 2QB1A 4GBAA 1V85A 1SV0A 2B6GA 4I5JA 2DKXA 3SS3A 3BS7A 1X9XA 1V38A 2DKZA 2KSOB 3SENA 2KSOA 2E8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRT A;  2KG5 A;  1JI7 A;  5J8Y C;  2Y9T A;  2F3N A;  1SV0 C;  1RG6 A;  2GLE A;  2K60 A;  5JTI A;  2EAP A;  5JU5 A;  3HIL A;  3SEI A;  2EAM A;  2QB0 B;  1SXD A;  2JV3 A;  2QB0 A;  4IS7 A;  2L5Y A;  2DL0 A;  4NL9 A;  3KKA A;  2D3D A;  4MHV A;  4PZN A;  3K1R B;  1PK1 A;  2QAR B;  2QAR A;  1WWU A;  2F44 A;  5L1M A;  1SXE A;  3TAD A;  2ESE A;  1OW5 A;  3H8M A;  2KE7 A;  4NL9 C;  1DXS A;  1WWV A;  2KIV A;  5F3X B;  2ES6 A;  3KKA C;  2Y9U A;  1SV4 A;  3BS5 B;  3BS5 A;  1X66 A;  1PK3 A;  3TAC B;  3BQ7 A;  2EAN A;  2EAO A;  1PK1 B;  1SGG A;  3TAD C;  2QKQ A;  1LKY B;  1LKY A;  1UQV A;  2K4P A;  1Z1V A;  5KNI A;  2FE9 A;  4NJ8 A;  2YTU A;  3IDW A;  1UCV A;  1B0X A;  4PZO A;  4RQN A;  2LMR A;  2LPE A;  1B4F A;  1COK A;  2E8O A;  2E8P A;  1X40 A;  2F8K A;  2E8N A;  1KW4 A;  2KMD A;  2D8C A;  1OXJ A;  5J8Y A;  4RQM A;  1F0M A;  2QB1 A;  1V85 A;  1SV0 A;  2B6G A;  2DKX A;  3BS7 A;  1X9X A;  1V38 A;  2DKZ A;  2KSO B;  3SEN A;  2KSO A;  2E8M A; 
#chains in the Genus database with same CATH topology
 1YUT A;  1DJY A;  5B8I B;  3CGA A;  2K8C B;  1A75 A;  3BFH A;  1XU4 A;  2CT9 A;  2AQ4 A;  1TFR A;  2PFQ A;  2HMX A;  4Q44 A;  3IM1 A;  2I5H A;  2EAM A;  2P35 A;  1SXD A;  3TAN A;  4MEW A;  4JPZ B;  2RGI A;  1S5L U;  4F2S A;  9ICN A;  1D9F A;  4BWJ A;  5B66 U;  2WF8 A;  7ICU A;  8ICM A;  7ICV A;  4IRK A;  2L5X B;  5J0U A;  4OJO A;  1MA7 A;  4F71 A;  2H8V A;  4KMU A;  2WND A;  4BY4 A;  4UAY A;  2KK0 A;  1ZQ1 C;  2E3T A;  2KI6 C;  1K95 A;  2IOF A;  4QZ8 A;  1OOH A;  2K4E A;  3D10 A;  3PAL A;  4M9H A;  1NKE A;  1ZOT B;  3OB1 B;  3D6J A;  5KG4 A;  4DL7 A;  3RJI A;  2R18 A;  5KFJ A;  3BDP A;  1IWQ A;  3K1Z A;  4IR1 A;  5KTY A;  4OJ5 A;  1XFU O;  1ZET A;  1DXS A;  2DPI A;  4YR3 A;  5AKZ A;  3LDA A;  3RJH A;  3V6J A;  2OYY A;  2LM5 A;  1IKU A;  4XUS A;  2HSZ A;  4B9T A;  5J0P A;  5KG0 A;  1DT7 B;  9ICL A;  5KFU A;  4DO9 A;  5KFS A;  1SB3 C;  2GV5 A;  1Z19 A;  4DL3 A;  1ZQF A;  3WK6 A;  2QKQ A;  1CKK A;  3DVM A;  3L4L A;  1KDH A;  1SL2 A;  3CW2 C;  5KT2 A;  1NX0 A;  1NUB A;  1Z1V A;  2PMZ F;  5GTI U;  2B1U A;  2MA1 A;  2KZZ A;  2NCO A;  5CWR A;  1C7V A;  2JEI A;  2K4H A;  1DJG A;  2LM4 A;  2KAV A;  1UHU A;  4DSK A;  4RQN A;  1R2U A;  5KFT A;  1ARO P;  4U8D A;  3SG6 A;  2JHD A;  4UB3 A;  2LPE A;  1RPL A;  1QWV A;  4A4C A;  3WK7 A;  3A8R A;  1YUU A;  8ICU A;  1OMV A;  5ALZ A;  4I5L B;  3BUX B;  3I5H B;  1D8L A;  4F0Z B;  4IQT A;  1CFD A;  2KIW A;  1L7O A;  1RYU A;  4PE0 A;  1F0M A;  3PZP A;  4J9S A;  3RJK A;  2HHS A;  2MRD A;  1L3S A;  3OHM B;  3R9K A;  1CDN A;  4ECW A;  1QX2 A;  4UAS A;  4O3N A;  3RB4 A;  2B6G A;  2Y1N A;  1GGW A;  4MEX A;  3JVT B;  4GUK A;  3KZX A;  3QYP A;  4GFT A;  3PW5 A;  3ETR A;  1YR5 A;  4JV0 A;  4ECZ A;  4DQP A;  2HHX A;  1M63 B;  4AP9 A;  3K21 A;  5J8Y C;  1QV0 A;  4M0A A;  2GOL A;  4FBT A;  3L4P A;  4B6J A;  4C4T A;  4N1F A;  2BKI B;  3Q8S B;  2GO7 A;  5IIM A;  3L3F X;  2L2E A;  1N48 A;  3OBV A;  4M47 A;  2JV3 A;  3GIJ A;  1S5G Z;  2HI0 A;  1S8O A;  2L51 A;  3FE8 A;  2G9B A;  4YMM A;  2LVJ A;  5J2J A;  2MLE C;  5AM4 A;  1QVI Y;  4GPL B;  3KPX A;  3MDC A;  1ZRN A;  3K1R B;  2GTE A;  3PY8 A;  7ICN A;  2HOQ A;  1OOF A;  4HRH A;  4AOM A;  4GGF A;  1J7O A;  5IIO A;  3TDZ A;  2HW3 A;  2KPH A;  1FPW A;  1V97 A;  1S6J A;  3M6Z A;  5KFO A;  3T5K A;  4C7Y A;  2AHO B;  5J0W A;  1X42 A;  2F1H A;  2ZJA A;  4F4W A;  3OP0 A;  3WK4 A;  1JIH A;  2BKH B;  2W9B