2K60A

Nmr structure of calcium-loaded stim1 ef-sam
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
GSHMASSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Stromal interaction molecule 1)
publication title Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k60A02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2k60A01
2DKZA 2F8KA 1LKYB 2K4PA 1V85A 4PZNA 2DL0A 2QARA 2Y9TA 2QARB 1X9XA 2KE7A 2QB0A 1JI7A 2L5YA 2QB0B 5F3XB 5KNIA 2YTUA 5JTIA 1OXJA 3IDWA 2EAMA 1SGGA 2KMDA 1B0XA 2KG5A 1PK1A 1F0MA 3KKAA 2LPEA 5JU5A 1PK1B 5L1MA 1B4FA 1KW4A 3BS5A 2EAPA 4RQMA 1SV0C 3BS5B 4RQNA 1LKYA 5JRTA 3H8MA 2ES6A 1COKA 1PK3A 2DKXA 1RG6A 1Z1VA 1X40A 2E8OA 2ESEA 2KIVA 2LMRA 3TADC 1UQVA 1X66A 2E8MA 4PZOA 1WWVA 2EAOA 4NL9C 4NJ8A 2B6GA 3TADA 2F44A 1SV0A 3K1RB 2FE9A 2K60A 2E8NA 1SXDA 3HILA 3TACB 3BS7A 2JV3A 2QKQA 2KSOA 1WWUA 5J8YC 2KSOB 2F3NA 4IS7A 1V38A 1OW5A 4MHVA 3SENA 1DXSA 3KKAC 2QB1A 2D3DA 5J8YA 2GLEA 3BQ7A 2D8CA 2Y9UA 2E8PA 1SV4A 1SXEA 4NL9A 1UCVA 2EANA 3SEIA
chains in the Genus database with same CATH superfamily
3FC4A 2F2PA 2HETA 2AH5A 5JOLA 2RP5A 1CDLA 1KTQA 7ICJA 1G33A 3JPTA 1RXWA 2W8KA 1W7IB 1JALA 5PALA 9ICWA 5J2CA 1UA0A 2WCHA 2KTQA 1NCYA 2G09A 1KK7Z 1M6YA 3UPQA 4K4GA 5J2HA 2L5YA 3TDZA 4Y2JA 4GLXA 2JQ6A 3JPQA 3IDWA 4J9QA 9ICBA 5J2EA 1OZOA 3WKEA 2WB1F 3Q8PB 1A77A 1O08A 5ALXA 1NKCA 4TURA 1T14A 3A0BU 2MHHA 4C8KA 2MJWB 1ZRMA 5B8IB 4QIWC 1CKKA 3H8MA 3T79A 3C5GA 1COKA 1M39A 1NK4A 2FLNA 4PDZA 1VJ5A 1L6NA 3TFSA 1AHRA 2BR0A 1D1OA 2GOLA 2BQRA 4EEYA 2YX8A 4QZ9A 4I5KA 3TANA 5TNCA 4GIBA 5D3OA 3TARA 1BOCA 2M3WA 2OM6A 5CJ7A 1ZQIA 3S6JA 3WKAA 2ZIUB 3O2PA 4E0DA 2WCBA 3S0BA 1RQNA 4ELTA 4DSKA 3QNMA 1BMOA 2XGPA 2NYVA 1EG3A 1VRKA 2NRTA 3NRWA 3FS7A 5I8NA 1JSAA 5AKXA 4I2FA 1CDMA 3RLZA 3G6YA 3OX5A 1RYUA 1AJ5A 2NCPA 3QZ7A 2F1IA 1KWOB 2BL0B 2FPKA 1QLSA 2ISPA 1CDNA 4EX6A 1BF5A 3ISDA 4GAOA 5ALIA 3D76A 4WJ3B 3KFUF 4AOMA 3C1YA 3UXNA 3V6KA 5J2GA 1U5IA 4F7FA 1OOHA 2JXLA 4DF8A 5J2IA 1TUZA 3I5GB 1COOA 3DDHA 3RBEA 2E30A 3KPXA 2ZIVB 3NVVA 2D8CA 2I7AA 4XRHA 2LE9B 4M9HA 5DG7A 1WLZA 8ICMA 2D6FC 1ZQJA 2EANA 4B6JA 4BXOB 2CXJA 4DQIA 3OSNA 3ZD8A 4GBAA 5KTQA 3KEVA 5JJGA 1FI5A 1LINA 5DLGA 1LKYB 8ICBA 2KBIA 2NXQA 1V85A 1M45A 1PRWA 2DL0A 3RZSA 3QMEA 3TUYC 2JHDA 5D46A 2HOIA 1PSRA 2H5XA 3O78A 3L4PA 2JTTA 3CR2A 3CYZA 4Z6DA 1IGVA 3SZ2A 1TUJA 1C7YA 3VB1A 3ZDEA 1VDVA 2JXJA 2ATLA 1YUUA 1PSBA 5AM5A 3RB0A 1S76D 5J2KA 1G4YR 2K2FA 2LAPA 3ISBA 4ACOA 4QW8A 3M8SA 5ALDA 5FP0A 5CA7A 1B4FA 1KW4A 4GXJA 4RQNA 4E68A 4DL4A 5L9XA 2GGZA 5ALYA 2W9BB 1ZD3A 2PSRA 1OOGA 3NASA 4M9GA 3OGUA 2WB1C 2VANA 1B1GA 1DGVA 2E8OA 4NM2A 2ALZA 4J9RA 4KLGA 2HBLA 3MSEB 3DYEA 1NK8A 3PSRA 3BQTA 3D2QA 3RJJA 2FJ6A 5AEQA 2ZG6A 4J9KA 4R66A 5L1LA 1JUOA 2TN4A 1DJZA 4PZOA 2BGWA 2HCFA 2JWWA 7ICLA 1ZQMA 3R9KA 4C80A 1L5UA 4MEYA 4PHDA 3LVVA 2F76X 3U26A 1U47A 4JV2A 1PULA 2PI5A 3TADA 5KFIA 5DGAA 2CCMA 1Z00B 4QZCA 4I29A 1IV8A 2XICA 4Y2PA 2J6TA 1ZOTB 1SV0A 4US9A 1CM1A 1B8CA 3NSOA 3NVWA 2DWQA 5KFWA 4YR2A 3Q8RB 3TAPA 1PZNA 3EK8A 1SXDA 4JPZB 1OSAA 1K5OA 3IQOA 1RZTA 4JV0A 1S5GZ 2B21A 1X9MA 1Y1AA 3R72A 1JX4A 4PGXA 5J8YC 5EWEA 2AJQA 3MABA 8ICXA 4NXZA 2LP3A 4MBEA 4IS7A 1V38A 4UW9A 9ICLA 1RWYA 1ZQTA 5HR7A 3JTDB 1BVSA 3DVMA 1BNOA 4DSEA 3Q8LA 5D7FA 2KICA 1S5GY 3VRRA 1UHHA 4KLDA 2GLEA 9ICSA 1IJ5A 4Q8FA 2Y1NA 3N7HA 5KFVA 4DL3A 2XY7A 1YUSA 4AQJA 3GZFA 4KX5A 4KLSA 1RPLA 5AHXA 2LM4A 2KJ5A 4TQSA 3ZWHA 2RDIA 1SKWA 5IIOA 2ZIWB 3C1ZA 2QEVA 4R8UB 2LBOA 4OJLA 4FZLA 3E3RA 4Q43A 4DIRA 1KFTA 4CPVA 3AU6A 2WF6A 4RQ7A 4WQ3A 1XFRA 4Y2VA 4NDCA 1SGGA 1ZQCA 1CFFA 4IQTA 3PM2A 4M04A 5CP2A 2BCAA 4PJ0U 3S0FA 1F0MA 2G2BA 1SV0C 1A29A 3IN5A 3PX0A 4DF4A 4K4HA 1MWNA 2LI6A 4MEWA 1SK6D 2OTGB 4M2QA 3A0HU 2KQ6A 