2K60A

Nmr structure of calcium-loaded stim1 ef-sam
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
GSHMASSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (Stromal interaction molecule 1)
total genus 45
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k60A02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2k60A01
1PK1A 2FE9A 2E8MA 4NJ8A 1LKYB 5JTIA 2F8KA 3BS7A 4PZNA 2Y9UA 2GLEA 4NL9C 1LKYA 3H8MA 3TADC 2E8PA 1JI7A 5J8YC 1SXEA 3SENA 1B0XA 1UQVA 2QB0B 1OXJA 2KIVA 2ESEA 1RG6A 1DXSA 2DKXA 4PZOA 1COKA 3KKAC 4MHVA 2E8NA 5JRTA 1OW5A 5L1MA 2D8CA 1B4FA 2E8OA 1X9XA 2QB1A 2JV3A 2ES6A 4RQMA 1PK3A 2K60A 1UCVA 1SV4A 2QARB 3TADA 2B6GA 2EANA 2KMDA 1WWUA 1SV0A 1F0MA 1Z1VA 2Y9TA 1SV0C 2QKQA 2QARA 2KSOA 1PK1B 2K4PA 1X66A 3K1RB 1V85A 1SXDA 2F3NA 3BS5A 2DKZA 1KW4A 3BS5B 2KG5A 3SEIA 2LMRA 2D3DA 5JU5A 2EAOA 2EAPA 1V38A 2QB0A 2EAMA 4NL9A 2DL0A 4IS7A 3BQ7A 2L5YA 2KE7A 5F3XB 2F44A 1X40A 3KKAA 2KSOB 5J8YA 3IDWA 2YTUA 4RQNA 1WWVA 3TACB 5KNIA 3HILA 1SGGA 2LPEA
chains in the Genus database with same CATH superfamily
1KK8B 3RAQA 2HSZA 1HT9A 3EYZA 2JMGA 2MHHA 1RROA 2Y1NA 4DL2A 1KRPA 4CPVA 4QZHA 5IILA 2F33A 1VJ5A 1X9WA 2KEYA 9ICGA 5C0YA 2HHUA 3KHRA 1T7PA 3DZTA 1GJYA 4UB8U 1NI3A 3WKBA 2ASLA 4A4BA 5FI6A 2EQYA 2M1KB 2KI6D 3PMLA 4YG2A 3L4LA 3BUWB 3LK1A 2EH9A 3LYSA 1RFJA 3IHQB 5KAIU 3TS5C 5A0LA 3C2LA 5I2LA 3GQCA 1R6PA 4QJFB 4P0PB 3NASA 5JRTA 5KFVA 3SAHA 7ICOA 4ORAB 2HCFA 2E8OA 4FBTA 2MLFC 4UASA 4OCZA 3H40A 3HX0A 2I9GA 5I2OA 3PZPA 1ZACA 1UCVA 2ZG6A 3WK6A 3O6BA 3DF0B 1FF1A 1CLLA 2B6GA 2DPJA 1IM4A 1OUQA 1YUTA 2BCBA 1XC9A 2KKPA 1JXLA 2H3IA 5EWEA 1AJ4A 4QZCA 1LVHA 3ICBA 1E8AA 3RH5A 3L4AA 4CNQA 4I2DA 1OMDA 2OS8C 3CTNA 3I5HB 2P35A 4IC9A 5KFIA 2WCJA 3JTDB 2ZIXB 2FCDA 4RNNA 1BR1B 4U6PA 1U5IA 4F93B 2C22A 2HOQA 5G5HA 5J0UA 4F5NA 5DDYA 3BS5A 2W9CB 3BFHA 3LVWA 2AHOB 4GNKB 2ZNEA 4NY8A 2I2RE 5DQGA 2LUCA 2V9WA 5HHIA 1UA0A 4ECRA 5KT4A 5CP2A 2W43A 4ELVA 5C5JA 1C20A 4O3MA 2LMTA 5DKRA 4QJ3B 1MQ1A 4F5RA 2HBKA 1EG4A 2GTEA 3ZDEA 3Q8SB 3D0YB 4F4KA 1PULA 2F44A 2H61C 2DGZA 4P0QA 3CS1A 1FFVA 1WRLA 1J1EA 4FO6A 4DFPA 2BR0A 2A19A 4Z6EA 4KN7A 4O3NA 2JEJA 1S3PA 2RP5A 2E1EA 1C3YA 2JR5A 2KOBA 3WK9A 2KLDA 3QEBZ 1KFUL 4QZBA 2KFHA 3PALA 4INWA 4PCWA 2ASDA 1KQMC 2QEOA 1ZQSA 3I5IB 4CFQA 5DLGA 4UAUA 4Q44A 4PZNA 1X6IA 3PV8A 4MFFA 3C1ZA 2LUXA 3RR8A 4F72A 1DF0A 1SXEA 1B8CA 4QZGA 1JIHA 5EOZA 5AKJA 5I94A 1QVIY 3SR6A 8ICJA 3QU5A 3BQ3A 2P6UA 4F91B 1YX8A 5J2BA 1SL0A 4EBEA 2GGMA 1NCYA 3OHMB 1SWVA 2RQ5A 2W54A 2GH1A 1MQ3A 1TCFA 3EZ5A 4RU9A 1BPXA 1W7IB 4QJ5B 5TZVA 2WF8A 3TARA 3FIAA 4TUPA 1BF5A 1BGXT 3NVYA 2CBLA 2CXYA 5ALTA 4OO1J 4JQ0D 2YN4A 4C4SA 1OW4A 3C29A 2ZRTA 5F9NA 4X5VA 1A77A 2L50A 2EDUA 3WKDA 3BFBA 5KG3A 1RWYA 1JUOA 4I2AA 2KHNA 1ZQRA 2MBXA 3GV7B 2BDUA 4RQ4A 2F1IA 4EBCA 1NX0A 2JXJA 1TFRA 4M9LA 5KT3A 5AEQA 2HBMA 2KFFA 2UVUA 9ICQA 1Z00A 1SNLA 4Z6DA 3WK4A 1XYDA 4F5PA 3VRRA 1HJPA 1DELA 3M0WA 2MUTB 3B0YA 1P28A 1Y0VH 3I5FC 4UW9A 4DSJA 5KFJA 2PALA 1DGVA 3GU3A 1SB3C 1DJXA 2BE4A 2LE9B 1QVIZ 5HMLA 4MLWA 3IRUA 1ZD3A 3IP4B 2R8GA 2XI9A 3AQFA 3F45A 2P70A 5KFCA 1NK6A 1V38A 3BOWB 1QS7A 2EAMA 3N7HA 4YI8A 2LI6A 1YT3A 2WCKA 2IHMA 3K75D 1X6JA 2PRUA 2JZBB 8ICTA 3H0LB 1NK5A 3CZ0A 1UHUA 3E58A 5ALSA 3EKJA 3FE8A 1OOJA 4M6WB 8ICWA 4AP9A 2EZZA 2WF5A 4DLEA 1EXNA 1SCMC 8ICXA 1U47A 1KL9A 3AEVA 4UB2A 3B87A 4DOBA 2ZRSA 4GGNA 2I6XA 3AQEA 3FWBA 2XY7A 3T3FA 3KTQA 3RB6A 5T14A 5DQHA 1B7TY 4O3OA 4O0IA 4ECWA 2K7BA 2LM1A 4YP3A 1TNQA 1MWNA 8ICGA 5AM4A 1A0PA 5CB1A 2K8AA 1CNPA 2WOSA 1S0NA 3NHIA 1SY9A 2LHIA 1YR5A 3TADC 4BY4A 1S5GZ 3KHGA 4MEYA 4PHMA 5AI4A 3TS5B 4KLUA 1RM6C 5AI8A 1NJZA 4YN4A 1ZQAA 1HUOA 2PSRA 2KGBC 4DL4A 5KTYA 2K4EA 3M9OB 4J9RA 4US9A 5IIOA 4M0AA 4ELTA 5DGBA 2EZYA 7ICTA 1HQVA 3D73A 2DF4B 3WKEA 1FFUA 2NO4A 7ICQA 1SV4A 3NRWA 3NSOA 3UXPA 5D4BA 1Z4HA 1UT8A 4PHNA 2EANA 4I2EA 2KHVA 2KYCA 3JVTB 3RTVA 3OB2B 5ALEA 4PGYA 3TKAA 4QJ4B 2PFPA 5H2FU 9ICXA 4O5KA 7ICLA 1EL4A 1NIWA 4B9VA 1XSLA 2WNDA 1B4CA 5ALXA 2PXIA 1C7YA 2XC9A 5DG8A 4M04A 3WU2U 2ZN8A 4PE4A 1EG3A 4QZDA 4B6JA 4RZRA 8ICIA 3GDXA 2KLEA 5FP0A 4ECZA 3ETLA 4KLTA 4KLGA 1V85A 2JRZA 2BCAA 3PN7B 3IG5A 4PL1A 2B1UA 3EWAA 3G6XA 1CI4A 2EZXA 4ECSA 1DJZA 3GIJA 1Y1XA 1ZQPA 3DYEA 3IF7A 1GGZA 1L7PA 1OMRA 5AKZA 3R1VA 5ALDA 5AI5A 2OEHA 3G6VA 2JC2A 3T5KA 4WRIA 4IQVA 1ZQXA 5IIIA 4LZGA 5DBCA 1KBUA 2YQEA 3Q8KA 2FMSA 4O5EA 3BUNB 5J3XA 2OYYA 1JF0A 3L4PA 1Y1UA 3TFSA 1QASA 1IJ5A 4M47A 2KJ5A 2LMUA 2JEGA 3C5GA 1L8OA 1ZETA 5ALIA 2H3VA 1IG5A 4US8A 1U49A 3BQTA 2KHQA 3WKAA 2HOIA 4FZMA 2VJ4A 1DGUA 4M9JA 4GAOA 1ZJMA 1CMGA 3BUMB 4FBUA 5AKGA 1ZQGA 2PVBA 2FE9A 3NS1A 4IQWA 3NSKA 4OCIA 3ALRA 3CRXA 5J2KA 3D76A 2H3ZA 2F8KA 4JKTA 3V7LA 1QTMA 2RLTA 4RQ7A 3UQ0A 3S0AA 2ZXIA 4MFAA 4Y2UA 3WNXB 2Z7JA 3UXNA 1WY9A 2ZTDA 5KFXA 3SENA 2L0PA 2KDHA 4ECYA 3WK7A 3VB1A 2WCLA 4I2HA 3TDZA 5ALUA 5ALYA 4O3SA 4KITB 7ICPA 2PMZC 1A75B 1TRFA 3EKHA 3VC8A 3A8RA 3OHAA 3FC4A 2ATLA 2LP2A 2OCEA 1K9UA 3TAQA 3RM1A 1BOCA 2HDOA 3ONNA 2HQ8A 3V6JA 1SCMB 5J2IA 2M97A 3SIBA 4PHEA 2WB1C 5ALJA 4J9SA 1LB2B 2JXLA 3RJHA 1SIJA 2KN7A 1WRZA 3BXKA 2FI1A 9ICPA 9ICHA 3PSIA 5EE3A 4UATA 1K1SA 3T5LA 4DRWA 1WWUA 1CM4A 5AICA 1K9PA 1FPWA 1NUBA 3RJJA 4EBDA 4YMMA 1QLKA 1DJGA 2BQ3A 1ZQOA 5KL8B 2KAYA 2QARA 1TNXA 5CEHA 4FFDA 2HBJA 2OH2A 1QCKA 2BPFA 8ICAA 1TKDA 4QWEA 1WUDA 1ZUZA 1XO5A 4GBAA 1GGWA 2FOTA 1YRTB 3PW5A 2GOLA 4A8EA 2LP3A 2Q4TA 1NNLA 8ICBA 1XWLA 3IQQA 1ZQMA 3OBVA 4UARA 1KW4A 4I2FA 1WDCC 3EK4A 8ICRA 3SG7A 5L9XA 4UB1A 1OOFA 2BNXA 4EYIB 4QWDA 3EVVA 1J2NA 3B9JA 3V2LA 3DVEA 2LVVA 4XJKB 2GGZA 3C23A 3KF9A 1ZD2P 3TANA 3C5FA 1X9SA 1KWOB 1OOGA 3BJHA 2NRTA 4B9SA 3A4UB 3GILA 2WB1F 3NVZA 1X40A 3Q8QB 3DXLA 3SAFA 2WF7A 4DWIA 1CDLA 4DSEA 5AKKA 1TK8A 1OMVA 2YMLA 5DB7A 2MAZA 1DTLA 4ED0A 4IRCA 2HOFA 4BY5A 5KG1A 4UBCA 7ICNA 1ZQ1C 4C4TA 4DCKA 2OTGC 2SCPA 3JPQA 4M9NA 4B9MA 1WRKA 2F8LA 3M9MB 3U26A 5KFQA 5HHHA 5HKWA 4EEKA 5L1LA 3AMZA 5J0PA 3CYMA 3PW0A 3M1YA 4R1EA 5AK3A 3SG6A 3O2PA 2BBMA 1SKRA 1C7VA 4OJOA 5AI6A 4M2PA 5DDMA 2M7NA 4C0KA 1JC2A 1UQVA 4CF3A 1Y1AA 5HKYA 3H0MB 3IG8A 4ED6A 4KX3A 5D46A 3PW7A 1B4FA 2JEIA 