A;  3OGN A;  5KFA A;  5L1L A;  2FCD A;  1PK3 A;  4YD2 A;  2LHL A;  1CDM A;  1SPY A;  4FS2 A;  2VA3 A;  4RQ3 A;  4RQ1 A;  4MFF A;  1WDC C;  3PFV A;  3SV3 A;  1ECW A;  4UPG A;  2KI4 C;  4KLE A;  5AKK A;  2OXO A;  4Q43 A;  4MZK A;  5ALY A;  4R66 A;  3D0Y B;  5ALL A;  1MSW D;  2A1J A;  3WKC A;  2LMV A;  5EOZ A;  2NCP A;  8ICW A;  2KGB C;  2LLS A;  4ETO A;  5DB7 A;  1SL9 A;  5III A;  5KFR A;  3U26 A;  1KK8 B;  2ZND A;  3IDW A;  5JUM A;  1UCV A;  2LMR A;  1KFU S;  3F5A A;  3TFS A;  4ECV A;  3AAK A;  4O3M A;  4C80 A;  5HP4 A;  3PMN A;  4JD9 A;  1NX1 A;  1OMD A;  1SR6 B;  1F4O A;  3BUO B;  5BOM A;  1MXL C;  5KG5 A;  1ZJN A;  2L0P A;  3WK5 A;  4PCW A;  2JNF A;  4C4R A;  2W9C B;  3BQ3 A;  3RRG A;  1JBA A;  1A29 A;  4IL6 U;  2HHW A;  3CR5 X;  5D3O A;  4Y2Y A;  1EL4 A;  2UVV A;  5ALU A;  1DQE A;  3RRH A;  4I5J A;  3S6J A;  4M6W B;  2WB1 C;  1CMF A;  1MC8 A;  2LAN A;  5KAF U;  2CNP A;  2KAY A;  3TDU A;  1ZQX A;  3H0R B;  1QTM A;  3PSP A;  1PVP A;  4RU9 A;  3GDX A;  1TUJ A;  4PGQ A;  3RH6 A;  4DFJ A;  3D78 A;  3PX0 A;  4DL5 A;  1S0V A;  1BNO A;  4J9N A;  4ECR A;  2PVB A;  2ZG6 A;  2XY7 A;  2NRX A;  1ZD3 A;  3SS4 A;  5AKE A;  4F2R A;  1KFT A;  4ZH4 A;  3WNX B;  2HOF A;  4J9Q A;  5AFP A;  1A03 A;  4DOA A;  2H3Z A;  5I2L A;  2LVV A;  2GWS A;  4GXI A;  2P66 A;  4RQ8 A;  4UAZ A;  3R1O A;  2AU0 A;  2JWW A;  3HJE A;  1MUX A;  1JXE A;  4RUA A;  1J7Q A;  2XGQ A;  3UNW A;  4EZ6 A;  3OGU A;  2NZ0 A;  4US8 A;  5AI8 A;  4PH5 A;  4O3S A;  3CZ2 A;  4DIR A;  1AHR A;  1Y1X A;  4E68 A;  5KG3 A;  5KFE A;  2UVW A;  3IQQ A;  9ICO A;  3SG7 A;  1PK1 A;  2QAR A;  3GV5 B;  3HX0 A;  3CS1 A;  5J2I A;  2F2A B;  3RFA A;  3M9M B;  1TAM A;  3AL0 B;  5HHI A;  1Y88 A;  1CUK A;  3A0H U;  1WY9 A;  4OV2 A;  1LXF C;  1ZQP A;  2QEO A;  4ORC B;  3PSF A;  4YGD B;  1NP8 A;  3EVR A;  3IF7 A;  3GV8 B;  4KLI A;  1C7W A;  3WHU B;  3QX7 A;  2BCS A;  3R1V A;  3HPO A;  1Q8K A;  3EPI A;  4F7F A;  4EEK A;  4YVZ A;  3CP8 A;  2ZIU B;  4MF2 A;  4DS5 A;  2Q4U A;  3SV4 A;  1PK1 B;  3QXG A;  4I2H A;  4UW9 A;  2LP3 A;  2KBI A;  5ALK A;  1FF1 A;  1XO1 A;  1K9K A;  2F77 X;  2G0A A;  1ZQV A;  2H3I A;  8ICS A;  4MFC A;  2RP5 A;  1YRU B;  3TS5 B;  3G6X A;  2KN7 A;  3MAB A;  4AQJ A;  2RQ5 A;  2FPL A;  1YT3 A;  3AU2 A;  1AJ4 A;  4PHM A;  2F1I A;  1PZN A;  5CJ7 A;  3ZDB A;  2E8O A;  4QWC A;  2E8P A;  4M2Q A;  4WQ2 A;  2HOI A;  3F53 A;  2KMD A;  3PAT A;  1K1Q A;  2WF7 A;  4P0Q B;  1T8E A;  3F5E A;  5L1K A;  3N7P D;  2E1F A;  2FPM A;  2C2R A;  2QB1 A;  1XYD A;  3QU2 A;  4I28 A;  1V85 A;  3AKA A;  1NK0 A;  1RJV A;  5AM1 A;  2M97 A;  7ICM A;  2XVT A;  4Y2U A;  1ZAC A;  2M9N A;  2WFA A;  2MLF C;  2KSO B;  3EUB 2;  4JV2 A;  3I5H C;  2KJ9 A;  1NJW A;  2F1J A;  2Y4Q A;  4DSF A;  5AKJ A;  1DGJ A;  2YMM A;  2OS8 B;  1BGX T;  4P4M A;  4USL A;  5KT7 A;  3B7A A;  3NGD A;  4PHE A;  1YX8 A;  2ZRT A;  3CNH A;  2ZIX B;  1ZQR A;  1RDF A;  4CF5 A;  3JVT C;  4PHD A;  2BE4 A;  3GK4 X;  4N1G A;  2V9W A;  1KQM C;  2M9G A;  4DCC A;  4GIB A;  2R8K A;  3OHB A;  3I5I B;  4O0I A;  1NX3 A;  1DF0 A;  2LE9 B;  5DG7 A;  4QJ4 B;  1EXN A;  2LAP A;  4RZR A;  3CYZ A;  4PPX A;  2K2A A;  1F71 A;  3HRD D;  1XVJ A;  3FM9 A;  1ZQG A;  3PVX A;  8ICJ A;  1X9S A;  4ZCU A;  1KN5 A;  2KE7 A;  1NK4 A;  1KSP A;  3ICX A;  2BCQ A;  1Y1U A;  2O6K A;  3DYE A;  1C07 A;  3BOW B;  2JTZ A;  4UBC A;  2AAO A;  1JSA A;  3FIA A;  1QIV A;  3NVW A;  3ALR A;  3BS5 B;  3KZI U;  2NO5 A;  4PE1 A;  2FLN A;  4QZE A;  3V6H A;  1X6I A;  4C8O A;  5HHH A;  2ZUD A;  4U7C A;  3ISC A;  2JT3 A;  1C20 A;  1OE9 B;  4OO1 J;  2DQN B;  