2GWSA 4F4ZA 2BQ3A 2PALA 1NK7A 2JC2A 2PXIA 4GGNA 4PE0A 1MXLC 4F3OA 1Z3EB 4EEKA 2K2AA 1B47A 4ED6A 3OP0A 1CUKA 1SW8A 2WC8A 1HJPA 1CDPA 3SMVA 4UPGA 1KSPA 3SD7A 4YI9A 3KHRA 1FPWA 4YXMA 4R64A 2LUXA 3VROA 3B86A 2XGQA 3HJEA 2ZTDA 3RR8A 1PVQA 1HUZA 1JMSA 1UUSA 2KZ3A 2AHOB 1RYSA 9ICXA 5F6TA 1DGSA 3QU7A 3KHGA 2ZKMX 5CR0A 5J3XA 2WHEA 4J9NA 3LK0A 1C7VA 3DY9A 4JMUA 2OEHA 2FJYA 2KQYA 2YGUA 5KFFA 4UB6U 3NVZA 4NLZA 5FYXA 4QWBA 2F1JA 5KFJA 4RUAA 3M9NB 2BKEA 4YMNA 3QZ8A 2WCJA 2R8IA 3SENA 3EWAA 3DZTA 4UB8U 2ZIVA 5KFDA 1B8RA 4F5PA 1ZQ1C 1NWDA 5KG1A 3OGNA 3G6VA 2FLLA 1BPBA 1XA5A 2AU0A 4BXOA 3EKHA 3NGVA 2PVBA 2L2CA 2ZXHA 3TQ1A 4GGFA 4C4RA 3MDCA 3QEBZ 3CWGA 3FE6A 2YB1A 2OXOA 3SS3A 1S97A 8ICIA 4RNNA 1RFJA 2QARB 3ZDDA 5J0QA 5CSIA 4ELVA 2KHQA 3ONNA 4MRXA 3OSPA 3C1VA 3EW9A 2PI4A 3S0AA 4ELUA 4MFCA 3JVTC 3NHTA 3FE8A 1L3SA 4FE3A 4PL2A 5HLVA 2RHFA 2LYBA 1OMDA 2KNEA 5ER4X 5JU5A 2IA6A 5AI6A 4JUZA 2KZMA 1PVPA 3EG5B 1ZQRA 1T94A 3H40A 1V9PA 4NLBA 2W9BA 5KFUA 5KFMA 1CTRA 7ICUA 2VRGA 7ICGA 4FS1A 2L4IA 2HHSA 4CF3A 2KK0A 4ECYA 4HSZA 4P4MA 1AP4A 5AIAA 4KLQA 1JUDA 4OV2A 4I2AA 2E3TA 4PHEA 1ZQKA 1QVIZ 1UHJA 4DQSA 1Z4HA 4TQRA 4MLWA 4P2YB 1KK8B 1Z4NA 1QQ6A 1JN3A 3QRXA 3KHHA 2ASJA 5DBBA 2I18A 2LHLA 2DPJA 2F1HA 1T8EA 4QWCA 2LVVA 4MVFA 4I27A 2Q4UA 4NJ8A 1QQ5A 4PHAA 4QWEA 2YMPA 1QVIY 1F55A 4TNCA 2LLSA 1YZ6A 1Z00A 4QZBA 4F4XA 3FAHA 2KIWA 3SAFA 3I5FC 1N63A 1NOMA 1U45A 2MA2A 2CT9A 1YZ7A 2FE9A 3WHUB 1TN4A 3D75A 3O4YA 4FBUA 1OZSA 2C28A 3JPNA 2Y4QA 3D6JA 4KLIA 5KAFU 2HDOA 3K4GA 1WWUA 4HRHA 2JGAA 1A4PA 2BAPA 5CSJA 2BPGA 4OD0A 2KN7A 5HR6A 1LXFC 1LB2B 2LMVA 3VC8A 2KI4B 4Q44A 2ASLA 1NZPA 4KLJA 4DS5A 1N2DA 1N48A 3L3FX 2Q91A 2LLUA 1HIWA 3V7JA 5CSFA 5JUMA 5HMLA 3UXOA 2WCKA 1SV4A 1Y1UA 4KLEA 2KZZA 2DKZA 1URJA 4JWNA 2QDIA 2ZIWA 1S0VA 4INWA 5J0TA 4ECXA 3WK5A 4EZ6A 4R8UA 2BCBA 2F3ZA 2JOJA 2JPTA 1ZQSA 4DRWA 5CEHA 2NRWA 1GGWA 1L2OB 2IBKA 5AKKA 1BODA 3K1EA 2KE7A 4BUGA 2QB0B 7ICOA 1UT8A 2W3SA 3M0WA 1RROA 2EAMA 2ASDA 3TS5B 1XYDA 4J03A 4I2BA 2H3ZA 4P4PA 1K95A 1RDFA 1SBJA 1TNPA 1CRXA 3MGIA 4JQ0D 3I5IC 2QACA 1A2XA 3B0XA 1EXRA 2PASA 4RZRA 2I9GA 3BFBA 1S6IA 1HUOA 2KAYA 2KYCA 4AQIA 1IRJA 2KJ9A 1S5LU 4PL1A 1ZFSA 2EZYA 3SJSA 4DUQA 1Q8KA 4WRIA 2HHWA 8ICRA 3RAXA 1DK2A 4M6WB 2DBYA 2LUCA 1QIWA 2JT8A 2LV7A 5AK6A 1UQVA 2W11A 5CB1A 3Q8MA 2CXYA 3SV3A 3F2DA 4UATA 1MQ3A 2ZRTA 4CGZA 1ZQUA 1WWVA 1XK4A 2OS8B 4PCWA 5ALPA 3PMNA 3F2CA 3D0YB 4AYBC 3A8RA 5IIMA 2LKYA 3ZNIA 2C2EA 1QV0A 1CLBA 1IIPA 4DQPA 5KG2A 4OJPA 4EBCA 8ICVA 1YVLA 1TCOB 2BCQA 1NSHA 4HREE 1UT5A 5DKRA 4ORCB 2ZXIA 4XJKB 1AK8A 2FPMA 2AQ4A 2QKQA 3QU2A 4F5RA 3WKDA 2LVJA 2XCAA 3CR4X 3CZ2A 5KFGA 4OKHA 5HKWA 2M0RA 2IOFA 2HBKA 3ORYA 2PFOA 1ZETA 1NIWA 1K93D 1C7WA 3CR5X 3HP6A 1DGJA 2AGPA 4J9MA 1U4BA 2L4HA 5AKGA 3BQ7A 2Y9UA 1SCVA 1M31A 1KQVA 1DJIA 4J9PA 1SKRA 3E2EA 2C2RA 4F50A 1ZQBA 4U8DA 4MEXA 3Q8QB 2KJ8A 2KOBA 4UB2A 9ICKA 2H8VA 3PO4A 3I5HB 3TAQA 4N1GA 3GFKB 3GIJA 1KLNA 4PHNA 3LK9A 1QSYA 1N62A 2KP7A 8ICNA 1NKEA 2QARA 1YUTA 5AI5A 2FJUB 5EL2A 4DQQA 5KT4A 1KDHA 9ICRA 1JROA 4I2JA 1XK4C 2R8KA 3RH4A 1ZQOA 3IG5A 4KMUA 2FMPA 1MR8A 3RFAA 1ZD4A 3M7DA 1QS7A 3H4DA 1LS8A 2B1UA 4RQMA 3QU5A 1KSOA 4YR0A 2G06A 5IIIA 2LANA 1K1SA 1GJYA 2DKXA 2COLB 4QJ4B 3UMCA 2KFHA 3MC1A 2EQYA 1Z1VA 4O3OA 4GFTA 2W9CB 3MFIA 3CW2C 2RDJA 1SSEB 1OOFA 1M46A 4O3NA 5ALFA 4GNKB 4N1FA 3I1YA 2P6UA 1BR4B 4GPLB 4UQGA 1TOPA 4PHMA 1S0OA 3SG5A 2HHVA 5IBWA 5KG4A 2ZN9A 2M49B 4F4KA 4HYKA 1Y0VH 4DOAA 3JPRA 4B9LA 1X6IA 1SL8A 2W7OA 1MXEA 2EAOA 4UBBA 5T14A 4ED3A 3IM1A 1IQ3A 5AI9A 2VA8A 1KFDA 2F33A 3AQEA 1ODBA 4QZEA 5HLOA 2DPIA 4IC9A 4QZIA 3J81j 9ICUA 3EZ5A 1SCMB 2BCRA 1ZMZA 2ZUDA 1O03A 3PY8A 3S0DA 2IS9A 4TUPA 3TACB 5KFKA 2WC6A 4FZNA 4O5EA 1NX2A 9ICEA 1OQPA 1KBUA 