3MR3A 2AAOA 1M6YA 5DB9A 1PRWA 4O5CA 4RQMA 4KLSA 3MBYA 4EYHB 1TVAA 1K5OA 3OJSA 2QARB 2HHVA 3MFIA 2J6UA 4ICAA 4C8KA 4PGXA 2WF6A 1BU3A 2XCAA 1ZQFA 1BNPA 2LMVA 1XO1A 3O4XA 4QZEA 1Q3UA 3R1PA 4NDDA 1V97A 1IRJA 2K7DA 4MVFA 4P2HA 1S0OA 3PM8A 2D8NA 2W55A 3B0XA 4C0LA 1Z3EB 2Y1JA 2ZIUB 4NDBA 2I7AA 4CFRA 2G08A 2HBLA 1CMFA 1K2HA 3OJUA 1K94A 1QV1A 2WCMA 4PPXA 2M0RA 2PYQA 1TWOA 4N5XA 3WHUB 2R8JA 2UVRA 3WXAA 5AKLA 3CR4X 2V4QA 2G0AA 3EG5B 2P66A 4ED2A 3UPQA 4Y2QA 4QZ9A 4LJXA 2AXTU 5L1JA 3GK1A 3CABA 5JJGA 1ZQJA 3H8SA 1KTQA 3CDNA 4DQQA 2H8VA 5HR7A 5HMMA 3UO9A 1RYRA 3QNMA 2A1AA 2L4IA 3KPXA 1QIWA 2K8CB 2LLTA 2JNFA 4O3RA 3BQ2A 4ED7A 1VDVA 2L5YA 4C0JA 1NJWA 4MF2A 2BGWA 4YGCB 4MRXA 5J2EA 3KKAA 1QSYA 1PK0D 4F92B 5KFLA 2NXQA 3GIIA 2YTUA 2LNKA 5HYDA 4AQJA 4B9LA 5EWGA 1N2DA 3EK8A 1MHOA 3AKAA 1NKEA 3PSPA 1DEKA 1WG8A 2KTQA 2E8MA 3NGDA 2OWOA 1AK8A 3TI0A 4G3IA 2EC6C 1AROP 3RJEA 2GLEA 4PHJA 4QW9A 2K2FA 1SZPA 1MSWD 2BBNA 2JQ6A 5J2DA 8ICLA 4CDGA 1FEZA 1SL7A 3AN1A 4Q04A 3GK2A 2NRZA 1IGVA 4C80A 3F2DA 2BPGA 4PE0A 2PMZF 5DKQA 4ED8A 1BT6A 1F8HA 3WKCA 3QXGA 3EK7A 5CSNA 3N7SC 2V53A 2VANA 2JGAA 3RB3A 2IHNA 2FJ6A 1HIWA 1PZNA 3HKZF 3PATA 3DVJA 3RR7A 3F2BA 2F8PA 4DUQA 3D75A 1HUZA 2M9NA 4UAZA 3NTUA 4GLXA 1BPDA 1ALVA 4UPGA 2IBKA 1YURA 3M6ZA 3DVKA 4I2IA 2VKQA 2NRVA 3JPOA 5ALRA 4Q45A 2JT3A 1D8BA 3SIAA 1IIOA 1JSAA 2NYVA 2Y1IA 1G33A 1V1FA 1S0MA 1ZQIA 3PO5A 3DVMA 4AQIA 8ICQA 4F7FA 4YMNA 3SJSA 4GFTA 1RXWA 1DJHA 1T3NA 1S77D 1L2OC 2VJ5A 4NWIA 5J2JA 3TFRA 1YUSA 3NVWA 3QRXA 5JU5A 1D8YA 2KQYA 5KFWA 1IQ3A 3AU2A 9ICTA 3H0RB 3PW2A 5DGAA 9ICVA 3D77A 3MGIA 2R18A 4PGQA 2G9BA 4A4CA 3V6KA 4KTQA 4IS7A 4F5QA 1TOPA 2KYFA 4IL1A 2BDPA 2ZKMX 1KDHA 3HKZC 1ODBA 2MA1A 5AKIA 2BCQA 2B21A 3D2SA 4GC6A 3T5JA 5CR0A 5J8YA 1A2XA 4DQIA 1ZQCA 3K4GA 1TN4A 1SBJA 1WWVA 1XNSA 5KNIA 3BUOB 2W9MA 2J6SA 4B9TA 9ICFA 4JD9A 4UB3A 2JZIA 4CGZA 5DICA 1ZD5A 1DT7B 4ECTA 4YGDB 1URJA 1XS9D 3DY9A 2Y9UA 3MGVA 1JUDA 1KSMA 1LXFC 4OJPA 3SG5A 3QUQA 1SKTA 2KBMA 4IRKA 4D1EA 5KL1B 3E3RA 5D7FA 1ORGA 4GGFC 1OZSA 5J0OA 1NWDA 4MZKA 3NSLA 1BLQA 3BZCA 3IVTA 5J2GA 1RG6A 1OE9B 1T94A 5D69A 4IJ7A 3GIKA 3UMGA 4Z6FA 5DKNA 1BJFA 3MABA 1RYUA 3UQ2A 1P7DA 2DQNB 2WAQF 5JUMA 4MSPA 4M6WA 3S0FA 2HQWA 5D3OA 4Q43A 3TADA 1C3ZA 1WCLA 2MJWB 3R1OA 4C8OA 1RYSA 4E0DA 2KMDA 1FO4A 8ICUA 2LVKA 4ZCVA 2C2RA 2DWQA 4PL2A 1KFXS 4I5KA 3EUB2 2JPOA 2MRLA 2ZTEA 4KLDA 2ZUCA 8ICNA 4YGEB 2WCHA 1NSHA 1YZ6A 5JOLA 1IV8A 3C28A 4ICBA 4ORCB 1AP4A 1N65A 5B8IB 2IOFA 2W11A 2HHQA 4F5OA 1Q3VA 4YMOA 9ICNA 1EXRA 1YVHA 4RQ5A 3EVUA 1QQ5A 5AIAA 3WHTB 4C7YA 1W7JB 3BQ1A 4NLNA 3PX6A 2WF9A 2D3DA 2K0JA 5AM3A 5DB8A 5BOLA 5HL1A 4UB6U 1IIPA 2EAOA 3SQIA 7ICUA 4MN0A 2YMQA 1QSLA 3CR5X 2CT9A 8ICCA 4HRHA 4KN4A 1SW8A 5J0RA 2WAQC 2H5XA 1GQMA 3RF9A 2BCXA 4DSLA 1N5WA 4QIWC 3MR5A 4J9PA 1DGSA 9ICSA 4J9NA 4KLJA 1CFCA 1X2IA 2KSOB 4I5LB 1XFVO 1KFXL 1S9FA 1JXEA 3TACB 1S0VA 1D8LA 4AOMA 2KZ3A 4Y2RA 4R65A 1LKJA 4MRYA 1BVSA 3PVXA 1XK4C 2W03A 2HF5A 3L5KA 3LL8B 4F3OA 3BS7A 3T79A 1S26D 3AU6A 5AK6A 4P4OA 1SK6D 2TN4A 3H8MA 1UPHA 4YVZA 2E8PA 1NK4A 3CW2C 1X42A 2Q4UA 3Q8PB 2J6TA 3M6KA 5IIMA 1UT5A 4DSKA 8ICVA 3ISCA 1X02A 2Q91A 2LV7A 4MZJA 2L51A 5HKZA 1NK7A 1IG6A 5J0YA 5K4LA 2LM4A 4YFKA 3O0FA 1OSAA 2ES6A 1XFRA 4XJKA 4C4RA 4J9MA 2BCUA 4PHPA 4GPLB 1TUJA 4OJ6A 4ORBB 5KG7A 5KFYA 4FQOA 2PKEA 1N62A 4R66A 3JPRA 1UHNA 1VLBA 3NGVA 1OZOA 1HEKA 1XSNA 1DJIA 1BPZA 1NCXA 4LZDA 2QKQA 4FZNA 4K4HA 1Z00B 4JV0A 5DQIA 2HI0A 4OJLA 3K1RB 3GV8B 1F4QA 3UMCA 2KI4B 3N7PD 2FLNA 5KG0A 2NCPA 4TUQA 1PSRA 3QU7A 2JHDA 1CDMA 1S5LU 2D6FC 1JROA 5KFKA 5KFFA 4RQ6A 4UBBA 1M63B 2LVJA 2WCEA 2LMRA 1KSPA 4MBEA 3H8WA 3C2KA 4PHDA 2I1QA 1XO0A 1NK0A 4OKHA 1NZBA 2HPSA 1OOIX 4HYKA 3AAJA 1F55A 2OPOA 5IIJA 5KG4A 2KZZA 7ICIA 2LKYA 4BX9C 2AH5A 2CRXA 1V1GA 2I94A 3L47A 2NRWA 3DDHA 4DS4A 4RQNA 5HP4A 2ODGA 1MR8A 3UXOA 1S6JA 5HLOA 1N2XA 1IJ6A 1CRXA 4KLLA 3WK5A 4OD0A 1QH9A 4PE1A 3F5AA 3K21A 1FIQA 4HSZA 1WYGA 5AM1A 5KU1A 4CF5A 1LKYA 1BMOA 4KLMA 3IQOA 3HCMA 3ZDBA 3EPGA 5DKWA 2HHTA 1RECA 1JI7A 4RPXA 3OSPA 1ZQQA 1KQQA 2RDIA 2M0NA 1OXJA 2F3YA 3JPTA 1ZQHA 1J7RA 3ZD8A 1COKA 1NYAA 2UVWA 4ECUA 4CRXA 4R64A 3OX5A 3ZDAA 1BR4B 2ISPA 4WQ3A 4KLFA 2CCMA 1J7PA 1X9XA 3BZKA 3HT3A 3AUOA 3ISDA 1W9ZA 9ICBA 1K96A 7ICVA 1PK3A 2RDJA 4DEZA 5ALFA 5BPJA 1NPQA 4OJ5A 2AU0A 3L3FX 1KN5A 2JWWA 4I5NB 9ICKA 3UM9A 3BFAA 1F70A 1QX5B 1DGJA 1SV0A 1ZQNA 3D2NA 1F4OA 2WC6A 3V6HA 4YGAA 1Z1VA 4DS5A 2HMXA 4R8UB 2W7OA 2QDIA 2KP7A 1FBVA 2K8MB 3TUYB 3F53A 3E0FA 3RFAA 3NSIA 1X9MA 2A1JA 2E30A 2AGQA 1IWQA 3ZNIA 1RK9A 2KI6C 1T8EA 3PM2A 1NCZA 4DL3A 3PN7C 1JALA 4EENA 5AI0A 2HHWA 1COOA 1SL1A 1QV0A 4QZAA 4N1FA 3VCBA 2C2DA 1B7TZ 3N7RC 1ZQYA 5CA7A 1PUZA 5GQQC 3OX6A 1UA1A 3A0BU 4RQ2A 1N0YA 5J0SA 4QIWF 2R2IA 1QIVA 2F3ZA 5IBWA 3LVVA 3S0EA 1TAUA 3FE6A 1PVQA 5AKEA 3PFVA 3QUCA 4INXA 1S8OA 4YD1A 2VRGA 5BPCA 1DVIA 1QLNA 3GK4X 1UURA 4QZFA 7ICHA 1SZHA 3KZXA 2K4IA 3ZDCA 2LYAA 1QWVA 3D78A 3LLEA 2AMIA 2JTTA 4M2QA 3KHLA 2BZFA 4EZ6A 5AKYA 3KZIU 3QZ7A 1NX1A 2KJ8A 3H8JA 1L7ZA 3QX7A 5CPVA 1L3SA 3AL0B 5AI9A 1SCVA 2YX8A 1B43A 1LS8A 2PI5A 4TQRA 4NL9C 2H2KA 1DQEA 9ICOA 1B8RA 1JBAA 2ALZA 3LWLA 5KT5A 2QEBA 5CSIA 1F71A 3HPOA 4OV2A 2QB0B 2OHFA 3N4MB 4BXOB 2V4RA 2JNXA 3RJIA 1DXSA 3JPPA 3FYHA 4ECQA 1L2OB 1CLBA 4MHVA 4M2OA 3I28A 1XFXO 1RZTA 7ICRA 1DOQA 8ICOA 4NLBA 2KD1A 1A4PA 4B9UA 1H38A 3JPNA 5KFRA 1FI5A 1NP8A 3B88A 3VRQA 2XICA 3GOFA 2BL0B 4IQTA 4PHKA 2O60A 3JVTC 4QWBA 1Q46A 4F4WA 1MXEA 3EPIA 4DSIA 5HR6A 4KMOB 4WJ3B 4YR3A 4CIDA 2ZFDA 3I76A 3QYPA 1ZQZA 3LWMA 7ICGA 1RPLA 2G07A 3ED5A 4F2RA 2KZMA 9ICJA 1B47A 3R9KA 2BKHB 2JRFA 4P4MA 2KNEA 3AM9A 2W7PA 4GUKA 4BWJA 3NRZA 1MN8A 5J2FA 1PVRA 2QPTA 1R2UA 1PK1B 8ICMA 4ACOA 2ZJ8A 3WK8A 1K93D 2KI4C 3Q8MA 5G5GA 5J0XA 2VA3A 5KAFU 4FTGA 1T14A 4ECXA 3H4SE 3PX4A 3GFKB 2KG5A 4UAYA 2KFNA 3SEIA 2IOHA 1L7MA 3F5EA 3SS3A 1U4BA 3H4DA 4JB3A 1K90D 4I27A 3AKBA 2Y0SF 4NM1A 2ASJA 1N63A 3MDAA 3VGOA 3SS5A 2DL0A 2GO7A 1K8UA 1KK7Z 1J7QA 2GV5A 5CSFA 1L8LA 1T3QA 3QE9Y 2I5HA 8ICSA 3SS4A 4Y2PA 4RNMA 1DMOA 4I2JA 3M7DA 2IMWP 1A75A 5I8NA 3FS7A 3I5HC 3OB1B 5G08A 1L7OA 3SV4A 3JTDC 2RRDA 4EELA 