4JMU A;  3V2L A;  8ICI A;  1ZQE A;  5DG9 A;  2K7B A;  3BFA A;  3TAD C;  1J1D A;  1LKY A;  2WF5 A;  5HKY A;  3VRP A;  1LS8 A;  3CZT X;  3AM9 A;  1Z4N A;  2SCP A;  4F8R A;  1Z1B A;  3KHG A;  4PHA A;  3PJI A;  1Y0V H;  1EXR A;  2HET A;  4C8K A;  1L3U A;  2ASJ A;  2YTU A;  2ATL A;  1UP5 A;  3QME A;  1XO5 A;  9ICJ A;  3QRX A;  1NI3 A;  3WU2 U;  1NKC A;  3BFB A;  4EX7 A;  1TK0 A;  1KW4 A;  3UXN A;  2ISO A;  2LBO A;  1SL0 A;  3MFH A;  2XY6 A;  5KFN A;  5CHG A;  3C2K A;  5J8Y A;  2BQ3 A;  2J6S A;  4P0P A;  3QEB Z;  3SG2 A;  1UHH A;  4C8M A;  4J9L A;  4GC6 A;  3OX5 A;  4RPX A;  2Y1J A;  1KK8 C;  3QUQ A;  1TCO B;  1B22 A;  1KFU L;  1CNP A;  2KJ5 A;  8ICA A;  4RNO A;  1AJ5 A;  4FZN A;  3WK9 A;  2MUT A;  1L7Z A;  4O5E A;  5AIC A;  1WRK A;  4A4B A;  3WK8 A;  5IBW A;  2NV3 A;  9ICP A;  5HMM A;  3KFU F;  1FI5 A;  5EWE A;  3RR8 A;  9ICV A;  3HCM A;  1DGU A;  5ALD A;  5BOL A;  3HW8 A;  2M49 B;  5CPV A;  9ICC A;  5FP0 A;  3D77 A;  1IG6 A;  1DJH A;  1CM4 A;  4J03 A;  9ICG A;  2LKY A;  5KT3 A;  1A6S A;  3A0B U;  1N5X A;  4YCX A;  3AEV A;  1NK7 A;  4DF8 A;  4DQS A;  5GQQ C;  1IIO A;  2KAX A;  1REC A;  5JOL A;  4QWE A;  3BUN B;  2MJW B;  2H2K A;  3RF9 A;  5L1I A;  3GK1 A;  1H8B A;  4ECU A;  2LVI A;  2SAS A;  2OPO A;  2JH1 A;  1LV5 A;  4KLH A;  3I5F B;  1BLQ A;  1RXW A;  2PKE A;  3OPX A;  1N2D A;  4F4Z A;  7ICF A;  2G06 A;  1IV8 A;  2HPS A;  1WWV A;  4K4H A;  1JX4 A;  2OEH A;  1Q3U A;  3CRX A;  4Y2S A;  1BPZ A;  3D74 A;  5FI2 A;  1AQ6 A;  3LYS A;  1UUS A;  2ZJ8 A;  1O08 A;  2QEV A;  4YR2 A;  1RK9 A;  1B8L A;  3OJS A;  1KFD A;  1MQ3 A;  8ICE A;  3RB6 A;  1WDC B;  4AQI A;  4I2D A;  2BNX A;  2NO4 A;  1ZQY A;  4BGD A;  4QWA A;  4UAT A;  2JEF A;  5HR6 A;  3RR7 A;  3C2L A;  5KNI A;  3Q8R B;  4B9U A;  3B86 A;  3CWG A;  5CSI A;  3TUY B;  1EH2 A;  1CFF A;  2Y1I A;  1FBV A;  3NHT A;  1KTQ A;  1WG8 A;  2EC6 B;  5I2O A;  4MSP A;  1SZH A;  4RPZ A;  4JB3 A;  2M3W A;  3D76 A;  5J2D A;  2WOS A;  4DCK A;  5KL8 B;  4DSI A;  3ZDA A;  1X40 A;  1S0O A;  3CR4 X;  1KFS A;  4Y2X A;  1K93 D;  1NK5 A;  8ICC A;  2ZFD A;  4FZL A;  1PK0 D;  3RTV A;  4RQ0 A;  2ZTD A;  4L9M A;  1N5W A;  4Z6D A;  3T3F A;  2OCE A;  3TS5 C;  1RM6 C;  4PE7 A;  4LJX A;  4G9B A;  4IQU A;  3H40 A;  1N63 A;  9ICK A;  2NLN A;  1HUZ A;  1F70 A;  2KZM A;  2W3R A;  1OQP A;  2KHN A;  2DKZ A;  2ZN8 A;  1XK4 C;  1Z00 B;  3QNM A;  3TDI A;  2KVS A;  2W54 A;  1QAS A;  5KFV A;  4DOC A;  2ZXH A;  3QZ7 A;  2F3N A;  1X02 A;  1ZRM A;  1MN8 A;  4KIT B;  1SWV A;  5KL1 B;  4PGX A;  2QPT A;  5HKW A;  4ED3 A;  1RG6 A;  2WF6 A;  2WC6 A;  3GOF A;  5IIL A;  3DXL A;  4TQR A;  4CNQ A;  2KFN A;  3PR5 B;  4PL2 A;  1IJ5 A;  3B6X A;  4NLG A;  1KKX A;  3NVV A;  2QLT A;  3VRR A;  1N0Y A;  3SEI A;  2QB0 B;  1B43 A;  4ACO A;  4M9L A;  3IV6 A;  5J0X A;  3KTQ A;  2L5Y A;  5DB6 A;  2K7D A;  2K7C A;  3H0L B;  2LCP A;  2JT8 A;  2BE6 A;  3JPP A;  3EVV A;  4PAL A;  4F5O A;  4KLF A;  2YML A;  5DQI A;  1DGV A;  1CFC A;  8ICL A;  1QQ6 A;  2OS8 C;  4F93 B;  1JRP A;  3HWT A;  2DOQ A;  1DEK A;  3M6K A;  2AUC A;  2BCA A;  3BUW B;  4O3O A;  4I2F A;  4DS4 A;  2E6W A;  1B7T Y;  1YVL A;  4YR0 A;  2KOB A;  3NS1 A;  4UB4 A;  3DVE A;  3H8M A;  2BPG A;  2KHV A;  4XRH A;  5KFH A;  2UVR A;  1M6Y A;  4YMO A;  1Z3E B;  4NY8 A;  3I5I C;  3SD7 A;  1FW4 A;  2JPT A;  5AKL A;  2ASD A;  4IRD A;  5HL1 A;  4KN4 A;  3B87 A;  1YTZ C;  5EE0 A;  2KFG A;  3VRO A;  3UXO A;  4JWQ A;  1TAU A;  1FEZ A;  1SZP A;  2FI1 A;  3MBY A;  2R2I A;  4EYH B;  5ALS A;  5KFX A;  2JXC A;  2FJ6 A;  3KHR A;  2YMQ A;  5KFQ A;  5CSN A;  4HYK A;  3H8J