2I2RE 5GQQC 3SIAA 5AK5A 1WDCB 4QJFB 2KHVA 3ZI4A 4RQ0A 2V4QA 2O60A 4UAYA 3PALA 5J0WA 3R1OA 4FBTA 4JKTA 1S0MA 3CP8A 4C8LA 5ALSA 4UAVA 1HEKA 1VLBA 8ICEA 5CRXA 2ZJAA 3HRDD 4UB3A 3RB3A 4M9NA 2EC6B 1QSSA 4NL9A 1S10A 2E1FA 3IQQA 5KTYA 3Q8SB 3BOWB 4B9UA 1BPYA 2L5XB 3WKCA 5AKHA 1NX3A 2FI1A 1A76A 1Y88A 2ZUCA 1PUZA 2F77X 3T3FA 8ICKA 1DVIA 2H61A 1BG1A 2VJ5A 4Q04A 9ICJA 1F8HA 4KLFA 3RTVA 1DF0B 3M9MB 4IQUA 2QB0A 3C5FA 4KLOA 4JWMA 3NSIA 3AEVA 4XUSA 5G5HA 4BY4A 4QWAA 5B66U 2KG5A 1C3YA 2ZJ5A 1IJ6A 2BKHB 1KEJA 4L9MA 3L5KA 4A8EA 3I28A 3EVRA 2HVIA 2SCPA 5JRTA 1ZD5A 2KVSA 3ZDAA 4R65A 7ICRA 1PK3A 2FOTA 2IOFK 4RPYA 4DQRA 1H4BA 2FDRA 4MFAA 3NXAA 1X2IA 4G9BA 4UBCA 1DJYA 2LYHA 1L7MA 1X9WA 4C8OA 2R2IA 5F9NA 4IL6U 3EK7A 1V1GA 3LLEA 4BX9C 2CRXA 3K75D 2ZNEA 2C2DA 4PGYA 2JU0A 1BPXA 4C0LA 4M6WA 3FWCA 3KZXA 2AAOA 4DCCA 4RNOA 1SMGA 3OJUA 1FI6A 2E5SA 5ALZA 2EH9A 2HQ8A 2JT0A 1BPDA 5KFBA 1Z2CB 3H8WA 2OH2A 2XO7A 3LWLA 4A4CA 4YVZA 8ICUA 2FMSA 4NL9C 3D0YA 1SWVA 5EE0A 5KG5A 2ZRSA 1J97A 2KFFA 4QZGA 2NCOA 5DB6A 4C8MA 3DEEA 4RU9A 3VCBA 1WG8A 3K1RB 1QX5B 2K89A 3DV9A 3E58A 4PHKA 4MSPA 3IVTA 4C8NA 4YQWA 4GC6A 4XJKA 1G8IA 2YMLA 8ICFA 2KSOB 4RT3A 3GIMA 2KKPA 5KFEA 3WK8A 5ALUA 1ZXIA 2I1QA 4KLLA 3GK2A 4DSFA 4F4YA 2KBMA 5GTIU 4EYIB 1J1EA 5J2BA 2KVCA 2QB1A 3GDXA 3PR5B 2IMWP 2D3DA 1IQ5A 1D8LA 2KI6C 4Y2YA 2LHIA 2K8MB 3SQIA 4CF5A 3B88A 2K7DA 4YMOA 2CTNA 2R18A 1N0YA 1A75B 1BJFA 2XVTA 3SEIA 4ECWA 1NJXA 4EENA 3B87A 8ICAA 1UURA 3QUTA 2WF5A 2MAXA 1S36A 1KFUS 2ZIXB 4USAA 2BNXA 4UASA 3CZ1A 4ORAB 2K8AA 1WCLA 1DEKA 1L7PA 4RQ8A 5DLFA 2I5HA 1X42A 5EWFA 1ZQHA 5DDYA 3RB4A 2V4RA 4KLHA 2QEOA 4MZLA 2I6XA 3QXGA 5ALMA 3QU4A 3AMZA 4C7YA 1N56A 3EK4A 3TUYB 2EAPA 5AXIA 1N2XA 4F92B 4EBEA 1RXVA 3N7PD 1TV9A 4DLGA 5J0YA 3EPIA 3M6KA 1FW4A 4US8A 1J7QA 1RG6A 1T3QA 2AQ0A 3PO5A 1B7TZ 5F9LA 2W9CA 4DLEA 3PX4A 4DO9A 5HHIA 1JFJA 1IWQA 3NSKA 3CS1A 4CDGA 5AFPA 2HVHA 1SR6B 5AIBA 2JEGA 2HOFA 5KT7A 2H2KA 1YX8A 5HMMA 4GC7A 2LM1A 3TZ1A 1S1EA 2F2AB 4DFPA 3TADC 3RJIA 1B7TY 1TIZA 3HKZF 2H3FA 1L8OA 4DFKA 2CN1A 7ICPA 5BOLA 8ICYA 1KCYA 5L1KA 4KYNA 3SG4A 2WF7A 1KQMC 3OJSA 1XNSA 2YB4A 2KPHA 1UHIA 2ISOA 1AQ6A 4NDDA 3RAQA 4Z6FA 2A1AA 4DL7A 1DJHA 4RQ6A 3IV6A 3PJIA 3ICXA 2E1EA 5KG6A 4FO6A 1ZACA 2W43A 2VKQA 3SS4A 1TAQA 2RQ5A 3MGHA 2WCFA 3MR6A 2ZIUA 3L47A 4M2PA 3CLNA 3H0RB 4ED2A 2J6UA 5ALHA 2BBMA 3PSTA 2G9BA 4QZFA 4XYNA 1RK9A 3WK9A 1FF1A 3UMBA 5ALQA 4O0IA 5C0YA 4PT1A 5KFOA 2Y1JA 1CFDA 2DUYA 5DGBA 1SXEA 3BOWA 4YGAA 4GUKA 2JNXA 3BQ1A 1OE9B 2WF9A 4YR3A 1EH2A 2M7NA 3UNWA 3PW7A 5D69A 1DF0A 3NGDA 2M9GA 2C22A 1XSNA 2M7LA 2KFZA 3TFRA 5TISU 2VJ4A 3R1PA 1RQLA 1U49A 5KNIA 4QZAA 1YX7A 2BBNA 4DL5A 1OMVA 4O3SA 1LVCD 2XC9A 2KMDA 5E79U 3IG8A 2XCPA 2P35A 1NP8A 5KT5A 3V6HA 5J0SA 5J2AA 4C0JA 1Y1XA 5HKYA 2K7CA 1LKYA 4FTGA 2BECA 1QATA 1KL9A 4YGCB 1CEZA 3PW5A 2FLPA 4EZ9A 5DKQA 1F4QA 2YN4A 1XFVO 3C2MA 4KN7A 4DL2A 2MSNA 4F5OA 4IRKA 9ICQA 1TNQA 4O3PA 1T4GA 3NVYA 2ESEA 4M47A 3F5AA 5KFTA 1TVAA 9ICMA 2KD1A 3B7AA 2FCEA 3M8RA 3F2BA 1QQ7A 2JEFA 4Y2RA 1X02A 2MA1A 2EC6C 2M0NA 4F5NA 2A4JA 2WCMA 5AKJA 1KWOC 4P5OE 1WRLA 2ZJ8A 2BL0C 5KFXA 3DF0B 2GTEA 3C23A 4C4SA 1ED1A 3UXPA 2ERBA 1ZQXA 3PSPA 1UP5A 3S0GA 4PPXA 1AVSA 5DKNA 3HKZC 4I2GA 2FPLA 1J55A 4RQ3A 3I5GC 4AYBF 1IM4A 1BNPA 1QCKA 1P7DA 3BS7A 3QU9A 5CWRA 1WY9A 4ED1A 1UHKA 2KSOA 1RJVA 3CRXA 1K90D 4B9SA 5IIKA 4RQ2A 1V97A 3CABA 3WNXB 5BPJA 2AGOA 4DFDA 5KFZA 4GGFC 8ICTA 3Q8KA 1ZQNA 4DSJA 4UB5A 4KX3A 1DJXA 3BQ2A 5ALJA 3ZDBA 3N97B 1A75A 2JH1A 2QEBA 5EE3A 3EUB2 3BYAA 5EOZA 3GIKA 1ZYQA 1NI3A 2JZBB 2ZIXA 4PZNA 1SL0A 4KMOB 1SY9A 2ZFDA 1QASA 2MUTB 4YMMA 2PMYA 4XA5A 2M9NA 3H8JA 3MR2A 2P71A 5HYDA 2YTUA 1ZRNA 5IILA 2KGBC 1CMGA 1S8OA 5AANA 1KN5A 1TAMA 2H3QA 5J2DA 4BJQA 