2LPEA 3SYZA 2PQLA 5FI7A 3I5GB 1N5XA 3BYAA 5AM5A 2QEHA 4XYNA 2F2AB 5ALHA 3RJKA 3RJFA 1A03A 4F4ZA 3MFHA 3B6XA 4RQ1A 4JWNA 2XY5A 1K1QA 1J97A 4P4PA 4O3QA 5J8YC 3S0GA 1UWOA 3S0BA 4JV1A 2M29A 1Q8KA 5KT6A 2NCOA 5DBAA 2Y0SC 9ICIA 2KAVA 2Q0ZX 4YQWA 2FPLA 2XY6A 3VROA 3LDAA 2WCBA 1ALWA 1OW5A 5L1MA 5AANA 4TUSA 2UVVA 5TISU 3ZWHA 2W9BB 1MA7A 2BECA 1GM0A 2DOQA 1KFSA 2KNJA 3MDCA 4EEYA 1DK3A 1TUZA 2PMYA 3C2MA 4K4IA 2QLTA 2WORA 4YR2A 1QQ6A 1OOHA 2XVTA 2W04A 1CUKA 5HNKA 4L9MA 1BG1A 2JPTA 5KT2A 4DFDA 1D1OA 5KFHA 3QUBA 4GIBA 5J2CA 2BPCA 4MF8A 3I5IC 2A3VA 4NDCA 2FJUB 3KFUF 1B1GA 3QU9A 2DUYA 1OQPA 2KIWA 2COLB 5J2HA 3Q8IA 5AXIA 1ZRMA 4PHAA 2FMQA 1AUIB 2JT0A 2KFGA 1G8IA 1CLMA 4U8DA 4TQSA 3M8SA 2F2PA 1ZQVA 2ZTCA 1PVPA 3SZ2A 5KTQA 4ECVA 1SSEB 3EVRA 3BS5B 7ICFA 1JF2A 3NUQA 1AHRA 3DF0A 2MLEC 1ZQEA 4JWMA 3THVA 4DF4A 1J7OA 1MF8B 1KWOC 3ORYA 4J03A 3KHHA 5AM0A 5AKHA 4CF4A 4KMUA 3S0DA 3RH4A 3ZI4A 4P0PA 2A1JB 1LA0A 4PT1A 2ZUDA 8ICKA 4OVNF 4MEXA 2PFOA 3BQ0A 4CE6A 3LK0A 2E3TA 1S97A 2WHEA 4J9LA 2ZUBA 2Y1MA 1U9LA 1ZOLA 4I29A 4CCHA 1UHIA 1UP5A 2OTGB 2L98A 2OM6A 4UB5A 4F2SA 1RJVA 4GFJA 1UUSA 2O5GA 4C0ZA 4HRGA 4C8NA 3I5GC 3OTQA 4LVSA 1ZFSA 2PI4A 2KQ6A 2M49B 5ALQA 1XU4A 3BOWA 3KBBA 2FCEA 3OHBA 3DD4A 1PSBA 1WCNA 5ALVA 5K89A 1ZQLA 3KEVA 5KFBA 3C1YA 1AQ6A 2P6BB 2ESEA 1MXLC 3V7JA 2DKXA 1O08A 1A6SA 4BXOA 1KCYA 4XA5A 3V72A 1QATA 3PR4A 1NK8A 5KFUA 1G4YR 2LANA 4JWQA 2QB1A 2CXJA 4RT3A 2JV3A 1TE2A 2EGDA 1CKKA 4DLGA 4RPZA 2K60A 5EE0A 1SWWA 4F71A 2L2CA 3TQ1A 4IR1A 2M3WA 1SRAA 1NJXA 4XUSA 3VRPA 4KLQA 2NLNA 4QWAA 3OGUA 1S1EA 2BQUA 8ICZA 1CM1A 1XK4A 2KVCA 3MC1A 3N28A 2CTNA 2RHFA 9ICUA 3KO0A 4FS2A 1ZQDA 1WLZA 3NXAA 1SV0C 1CFFA 4KLIA 1O03A 2W8KA 4QZIA 5CWRA 1L5UA 2MRDA 4PE7A 4NLKA 3CGAA 4ZOHC 2K4PA 5AFPA 5KT7A 5DLFA 3IM1A 5KFAA 2KAXA 2DFLA 2LC5A 4UAVA 2ZJAA 1U45A 1NKCA 3RLZA 1H4BA 3CP8A 4YR0A 9ICAA 5ALNA 3FDSA 4GXKA 4RQ8A 3MR6A 1QTXA 4DF8A 5J0WA 2G2BA 2M7LA 2VIXA 2EAPA 5B5EU 2XO7A 3BDPA 4P5OE 2CNPA 2ISOA 1SR6B 1A29A 5ER4X 2E6WA 1VRKA 2ZIWB 3DEEA 3QUTA 1TNWA 4DL5A 1TIZA 1ZD4A 3ICXA 3NHTA 3IN5A 4OZDA 2WFAA 2H3QA 2KV2A 3HWTA 3C1VA 1ZQKA 5KFZA 2LLUA 2ERBA 1NZPA 9ICCA 4FZLA 3MSEB 2KKVA 2HVIA 4DQPA 7ICMA 4RUAA 2QEVA 4NJ8A 2LHTA 4BGDA 3CNHA 5KFDA 4J9OA 5KFGA 3KOOA 5JTIA 5DB6A 4M9HA 1KKXA 2EC6B 3CYZA 1UHKA 1BPEA 2FJYA 1J55A 4USAA 2ZIXA 4KX5A 1S76D 1KSOA 1Y88A 1S6IA 3DV9A 5CHGA 2FLPA 1ZOTB 1TCOB 3N97B 4DSFA 4Y2SA 2BAPA 2R8KA 3TDIA 2W9CA 2JULA 2K8BB 4MFCA 7ICKA 1BODA 8ICEA 3KKAC 4O3PA 4I2CA 1L6NA 3O4YA 2ZJ5A 4QW8A 2HW3A 2P71A 5CSJA 1NX2A 3D2QA 3F2CA 2KBIA 2JZBA 1KFDA 5AERA 4ZCUA 4BWMA 1Z4OA 5FI2A 1DJWA 1S10A 1M39A 1QXPA 2H61A 5AM2A 2AGPA 2IA6A 4RT2A 1RDFA 1C07A 4UAWA 2W9AA 3TDUA 1JN3A 2G09A 2M1UA 3LK9A 2BCVA 1TK5A 3SG3A 1ZMZA 2PASA 2LYBA 3VRNA 4QWCA 4NXZA 1JFKA 3NVVA 1X66A 9ICRA 2G5IB 4Y2VA 4RPYA 5KFOA 2W8LA 2VA8A 4DOAA 1KQMB 1UHHA 5ALKA 2F3NA 1EH2A 3A0HU 5AHXA 3SD7A 2WTFA 4CLNA 3QU4A 2DBYA 4IR9A 4USLA 3KD3A 4C8LA 2XGQA 4PH5A 8ICFA 4ETOA 3CZ2A 2QB0A 2YMMA 3PMNA 1T4GA 4NL9A 2BCSA 2NZ0A 1Z4NA 1TTXA 4FE3A 3TAPA 4KLOA 2DPIA 3BQ7A 5ALZA 3H4BA 5F3XB 4ELUA 1YVLA 4J9KA 1KFUS 3CR2A 4NM2A 4JUZA 2OXOA 1LVCD 5E79U 2OS8B 4IQUA 3QZ8A 3HILA 4UQGA 5KFMA 2BL0C 4XRHA 3KHEA 2Y5IA 4PALA 3Q8RB 1ED1A 1AJ5A 1MQ2A 1SKWA 1S6CA 5F6TA 2JT8A 5KFTA 4DIRA 1CTRA 2F77X 1ZQTA 1YTZC 1QX2A 4MZLA 4HAIA 2H3FA 3HJEA 3FE9A 1JFJA 2E1FA 4AYBC 1ZQWA 1B0XA 4NLCA 2K7OA 1KLNA 3M9NB 3CLNA 1FI6A 5DBBA 3D6JA 2P6RA 1B22A 5KSZA 2E5SA 4TNCA 5PALA 4YRUA 1U48A 4R63A 4E68A 3OP0A 5TNCA 3K1ZA 3D10A 5I2QA 3BUXB 4I5JA 2AUCA 1ECWA 5D49A 1F5SA 4M2YA 2L5XB 4NQGA 2HVHA 4DFMA 1PALA 3GIMA 2AJQA 4FS1A 2ZXHA 4YI9A 1SL8A 1JRPA 5AIBA 1JMSA 4GXJA 2Y4QA 1IXRA 3CZ1A 5EE1A 1CFPA 2B0CA 2C2EA 2MAXA 1F0MA 5BOMA 1DK2A 5IIKA 3ZDDA 1ZQBA 5GTHU 5EWFA 4QNLA 1M46A 1SKSA 1RXVA 2L2EA 2WC8A 3SV3A 1F54A 4KLEA 2PFQA 2QACA 2KSOA 2YB1A 4GGFA 4DS7A 2KICA 4EX7A 1NKBA 3GV5B 2WC5A 1ZYQA 4ZH4A 3ISBA 2ZNDA 1DC1A 2KJ9A 2JU0A 4MEWA 2K4HA 4XQ8A 4AYBF 1ZJNA 4C8MA 3HW8A 2KGRA 2KFZA 2L4HA 1QQ7A 3OSNA 1L3VA 4YXMA 1KEJA 3I1YA 2NV3A 1L7NA 1GO3F 2ISDA 4F50A 7ICEA 1SR6C 1AVSA 3PLFB 3MR2A 2M9GA 4Y2TA 2KPHA 2AGOA 4RQ0A 1TNPA 2W3SA 1N56A 4O9MA 5L1IA 1SPYA 2KOTA 1N61A 3SMVA 2W9BA 4Y2JA 5FYXA 3BJYA 2MU2A 2JH7A 3RRHA 3QMEA 7ICSA 1L3TA 1BNOA 1YZ7A 3UMBA 3PSTA 5AK5A 2BKEA 1XFZO 3SG2A 2FDRA 2FPKA 2XIDA 3FWCA 1SGGA 4N1GA 1EJ3A 2PFNA 3PJIA 4F8RA 4JPZB 2VA2A 3T5HA 1U5IB 3B86A 5J0TA 3OGNA 2W3RA 4NV0A 1RTP1 2LLSA 1IKUA 8ICHA 2F2OA 3RZSA 2JXCA 3I5FB 3PNCA 2LCPA 2K2AA 4DCCA 4Y2YA 1M31A 2MA2A 4K4GA 1YUUA 2LM5A 3HP6A 1N48A 1S36A 5DG7A 1FW4A 5IINA 1DJYA 5J2AA 1Q80A 2BKIB 1Y6WA 1XFUO 2JOJA 2YY6A 3FM9A 3TZ1A 4IRDA 2JTZA 2KIVA 3FAHA 1RQLA 2CN1A 4EX6A 4DFKA 2R8IA 3PW4A 4FQTA 5AKXA 5F9LA 1F44A 1SL9A 1TK0A 4DQRA 2LBOA 3RBEA 2G06A 1XSPA 4PDZA 1WLMA 3PR5B 3PO4A 1QX7A 3PSFA 4JK1A 1S5GY 2ZIWA 1TAMA 4BUGA 1XVJA 4YD2A 3RBDA 2SASA 3J81j 3CZTX 4Z6CA 1NOMA 2NRXA 3RRGA 4R8UA 2BCRA 2LVIA 4YCXA 4J9QA 1JX4A 1LV5A 2Y9TA 4YXJA 2FMPA 3RJGA 4I2GA 3RB4A 3D0YA 1ZQUA 2YB4A 5B66U 4BDPA 5AK4A 1DF0B 1KK8C 1Z19A 2KSPA 4C7ZA 1PVAA 1CB1A 2LHLA 1LINA 1Z2CB 1SXDA 4KYNA 1CDPA 1UHJA 2K61A 4IL6U 1LA3A 2BHNA 3GZFA 5KFNA 5EE9A 2ZIVB 4M9GA 9ICEA 9ICWA 2A4JA 3SI8A 1KQVA 3G6YA 4Y2XA 2IOFK 5ALGA 4Q8EA 3ETRA 2WCFA 5J29A 1K95A 2M8UA 3RB0A 2BQRA 3D74A 4EZ9A 3JPSA 3O78A 2CPRA 4Q8FA 1NK9A 1KK7Y 5KG5A 4NLGA 4F0ZB 3H7IA 2I18A 3PX0A 2KE7A 3R72A 2ZIUA 1YX7A 1J1DA 8ICPA 2JH1A 1IH0A 3IV6A 1QSSA 4RNOA 2FLLA 2RGIA 3IDWA 2XGPA 2YMPA 1D9DA 3PSRA 5KFPA 5CJ7A 4U7CA 4GXIA 1BPYA 1JWDA 4UB4A 4WQ2A 3HX4A 3K1EA 1PK1A 1ZXIA 1CEZA 3S6JA 2R8HA 2JEFA 3QEAZ 1B8LA 1MC8A 1LKYB 2F1HA 3RH6A 2EHBA 3E2EA 5HLVA 4PJ0U 2KVSA 3SG4A 3OPXA 4DFJA 2IS9A 4YGBB 3HRDD 1XFWO 3V7KA 4NLZA 2KK0A 4I28A 1CFDA 4B9NA 5KFSA 5J0QA 1IQ5A 1NX3A 5KG6A 3M8RA 4DL6A 4HREE 2LAPA 2XCPA 1H8BA 4PZOA 1WDCB 9ICMA 1DRGA 8ICYA 2E8NA 1CDNA 5ALPA 2D8CA 2MUTA 4KLHA 1B9AA 1N60A 3C21A 4OR9B 2AQ0A 4QZ8A 7ICJA 2G5HB 2HETA 3RAXA 1NJYA 5EL2A 5ALLA 1QLSA 4JV2A 3EW9A 1KFTA 2N1RA 1PVBA 4RQ3A 4P2YB 1RQNA 4DL7A 1ZRNA 9ICLA 3CWGA 4GC7A 5DG9A 1Z1BA 5KFEA 1XFYO 1MUXA 5CRXA 2HHXA 4ED1A 2ZIVA 3TUYC 4YBHB 4DOCA 3QU2A 1A76A 4DO9A 4P0QB 4ED3A 1M45A 3MGHA 5GTIU 1D9FA 1K9KA 1XA5A 2YGUA 2O6KA 3LCPC 2FPMA 4BJQA 3UNWA 3Q8LA 3B7AA 1QJTA 1TAQA 1BPBA 4F4YA 2NO5A 4TURA 2HHSA 2ZN9A 3AAKA 2DKZA 2K89A 5ALWA 4I2BA 5KG2A 1J2MA 1SL2A 2F76X 2LYHA 2BE6A 5L1KA 4DQSA 1C7WA 1SYMA 1YRUB 3SAGA 4JMUA 2K7CA 1L3UA 5ER5A 3ZD9A 2AQ4A 2GWSA 4G9BA 1V9PA 5ALOA 3PY8A 4RUCA 2MSNA 1TV9A 2C28A 5ALMA 2F1JA 1SMGA 4F4XA