A;  1ZFS A;  5KFB A;  1ZQT A;  3HKZ F;  2FLL A;  2JC2 A;  2WCE A;  2K4I A;  4BUG A;  1UA1 A;  1DMO A;  4F4Y A;  2FLP A;  2YY6 A;  4DQQ A;  1PUZ A;  3T79 A;  1TAQ A;  5AIB A;  2KNE A;  4FS1 A;  1MR8 A;  5ALF A;  3RAQ A;  5L1J A;  3ZNI A;  3JTD B;  3AN1 A;  5ALG A;  4DLE A;  5DGA A;  5J2A A;  2I9G A;  1ZQM A;  2L2C A;  3A4U B;  2JZB B;  3VRQ A;  4NQG A;  4UB1 A;  3EK7 A;  3HP6 A;  2F76 X;  4JV1 A;  1B47 A;  1SSE B;  4KN7 A;  2A3V A;  1S1E A;  1S0M A;  1K94 A;  4ED6 A;  3NRW A;  1XFR A;  1A76 A;  4GC7 A;  2Y5I A;  2PXI A;  1TK8 A;  1CTR A;  1G33 A;  1UHJ A;  2K8M B;  1W7I B;  7ICH A;  2FOT A;  1SWW A;  4YGB B;  2HBM A;  1MXE A;  3UMB A;  4UB6 U;  1ALV A;  5JRT A;  5J2K A;  1N2X A;  1XFZ O;  1M31 A;  2ZUB A;  3ZWH A;  1XO0 A;  2BHN A;  3LVW A;  3IHQ B;  2KOT A;  2B0C A;  3UXP A;  1ZMZ A;  4GNK B;  4N5X A;  1UUR A;  1QQ5 A;  5DQG A;  2P71 A;  4YRU A;  4QNL A;  2F33 A;  3BZK A;  2EZZ A;  2QDI A;  2G2B A;  1RFJ A;  2XI9 A;  4JUZ A;  1IXR A;  4IS7 A;  2XCP A;  3SI8 A;  4J9K A;  1NZP A;  5KG2 A;  1G8I A;  7ICO A;  2JMG A;  2ZIV B;  4EBC A;  5A0L A;  1KQM B;  4UAR A;  4NDD A;  5TIS U;  4EX6 A;  2ZIW B;  3ZDE A;  4YFK A;  5ER5 A;  3SYZ A;  2BEC A;  3T5H A;  3HT3 A;  1JAL A;  3FC4 A;  4EEN A;  2WAQ C;  1TTX A;  1WWU A;  2COL B;  2HVH A;  4IRC A;  5FYX A;  2K2F A;  3JPT A;  3TAQ A;  3TAD A;  1SCM B;  3H8S A;  3M1Y A;  1OW5 A;  4F5R A;  5ALI A;  1PSB A;  5B5E U;  3CAB A;  3LLE A;  1Q3V A;  3RBE A;  2BZF A;  2GGZ A;  4NXZ A;  3KD3 A;  2W7P A;  1ZQD A;  2BBN A;  2JOJ A;  2HDO A;  4TNC A;  1ZQU A;  3GV7 B;  4DUQ A;  3PW0 A;  2DFL A;  3J81 j;  3E3R A;  3VC8 A;  1J2M A;  3EZ5 A;  3L5K A;  4ICB A;  1D1O A;  5DB8 A;  2LLU A;  3MFI A;  3S0A A;  3FE6 A;  3I5F C;  1CEZ A;  1BR1 B;  1QLS A;  2KLD A;  5FI6 A;  2KFZ A;  3I76 A;  3D0Y A;  4F92 B;  3RM1 A;  1NIW A;  4C0Z A;  4DS7 A;  2I94 A;  1KK7 Z;  1RWY A;  4DL6 A;  2FE9 A;  3CYM A;  4GAO A;  4UAV A;  1BJF A;  5KFM A;  2KKV A;  1NOM A;  1L7P A;  1QQ7 A;  2H5X A;  2IS9 A;  2XCA A;  1DVI A;  4IQW A;  3EPG A;  5EWF A;  1COK A;  1T14 A;  2PFO A;  4ELT A;  4F5P A;  4DL2 A;  3GK2 A;  3JPS A;  3UM9 A;  1BNP A;  4Z6C A;  4HSZ A;  2W9C A;  3NTU A;  2BCV A;  4KX3 A;  3DEE A;  1N61 A;  3TUY C;  3GFK B;  9ICS A;  1M45 A;  2V4R A;  1YVH A;  1NX2 A;  1TCF A;  4MN0 A;  1BR4 B;  3NUQ A;  2OWO A;  2EC6 C;  4M6W A;  5AKH A;  1N65 A;  1MHO A;  1ZQB A;  3DF0 B;  2KJ8 A;  2MAZ A;  2C2E A;  3PST A;  1WCN A;  5DGB A;  1NJY A;  1DJW A;  4F4X A;  4QIW F;  3UMC A;  4ZOH C;  1OW4 A;  3ZD9 A;  3C29 A;  3LL8 B;  4UB8 U;  1S6C A;  1AVS A;  4C0J A;  4QJF B;  2YQE A;  4YMN A;  3LK1 A;  2M1U A;  3HIL A;  4YBH B;  1BT6 A;  1V1G A;  4P5O E;  5AI6 A;  2BGW A;  1B8C A;  3VGO A;  2EQY A;  3PM8 A;  1KEJ A;  4X5V A;  4P4O A;  3SS5 A;  3RJE A;  2XIC A;  3WKA A;  4B9V A;  2CXY A;  1ORG A;  5J29 A;  4INW A;  4QWD A;  3C21 A;  5DKW A;  2R8I A;  1TNX A;  4BJQ A;  4O3R A;  3H4S E;  5TZV A;  4M04 A;  1NJX A;  5J0Q A;  2BPF A;  1WRL A;  4Q8F A;  5F3X B;  5TNC A;  2WC5 A;  3LCP C;  4C0L A;  2MU2 A;  3IRU A;  1WLM A;  4DEZ A;  2ZIU A;  1CM1 A;  3ETL A;  4CGZ A;  2I7A A;  2M0R A;  2IHM A;  3DZT A;  1Z4O A;  1JFK A;  1SCV A;  2HBK A;  4DLG A;  1JMS A;  4CDG A;  2XY5 A;  4OVN F;  1ODB A;  3C28 A;  2BPC A;  4J9O A;  5KTQ A;  3NSK A;  4OD0 A;  1N62 A;  2O60 A;  3C5G A;  1BPY A;  1OOG A;  1Z2C B;  2KQY A;  5IIN A;  2IHN A;  3QZ8 A;  1QSS A;  4M9N A;  1KQV A;  4RQ7 A;  3PV8 A;  4Q45 A;  5AHX A;  4QZA A;  4FQT A;  4C8L A;  3N7R C;  3TQ1 A;  2CBL A;  1NJZ A;  4XJK B;  8ICY A;  1D9D A;  1XK4 A;  1Y1A A;  5ALR A;  