2W04A 1JXLA 3SV4A 3IP4B 1XO5A 1PK1B 1NX0A 3KHLA 1PVAA 4NWIA 5DQGA 3PZPA 8ICCA 1Z19A 4BWMA 3QUCA 1YVHA 3DVKA 3JPPA 7ICFA 5J0PA 4DEZA 1JRPA 4TUQA 3HW8A 7ICEA 4J9SA 1DTLA 1YRUB 3BQ3A 5DKWA 5TZVA 4CRXA 4IQVA 4EBDA 7ICQA 5DB9A 4O3RA 4JB3A 4P4OA 4IJ7A 1XO1A 2R8GA 3O4XA 3AAKA 3GV5B 9ICVA 4C0KA 1B9AA 4YXJA 3Q8IA 1SRAA 3O6BA 4HRGA 5AI4A 1KQQA 1ZQVA 2KDHA 3OB2B 4LZGA 2MU2A 2JXCA 1JBAA 2LC5A 1NK0A 1P28A 1ZQZA 3M6ZA 4O3QA 2G0AA 2KKVA 5DDMA 1V1FA 2LHTA 2ZTEA 2WORA 1S6CA 4NLGA 4UAWA 1K8UA 4MF8A 2ZUBA 3JTDC 2RRDA 3EKJA 9ICNA 1ZUZA 1NK6A 5EE1A 3OPXA 8ICSA 4EELA 1TAUA 1SWWA 2PFNA 3UM9A 3AKAA 2BDPA 1F5SA 8ICLA 2DFLA 3C2LA 2EGDA 4LJXA 3M9OB 2KHNA 3PM8A 4CCHA 3PVXA 2L50A 4Y2XA 3V2LA 1N60A 3NTUA 5DQHA 1EG4A 1XFUO 1CFPA 3C29A 2DOQA 1PK0D 7ICHA 1DGUA 1JXEA 3MBYA 2NZ0A 1DRGA 2BCXA 4P0PB 2A3VA 3RM1A 4RQ4A 2P70A 4I2IA 5AKIA 4F91B 1NK5A 4I2HA 2HPSA 8ICGA 2MRLA 3DVEA 1QXPA 5ALNA 1A6SA 3PATA 5KL8B 1UHUA 4KITB 4P0QB 2P6RA 3B6XA 1CLLA 2ZN8A 4M2YA 2OTGC 5C5JA 1XC9A 3EPGA 4O5CA 2IOHA 2JH7A 3N4MB 4N5XA 3D2SA 1MC8A 1ZQQA 4Z6CA 1ZQAA 3CZTX 3AM9A 3BS5B 3T5LA 3ZDCA 1ZQFA 1FEZA 5IINA 5DG8A 1Q3UA 3SG2A 1PALA 1Q80A 1SNLA 2VIXA 2UVRA 2BDUA 1X40A 1Q3VA 3BUMB 9ICHA 5AK3A 2W7PA 2AMIA 1ZQLA 3HPOA 2KNJA 1GO3F 4ZCVA 5I2QA 5DG9A 4MRYA 5EE9A 2G07A 2R8HA 1UA1A 2GO7A 3UQ0A 4YD1A 3VRNA 3HT3A 5ALVA 3NHIA 5J29A 1U48A 1JFKA 2UVWA 4NLCA 2WCEA 1FBVA 3DF0A 4DS7A 3ETRA 2BE4A 4JD9A 1AUIB 2KAVA 3NSLA 2CNPA 1K1QA 3HX4A 1NKBA 4PALA 2BQUA 3OB1B 5KT2A 2Y5IA 1MHOA 2LVKA 1JF2A 3H7IA 3KHEA 2XIDA 1D9FA 2E8NA 4FFDA 1QX7A 1FO4A 2W55A 1YTZC 2B0CA 1E8AA 1FFVA 2K4EA 2BCSA 4M0AA 2K8BB 3DD4A 5I2LA 3GK1A 1JC2A 2V9WA 2EDUA 1Q46A 3TI0A 2VA2A 3HX0A 4UB1A 2A19A 3NUQA 1CFCA 2YMQA 4MHVA 1NCXA 3H8SA 3EVUA 4IL1A 3IHQB 3IF7A 1ZQWA 2BZFA 1N61A 2HHUA 2G5IB 1W9ZA 5J0OA 4GFJA 4Z6EA 1AROP 2LYAA 4C0ZA 1KK7Y 1YRTB 1BPEA 1WYGA 4ICAA 3VGOA 1ORGA 2JZBA 5KFHA 2PRUA 1DJGA 2MUTA 1S3PA 3CNHA 4X5VA 1YR5A 2MRDA 3ISCA 4NM1A 5J0RA 3L4LA 4Q8EA 4DWIA 2OHFA 1GM0A 3C21A 3GIIA 5ALGA 1S0NA 2UVVA 1DK3A 3WXAA 2KI6D 3OHAA 3MFHA 2QEHA 1SB3C 5KFQA 2HF5A 1PK1A 5L1MA 1KFXL 1UPHA 2K8CB 2R8JA 3NS1A 2JMGA 3OHBA 5AKZA 4DL6A 4RQ5A 3RBDA 1D8YA 1NJYA 4AP9A 1MQ2A 3JVTB 2M1KB 1OUQA 2KLDA 4F5QA 1KK8C 4DOCA 8ICHA 1N65A 4FQOA 1ZJNA 4I5NB 4DFMA 5AI0A 1L7ZA 2JNFA 5G08A 4R1EA 1XFYO 1TK0A 3PSFA 3KZIU 3LYSA 3GV7B 4A4BA 2WAQF 4ORBB 3T5KA 3OHMB 4EYHB 1XSPA 1UWOA 4QWDA 5L1JA 5KFSA 3D78A 1MN8A 1QTMA 2P66A 4CFRA 4CNQA 1N5WA 2KGRA 4D1EA 8ICPA 1K94A 1K96A 4B9TA 4Y2TA 1WRKA 2K7OA 3WU2U 4B9MA 3OBVA 8ICWA 3PFVA 1HQVA 3UO9A 1SKSA 3RJEA 9ICTA 1TFRA 5ALKA 2FCDA 3V7KA 1IG5A 4KLUA 4HAIA 3JPSA 1SZHA 1S9FA 1YURA 3H4SE 4O5KA 4KLMA 4O3MA 2KI4C 5CPVA 1BLQA 3CYMA 4R63A 1TWOA 2JV3A 4ECVA 5AKYA 5KFYA 3I5FB 2H3IA 5ALRA 5AICA 3RF9A 2NO4A 3RJFA 2J6SA 1OOJA 2IHNA 3BQ0A 2RLTA 2CPRA 1WCNA 3S0EA 3PV8A 1L3VA 4INXA 2GH1A 1MSWD 2H61C 2HQWA 2NO5A 2BPFA 5J8YA 1C20A 4I5JA 2JZIA 5K4LA 1R6PA 5J0XA 4OO1J 3UMGA 3EVVA 1YT3A 4BY5A 1L2OC 4DFJA 3RJHA 3H0MB 1ZQDA 1DELA 1DC1A 3PNCA 5AERA 1OOIX 4C4TA 4P0PA 1ECWA 3TS5C 4B9VA 2JTZA 5B5EU 2PMZF 5KFRA 3C28A 2XY5A 2Y9TA 3WKBA 2KAXA 3UQ2A 1CB1A 4OJ6A 1ALWA 4F8RA 3D2NA 3PMLA 1JI7A 1OMRA 5J2JA 1M63B 4P0QA 1OXJA 4BWJA 2E6WA 1EJ3A 5D4BA 2K61A 3BDPA 1J2NA 1S6JA 4J9OA 2AXTU 2L2EA 3KKAA 1DJWA 4YRUA 3BS5A 5ALOA 3EYZA 4IQWA 1J7PA 3T5HA 4GXIA 1PVRA 5ALEA 1QWVA 1IH0A 1QX2A 1WLMA 4I5LB 8ICZA 2HI0A 2W9AA 1F71A 1XS9D 2WCLA 2H3VA 4ZOHC 4F71A 1UHNA 2LMUA 2LVIA 2BCUA 1JF0A 3AKBA 4KN4A 2G5HB 3QEAZ 4IR9A 4RQ1A 2WNDA 3DXLA 1PVBA 2ZNDA 1X9SA 2JT3A 3I5IB 2OS8C 1H8BA 3KD3A 3D10A 3HWTA 2KFGA 3RH6A 4FQTA 2HOQA 4YD2A 4NLNA 3BUXB 1TK5A 2W3RA 1KFSA 5CHGA 1NPQA 5HKZA 5KG7A 3HCMA 2WAQC 3SR6A 3A4UB 5AM2A 3ICBA 3V6JA 1MF8B 