chains in the Genus database with same CATH topology
4GAOA 2KLDA 5FI7A 1PK1A 1DEKA 2FE9A 2E8MA 4NJ8A 1LKYB 5JTIA 2F8KA 4JKTA 3BS7A 4PZNA 2Y9UA 2GLEA 4NL9C 1LKYA 3H8MA 3TADC 5FI6A 2E8PA 1JI7A 5J8YC 1SXEA 3SENA 1B0XA 1UQVA 3KEVA 5I94A 2QB0B 2BAPA 1OXJA 3IVTA 2KIVA 2ESEA 1RG6A 1DXSA 2DKXA 4PZOA 1COKA 4IJ7A 3KKAC 4MHVA 2E8NA 5JRTA 1OW5A 5L1MA 2D8CA 1B4FA 2E8OA 1X9XA 4I5JA 2QB1A 1W9ZA 2JV3A 2ES6A 4RQMA 5D3OA 1PK3A 2K60A 1UCVA 1SV4A 2QARB 3TADA 2B6GA 1Z4HA 4I5NB 5FI2A 2EANA 3O4XA 2KMDA 1WWUA 1SV0A 1F0MA 1Z1VA 4I5KA 2Y9TA 1SV0C 2QKQA 2QARA 2YGUA 2KSOA 4GBAA 1PK1B 3UNWA 2K4PA 1DC1A 1X66A 2KLEA 3K1RB 4MEWA 1DELA 1V85A 1Z2CB 1SXDA 3PM2A 2F3NA 4KYNA 3BS5A 2DKZA 3OBVA 3EG5B 1KW4A 3BS5B 2KG5A 2BNXA 3SEIA 2LMRA 2D3DA 5JU5A 3SS3A 3UO9A 5HL1A 2EAOA 2EAPA 1V38A 2QB0A 2EAMA 4NL9A 3SS5A 2DL0A 4IS7A 3BQ7A 2L5YA 2KE7A 5F3XB 2F44A 3SS4A 1X40A 3KKAA 2KSOB 4I5LB 5J8YA 3IDWA 2YTUA 4RQNA 1WWVA 3TACB 5KNIA 3HILA 1SGGA 2LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK1 A;  2FE9 A;  2E8M A;  4NJ8 A;  1LKY B;  5JTI A;  2F8K A;  3BS7 A;  4PZN A;  2Y9U A;  2GLE A;  4NL9 C;  1LKY A;  3H8M A;  3TAD C;  2E8P A;  1JI7 A;  5J8Y C;  1SXE A;  3SEN A;  1B0X A;  1UQV A;  2QB0 B;  1OXJ A;  2KIV A;  2ESE A;  1RG6 A;  1DXS A;  2DKX A;  4PZO A;  1COK A;  3KKA C;  4MHV A;  2E8N A;  5JRT A;  1OW5 A;  5L1M A;  2D8C A;  1B4F A;  2E8O A;  1X9X A;  2QB1 A;  2JV3 A;  2ES6 A;  4RQM A;  1PK3 A;  2K60 A;  1UCV A;  1SV4 A;  2QAR B;  3TAD A;  2B6G A;  2EAN A;  2KMD A;  1WWU A;  1SV0 A;  1F0M A;  1Z1V A;  2Y9T A;  1SV0 C;  2QKQ A;  2QAR A;  2KSO A;  1PK1 B;  2K4P A;  1X66 A;  3K1R B;  1V85 A;  1SXD A;  2F3N A;  3BS5 A;  2DKZ A;  1KW4 A;  3BS5 B;  2KG5 A;  3SEI A;  2LMR A;  2D3D A;  5JU5 A;  2EAO A;  2EAP A;  1V38 A;  2QB0 A;  2EAM A;  4NL9 A;  2DL0 A;  4IS7 A;  3BQ7 A;  2L5Y A;  2KE7 A;  5F3X B;  2F44 A;  1X40 A;  3KKA A;  2KSO B;  5J8Y A;  3IDW A;  2YTU A;  4RQN A;  1WWV A;  3TAC B;  5KNI A;  3HIL A;  1SGG A;  2LPE A; 
#chains in the Genus database with same CATH topology
 1KK8 B;  3RAQ A;  2HSZ A;  1HT9 A;  3EYZ A;  2JMG A;  2MHH A;  1RRO A;  2Y1N A;  4DL2 A;  1KRP A;  4CPV A;  4QZH A;  5IIL A;  2F33 A;  1VJ5 A;  1X9W A;  2KEY A;  9ICG A;  5C0Y A;  2HHU A;  3KHR A;  1T7P A;  3DZT A;  1GJY A;  4UB8 U;  1NI3 A;  3WKB A;  2ASL A;  4A4B A;  5FI6 A;  2EQY A;  2M1K B;  2KI6 D;  3PML A;  4YG2 A;  3L4L A;  3BUW B;  3LK1 A;  2EH9 A;  3LYS A;  1RFJ A;  3IHQ B;  5KAI U;  3TS5 C;  5A0L A;  3C2L A;  5I2L A;  3GQC A;  1R6P A;  4QJF B;  4P0P B;  3NAS A;  5JRT A;  5KFV A;  3SAH A;  7ICO A;  4ORA B;  2HCF A;  2E8O A;  4FBT A;  2MLF C;  4UAS A;  4OCZ A;  3H40 A;  3HX0 A;  2I9G A;  5I2O A;  3PZP A;  1ZAC A;  1UCV A;  2ZG6 A;  3WK6 A;  3O6B A;  3DF0 B;  1FF1 A;  1CLL A;  2B6G A;  2DPJ A;  1IM4 A;  1OUQ A;  1YUT A;  2BCB A;  1XC9 A;  2KKP A;  1JXL A;  2H3I A;  5EWE A;  1AJ4 A;  4QZC A;  1LVH A;  3ICB A;  1E8A A;  3RH5 A;  3L4A A;  4CNQ A;  4I2D A;  1OMD A;  2OS8 C;  3CTN A;  3I5H B;  2P35 A;  4IC9 A;  5KFI A;  2WCJ A;  3JTD B;  2ZIX B;  2FCD A;  4RNN A;  1BR1 B;  4U6P A;  1U5I A;  4F93 B;  2C22 A;  2HOQ A;  5G5H A;  5J0U A;  4F5N A;  5DDY A;  3BS5 A;  2W9C B;  3BFH A;  3LVW A;  2AHO B;  4GNK B;  2ZNE A;  4NY8 A;  2I2R E;  5DQG A;  2LUC A;  2V9W A;  5HHI A;  1UA0 A;  4ECR A;  5KT4 A;  5CP2 A;  2W43 A;  4ELV A;  5C5J A;  1C20 A;  4O3M A;  2LMT A;  5DKR A;  4QJ3 B;  1MQ1 A;  4F5R A;  2HBK A;  1EG4 A;  2GTE A;  3ZDE A;  3Q8S B;  3D0Y B;  4F4K A;  1PUL A;  2F44 A;  2H61 C;  2DGZ A;  4P0Q A;  3CS1 A;  1FFV A;  1WRL A;  1J1E A;  4FO6 A;  4DFP A;  2BR0 A;  2A19 A;  4Z6E A;  4KN7 A;  4O3N A;  2JEJ A;  1S3P A;  2RP5 A;  2E1E A;  1C3Y A;  2JR5 A;  2KOB A;  3WK9 A;  2KLD A;  3QEB Z;  1KFU L;  4QZB A;  2KFH A;  3PAL A;  4INW A;  4PCW A;  2ASD A;  1KQM C;  2QEO A;  1ZQS A;  3I5I B;  4CFQ A;  5DLG A;  4UAU A;  4Q44 A;  4PZN A;  1X6I A;  3PV8 A;  4MFF A;  3C1Z A;  2LUX A;  3RR8 A;  4F72 A;  1DF0 A;  1SXE A;  1B8C A;  4QZG A;  1JIH A;  5EOZ A;  5AKJ A;  5I94 A;  1QVI Y;  3SR6 A;  8ICJ A;  3QU5 A;  3BQ3 A;  2P6U A;  4F91 B;  1YX8 A;  5J2B A;  1SL0 A;  4EBE A;  2GGM A;  1NCY A;  3OHM B;  1SWV A;  2RQ5 A;  2W54 A;  2GH1 A;  1MQ3 A;  1TCF A;  3EZ5 A;  4RU9 A;  1BPX A;  1W7I B;  4QJ5 B;  5TZV A;  2WF8 A;  3TAR A;  3FIA A;  4TUP A;  1BF5 A;  1BGX T;  3NVY A;  2CBL A;  2CXY A;  5ALT A;  4OO1 J;  4JQ0 D;  2YN4 A;  4C4S A;  1OW4 A;  3C29 A;  2ZRT A;  5F9N A;  4X5V A;  1A77 A;  2L50 A;  2EDU A;  3WKD A;  3BFB A;  5KG3 A;  1RWY A;  1JUO A;  4I2A A;  2KHN A;  1ZQR A;  2MBX A;  3GV7 B;  2BDU A;  4RQ4 A;  2F1I A;  4EBC A;  1NX0 A;  2JXJ A;  1TFR A;  4M9L A;  5KT3 A;  5AEQ A;  2HBM A;  2KFF A;  2UVU A;  9ICQ A;  1Z00 A;  1SNL A;  4Z6D A;  3WK4 A;  1XYD A;  4F5P A;  3VRR A;  1HJP A;  1DEL A;  3M0W A;  2MUT B;  3B0Y A;  1P28 A;  1Y0V H;  3I5F C;  4UW9 A;  4DSJ A;  5KFJ A;  2PAL A;  1DGV A;  3GU3 A;  1SB3 C;  1DJX A;  2BE4 A;  2LE9 B;  1QVI Z;  5HML A;  4MLW A;  3IRU A;  1ZD3 A;  3IP4 B;  2R8G A;  2XI9 A;  3AQF A;  3F45 A;  2P70 A;  5KFC A;  1NK6 A;  1V38 A;  3BOW B;  1QS7 A;  2EAM A;  3N7H A;  4YI8 A;  2LI6 A;  1YT3 A;  2WCK A;  2IHM A;  3K75 D;  1X6J A;  2PRU A;  2JZB B;  8ICT A;  3H0L B;  1NK5 A;  3CZ0 A;  1UHU A;  3E58 A;  5ALS A;  3EKJ A;  3FE8 A;  1OOJ A;  4M6W B;  8ICW A;  4AP9 A;  2EZZ A;  2WF5 A;  4DLE A;  1EXN A;  1SCM C;  8ICX A;  1U47 A;  1KL9 A;  3AEV A;  4UB2 A;  3B87 A;  4DOB A;  2ZRS A;  4GGN A;  2I6X A;  3AQE A;  3FWB A;  2XY7 A;  3T3F A;  3KTQ A;  3RB6 A;  5T14 A;  5DQH A;  1B7T Y;  4O3O A;  4O0I A;  4ECW A;  2K7B A;  