5HYD A;  1OXJ A;  4P0Q A;  2PAS A;  1RRO A;  1NSH A;  1IM4 A;  4OCZ A;  3VCB A;  1S9F A;  4ORA B;  4LVS A;  1K90 D;  2JXJ A;  5ALP A;  2NRZ A;  3H0M B;  4RT2 A;  2FCE A;  3R72 A;  3JTD C;  4EBE A;  1IH0 A;  2PSR A;  4DSJ A;  4XA5 A;  2XC9 A;  2KHQ A;  2KSO A;  1TNQ A;  2LP2 A;  2IBK A;  3KF9 A;  1WRZ A;  1JC2 A;  1ZQQ A;  1U45 A;  4O5K A;  5KFL A;  1E8A A;  2YB4 A;  1ZQO A;  4EZ9 A;  2KLE A;  4KTQ A;  3QUC A;  3RJG A;  1QX7 A;  2WCJ A;  1QSL A;  2DF4 B;  7ICS A;  1S36 A;  1Q46 A;  1MQ1 A;  4Z6F A;  2BQR A;  1S76 D;  1KCY A;  1JF0 A;  2KTQ A;  2ZIX A;  3E2E A;  5ALH A;  4OJ6 A;  5AAN A;  2M0N A;  4DOB A;  3PSR A;  1HQV A;  2DL0 A;  2KGR A;  4NLK A;  4YI9 A;  1F8H A;  2W8K A;  5GTH U;  1XFV O;  1OMR A;  1L7M A;  4QWB A;  5DIC A;  1BOC A;  4MHV A;  1JUO A;  1COO A;  3SG5 A;  2DPJ A;  5C0Y A;  2LMT A;  2R8J A;  1U5I B;  4DQI A;  2AQ0 A;  5ALJ A;  1OUQ A;  2BQU A;  2L4H A;  4ELV A;  3H4B A;  3LWM A;  2P70 A;  2HHV A;  2MBX A;  3V7J A;  5AI0 A;  2KFH A;  3JPR A;  5KG1 A;  3MSE B;  2ESE A;  1FFU A;  1AK8 A;  1CFP A;  2F2P A;  2VA2 A;  3ED5 A;  5HR7 A;  1U49 A;  1LVH A;  5ALT A;  3GQC A;  2WAQ F;  3BOW A;  1S6I A;  2ODG A;  1DJX A;  3AAJ A;  4PDZ A;  1PUL A;  3BS5 A;  4YI8 A;  3QUB A;  4QW8 A;  1X6J A;  4MBE A;  1BF5 A;  2G5I B;  3D2S A;  3RB3 A;  4K4G A;  4Y2R A;  1UHK A;  2NRW A;  1AP4 A;  1SCM C;  2ZTE A;  1ZJM A;  3QU9 A;  2K4P A;  2GH1 A;  4DL4 A;  1VJ5 A;  2J6T A;  5KFP A;  1OZS A;  4KX5 A;  4YG2 A;  4PHP A;  4QZG A;  3D73 A;  2M7L A;  4OJL A;  1ZQJ A;  1J2N A;  9ICA A;  1SYM A;  7ICL A;  4I2A A;  4F3O A;  4JK1 A;  1MQ2 A;  3B0Y A;  2KD1 A;  5J2B A;  2VJ4 A;  4ED8 A;  1H38 A;  3F45 A;  2EGD A;  5EE1 A;  2H61 C;  2ZKM X;  3UO9 A;  4MFA A;  3NVZ A;  4CE6 A;  1IQ5 A;  5D69 A;  1SK6 D;  3RLZ A;  3HKZ C;  3B0X A;  2CPR A;  4I2C A;  3SG3 A;  3PX6 A;  3FWB A;  2AJQ A;  2F3Z A;  4GBA A;  1D8Y A;  4DWI A;  3MGH A;  4JWN A;  1NKB A;  1ZQZ A;  3IQO A;  4P2H A;  3SS3 A;  4RNN A;  1TRF A;  3AKB A;  2RLT A;  1X9X A;  5CP2 A;  1V38 A;  1QH9 A;  2G07 A;  4BWM A;  1T94 A;  1B4C A;  3O4X A;  4QZD A;  2I18 A;  1AUI B;  3CZ0 A;  1J7R A;  3SG4 A;  5AKY A;  2AMI A;  4J9P A;  2E5S A;  1XFX O;  2JZI A;  3O0F A;  3IG8 A;  1CDP A;  2Q0Z X;  5KT5 A;  1SL1 A;  2GLE A;  2QEH A;  5JJG A;  3CZ1 A;  4LZG A;  1QLK A;  1K9U A;  3JPO A;  5L9X A;  3B9J A;  2XID A;  5AKX A;  3Q8K A;  2IMW P;  2V53 A;  4WRI A;  4I5N B;  1A2X A;  2VA8 A;  1HUO A;  2R8H A;  5DDM A;  3PNC A;  1U47 A;  4MF8 A;  1KL9 A;  1F44 A;  2H3V A;  5BPJ A;  1KBU A;  2LC5 A;  3NXA A;  5C5J A;  3NSO A;  3O6B A;  5HLV A;  3ZD8 A;  5DKR A;  3RH4 A;  1KLN A;  1KRP A;  3BQT A;  4TUQ A;  5KAI U;  1JN3 A;  4HRG A;  5AK5 A;  4B9S A;  2WCL A;  3HX4 A;  2ZNE A;  3DVK A;  1GQM A;  9ICM A;  5ALE A;  1NYA A;  2W43 A;  3BQ0 A;  2A1A A;  5D7F A;  2NXQ A;  2ES6 A;  1SBJ A;  3KKA C;  2Y9U A;  2AGO A;  1SV4 A;  5KFD A;  1M46 A;  2BCX A;  1X66 A;  4TUR A;  5H2F U;  1YZ7 A;  1ZQH A;  1DTL A;  4IC9 A;  3NSI A;  3VRN A;  2A19 A;  4AYB C;  1FFV A;  1HEK A;  5ALW A;  4F5Q A;  1PRW A;  1IIP A;  1GO3 F;  4EEY A;  4QW9 A;  3OSN A;  5CEH A;  3OTQ A;  3EKH A;  1DRG A;  4OR9 B;  2KKP A;  3F2C A;  2RDJ A;  4YGA A;  4PHJ A;  1C7Y A;  1QJT A;  2EZY A;  2Y1M A;  5EE3 A;  1S3P A;  4XYN A;  4KLG A;  7ICP A;  3SZ2 A;  1TIZ A;  2JQ6 A;  2XGP A;  3EYZ A;  3AQE A;  1HJP A;  2WCB A;  1G4Y R;  2WTF A;  3NVY A;  5I94 A;  4B9M A;  4Y2P A;  1JRO A;  2JR5 A;  4EEL A;  1C3Z A;  4KLM A;  2LYB A;  4LZD A;  3RJF A;  2BBM A;  3UQ2 A;  1GJY A;  1TOP A;  2FPK A;  5AM0 A;  1RQL A;  3BQ1 A;  1UWO A;  4QJ5 B;  