2GGMA 4DOBA 4BDPA 9ICGA 3G6XA 1JWDA 4YI8A 4IR1A 4RUCA 3TDUA 1QTXA 4MFFA 2A1JB 1L8LA 2SASA 2K60A 3QUBA 3MGVA 3HILA 4OCZA 4NQGA 4MN0A 5KFNA 5BOMA 1SL2A 3BJYA 1DQEA 3RRGA 4FZMA 1NX1A 1B4CA 4UAZA 2M8UA 2NLNA 3H4BA 4FS2A 4DSLA 1DXSA 4YGBB 3KKAC 3I5HC 2G08A 4OR9B 4USLA 3T5JA 3LWMA 3ZD9A 5H2FU 1SIJA 1NJWA 4IRDA 1CM4A 1DOQA 3ETLA 3QE9Y 4I28A 4M9JA 2BHNA 1XSLA 1LA0A 5HP4A 3FIAA 2BCVA 1BT6A 3PSIA 2F2OA 2P6BB 3ALRA 1B8LA 1XFZO 3WHTB 2AUCA 4ICBA 1NCZA 7ICTA 1IG6A 5FI7A 3RJKA 1L7OA 1F70A 5AM3A 3I76A 4U6PA 1QLNA 4YG2A 4ED7A 5JTIA 3RJGA 4G3IA 1H38A 1QSLA 3BXKA 2PFQA 4F2RA 1QLKA 5KU1A 4F2SA 7ICSA 2L0PA 3BJHA 1C07A 4ED0A 1B0XA 2HBMA 3WK6A 2PMZC 2JRZA 3SG3A 2K4HA 1HT9A 1XWLA 1DT7B 5CSNA 2EZZA 3GILA 2Y1IA 1Z4OA 3PN7B 3OTQA 4F4WA 4MZKA 3LDAA 2ES6A 2L51A 2NRXA 2ISDA 1JIHA 3F53A 1A0PA 1K9KA 1F54A 2HBJA 5KG3A 2W03A 4CIDA 1AJ4A 1OW4A 1SZPA 4ED8A 3NRZA 4EX7A 9ICFA 1CMFA 5D49A 1ZD2P 2JULA 3BFHA 4GXKA 2XI9A 1L7NA 2PFPA 4RPXA 2WFAA 1KSMA 3K21A 3SG6A 3D73A 4CFQA 5L1IA 5HHHA 3TKAA 2JRFA 3SI8A 3O0FA 4CE6A 3MR3A 1SCMC 3AQFA 1J7RA 2NRZA 3MDAA 1C3ZA 1QIVA 3FYHA 2YQEA 3GV8B 1RTP1 1FIQA 1KFUL 4I2CA 1MUXA 7ICNA 2B6GA 2HHXA 1J1DA 2BE6A 4K4IA 3OX6A 4QZDA 3JPOA 4RPZA 4DS4A 1F4OA 3SG7A 4NLKA 2Y1MA 3F45A 4QJ5B 1WDCC 1BU3A 1LVHA 1XVJA 3WK7A 1TNWA 5DB7A 1NUBA 2KFNA 2I94A 4PE1A 5KAIU 5FI2A 1NNLA 2M97A 4MF2A 3FM9A 4ZH4A 3E0FA 1NZBA 5K89A 2YY6A 2AGQA 4JV1A 2Q4TA 2WC5A 4NDBA 8ICJA 3N7RC 4YBHB 3BZKA 2EHBA 3PW4A 2KYFA 1QJTA 3N28A 3GQCA 5KT6A 2QPTA 2WF8A 3QYPA 1SL1A 2NRVA 1BGXT 1TE2A 4RT2A 4F0ZB 1LKJA 2JPOA 3SS5A 3AU2A 4P2HA 2GV5A 5J0UA 3B9JA 3PR4A 2F8KA 2Z7JA 1MQ1A 5IIJA 3KOOA 1S26D 4YCXA 2JEJA 4LVSA 3TDIA 4JWQA 2ZTCA 3F5EA 1J2MA 1BR1B 2MAZA 3H0LB 1KRPA 4PHPA 4I2EA 2D8NA 2DGZA 1X9XA 5DBAA 1SL7A 4DSIA 1SL9A 5F3XB 8ICQA 2W9MA 4PHJA 4NV0A 1XFWO 3RB6A 1DMOA 3CGAA 2Y0SF 5AKEA 4WQ2A 2VA3A 1GQMA 4M2OA 1CLMA 4QNLA 1J7OA 4IRCA 1X6JA 5KFPA 3V7LA 4Y2QA 2BPCA 4UB4A 2OPOA 1SYMA 3BZCA 5I2OA 2OCEA 2OWOA 2V53A 1R2UA 2DF4B 1S77D 3D74A 1TNXA 7ICKA 3GK4X 5ALWA 2K4IA 2LM5A 5ALLA 5KG0A 1CI4A 2KIVA 2O6KA 1EXNA 1X66A 5ALTA 2HHQA 1D9DA 4QW9A 1RYRA 2M29A 2WOSA 4Y2UA 9ICAA 5A0LA 4YFKA 1QH9A 2F8LA 1RM6C 5AM4A 5AM1A 3AAJA 1IXRA 1CNPA 9ICPA 4QZ8A 4C7ZA 2EZXA 2HHTA 9ICCA 2PQLA 3B0YA 2F3YA 3VRPA 9ICIA 3KO0A 4O9MA 4KLTA 2A1JA 2N1RA 3THVA 2W54A 2LMTA 3C2KA 1IIOA 3CTNA 5AI8A 2CBLA 2RGIA 5I94A 4B9NA 3L4AA 3FDSA 4NY8A 1LA3A 3BUOB 3SAHA 4CF4A 4ECRA 2F3NA 5KFLA 2K0JA 2KSPA 2O5GA 1U5IB 5KSZA 1QV1A 4TUSA 2L98A 1XFXO 5AM0A 3RR7A 3KTQA 2ODGA 1K9UA 1WRZA 2KV2A 4OJ5A 5HNKA 4PGQA 3GOFA 1Z1BA 1RECA 3LL8B 4OVNF 1MA7A 3WK4A 1NK9A 1EL4A 1UCVA 1N5XA 3VRQA 1SKTA 5KFAA 3MR5A 1Y6WA 3AUOA 3M1YA 2QLTA 1T7PA 1KKXA 4QJ3B 2K4PA 5ER5A 2JEIA 2HW3A 3ED5A 4ETOA 2UVUA 1TTXA 5DICA 4DCKA 3LVWA 4QIWF 1ALVA 5GTHU 1NYAA 4U7CA 1L3TA 3PW2A 2KLEA 3LK1A 1ZQPA 5AKLA 1T3NA 2PYQA 3BFAA 5BPCA 4ZCUA 1ZQYA 2MLFC 3SAGA 3R1VA 3SIBA 7ICIA 3IRUA 4ECUA 2HSZA 4UARA 2K7BA 3N7SC 2XY6A 3CDNA 3BUNB 2LPEA 2JR5A 3D77A 4RNMA 4I2DA 3K1ZA 5KT3A 3PLFB 2HMXA 3FE9A 1SR6C 4YP3A 5DQIA 9ICOA 1B22A 1F44A 4PE4A 4UAUA 3AL0B 4BGDA 1ZJMA 2Q0ZX 5G5GA 2Y0SC 2KOTA 1FFUA 4PE7A 1U9LA 4KTQA 4YGDB 3RH5A 1TRFA 5KFCA 1W7JB 4ECSA 2IHMA 1BPZA 4OZDA 4OCIA 1GGZA 2OYYA 1D8BA 2DQNB 2NV3A 1TK8A 4LZDA 7ICVA 4XQ8A 5DBCA 5J2FA 2LMRA 1KFXS 1L3UA 1B43A 3AN1A 3RRHA 2E8MA 4M9LA 3LCPC 4F72A 1A03A 2MLEC 3PX6A 2PKEA 2WTFA 2F44A 4ECTA 4MZJA 3QUQA 7ICMA 2MBXA 2FMQA 5EWGA 1K2HA 4J9LA 2F8PA 4JK1A 3FWBA 1IKUA 3KBBA 2BKIB 4OJOA 1WUDA 3GU3A 4PH5A 1LV5A 4YGEB 1XU4A 2YMMA 4ECQA 1KQMB 5KL1B 1TKDA 2LP2A 4YN4A 4Q45A 4Y2SA 2W8LA 1ZOLA 3PW0A 1NJZA 1TCFA 5DB8A 1SPYA 4F93B 3KF9A 3DVJA 4ECZA 8ICOA 2KEYA 1OW5A 5AK4A 3QX7A 3PN7C 1K9PA 2M1UA 3V72A 5HL1A 2LNKA 5FI6A 1ZQGA 4CLNA 2E8PA 1ZQEA 3CZ0A 2LCPA 1XO0A 2LLTA 3BUWB 4QZHA 3SYZA