2LM1 A;  4YP3 A;  1TNQ A;  1MWN A;  8ICG A;  5AM4 A;  1A0P A;  5CB1 A;  2K8A A;  1CNP A;  2WOS A;  1S0N A;  3NHI A;  1SY9 A;  2LHI A;  1YR5 A;  3TAD C;  4BY4 A;  1S5G Z;  3KHG A;  4MEY A;  4PHM A;  5AI4 A;  3TS5 B;  4KLU A;  1RM6 C;  5AI8 A;  1NJZ A;  4YN4 A;  1ZQA A;  1HUO A;  2PSR A;  2KGB C;  4DL4 A;  5KTY A;  2K4E A;  3M9O B;  4J9R A;  4US9 A;  5IIO A;  4M0A A;  4ELT A;  5DGB A;  2EZY A;  7ICT A;  1HQV A;  3D73 A;  2DF4 B;  3WKE A;  1FFU A;  2NO4 A;  7ICQ A;  1SV4 A;  3NRW A;  3NSO A;  3UXP A;  5D4B A;  1Z4H A;  1UT8 A;  4PHN A;  2EAN A;  4I2E A;  2KHV A;  2KYC A;  3JVT B;  3RTV A;  3OB2 B;  5ALE A;  4PGY A;  3TKA A;  4QJ4 B;  2PFP A;  5H2F U;  9ICX A;  4O5K A;  7ICL A;  1EL4 A;  1NIW A;  4B9V A;  1XSL A;  2WND A;  1B4C A;  5ALX A;  2PXI A;  1C7Y A;  2XC9 A;  5DG8 A;  4M04 A;  3WU2 U;  2ZN8 A;  4PE4 A;  1EG3 A;  4QZD A;  4B6J A;  4RZR A;  8ICI A;  3GDX A;  2KLE A;  5FP0 A;  4ECZ A;  3ETL A;  4KLT A;  4KLG A;  1V85 A;  2JRZ A;  2BCA A;  3PN7 B;  3IG5 A;  4PL1 A;  2B1U A;  3EWA A;  3G6X A;  1CI4 A;  2EZX A;  4ECS A;  1DJZ A;  3GIJ A;  1Y1X A;  1ZQP A;  3DYE A;  3IF7 A;  1GGZ A;  1L7P A;  1OMR A;  5AKZ A;  3R1V A;  5ALD A;  5AI5 A;  2OEH A;  3G6V A;  2JC2 A;  3T5K A;  4WRI A;  4IQV A;  1ZQX A;  5III A;  4LZG A;  5DBC A;  1KBU A;  2YQE A;  3Q8K A;  2FMS A;  4O5E A;  3BUN B;  5J3X A;  2OYY A;  1JF0 A;  3L4P A;  1Y1U A;  3TFS A;  1QAS A;  1IJ5 A;  4M47 A;  2KJ5 A;  2LMU A;  2JEG A;  3C5G A;  1L8O A;  1ZET A;  5ALI A;  2H3V A;  1IG5 A;  4US8 A;  1U49 A;  3BQT A;  2KHQ A;  3WKA A;  2HOI A;  4FZM A;  2VJ4 A;  1DGU A;  4M9J A;  4GAO A;  1ZJM A;  1CMG A;  3BUM B;  4FBU A;  5AKG A;  1ZQG A;  2PVB A;  2FE9 A;  3NS1 A;  4IQW A;  3NSK A;  4OCI A;  3ALR A;  3CRX A;  5J2K A;  3D76 A;  2H3Z A;  2F8K A;  4JKT A;  3V7L A;  1QTM A;  2RLT A;  4RQ7 A;  3UQ0 A;  3S0A A;  2ZXI A;  4MFA A;  4Y2U A;  3WNX B;  2Z7J A;  3UXN A;  1WY9 A;  2ZTD A;  5KFX A;  3SEN A;  2L0P A;  2KDH A;  4ECY A;  3WK7 A;  3VB1 A;  2WCL A;  4I2H A;  3TDZ A;  5ALU A;  5ALY A;  4O3S A;  4KIT B;  7ICP A;  2PMZ C;  1A75 B;  1TRF A;  3EKH A;  3VC8 A;  3A8R A;  3OHA A;  3FC4 A;  2ATL A;  2LP2 A;  2OCE A;  1K9U A;  3TAQ A;  3RM1 A;  1BOC A;  2HDO A;  3ONN A;  2HQ8 A;  3V6J A;  1SCM B;  5J2I A;  2M97 A;  3SIB A;  4PHE A;  2WB1 C;  5ALJ A;  4J9S A;  1LB2 B;  2JXL A;  3RJH A;  1SIJ A;  2KN7 A;  1WRZ A;  3BXK A;  2FI1 A;  9ICP A;  9ICH A;  3PSI A;  5EE3 A;  4UAT A;  1K1S A;  3T5L A;  4DRW A;  1WWU A;  1CM4 A;  5AIC A;  1K9P A;  1FPW A;  1NUB A;  3RJJ A;  4EBD A;  4YMM A;  1QLK A;  1DJG A;  2BQ3 A;  1ZQO A;  5KL8 B;  2KAY A;  2QAR A;  1TNX A;  5CEH A;  4FFD A;  2HBJ A;  2OH2 A;  1QCK A;  2BPF A;  8ICA A;  1TKD A;  4QWE A;  1WUD A;  1ZUZ A;  1XO5 A;  4GBA A;  1GGW A;  2FOT A;  1YRT B;  3PW5 A;  2GOL A;  4A8E A;  2LP3 A;  2Q4T A;  1NNL A;  8ICB A;  1XWL A;  3IQQ A;  1ZQM A;  3OBV A;  4UAR A;  1KW4 A;  4I2F A;  1WDC C;  3EK4 A;  8ICR A;  3SG7 A;  5L9X A;  4UB1 A;  1OOF A;  2BNX A;  4EYI B;  4QWD A;  3EVV A;  1J2N A;  3B9J A;  3V2L A;  3DVE A;  2LVV A;  4XJK B;  2GGZ A;  3C23 A;  3KF9 A;  1ZD2 P;  3TAN A;  3C5F A;  1X9S A;  1KWO B;  1OOG A;  3BJH A;  2NRT A;  4B9S A;  3A4U B;  3GIL A;  2WB1 F;  3NVZ A;  1X40 A;  3Q8Q B;  3DXL A;  3SAF A;  2WF7 A;  4DWI A;  1CDL A;  4DSE A;  5AKK A;  1TK8 A;  1OMV A;  2YML A;  5DB7 A;  2MAZ A;  1DTL A;  4ED0 A;  4IRC A;  2HOF A;  4BY5 A;  5KG1 A;  4UBC A;  7ICN A;  1ZQ1 C;  4C4T A;  4DCK A;  2OTG C;  2SCP A;  3JPQ A;  4M9N A;  4B9M A;  1WRK A;  2F8L A;  3M9M B;  3U26 A;  5KFQ A;  5HHH A;  5HKW A;  4EEK A;  5L1L A;  3AMZ A;  5J0P A;  3CYM A;  3PW0 A;  3M1Y A;  4R1E A;  5AK3 A;  3SG6 A;  3O2P A;  2BBM A;  1SKR A;  1C7V A;  4OJO A;  5AI6 A;  4M2P A;  5DDM A;  2M7N A;  4C0K A;  1JC2 A;  1UQV A;  4CF3 A;  1Y1A A;  5HKY A;  3H0M B;  3IG8 A;  4ED6 A;  4KX3 A;  5D46 A;  3PW7 A;  1B4F A;  2JEI A;  3MR3 A;  2AAO A;  1M6Y A;  5DB9 A;  1PRW A;  4O5C A;  4RQM A;  4KLS A;  3MBY A;  4EYH B;  1TVA A;  1K5O A;  3OJS A;  2QAR B;  2HHV A;  3MFI A;  2J6U A;  4ICA A;  4C8K A;  4PGX A;  2WF6 A;  1BU3 A;  2XCA A;  1ZQF A;  1BNP A;  2LMV A;  1XO1 A;  3O4X A;  4QZE A;  1Q3U A;  3R1P A;  4NDD A;  1V97 A;  1IRJ A;  2K7D A;  4MVF A;  4P2H A;  1S0O A;  3PM8 A;  2D8N A;  2W55 A;  3B0X A;  4C0L A;  1Z3E B;  2Y1J A;  2ZIU B;  4NDB A;  2I7A A;  4CFR A;  2G08 A;  2HBL A;  1CMF A;  1K2H A;  3OJU A;  1K94 A;  1QV1 A;  2WCM A;  4PPX A;  2M0R A;  2PYQ A;  1TWO A;  4N5X A;  3WHU B;  2R8J A;  2UVR A;  3WXA A;  5AKL A;  3CR4 X;  2V4Q A;  2G0A A;  3EG5 B;  2P66 A;  4ED2 A;  3UPQ A;  4Y2Q A;  4QZ9 A;  4LJX A;  2AXT U;  5L1J A;  3GK1 A;  3CAB A;  5JJG A;  1ZQJ A;  3H8S A;  1KTQ A;  3CDN A;  4DQQ A;  2H8V A;  5HR7 A;  5HMM A;  3UO9 A;  1RYR A;  3QNM A;  2A1A A;  2L4I A;  3KPX A;  1QIW A;  2K8C B;  2LLT A;  2JNF A;  4O3R A;  3BQ2 A;  4ED7 A;  1VDV A;  2L5Y A;  4C0J A;  1NJW A;  4MF2 A;  2BGW A;  4YGC B;  4MRX A;  5J2E A;  3KKA A;  1QSY A;  1PK0 D;  4F92 B;  5KFL A;  2NXQ A;  3GII A;  2YTU A;  2LNK A;  5HYD A;  4AQJ A;  4B9L A;  5EWG A;  1N2D A;  3EK8 A;  1MHO A;  3AKA A;  1NKE A;  3PSP A;  1DEK A;  1WG8 A;  2KTQ A;  2E8M A;  3NGD A;  2OWO A;  1AK8 A;  3TI0 A;  4G3I A;  2EC6 C;  1ARO P;  3RJE A;  2GLE A;  4PHJ A;  4QW9 A;  2K2F A;  1SZP A;  1MSW D;  2BBN A;  2JQ6 A;  5J2D A;  8ICL A;  4CDG A;  1FEZ A;  1SL7 A;  3AN1 A;  4Q04 A;  3GK2 A;  2NRZ A;  1IGV A;  4C80 A;  3F2D A;  2BPG A;  4PE0 A;  2PMZ F;  5DKQ A;  4ED8 A;  1BT6 A;  1F8H A;  3WKC A;  3QXG A;  3EK7 A;  5CSN A;  3N7S C;  2V53 A;  2VAN A;  2JGA A;  3RB3 A;  2IHN A;  2FJ6 A;  1HIW A;  1PZN A;  3HKZ F;  3PAT A;  3DVJ A;  3RR7 A;  3F2B A;  2F8P A;  4DUQ A;  3D75 A;  1HUZ A;  2M9N A;  4UAZ A;  3NTU A;  4GLX A;  1BPD A;  1ALV A;  4UPG A;  2IBK A;  1YUR A;  3M6Z A;  3DVK A;  4I2I A;  2VKQ A;  2NRV A;  3JPO A;  5ALR A;  4Q45 A;  2JT3 A;  1D8B A;  3SIA A;  1IIO A;  1JSA A;  2NYV A;  2Y1I A;  1G33 A;  1V1F A;  1S0M A;  1ZQI A;  3PO5 A;  3DVM A;  4AQI A;  8ICQ A;  4F7F A;  4YMN