5AIA A;  4I29 A;  3BJH A;  4PE4 A;  2J6U A;  1FO4 A;  4CFQ A;  5ER4 X;  2K61 A;  3TZ1 A;  3S0B A;  2KVC A;  4HAI A;  3WKE A;  1Z00 A;  3BUM B;  1JI7 A;  1SL8 A;  2OTG B;  4CLN A;  1ZYQ A;  3C1Y A;  4YXJ A;  4PJ0 U;  1J1E A;  4ORB B;  3CLN A;  2LYA A;  3EW9 A;  2LHI A;  3DD4 A;  2W04 A;  4RNM A;  1SV0 C;  4KYN A;  5KFZ A;  4I27 A;  1JWD A;  4MZJ A;  2ZXI A;  3THV A;  1P28 A;  2EAP A;  5JU5 A;  1A4P A;  1ZOL A;  2QB0 A;  3KHH A;  2FDR A;  1ZQI A;  8ICN A;  4FTG A;  5J2G A;  4C8N A;  1ZD2 P;  4QIW C;  1F55 A;  2MSN A;  2K0J A;  1SL7 A;  5J2C A;  3GIK A;  1KFX S;  4A8E A;  1WCL A;  1S10 A;  2N1R A;  4YD1 A;  1K9P A;  4F5N A;  1RZT A;  5ALX A;  1SXE A;  4DF4 A;  4O5C A;  1XA5 A;  1X9W A;  4MZL A;  2KP7 A;  2W9A A;  1LKJ A;  3WXA A;  1SIJ A;  2KV2 A;  2KBM A;  3CTN A;  5KT4 A;  1T7P A;  1UA0 A;  4M9J A;  4C0K A;  1KWO C;  1QTX A;  4USA A;  4M2Y A;  2DUY A;  2JNX A;  1KSM A;  2YMP A;  4BXO B;  3Q8M A;  4R8U B;  1FI6 A;  1VRK A;  4CF4 A;  2MRL A;  2F3Y A;  3TAR A;  5DQH A;  4O3P A;  3MDA A;  2H3Q A;  5D46 A;  3NRZ A;  2KNJ A;  5J0O A;  1ZXI A;  1DOQ A;  3BZC A;  4GFJ A;  4PL1 A;  5AI5 A;  8ICR A;  1U4B A;  2HHT A;  4ECQ A;  1TN4 A;  3LK9 A;  1NPQ A;  2BCB A;  3KHL A;  3PML A;  4NV0 A;  3V7K A;  3NGV A;  3EVU A;  1BOD A;  2W03 A;  4PZO A;  2YGU A;  3L47 A;  2GGM A;  5ALQ A;  3I5G C;  5CSF A;  1JF2 A;  4CRX A;  3MR2 A;  5DKQ A;  2F8K A;  1CDL A;  2JZB A;  4Q8E A;  8ICQ A;  3N7S C;  5HML A;  2FJY A;  4ED7 A;  2E30 A;  4Y2Q A;  2D8C A;  3WKD A;  4NLB A;  3G6V A;  2PFN A;  8ICT A;  5D49 A;  1RYR A;  7ICQ A;  5IIJ A;  1QVI Z;  2IA6 A;  4MEY A;  2C2D A;  1PVB A;  3ICB A;  1TVA A;  4FBU A;  4WQ3 A;  1ZQL A;  9ICU A;  3ISD A;  2VIX A;  2P6B B;  1U48 A;  1SY9 A;  7ICG A;  2EHB A;  4PHK A;  1ZQN A;  3TAP A;  1IJ6 A;  1NK6 A;  2C28 A;  2FMQ A;  2WCK A;  1BPB A;  4IL1 A;  3TKA A;  5AEQ A;  1L3V A;  1A75 B;  1QAT A;  4BY5 A;  3F2B A;  5AI4 A;  5DLG A;  1UPH A;  2DBY A;  5KFG A;  2KSP A;  3QE9 Y;  2AXT U;  4DFD A;  2K7O A;  1ED1 A;  2ASL A;  1NWD A;  2D8N A;  3SIA A;  2BKE A;  7ICI A;  2RDI A;  3AMZ A;  1IQ3 A;  3KOO A;  3RAX A;  2QEB A;  2M1K B;  5BPC A;  2ZIV A;  3EK4 A;  3RZS A;  1TV9 A;  2ZIW A;  1L2O C;  2M8U A;  4PZN A;  2CN1 A;  3H4D A;  1H4B A;  1DEL A;  4J9M A;  2DWQ A;  2V4Q A;  2PYQ A;  4UB2 A;  2F44 A;  1BVS A;  1LVC D;  1KSO A;  4KLL A;  2VJ5 A;  4QZC A;  4RQ5 A;  1SKS A;  2BL0 B;  1RQN A;  4NL9 C;  3K1E A;  1Q80 A;  5KFY A;  1CB1 A;  5G5H A;  8ICZ A;  9ICR A;  3E58 A;  4Z6E A;  9ICW A;  5CB1 A;  5EL2 A;  1ZD4 A;  3ORY A;  5J2F A;  4YP3 A;  1XSN A;  2G5H B;  3TAC B;  4B9L A;  3BQ7 A;  4Y2J A;  5K89 A;  4M9G A;  2HCF A;  2H61 A;  2MA2 A;  1QCK A;  2JXL A;  1UQV A;  2KIC A;  3NAS A;  3V6K A;  2WCF A;  2ZRS A;  1A77 A;  3BYA A;  5IIK A;  4AYB F;  2P6U A;  2VKQ A;  3K75 D;  3ZDD A;  1TE2 A;  1YZ6 A;  5E79 U;  1YUR A;  2FJU B;  8ICB A;  3ISB A;  2HHU A;  4TUP A;  2FMP A;  1DJZ A;  5EWG A;  4DFK A;  1D8B A;  4PGY A;  3SR6 A;  4R1E A;  7ICT A;  3DY9 A;  3RB0 A;  1L8O A;  1EG3 A;  1ZQA A;  1K2H A;  7ICK A;  3GU3 A;  4GXJ A;  4BX9 C;  1CLB A;  3S0E A;  2WF9 A;  3D2N A;  3S0F A;  2WHE A;  3FAH A;  3PSI A;  4INX A;  1UT5 A;  3M9N B;  9ICH A;  4RUC A;  3JPQ A;  3BXK A;  4XQ8 A;  1RTP 1;  5F9L A;  3EK8 A;  4YGC B;  2W7O A;  1SKT A;  3DF0 A;  3MGV A;  2TN4 A;  2KG5 A;  2ISD A;  3H7I A;  1EG4 A;  5DG8 A;  3QUT A;  4MRX A;  2Y9T A;  5AKG A;  2I6X A;  2H3F A;  1ALW A;  4F50 A;  3ZDC A;  3K4G A;  2JPO A;  1JXL A;  3FYH A;  2JH7 A;  3PO5 A;  2WCH A;  2CCM A;  3NSL A;  4KLD A;  3PM2 A;  1BU3 A;  2Y0S C;  2KI6 