chains in the Genus database with same CATH topology
2DKZA 2F8KA 4GBAA 3KEVA 1LKYB 2K4PA 1V85A 3UNWA 4PZNA 2DL0A 2BNXA 3SS3A 2QARA 2Y9TA 5FI7A 2QARB 1X9XA 1DEKA 2KE7A 2QB0A 1JI7A 2L5YA 2KLEA 2QB0B 5F3XB 5KNIA 2YTUA 5JTIA 1OXJA 3IDWA 2EAMA 1SGGA 2KMDA 1B0XA 2KG5A 3PM2A 1PK1A 1F0MA 3KKAA 2LPEA 5JU5A 1PK1B 5L1MA 1B4FA 1KW4A 3BS5A 2EAPA 4RQMA 1SV0C 3BS5B 4RQNA 1LKYA 3EG5B 5JRTA 3H8MA 1DC1A 4MEWA 2ES6A 1COKA 1PK3A 2DKXA 2KLDA 4I5LB 1RG6A 1Z1VA 1X40A 4I5NB 2E8OA 4I5KA 4IJ7A 1Z4HA 2ESEA 5D3OA 2KIVA 2LMRA 3O4XA 3TADC 1UQVA 1X66A 1Z2CB 2E8MA 4PZOA 4KYNA 1WWVA 2EAOA 4NL9C 3OBVA 4NJ8A 2B6GA 3UO9A 3TADA 2F44A 1SV0A 3K1RB 2FE9A 2K60A 2E8NA 1SXDA 3IVTA 5I94A 3HILA 3TACB 3SS4A 5FI2A 3BS7A 4GAOA 2JV3A 2QKQA 2YGUA 2KSOA 1WWUA 5J8YC 2KSOB 2F3NA 2BAPA 4IS7A 1V38A 1OW5A 4MHVA 3SENA 1DXSA 3KKAC 4JKTA 2QB1A 2D3DA 5HL1A 5J8YA 2GLEA 4I5JA 3BQ7A 2D8CA 2Y9UA 5FI6A 1W9ZA 2E8PA 1SV4A 1SXEA 4NL9A 3SS5A 1UCVA 1DELA 2EANA 3SEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKZ A;  2F8K A;  1LKY B;  2K4P A;  1V85 A;  4PZN A;  2DL0 A;  2QAR A;  2Y9T A;  2QAR B;  1X9X A;  2KE7 A;  2QB0 A;  1JI7 A;  2L5Y A;  2QB0 B;  5F3X B;  5KNI A;  2YTU A;  5JTI A;  1OXJ A;  3IDW A;  2EAM A;  1SGG A;  2KMD A;  1B0X A;  2KG5 A;  1PK1 A;  1F0M A;  3KKA A;  2LPE A;  5JU5 A;  1PK1 B;  5L1M A;  1B4F A;  1KW4 A;  3BS5 A;  2EAP A;  4RQM A;  1SV0 C;  3BS5 B;  4RQN A;  1LKY A;  5JRT A;  3H8M A;  2ES6 A;  1COK A;  1PK3 A;  2DKX A;  1RG6 A;  1Z1V A;  1X40 A;  2E8O A;  2ESE A;  2KIV A;  2LMR A;  3TAD C;  1UQV A;  1X66 A;  2E8M A;  4PZO A;  1WWV A;  2EAO A;  4NL9 C;  4NJ8 A;  2B6G A;  3TAD A;  2F44 A;  1SV0 A;  3K1R B;  2FE9 A;  2K60 A;  2E8N A;  1SXD A;  3HIL A;  3TAC B;  3BS7 A;  2JV3 A;  2QKQ A;  2KSO A;  1WWU A;  5J8Y C;  2KSO B;  2F3N A;  4IS7 A;  1V38 A;  1OW5 A;  4MHV A;  3SEN A;  1DXS A;  3KKA C;  2QB1 A;  2D3D A;  5J8Y A;  2GLE A;  3BQ7 A;  2D8C A;  2Y9U A;  2E8P A;  1SV4 A;  1SXE A;  4NL9 A;  1UCV A;  2EAN A;  3SEI A; 
#chains in the Genus database with same CATH topology
 3FC4 A;  2F2P A;  2HET A;  2AH5 A;  5JOL A;  2RP5 A;  1CDL A;  1KTQ A;  7ICJ A;  1G33 A;  3JPT A;  1RXW A;  2W8K A;  1W7I B;  1JAL A;  5PAL A;  9ICW A;  5J2C A;  1UA0 A;  2WCH A;  2KTQ A;  1NCY A;  2G09 A;  1KK7 Z;  1M6Y A;  3UPQ A;  4K4G A;  5J2H A;  2L5Y A;  3TDZ A;  4Y2J A;  4GLX A;  2JQ6 A;  3JPQ A;  3IDW A;  4J9Q A;  9ICB A;  5J2E A;  1OZO A;  3WKE A;  2WB1 F;  3Q8P B;  1A77 A;  1O08 A;  5ALX A;  1NKC A;  4TUR A;  1T14 A;  3A0B U;  2MHH A;  4C8K A;  2MJW B;  1ZRM A;  5B8I B;  4QIW C;  1CKK A;  3H8M A;  3T79 A;  3C5G A;  1COK A;  1M39 A;  1NK4 A;  2FLN A;  4PDZ A;  1VJ5 A;  1L6N A;  3TFS A;  1AHR A;  2BR0 A;  1D1O A;  2GOL A;  2BQR A;  4EEY A;  2YX8 A;  4QZ9 A;  4I5K A;  3TAN A;  5TNC A;  4GIB A;  5D3O A;  3TAR A;  1BOC A;  2M3W A;  2OM6 A;  5CJ7 A;  1ZQI A;  3S6J A;  3WKA A;  2ZIU B;  3O2P A;  4E0D A;  2WCB A;  3S0B A;  1RQN A;  4ELT A;  4DSK A;  3QNM A;  1BMO A;  2XGP A;  2NYV A;  1EG3 A;  1VRK A;  2NRT A;  3NRW A;  3FS7 A;  5I8N A;  1JSA A;  5AKX A;  4I2F A;  1CDM A;  3RLZ A;  3G6Y A;  3OX5 A;  1RYU A;  1AJ5 A;  2NCP A;  3QZ7 A;  2F1I A;  1KWO B;  2BL0 B;  2FPK A;  1QLS A;  2ISP A;  1CDN A;  4EX6 A;  1BF5 A;  3ISD A;  4GAO A;  5ALI A;  3D76 A;  4WJ3 B;  3KFU F;  4AOM A;  3C1Y A;  3UXN A;  3V6K A;  5J2G A;  1U5I A;  4F7F A;  1OOH A;  2JXL A;  4DF8 A;  5J2I A;  1TUZ A;  3I5G B;  1COO A;  3DDH A;  3RBE A;  2E30 A;  3KPX A;  2ZIV B;  3NVV A;  2D8C A;  2I7A A;  4XRH A;  2LE9 B;  4M9H A;  5DG7 A;  1WLZ A;  8ICM A;  2D6F C;  1ZQJ A;  2EAN A;  4B6J A;  4BXO B;  2CXJ A;  