A;  3SJS A;  4GFT A;  1RXW A;  1DJH A;  1T3N A;  1S77 D;  1L2O C;  2VJ5 A;  4NWI A;  5J2J A;  3TFR A;  1YUS A;  3NVW A;  3QRX A;  5JU5 A;  1D8Y A;  2KQY A;  5KFW A;  1IQ3 A;  3AU2 A;  9ICT A;  3H0R B;  3PW2 A;  5DGA A;  9ICV A;  3D77 A;  3MGI A;  2R18 A;  4PGQ A;  2G9B A;  4A4C A;  3V6K A;  4KTQ A;  4IS7 A;  4F5Q A;  1TOP A;  2KYF A;  4IL1 A;  2BDP A;  2ZKM X;  1KDH A;  3HKZ C;  1ODB A;  2MA1 A;  5AKI A;  2BCQ A;  2B21 A;  3D2S A;  4GC6 A;  3T5J A;  5CR0 A;  5J8Y A;  1A2X A;  4DQI A;  1ZQC A;  3K4G A;  1TN4 A;  1SBJ A;  1WWV A;  1XNS A;  5KNI A;  3BUO B;  2W9M A;  2J6S A;  4B9T A;  9ICF A;  4JD9 A;  4UB3 A;  2JZI A;  4CGZ A;  5DIC A;  1ZD5 A;  1DT7 B;  4ECT A;  4YGD B;  1URJ A;  1XS9 D;  3DY9 A;  2Y9U A;  3MGV A;  1JUD A;  1KSM A;  1LXF C;  4OJP A;  3SG5 A;  3QUQ A;  1SKT A;  2KBM A;  4IRK A;  4D1E A;  5KL1 B;  3E3R A;  5D7F A;  1ORG A;  4GGF C;  1OZS A;  5J0O A;  1NWD A;  4MZK A;  3NSL A;  1BLQ A;  3BZC A;  3IVT A;  5J2G A;  1RG6 A;  1OE9 B;  1T94 A;  5D69 A;  4IJ7 A;  3GIK A;  3UMG A;  4Z6F A;  5DKN A;  1BJF A;  3MAB A;  1RYU A;  3UQ2 A;  1P7D A;  2DQN B;  2WAQ F;  5JUM A;  4MSP A;  4M6W A;  3S0F A;  2HQW A;  5D3O A;  4Q43 A;  3TAD A;  1C3Z A;  1WCL A;  2MJW B;  3R1O A;  4C8O A;  1RYS A;  4E0D A;  2KMD A;  1FO4 A;  8ICU A;  2LVK A;  4ZCV A;  2C2R A;  2DWQ A;  4PL2 A;  1KFX S;  4I5K A;  3EUB 2;  2JPO A;  2MRL A;  2ZTE A;  4KLD A;  2ZUC A;  8ICN A;  4YGE B;  2WCH A;  1NSH A;  1YZ6 A;  5JOL A;  1IV8 A;  3C28 A;  4ICB A;  4ORC B;  1AP4 A;  1N65 A;  5B8I B;  2IOF A;  2W11 A;  2HHQ A;  4F5O A;  1Q3V A;  4YMO A;  9ICN A;  1EXR A;  1YVH A;  4RQ5 A;  3EVU A;  1QQ5 A;  5AIA A;  3WHT B;  4C7Y A;  1W7J B;  3BQ1 A;  4NLN A;  3PX6 A;  2WF9 A;  2D3D A;  2K0J A;  5AM3 A;  5DB8 A;  5BOL A;  5HL1 A;  4UB6 U;  1IIP A;  2EAO A;  3SQI A;  7ICU A;  4MN0 A;  2YMQ A;  1QSL A;  3CR5 X;  2CT9 A;  8ICC A;  4HRH A;  4KN4 A;  1SW8 A;  5J0R A;  2WAQ C;  2H5X A;  1GQM A;  3RF9 A;  2BCX A;  4DSL A;  1N5W A;  4QIW C;  3MR5 A;  4J9P A;  1DGS A;  9ICS A;  4J9N A;  4KLJ A;  1CFC A;  1X2I A;  2KSO B;  4I5L B;  1XFV O;  1KFX L;  1S9F A;  1JXE A;  3TAC B;  1S0V A;  1D8L A;  4AOM A;  2KZ3 A;  4Y2R A;  4R65 A;  1LKJ A;  4MRY A;  1BVS A;  3PVX A;  1XK4 C;  2W03 A;  2HF5 A;  3L5K A;  3LL8 B;  4F3O A;  3BS7 A;  3T79 A;  1S26 D;  3AU6 A;  5AK6 A;  4P4O A;  1SK6 D;  2TN4 A;  3H8M A;  1UPH A;  4YVZ A;  2E8P A;  1NK4 A;  3CW2 C;  1X42 A;  2Q4U A;  3Q8P B;  2J6T A;  3M6K A;  5IIM A;  1UT5 A;  4DSK A;  8ICV A;  3ISC A;  1X02 A;  2Q91 A;  2LV7 A;  4MZJ A;  2L51 A;  5HKZ A;  1NK7 A;  1IG6 A;  5J0Y A;  5K4L A;  2LM4 A;  4YFK A;  3O0F A;  1OSA A;  2ES6 A;  1XFR A;  4XJK A;  4C4R A;  4J9M A;  2BCU A;  4PHP A;  4GPL B;  1TUJ A;  4OJ6 A;  4ORB B;  5KG7 A;  5KFY A;  4FQO A;  2PKE A;  1N62 A;  4R66 A;  3JPR A;  1UHN A;  1VLB A;  3NGV A;  1OZO A;  1HEK A;  1XSN A;  1DJI A;  1BPZ A;  1NCX A;  4LZD A;  2QKQ A;  4FZN A;  4K4H A;  1Z00 B;  4JV0 A;  5DQI A;  2HI0 A;  4OJL A;  3K1R B;  3GV8 B;  1F4Q A;  3UMC A;  2KI4 B;  3N7P D;  2FLN A;  5KG0 A;  2NCP A;  4TUQ A;  1PSR A;  3QU7 A;  2JHD A;  1CDM A;  1S5L U;  2D6F C;  1JRO A;  5KFK A;  5KFF A;  4RQ6 A;  4UBB A;  1M63 B;  2LVJ A;  2WCE A;  2LMR A;  1KSP A;  4MBE A;  3H8W A;  3C2K A;  4PHD A;  2I1Q A;  1XO0 A;  1NK0 A;  4OKH A;  1NZB A;  2HPS A;  1OOI X;  4HYK A;  3AAJ A;  1F55 A;  2OPO A;  5IIJ A;  5KG4 A;  2KZZ A;  7ICI A;  2LKY A;  4BX9 C;  2AH5 A;  2CRX A;  1V1G A;  2I94 A;  3L47 A;  2NRW A;  3DDH A;  4DS4 A;  4RQN A;  5HP4 A;  2ODG A;  1MR8 A;  3UXO A;  1S6J A;  5HLO A;  1N2X A;  1IJ6 A;  1CRX A;  4KLL A;  3WK5 A;  4OD0 A;  1QH9 A;  4PE1 A;  3F5A A;  3K21 A;  1FIQ A;  4HSZ A;  1WYG A;  5AM1 A;  5KU1 A;  4CF5 A;  1LKY A;  1BMO A;  4KLM A;  3IQO A;  3HCM A;  3ZDB A;  3EPG A;  5DKW A;  2HHT A;  1REC A;  1JI7 A;  4RPX A;  3OSP A;  1ZQQ A;  1KQQ A;  2RDI A;  2M0N A;  1OXJ A;  2F3Y A;  3JPT A;  1ZQH A;  1J7R A;  3ZD8 A;  1COK A;  1NYA A;  2UVW A;  4ECU A;  4CRX A;  4R64 A;  3OX5 A;  3ZDA A;  1BR4 B;  2ISP A;  4WQ3 A;  4KLF A;  2CCM A;  1J7P A;  1X9X A;  3BZK A;  3HT3 A;  3AUO A;  3ISD A;  1W9Z A;  9ICB A;  1K96 A;  7ICV A;  1PK3 A;  2RDJ A;  4DEZ A;  5ALF A;  5BPJ A;  1NPQ A;  4OJ5 A;  2AU0 A;  3L3F X;  1KN5 A;  2JWW A;  4I5N B;  9ICK A;  3UM9 A;  3BFA A;  1F70 A;  1QX5 B;  1DGJ A;  1SV0 A;  1ZQN A;  3D2N A;  1F4O A;  2WC6 A;  3V6H A;  4YGA A;  1Z1V A;  4DS5 A;  2HMX A;  4R8U B;  2W7O A;  2QDI A;  2KP7 A;  1FBV A;  2K8M B;  3TUY B;  3F53 A;  3E0F A;  3RFA A;  3NSI A;  1X9M A;  2A1J A;  2E30 A;  2AGQ A;  1IWQ A;  3ZNI A;  1RK9 A;  2KI6 C;  1T8E A;  3PM2 A;  1NCZ A;  4DL3 A;  3PN7 C;  1JAL A;  4EEN A;  5AI0 A;  2HHW A;  1COO A;  1SL1 A;  1QV0 A;  4QZA A;  4N1F A;  3VCB A;  2C2D A;  1B7T Z;  3N7R C;  1ZQY A;  5CA7 A;  1PUZ A;  5GQQ C;  3OX6 A;  1UA1 A;  3A0B U;  4RQ2 A;  1N0Y A;  5J0S A;  4QIW F;  2R2I A;  1QIV A;  2F3Z A;  5IBW A;  3LVV A;  3S0E A;  1TAU A;  3FE6 A;  1PVQ A;  5AKE A;  3PFV A;  3QUC A;  4INX A;  1S8O A;  4YD1 A;  2VRG A;  5BPC A;  1DVI A;  1QLN A;  3GK4 X;  1UUR A;  4QZF A;  7ICH A;  1SZH A;  3KZX A;  2K4I A;  3ZDC A;  2LYA A;  1QWV A;  3D78 A;  3LLE A;  2AMI A;  2JTT A;  4M2Q A;  3KHL A;  2BZF A;  4EZ6 A;  5AKY A;  3KZI U;  3QZ7 A;  1NX1 A;  2KJ8 A;  3H8J A;  1L7Z A;  3QX7 A;  5CPV A;  1L3S A;  3AL0 B;  5AI9 A;  1SCV A;  2YX8 A;  1B43 A;  1LS8 A;  2PI5 A;  4TQR A;  4NL9 C;  2H2K A;  1DQE A;  9ICO A;  1B8R A;  1JBA A;  2ALZ A;  3LWL A;  5KT5 A;  2QEB A;  5CSI A;  1F71 A;  3HPO A;  4OV2 A;  2QB0 B;  2OHF A;  3N4M B;  4BXO B;  2V4R A;  2JNX A;  3RJI A;  1DXS A;  3JPP A;  3FYH A;  4ECQ A;  1L2O B;  1CLB A;  4MHV A;  4M2O A;  3I28 A;  1XFX O;  1RZT A;  7ICR A;  1DOQ A;  8ICO A;  4NLB A;  2KD1 A;  1A4P A;  4B9U A;  1H38 A;  3JPN A;  5KFR A;  1FI5 A;  1NP8 A;  3B88 A;  3VRQ A;  2XIC A;  3GOF A;  2BL0 B;  4IQT A;  4PHK A;  2O60 A;  3JVT C;  4QWB A;  1Q46 A;  4F4W A;  1MXE A;  3EPI A;  4DSI A;  5HR6 A;  4KMO B;  4WJ3 B;  4YR3 A;  4CID A;  2ZFD A;  3I76 A;  