D;  2LLT A;  3O78 A;  3I28 A;  3UQ0 A;  2ZN9 A;  1T3N A;  5KFC A;  2OTG C;  3KKA A;  1F4Q A;  2AH5 A;  2CTN A;  1BMO A;  3KBB A;  3QU5 A;  3H8W A;  5L1M A;  2LM1 A;  4FQO A;  1XWL A;  1SRA A;  3N7H A;  3OX6 A;  1TK5 A;  3S0D A;  2JRF A;  2K89 A;  3SAG A;  4NDB A;  3QU7 A;  3PN7 B;  4KLQ A;  2FMS A;  1QX5 B;  2W9B B;  5F9N A;  1F54 A;  1KFX L;  2F2O A;  2P6R A;  8ICP A;  1NCZ A;  2K8A A;  1YX7 A;  2EAN A;  3PW2 A;  2PFP A;  1OSA A;  4CID A;  4UB5 A;  1N56 A;  3PW4 A;  4ECT A;  4F91 B;  2A4J A;  1URJ A;  3T5L A;  3Q8L A;  4P2Y B;  5DKN A;  5J3X A;  3N4M B;  1XFY O;  5CR0 A;  1EJ3 A;  2A1J B;  2JTT A;  2ERB A;  3SIB A;  4K4I A;  1B0X A;  2YN4 A;  4NDC A;  1CLM A;  3T5J A;  3M8S A;  1B9A A;  1Z4H A;  3SJS A;  4XJK A;  4ELU A;  5J2H A;  3CDN A;  3SAH A;  3D75 A;  4DQR A;  4OKH A;  1UHI A;  4ECS A;  4RPY A;  1S5G Y;  4EYI B;  5KFF A;  2JUL A;  5I8N A;  4HRE E;  3S0G A;  1SV0 A;  1XNS A;  4NLZ A;  8ICF A;  9ICI A;  2VRG A;  5AXI A;  4QZ9 A;  1LIN A;  2MHH A;  3BS7 A;  2NYV A;  3SQI A;  2Z7J A;  4P4P A;  1J97 A;  3SEN A;  2LUX A;  3PO4 A;  4MVF A;  3Q8P B;  3LVV A;  2W3S A;  3QEA Z;  5ALM A;  2RRD A;  1KK7 Y;  1QS7 A;  8ICK A;  1RXV A;  1ZQC A;  2D6F C;  9ICE A;  1YUS A;  2BAP A;  5DB9 A;  3BQ2 A;  3RJJ A;  2HHQ A;  2AGQ A;  2BR0 A;  7ICJ A;  5F6T A;  4RT3 A;  3EG5 B;  4ECX A;  3EKJ A;  1S0N A;  8ICG A;  2JGA A;  1P7D A;  1TNP A;  4US9 A;  1CMG A;  2AGP A;  1X9M A;  2EH9 A;  2D3D A;  5HNK A;  1SKR A;  2PRU A;  2E1E A;  5AKI A;  3G6Y A;  2QAR B;  5KFK A;  2HF5 A;  4C4S A;  1TNW A;  1U5I A;  3O4Y A;  1R6P A;  1DGS A;  3MC1 A;  4D1E A;  4MRY A;  1DC1 A;  8ICV A;  1K96 A;  4I2J A;  1DK2 A;  5HLO A;  4TQS A;  5AK6 A;  1WYG A;  2YX8 A;  2W9M A;  3C2M A;  8ICH A;  1JFJ A;  4OJP A;  4M2P A;  1K1S A;  2W8L A;  2KZ3 A;  4ED0 A;  1KWO B;  3OHA A;  3IVT A;  4PT1 A;  3GZF A;  1B1G A;  7ICE A;  5AK4 A;  1T4G A;  3PLF B;  3LWL A;  3RBD A;  1PVA A;  4Q04 A;  4ECY A;  5J0S A;  4JKT A;  3DVJ A;  1BPE A;  5DBA A;  1TWO A;  9ICX A;  3C5F A;  3UMG A;  2JU0 A;  4CFR A;  4I2G A;  1NCX A;  1LB2 B;  2BL0 C;  3LK0 A;  4GGN A;  7ICR A;  2HVI A;  3OB2 B;  4UAW A;  4YN4 A;  5ALV A;  1O03 A;  2K8B B;  1B8R A;  1Y6W A;  3L4A A;  1GM0 A;  8ICO A;  2C22 A;  3IP4 B;  3CR2 A;  1GGZ A;  3TFR A;  2BDP A;  4DFP A;  1B4F A;  2F8L A;  4PHN A;  5K4L A;  5KG6 A;  5J2E A;  5CSJ A;  5G08 A;  3UPQ A;  3I5G B;  9ICT A;  1CI4 A;  8ICX A;  3DDH A;  1TKD A;  1WUD A;  5KG7 A;  3OJU A;  2BCR A;  4IR9 A;  3KEV A;  2JT0 A;  1PVQ A;  1M39 A;  4FZM A;  1K5O A;  1ZUZ A;  4NLC A;  3M8R A;  2I2R E;  2DKX A;  2QAC A;  4FE3 A;  3ONN A;  2JEJ A;  1SNL A;  4ED2 A;  3AUO A;  3E0F A;  2LMU A;  5ALN A;  1BPX A;  4NM2 A;  3RH5 A;  3BJY A;  3KO0 A;  1HT9 A;  2M29 A;  2PI5 A;  1V1F A;  2L98 A;  4M2O A;  4RQ4 A;  2W11 A;  4O3Q A;  1N60 A;  2PI4 A;  1ZQK A;  4KLU A;  2LHT A;  4J9R A;  2ZJ5 A;  5JTI A;  2BCU A;  2HBL A;  5AM3 A;  4R65 A;  5J0T A;  2CRX A;  2ISP A;  2WC8 A;  4EBD A;  2WCM A;  4NL9 A;  3MR3 A;  3R1P A;  4R63 A;  2WOR A;  2DGZ A;  3GIM A;  4MLW A;  1X2I A;  1DF0 B;  4F72 A;  5DDY A;  2Y0S F;  4JWM A;  4FO6 A;  1NK8 A;  2KFF A;  1XSP A;  1L2O B;  2LI6 A;  4Y2T A;  2VAN A;  5KU1 A;  2UVU A;  4OZD A;  3WHT B;  4QJ3 B;  3FS7 A;  1T3Q A;  2KQ6 A;  1ZQS A;  4ED1 A;  2HBJ A;  1PAL A;  3VB1 A;  4I5K A;  1VDV A;  3NHI A;  3OSP A;  4IQV A;  1NK9 A;  3M9O B;  1V9P A;  2BDU A;  2LYH A;  1LA3 A;  3DV9 A;  1DK3 A;  5CRX A;  4I2B A;  1L3T A;  2PQL A;  5ALO A;  4UBB A;  4GGF C;  2PMZ C;  1J55 A;  2JEG A;  1NCY A;  1QIW A;  1LKY B;  2L4I A;  2LUC A;  3Q8I A;  