4DQI A;  3OSN A;  3ZD8 A;  4GBA A;  5KTQ A;  3KEV A;  5JJG A;  1FI5 A;  1LIN A;  5DLG A;  1LKY B;  8ICB A;  2KBI A;  2NXQ A;  1V85 A;  1M45 A;  1PRW A;  2DL0 A;  3RZS A;  3QME A;  3TUY C;  2JHD A;  5D46 A;  2HOI A;  1PSR A;  2H5X A;  3O78 A;  3L4P A;  2JTT A;  3CR2 A;  3CYZ A;  4Z6D A;  1IGV A;  3SZ2 A;  1TUJ A;  1C7Y A;  3VB1 A;  3ZDE A;  1VDV A;  2JXJ A;  2ATL A;  1YUU A;  1PSB A;  5AM5 A;  3RB0 A;  1S76 D;  5J2K A;  1G4Y R;  2K2F A;  2LAP A;  3ISB A;  4ACO A;  4QW8 A;  3M8S A;  5ALD A;  5FP0 A;  5CA7 A;  1B4F A;  1KW4 A;  4GXJ A;  4RQN A;  4E68 A;  4DL4 A;  5L9X A;  2GGZ A;  5ALY A;  2W9B B;  1ZD3 A;  2PSR A;  1OOG A;  3NAS A;  4M9G A;  3OGU A;  2WB1 C;  2VAN A;  1B1G A;  1DGV A;  2E8O A;  4NM2 A;  2ALZ A;  4J9R A;  4KLG A;  2HBL A;  3MSE B;  3DYE A;  1NK8 A;  3PSR A;  3BQT A;  3D2Q A;  3RJJ A;  2FJ6 A;  5AEQ A;  2ZG6 A;  4J9K A;  4R66 A;  5L1L A;  1JUO A;  2TN4 A;  1DJZ A;  4PZO A;  2BGW A;  2HCF A;  2JWW A;  7ICL A;  1ZQM A;  3R9K A;  4C80 A;  1L5U A;  4MEY A;  4PHD A;  3LVV A;  2F76 X;  3U26 A;  1U47 A;  4JV2 A;  1PUL A;  2PI5 A;  3TAD A;  5KFI A;  5DGA A;  2CCM A;  1Z00 B;  4QZC A;  4I29 A;  1IV8 A;  2XIC A;  4Y2P A;  2J6T A;  1ZOT B;  1SV0 A;  4US9 A;  1CM1 A;  1B8C A;  3NSO A;  3NVW A;  2DWQ A;  5KFW A;  4YR2 A;  3Q8R B;  3TAP A;  1PZN A;  3EK8 A;  1SXD A;  4JPZ B;  1OSA A;  1K5O A;  3IQO A;  1RZT A;  4JV0 A;  1S5G Z;  2B21 A;  1X9M A;  1Y1A A;  3R72 A;  1JX4 A;  4PGX A;  5J8Y C;  5EWE A;  2AJQ A;  3MAB A;  8ICX A;  4NXZ A;  2LP3 A;  4MBE A;  4IS7 A;  1V38 A;  4UW9 A;  9ICL A;  1RWY A;  1ZQT A;  5HR7 A;  3JTD B;  1BVS A;  3DVM A;  1BNO A;  4DSE A;  3Q8L A;  5D7F A;  2KIC A;  1S5G Y;  3VRR A;  1UHH A;  4KLD A;  2GLE A;  9ICS A;  1IJ5 A;  4Q8F A;  2Y1N A;  3N7H A;  5KFV A;  4DL3 A;  2XY7 A;  1YUS A;  4AQJ A;  3GZF A;  4KX5 A;  4KLS A;  1RPL A;  5AHX A;  2LM4 A;  2KJ5 A;  4TQS A;  3ZWH A;  2RDI A;  1SKW A;  5IIO A;  2ZIW B;  3C1Z A;  2QEV A;  4R8U B;  2LBO A;  4OJL A;  4FZL A;  3E3R A;  4Q43 A;  4DIR A;  1KFT A;  4CPV A;  3AU6 A;  2WF6 A;  4RQ7 A;  4WQ3 A;  1XFR A;  4Y2V A;  4NDC A;  1SGG A;  1ZQC A;  1CFF A;  4IQT A;  3PM2 A;  4M04 A;  5CP2 A;  2BCA A;  4PJ0 U;  3S0F A;  1F0M A;  2G2B A;  1SV0 C;  1A29 A;  3IN5 A;  3PX0 A;  4DF4 A;  4K4H A;  1MWN A;  2LI6 A;  4MEW A;  1SK6 D;  2OTG B;  4M2Q A;  3A0H U;  2KQ6 A;  2GWS A;  4F4Z A;  2BQ3 A;  2PAL A;  1NK7 A;  2JC2 A;  2PXI A;  4GGN A;  4PE0 A;  1MXL C;  4F3O A;  1Z3E B;  4EEK A;  2K2A A;  1B47 A;  4ED6 A;  3OP0 A;  1CUK A;  1SW8 A;  2WC8 A;  1HJP A;  1CDP A;  3SMV A;  4UPG A;  1KSP A;  3SD7 A;  4YI9 A;  3KHR A;  1FPW A;  4YXM A;  4R64 A;  2LUX A;  3VRO A;  3B86 A;  2XGQ A;  3HJE A;  2ZTD A;  3RR8 A;  1PVQ A;  1HUZ A;  1JMS A;  1UUS A;  2KZ3 A;  2AHO B;  1RYS A;  9ICX A;  5F6T A;  1DGS A;  3QU7 A;  3KHG A;  2ZKM X;  5CR0 A;  5J3X A;  2WHE A;  4J9N A;  3LK0 A;  1C7V A;  3DY9 A;  4JMU A;  2OEH A;  2FJY A;  2KQY A;  2YGU A;  5KFF A;  4UB6 U;  3NVZ A;  4NLZ A;  5FYX A;  4QWB A;  2F1J A;  5KFJ A;  4RUA A;  3M9N B;  2BKE A;  4YMN A;  3QZ8 A;  2WCJ A;  2R8I A;  3SEN A;  3EWA A;  3DZT A;  4UB8 U;  2ZIV A;  5KFD A;  1B8R A;  4F5P A;  1ZQ1 C;  1NWD A;  5KG1 A;  3OGN A;  3G6V A;  2FLL A;  1BPB A;  1XA5 A;  2AU0 A;  4BXO A;  3EKH A;  3NGV A;  2PVB A;  2L2C A;  2ZXH A;  3TQ1 A;  4GGF A;  4C4R A;  3MDC A;  3QEB Z;  3CWG A;  3FE6 A;  2YB1 A;  2OXO A;  3SS3 A;  1S97 A;  8ICI A;  4RNN A;  1RFJ A;  2QAR B;  3ZDD A;  5J0Q A;  5CSI A;  4ELV A;  2KHQ A;  3ONN A;  4MRX A;  3OSP A;  3C1V A;  3EW9 A;  2PI4 A;  3S0A A;  4ELU A;  4MFC A;  3JVT C;  3NHT A;  3FE8 A;  1L3S A;  4FE3 A;  4PL2 A;  5HLV A;  2RHF A;  2LYB A;  1OMD A;  2KNE