3QYP A;  1ZQZ A;  3LWM A;  7ICG A;  1RPL A;  2G07 A;  3ED5 A;  4F2R A;  2KZM A;  9ICJ A;  1B47 A;  3R9K A;  2BKH B;  2JRF A;  4P4M A;  2KNE A;  3AM9 A;  2W7P A;  4GUK A;  4BWJ A;  3NRZ A;  1MN8 A;  5J2F A;  1PVR A;  2QPT A;  1R2U A;  1PK1 B;  8ICM A;  4ACO A;  2ZJ8 A;  3WK8 A;  1K93 D;  2KI4 C;  3Q8M A;  5G5G A;  5J0X A;  2VA3 A;  5KAF U;  4FTG A;  1T14 A;  4ECX A;  3H4S E;  3PX4 A;  3GFK B;  2KG5 A;  4UAY A;  2KFN A;  3SEI A;  2IOH A;  1L7M A;  3F5E A;  3SS3 A;  1U4B A;  3H4D A;  4JB3 A;  1K90 D;  4I27 A;  3AKB A;  2Y0S F;  4NM1 A;  2ASJ A;  1N63 A;  3MDA A;  3VGO A;  3SS5 A;  2DL0 A;  2GO7 A;  1K8U A;  1KK7 Z;  1J7Q A;  2GV5 A;  5CSF A;  1L8L A;  1T3Q A;  3QE9 Y;  2I5H A;  8ICS A;  3SS4 A;  4Y2P A;  4RNM A;  1DMO A;  4I2J A;  3M7D A;  2IMW P;  1A75 A;  5I8N A;  3FS7 A;  3I5H C;  3OB1 B;  5G08 A;  1L7O A;  3SV4 A;  3JTD C;  2RRD A;  4EEL A;  2LPE A;  3SYZ A;  2PQL A;  5FI7 A;  3I5G B;  1N5X A;  3BYA A;  5AM5 A;  2QEH A;  4XYN A;  2F2A B;  5ALH A;  3RJK A;  3RJF A;  1A03 A;  4F4Z A;  3MFH A;  3B6X A;  4RQ1 A;  4JWN A;  2XY5 A;  1K1Q A;  1J97 A;  4P4P A;  4O3Q A;  5J8Y C;  3S0G A;  1UWO A;  3S0B A;  4JV1 A;  2M29 A;  1Q8K A;  5KT6 A;  2NCO A;  5DBA A;  2Y0S C;  9ICI A;  2KAV A;  2Q0Z X;  4YQW A;  2FPL A;  2XY6 A;  3VRO A;  3LDA A;  2WCB A;  1ALW A;  1OW5 A;  5L1M A;  5AAN A;  4TUS A;  2UVV A;  5TIS U;  3ZWH A;  2W9B B;  1MA7 A;  2BEC A;  1GM0 A;  2DOQ A;  1KFS A;  2KNJ A;  3MDC A;  4EEY A;  1DK3 A;  1TUZ A;  2PMY A;  3C2M A;  4K4I A;  2QLT A;  2WOR A;  4YR2 A;  1QQ6 A;  1OOH A;  2XVT A;  2W04 A;  1CUK A;  5HNK A;  4L9M A;  1BG1 A;  2JPT A;  5KT2 A;  4DFD A;  1D1O A;  5KFH A;  3QUB A;  4GIB A;  5J2C A;  2BPC A;  4MF8 A;  3I5I C;  2A3V A;  4NDC A;  2FJU B;  3KFU F;  1B1G A;  3QU9 A;  2DUY A;  1OQP A;  2KIW A;  2COL B;  5J2H A;  3Q8I A;  5AXI A;  1ZRM A;  4PHA A;  2FMQ A;  1AUI B;  2JT0 A;  2KFG A;  1G8I A;  1CLM A;  4U8D A;  4TQS A;  3M8S A;  2F2P A;  1ZQV A;  2ZTC A;  1PVP A;  3SZ2 A;  5KTQ A;  4ECV A;  1SSE B;  3EVR A;  3BS5 B;  7ICF A;  1JF2 A;  3NUQ A;  1AHR A;  3DF0 A;  2MLE C;  1ZQE A;  4JWM A;  3THV A;  4DF4 A;  1J7O A;  1MF8 B;  1KWO C;  3ORY A;  4J03 A;  3KHH A;  5AM0 A;  5AKH A;  4CF4 A;  4KMU A;  3S0D A;  3RH4 A;  3ZI4 A;  4P0P A;  2A1J B;  1LA0 A;  4PT1 A;  2ZUD A;  8ICK A;  4OVN F;  4MEX A;  2PFO A;  3BQ0 A;  4CE6 A;  3LK0 A;  2E3T A;  1S97 A;  2WHE A;  4J9L A;  2ZUB A;  2Y1M A;  1U9L A;  1ZOL A;  4I29 A;  4CCH A;  1UHI A;  1UP5 A;  2OTG B;  2L98 A;  2OM6 A;  4UB5 A;  4F2S A;  1RJV A;  4GFJ A;  1UUS A;  2O5G A;  4C0Z A;  4HRG A;  4C8N A;  3I5G C;  3OTQ A;  4LVS A;  1ZFS A;  2PI4 A;  2KQ6 A;  2M49 B;  5ALQ A;  1XU4 A;  3BOW A;  3KBB A;  2FCE A;  3OHB A;  3DD4 A;  1PSB A;  1WCN A;  5ALV A;  5K89 A;  1ZQL A;  3KEV A;  5KFB A;  3C1Y A;  1AQ6 A;  2P6B B;  2ESE A;  1MXL C;  3V7J A;  2DKX A;  1O08 A;  1A6S A;  4BXO A;  1KCY A;  4XA5 A;  3V72 A;  1QAT A;  3PR4 A;  1NK8 A;  5KFU A;  1G4Y R;  2LAN A;  4JWQ A;  2QB1 A;  2CXJ A;  4RT3 A;  2JV3 A;  1TE2 A;  2EGD A;  1CKK A;  4DLG A;  4RPZ A;  2K60 A;  5EE0 A;  1SWW A;  4F71 A;  2L2C A;  3TQ1 A;  4IR1 A;  2M3W A;  1SRA A;  1NJX A;  4XUS A;  3VRP A;  4KLQ A;  2NLN A;  4QWA A;  3OGU A;  1S1E A;  2BQU A;  8ICZ A;  1CM1 A;  1XK4 A;  2KVC A;  3MC1 A;  3N28 A;  2CTN A;  2RHF A;  9ICU A;  3KO0 A;  4FS2 A;  1ZQD A;  1WLZ A;  3NXA A;  1SV0 C;  1CFF A;  4KLI A;  1O03 A;  2W8K A;  4QZI A;  5CWR A;  1L5U A;  2MRD A;  4PE7 A;  4NLK A;  3CGA A;  4ZOH C;  2K4P A;  5AFP A;  5KT7 A;  5DLF A;  3IM1 A;  5KFA A;  2KAX A;  2DFL A;  2LC5 A;  4UAV A;  2ZJA A;  1U45 A;  1NKC A;  3RLZ A;  1H4B A;  3CP8 A;  4YR0 A;  9ICA A;  5ALN A;  3FDS A;  4GXK A;  4RQ8 A;  3MR6 A;  1QTX A;  4DF8 A;  5J0W A;  2G2B A;  2M7L A;  2VIX A;  2EAP A;  5B5E U;  2XO7 A;  3BDP A;  4P5O E;  2CNP A;  2ISO A;  1SR6 B;  1A29 A;  5ER4 X;  2E6W A;  1VRK A;  2ZIW B;  3DEE A;  3QUT A;  1TNW A;  4DL5 A;  1TIZ A;  1ZD4 A;  3ICX A;  3NHT A;  3IN5 A;  4OZD A;  2WFA A;  2H3Q A;  2KV2 A;  3HWT A;  3C1V A;  1ZQK A;  5KFZ A;  2LLU A;  2ERB A;  1NZP A;  9ICC A;  4FZL A;  3MSE B;  2KKV A;  2HVI A;  4DQP A;  7ICM A;  4RUA A;  2QEV A;  4NJ8 A;  2LHT A;  4BGD A;  3CNH A;  5KFD A;  4J9O A;  5KFG A;  3KOO A;  5JTI A;  5DB6 A;  4M9H A;  1KKX A;  2EC6 B;  3CYZ A;  1UHK A;  1BPE A;  2FJY A;  1J55 A;  4USA A;  2ZIX A;  4KX5 A;  1S76 D;  1KSO A;  1Y88 A;  1S6I A;  3DV9 A;  5CHG A;  2FLP A;  1ZOT B;  1TCO B;  3N97 B;  4DSF A;  4Y2S A;  2BAP A;  2R8K A;  3TDI A;  2W9C A;  2JUL A;  2K8B B;  4MFC A;  7ICK A;  1BOD A;  8ICE A;  3KKA C;  4O3P A;  4I2C A;  1L6N A;  3O4Y A;  2ZJ5 A;  4QW8 A;  2HW3 A;  2P71 A;  5CSJ A;  1NX2 A;  3D2Q A;  3F2C A;  2KBI A;  2JZB A;  1KFD A;  5AER A;  4ZCU A;  4BWM A;  1Z4O A;  5FI2 A;  1DJW A;  1S10 A;  1M39 A;  1QXP A;  2H61 A;  5AM2 A;  2AGP A;  2IA6 A;  4RT2 A;  1RDF A;  1C07 A;  4UAW A;  2W9A A;  3TDU A;  1JN3 A;  2G09 A;  2M1U A;  3LK9 A;  2BCV A;  1TK5 A;  3SG3 A;  1ZMZ A;  2PAS A;  2LYB A;  3VRN A;  4QWC A;  4NXZ A;  1JFK A;  3NVV A;  1X66 A;  9ICR A;  2G5I B;  4Y2V A;  4RPY A;  5KFO A;  2W8L A;  2VA8 A;  4DOA A;  1KQM B;  1UHH A;  5ALK A;  2F3N A;  1EH2 A;  3A0H U;  5AHX A;  3SD7 A;  2WTF A;  4CLN A;  3QU4 A;  2DBY A;  4IR9 A;  4USL A;  3KD3 A;  4C8L A;  2XGQ A;  4PH5 A;  8ICF A;  4ETO A;  3CZ2 A;  2QB0 A;  2YMM A;  3PMN A;  1T4G A;  4NL9 A;  2BCS A;  2NZ0 A;  1Z4N A;  1TTX A;  4FE3 A;  3TAP A;  4KLO A;  2DPI A;  3BQ7 A;  5ALZ A;  3H4B A;  5F3X B;  4ELU A;  1YVL A;  4J9K A;  1KFU S;  3CR2 A;  4NM2 A;  4JUZ A;  2OXO A;  1LVC D;  5E79 U;  2OS8 B;  4IQU A;  3QZ8 A;  3HIL A;  4UQG A;  5KFM A;  2BL0 C;  4XRH A;  3KHE A;  2Y5I A;  4PAL A;  3Q8R B;  1ED1 A;  1AJ5 A;  1MQ2 A;  1SKW A;  1S6C A;  5F6T A;  2JT8 A;  5KFT A;  4DIR A;  1CTR A;  2F77 X;  1ZQT A;  1YTZ C;  1QX2 A;  4MZL A;  4HAI A;  2H3F A;  3HJE A;  3FE9 A;  1JFJ A;  2E1F A;  4AYB C;  1ZQW A;  1B0X A;  4NLC A;  2K7O A;  1KLN A;  3M9N B;  3CLN A;  1FI6 A;  5DBB A;  3D6J A;  2P6R A;  1B22 A;  5KSZ A;  