1ZQW A;  3KHE A;  3QU4 A;  5D4B A;  4KLS A;  4UAU A;  5DBB A;  2OM6 A;  3F2D A;  5DBC A;  2Q4T A;  3PN7 C;  1XFW O;  4NJ8 A;  3TI0 A;  4O9M A;  1OZO A;  1F5S A;  3C1Z A;  2NRT A;  4IJ7 A;  5KFI A;  1YRT B;  5AK3 A;  1A0P A;  1SKW A;  2Q91 A;  2NRV A;  2IOF K;  3MR5 A;  1SR6 C;  3N28 A;  1MF8 B;  2CXJ A;  3M0W A;  3SAF A;  5EE9 A;  4QZI A;  1K8U A;  1ZD5 A;  2E8N A;  2WB1 F;  5AM2 A;  4YQW A;  2O5G A;  2F8P A;  4NWI A;  4U6P A;  4E0D A;  4P0P B;  3AU6 A;  2XO7 A;  1L6N A;  2KYF A;  4TUS A;  1KQQ A;  1UT8 A;  4RQ2 A;  2I1Q A;  2JRZ A;  1SW8 A;  1XSL A;  4I2I A;  1QSY A;  1L8L A;  5I2Q A;  5J0R A;  2KDH A;  1B7T Z;  5G5G A;  1HIW A;  2G08 A;  2E8M A;  2MUT B;  2ZTC A;  3V72 A;  4BDP A;  2ALZ A;  4I2E A;  2LNK A;  3N97 B;  9ICB A;  1CLL A;  3JPN A;  1QLN A;  1J7P A;  3PR4 A;  1QXP A;  4CPV A;  1W9Z A;  4B9N A;  5KSZ A;  2OHF A;  4C7Z A;  3MGI A;  4DSL A;  1W7J B;  2PAL A;  2IOH A;  2K60 A;  3EWA A;  1BG1 A;  3SMV A;  4CF3 A;  4DRW A;  4KLJ A;  3PX4 A;  4UQG A;  4GXK A;  5HKZ A;  4FFD A;  3AQF A;  5DLF A;  2MAX A;  4QZH A;  1WLZ A;  3Q8Q B;  2RHF A;  4G3I A;  4F4K A;  4QZB A;  2KEY A;  3C1V A;  2HQ8 A;  4KMO B;  4YGE B;  1S26 D;  1MWN A;  1RYS A;  3D2Q A;  3M7D A;  1SMG A;  2KI4 B;  4OCI A;  1NZB A;  4JQ0 D;  5AI9 A;  3IN5 A;  2B21 A;  1JUD A;  5KFW A;  3B88 A;  2KYC A;  1C3Y A;  2KIV A;  2W55 A;  1NNL A;  4BXO A;  1IG5 A;  4R8U A;  4NLN A;  3GIL A;  1VLB A;  2R8G A;  2LV7 A;  4GLX A;  2EAO A;  4R64 A;  5FI7 A;  1OOI X;  5J0Y A;  1PSR A;  5PAL A;  1SGG A;  2EZX A;  1L5U A;  1UHN A;  5CA7 A;  3GII A;  3C23 A;  1QV1 A;  2L50 A;  3I1Y A;  3PW7 A;  4DFM A;  4ZCV A;  1BPD A;  1L7N A;  3FDS A;  4NM1 A;  1IGV A;  1S97 A;  9ICF A;  3FWC A;  3O2P A;  5KT6 A;  2G09 A;  1FIQ A;  3IG5 A;  5AM5 A;  4KLT A;  1U9L A;  5T14 A;  1XS9 D;  3FE9 A;  1S77 D;  3MR6 A;  1PVR A;  4KLO A;  4ICA A;  4RQM A;  1DJI A;  2LVK A;  3ZI4 A;  1IRJ A;  2YB1 A;  9ICQ A;  2PMY A;  5AER A;  3WKB A;  1OOJ A;  4DSE A;  1CRX A;  1XC9 A;  1TUZ A;  2HQW A;  2M7N A;  2ZUC A;  4Y2V A;  4RQ6 A;  4CCH A;  2OH2 A;  4QZF A;  3V7L A;  4YXM A;  2EDU A;  4WJ3 B;  1LA0 A; 
#chains in the Genus database with same CATH homology
 5JRT A;  3O4X A;  2KG5 A;  1JI7 A;  5J8Y C;  2KLE A;  2Y9T A;  2F3N A;  3SS4 A;  2BAP A;  1W9Z A;  1SV0 C;  1RG6 A;  2GLE A;  4KYN A;  2K60 A;  5JTI A;  2EAP A;  5JU5 A;  3EG5 B;  3HIL A;  4I5N B;  3SEI A;  2EAM A;  3OBV A;  2QB0 B;  1SXD A;  2JV3 A;  2QB0 A;  4IS7 A;  3PM2 A;  4MEW A;  2L5Y A;  2DL0 A;  3UNW A;  4NL9 A;  3KKA A;  2D3D A;  4MHV A;  3SS5 A;  4PZN A;  3K1R B;  1PK1 A;  2QAR B;  2QAR A;  1DEL A;  1WWU A;  1DEK A;  2F44 A;  5L1M A;  1SXE A;  3TAD A;  2ESE A;  1OW5 A;  1DC1 A;  3H8M A;  2KE7 A;  4NL9 C;  1DXS A;  4I5K A;  1WWV A;  2KIV A;  5F3X B;  2ES6 A;  3KKA C;  2Y9U A;  1SV4 A;  3BS5 B;  3IVT A;  3BS5 A;  5FI2 A;  5HL1 A;  1X66 A;  1PK3 A;  3TAC B;  3BQ7 A;  2EAN A;  2EAO A;  1PK1 B;  5FI7 A;  4JKT A;  1SGG A;  3TAD C;  2QKQ A;  1LKY B;  1LKY A;  2KLD A;  1UQV A;  2K4P A;  5FI6 A;  2BNX A;  1Z2C B;  1Z1V A;  5KNI A;  2FE9 A;  4GAO A;  4NJ8 A;  2YTU A;  3IDW A;  1UCV A;  4IJ7 A;  1B0X A;  4PZO A;  4RQN A;  2LMR A;  2YGU A;  2LPE A;  1B4F A;  1COK A;  2E8O A;  1Z4H A;  3UO9 A;  2E8P A;  1X40 A;  2F8K A;  2E8N A;  4I5L B;  5I94 A;  1KW4 A;  2KMD A;  2D8C A;  1OXJ A;  5J8Y A;  4RQM A;  1F0M A;  3KEV A;  5D3O A;  2QB1 A;  4GBA A;  1V85 A;  1SV0 A;  2B6G A;  4I5J A;  2DKX A;  3SS3 A;  3BS7 A;  1X9X A;  1V38 A;  2DKZ A;  2KSO B;  3SEN A;  2KSO A;  2E8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...