2E5S A;  4TNC A;  5PAL A;  4YRU A;  1U48 A;  4R63 A;  4E68 A;  3OP0 A;  5TNC A;  3K1Z A;  3D10 A;  5I2Q A;  3BUX B;  4I5J A;  2AUC A;  1ECW A;  5D49 A;  1F5S A;  4M2Y A;  2L5X B;  4NQG A;  2HVH A;  4DFM A;  1PAL A;  3GIM A;  2AJQ A;  4FS1 A;  2ZXH A;  4YI9 A;  1SL8 A;  1JRP A;  5AIB A;  1JMS A;  4GXJ A;  2Y4Q A;  1IXR A;  3CZ1 A;  5EE1 A;  1CFP A;  2B0C A;  2C2E A;  2MAX A;  1F0M A;  5BOM A;  1DK2 A;  5IIK A;  3ZDD A;  1ZQB A;  5GTH U;  5EWF A;  4QNL A;  1M46 A;  1SKS A;  1RXV A;  2L2E A;  2WC8 A;  3SV3 A;  1F54 A;  4KLE A;  2PFQ A;  2QAC A;  2KSO A;  2YB1 A;  4GGF A;  4DS7 A;  2KIC A;  4EX7 A;  1NKB A;  3GV5 B;  2WC5 A;  1ZYQ A;  4ZH4 A;  3ISB A;  2ZND A;  1DC1 A;  2KJ9 A;  2JU0 A;  4MEW A;  2K4H A;  4XQ8 A;  4AYB F;  1ZJN A;  4C8M A;  3HW8 A;  2KGR A;  2KFZ A;  2L4H A;  1QQ7 A;  3OSN A;  1L3V A;  4YXM A;  1KEJ A;  3I1Y A;  2NV3 A;  1L7N A;  1GO3 F;  2ISD A;  4F50 A;  7ICE A;  1SR6 C;  1AVS A;  3PLF B;  3MR2 A;  2M9G A;  4Y2T A;  2KPH A;  2AGO A;  4RQ0 A;  1TNP A;  2W3S A;  1N56 A;  4O9M A;  5L1I A;  1SPY A;  2KOT A;  1N61 A;  3SMV A;  2W9B A;  4Y2J A;  5FYX A;  3BJY A;  2MU2 A;  2JH7 A;  3RRH A;  3QME A;  7ICS A;  1L3T A;  1BNO A;  1YZ7 A;  3UMB A;  3PST A;  5AK5 A;  2BKE A;  1XFZ O;  3SG2 A;  2FDR A;  2FPK A;  2XID A;  3FWC A;  1SGG A;  4N1G A;  1EJ3 A;  2PFN A;  3PJI A;  4F8R A;  4JPZ B;  2VA2 A;  3T5H A;  1U5I B;  3B86 A;  5J0T A;  3OGN A;  2W3R A;  4NV0 A;  1RTP 1;  2LLS A;  1IKU A;  8ICH A;  2F2O A;  3RZS A;  2JXC A;  3I5F B;  3PNC A;  2LCP A;  2K2A A;  4DCC A;  4Y2Y A;  1M31 A;  2MA2 A;  4K4G A;  1YUU A;  2LM5 A;  3HP6 A;  1N48 A;  1S36 A;  5DG7 A;  1FW4 A;  5IIN A;  1DJY A;  5J2A A;  1Q80 A;  2BKI B;  1Y6W A;  1XFU O;  2JOJ A;  2YY6 A;  3FM9 A;  3TZ1 A;  4IRD A;  2JTZ A;  2KIV A;  3FAH A;  1RQL A;  2CN1 A;  4EX6 A;  4DFK A;  2R8I A;  3PW4 A;  4FQT A;  5AKX A;  5F9L A;  1F44 A;  1SL9 A;  1TK0 A;  4DQR A;  2LBO A;  3RBE A;  2G06 A;  1XSP A;  4PDZ A;  1WLM A;  3PR5 B;  3PO4 A;  1QX7 A;  3PSF A;  4JK1 A;  1S5G Y;  2ZIW A;  1TAM A;  4BUG A;  1XVJ A;  4YD2 A;  3RBD A;  2SAS A;  3J81 j;  3CZT X;  4Z6C A;  1NOM A;  2NRX A;  3RRG A;  4R8U A;  2BCR A;  2LVI A;  4YCX A;  4J9Q A;  1JX4 A;  1LV5 A;  2Y9T A;  4YXJ A;  2FMP A;  3RJG A;  4I2G A;  3RB4 A;  3D0Y A;  1ZQU A;  2YB4 A;  5B66 U;  4BDP A;  5AK4 A;  1DF0 B;  1KK8 C;  1Z19 A;  2KSP A;  4C7Z A;  1PVA A;  1CB1 A;  2LHL A;  1LIN A;  1Z2C B;  1SXD A;  4KYN A;  1CDP A;  1UHJ A;  2K61 A;  4IL6 U;  1LA3 A;  2BHN A;  3GZF A;  5KFN A;  5EE9 A;  2ZIV B;  4M9G A;  9ICE A;  9ICW A;  2A4J A;  3SI8 A;  1KQV A;  3G6Y A;  4Y2X A;  2IOF K;  5ALG A;  4Q8E A;  3ETR A;  2WCF A;  5J29 A;  1K95 A;  2M8U A;  3RB0 A;  2BQR A;  3D74 A;  4EZ9 A;  3JPS A;  3O78 A;  2CPR A;  4Q8F A;  1NK9 A;  1KK7 Y;  5KG5 A;  4NLG A;  4F0Z B;  3H7I A;  2I18 A;  3PX0 A;  2KE7 A;  3R72 A;  2ZIU A;  1YX7 A;  1J1D A;  8ICP A;  2JH1 A;  1IH0 A;  3IV6 A;  1QSS A;  4RNO A;  2FLL A;  2RGI A;  3IDW A;  2XGP A;  2YMP A;  1D9D A;  3PSR A;  5KFP A;  5CJ7 A;  4U7C A;  4GXI A;  1BPY A;  1JWD A;  4UB4 A;  4WQ2 A;  3HX4 A;  3K1E A;  1PK1 A;  1ZXI A;  1CEZ A;  3S6J A;  2R8H A;  2JEF A;  3QEA Z;  1B8L A;  1MC8 A;  1LKY B;  2F1H A;  3RH6 A;  2EHB A;  3E2E A;  5HLV A;  4PJ0 U;  2KVS A;  3SG4 A;  3OPX A;  4DFJ A;  2IS9 A;  4YGB B;  3HRD D;  1XFW O;  3V7K A;  4NLZ A;  2KK0 A;  4I28 A;  1CFD A;  4B9N A;  5KFS A;  5J0Q A;  1IQ5 A;  1NX3 A;  5KG6 A;  3M8R A;  4DL6 A;  4HRE E;  2LAP A;  2XCP A;  1H8B A;  4PZO A;  1WDC B;  9ICM A;  1DRG A;  8ICY A;  2E8N A;  1CDN A;  5ALP A;  2D8C A;  2MUT A;  4KLH A;  1B9A A;  1N60 A;  3C21 A;  4OR9 B;  2AQ0 A;  4QZ8 A;  7ICJ A;  2G5H B;  2HET A;  3RAX A;  1NJY A;  5EL2 A;  5ALL A;  1QLS A;  4JV2 A;  3EW9 A;  1KFT A;  2N1R A;  1PVB A;  4RQ3 A;  4P2Y B;  1RQN A;  4DL7 A;  1ZRN A;  9ICL A;  3CWG A;  4GC7 A;  5DG9 A;  1Z1B A;  5KFE A;  1XFY O;  1MUX A;  5CRX A;  2HHX A;  4ED1 A;  2ZIV A;  3TUY C;  4YBH B;  4DOC A;  3QU2 A;  1A76 A;  4DO9 A;  4P0Q B;  4ED3 A;  1M45 A;  3MGH A;  5GTI U;  1D9F A;  1K9K A;  1XA5 A;  2YGU A;  2O6K A;  3LCP C;  2FPM A;  4BJQ A;  3UNW A;  3Q8L A;  3B7A A;  1QJT A;  1TAQ A;  1BPB A;  4F4Y A;  2NO5 A;  4TUR A;  2HHS A;  2ZN9 A;  3AAK A;  2DKZ A;  2K89 A;  5ALW A;  4I2B A;  5KG2 A;  1J2M A;  1SL2 A;  2F76 X;  2LYH A;  2BE6 A;  5L1K A;  4DQS A;  1C7W A;  1SYM A;  1YRU B;  3SAG A;  4JMU A;  2K7C A;  1L3U A;  5ER5 A;  3ZD9 A;  2AQ4 A;  2GWS A;  4G9B A;  1V9P A;  5ALO A;  3PY8 A;  4RUC A;  2MSN A;  1TV9 A;  2C28 A;  5ALM A;  2F1J A;  1SMG A;  4F4X A; 
#chains in the Genus database with same CATH homology
 4GAO A;  2KLD A;  5FI7 A;  1PK1 A;  1DEK A;  2FE9 A;  2E8M A;  4NJ8 A;  1LKY B;  5JTI A;  2F8K A;  4JKT A;  3BS7 A;  4PZN A;  2Y9U A;  2GLE A;  4NL9 C;  1LKY A;  3H8M A;  3TAD C;  5FI6 A;  2E8P A;  1JI7 A;  5J8Y C;  1SXE A;  3SEN A;  1B0X A;  1UQV A;  3KEV A;  5I94 A;  2QB0 B;  2BAP A;  1OXJ A;  3IVT A;  2KIV A;  2ESE A;  1RG6 A;  1DXS A;  2DKX A;  4PZO A;  1COK A;  4IJ7 A;  3KKA C;  4MHV A;  2E8N A;  5JRT A;  1OW5 A;  5L1M A;  2D8C A;  1B4F A;  2E8O A;  1X9X A;  4I5J A;  2QB1 A;  1W9Z A;  2JV3 A;  2ES6 A;  4RQM A;  5D3O A;  1PK3 A;  2K60 A;  1UCV A;  1SV4 A;  2QAR B;  3TAD A;  2B6G A;  1Z4H A;  4I5N B;  5FI2 A;  2EAN A;  3O4X A;  2KMD A;  1WWU A;  1SV0 A;  1F0M A;  1Z1V A;  4I5K A;  2Y9T A;  1SV0 C;  2QKQ A;  2QAR A;  2YGU A;  2KSO A;  4GBA A;  1PK1 B;  3UNW A;  2K4P A;  1DC1 A;  1X66 A;  2KLE A;  3K1R B;  4MEW A;  1DEL A;  1V85 A;  1Z2C B;  1SXD A;  3PM2 A;  2F3N A;  4KYN A;  3BS5 A;  2DKZ A;  3OBV A;  3EG5 B;  1KW4 A;  3BS5 B;  2KG5 A;  2BNX A;  3SEI A;  2LMR A;  2D3D A;  5JU5 A;  3SS3 A;  3UO9 A;  5HL1 A;  2EAO A;  2EAP A;  1V38 A;  2QB0 A;  2EAM A;  4NL9 A;  3SS5 A;  2DL0 A;  4IS7 A;  3BQ7 A;  2L5Y A;  2KE7 A;  5F3X B;  2F44 A;  3SS4 A;  1X40 A;  3KKA A;  2KSO B;  4I5L B;  5J8Y A;  3IDW A;  2YTU A;  4RQN A;  1WWV A;  3TAC B;  5KNI A;  3HIL A;  1SGG A;  2LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...