A;  5ER4 X;  5JU5 A;  2IA6 A;  5AI6 A;  4JUZ A;  2KZM A;  1PVP A;  3EG5 B;  1ZQR A;  1T94 A;  3H40 A;  1V9P A;  4NLB A;  2W9B A;  5KFU A;  5KFM A;  1CTR A;  7ICU A;  2VRG A;  7ICG A;  4FS1 A;  2L4I A;  2HHS A;  4CF3 A;  2KK0 A;  4ECY A;  4HSZ A;  4P4M A;  1AP4 A;  5AIA A;  4KLQ A;  1JUD A;  4OV2 A;  4I2A A;  2E3T A;  4PHE A;  1ZQK A;  1QVI Z;  1UHJ A;  4DQS A;  1Z4H A;  4TQR A;  4MLW A;  4P2Y B;  1KK8 B;  1Z4N A;  1QQ6 A;  1JN3 A;  3QRX A;  3KHH A;  2ASJ A;  5DBB A;  2I18 A;  2LHL A;  2DPJ A;  2F1H A;  1T8E A;  4QWC A;  2LVV A;  4MVF A;  4I27 A;  2Q4U A;  4NJ8 A;  1QQ5 A;  4PHA A;  4QWE A;  2YMP A;  1QVI Y;  1F55 A;  4TNC A;  2LLS A;  1YZ6 A;  1Z00 A;  4QZB A;  4F4X A;  3FAH A;  2KIW A;  3SAF A;  3I5F C;  1N63 A;  1NOM A;  1U45 A;  2MA2 A;  2CT9 A;  1YZ7 A;  2FE9 A;  3WHU B;  1TN4 A;  3D75 A;  3O4Y A;  4FBU A;  1OZS A;  2C28 A;  3JPN A;  2Y4Q A;  3D6J A;  4KLI A;  5KAF U;  2HDO A;  3K4G A;  1WWU A;  4HRH A;  2JGA A;  1A4P A;  2BAP A;  5CSJ A;  2BPG A;  4OD0 A;  2KN7 A;  5HR6 A;  1LXF C;  1LB2 B;  2LMV A;  3VC8 A;  2KI4 B;  4Q44 A;  2ASL A;  1NZP A;  4KLJ A;  4DS5 A;  1N2D A;  1N48 A;  3L3F X;  2Q91 A;  2LLU A;  1HIW A;  3V7J A;  5CSF A;  5JUM A;  5HML A;  3UXO A;  2WCK A;  1SV4 A;  1Y1U A;  4KLE A;  2KZZ A;  2DKZ A;  1URJ A;  4JWN A;  2QDI A;  2ZIW A;  1S0V A;  4INW A;  5J0T A;  4ECX A;  3WK5 A;  4EZ6 A;  4R8U A;  2BCB A;  2F3Z A;  2JOJ A;  2JPT A;  1ZQS A;  4DRW A;  5CEH A;  2NRW A;  1GGW A;  1L2O B;  2IBK A;  5AKK A;  1BOD A;  3K1E A;  2KE7 A;  4BUG A;  2QB0 B;  7ICO A;  1UT8 A;  2W3S A;  3M0W A;  1RRO A;  2EAM A;  2ASD A;  3TS5 B;  1XYD A;  4J03 A;  4I2B A;  2H3Z A;  4P4P A;  1K95 A;  1RDF A;  1SBJ A;  1TNP A;  1CRX A;  3MGI A;  4JQ0 D;  3I5I C;  2QAC A;  1A2X A;  3B0X A;  1EXR A;  2PAS A;  4RZR A;  2I9G A;  3BFB A;  1S6I A;  1HUO A;  2KAY A;  2KYC A;  4AQI A;  1IRJ A;  2KJ9 A;  1S5L U;  4PL1 A;  1ZFS A;  2EZY A;  3SJS A;  4DUQ A;  1Q8K A;  4WRI A;  2HHW A;  8ICR A;  3RAX A;  1DK2 A;  4M6W B;  2DBY A;  2LUC A;  1QIW A;  2JT8 A;  2LV7 A;  5AK6 A;  1UQV A;  2W11 A;  5CB1 A;  3Q8M A;  2CXY A;  3SV3 A;  3F2D A;  4UAT A;  1MQ3 A;  2ZRT A;  4CGZ A;  1ZQU A;  1WWV A;  1XK4 A;  2OS8 B;  4PCW A;  5ALP A;  3PMN A;  3F2C A;  3D0Y B;  4AYB C;  3A8R A;  5IIM A;  2LKY A;  3ZNI A;  2C2E A;  1QV0 A;  1CLB A;  1IIP A;  4DQP A;  5KG2 A;  4OJP A;  4EBC A;  8ICV A;  1YVL A;  1TCO B;  2BCQ A;  1NSH A;  4HRE E;  1UT5 A;  5DKR A;  4ORC B;  2ZXI A;  4XJK B;  1AK8 A;  2FPM A;  2AQ4 A;  2QKQ A;  3QU2 A;  4F5R A;  3WKD A;  2LVJ A;  2XCA A;  3CR4 X;  3CZ2 A;  5KFG A;  4OKH A;  5HKW A;  2M0R A;  2IOF A;  2HBK A;  3ORY A;  2PFO A;  1ZET A;  1NIW A;  1K93 D;  1C7W A;  3CR5 X;  3HP6 A;  1DGJ A;  2AGP A;  4J9M A;  1U4B A;  2L4H A;  5AKG A;  3BQ7 A;  2Y9U A;  1SCV A;  1M31 A;  1KQV A;  1DJI A;  4J9P A;  1SKR A;  3E2E A;  2C2R A;  4F50 A;  1ZQB A;  4U8D A;  4MEX A;  3Q8Q B;  2KJ8 A;  2KOB A;  4UB2 A;  9ICK A;  2H8V A;  3PO4 A;  3I5H B;  3TAQ A;  4N1G A;  3GFK B;  3GIJ A;  1KLN A;  4PHN A;  3LK9 A;  1QSY A;  1N62 A;  2KP7 A;  8ICN A;  1NKE A;  2QAR A;  1YUT A;  5AI5 A;  2FJU B;  5EL2 A;  4DQQ A;  5KT4 A;  1KDH A;  9ICR A;  1JRO A;  4I2J A;  1XK4 C;  2R8K A;  3RH4 A;  1ZQO A;  3IG5 A;  4KMU A;  2FMP A;  1MR8 A;  3RFA A;  1ZD4 A;  3M7D A;  1QS7 A;  3H4D A;  1LS8 A;  2B1U A;  4RQM A;  3QU5 A;  1KSO A;  4YR0 A;  2G06 A;  5III A;  2LAN A;  1K1S A;  1GJY A;  2DKX A;  2COL B;  4QJ4 B;  3UMC A;  2KFH A;  3MC1 A;  2EQY A;  1Z1V A;  4O3O A;  4GFT A;  2W9C B;  3MFI A;  3CW2 C;  2RDJ A;  1SSE B;  1OOF A;  1M46 A;  4O3N A;  5ALF A;  4GNK B;  4N1F A;  3I1Y A;  2P6U A;  1BR4 B;  4GPL B;  4UQG A;  1TOP A;  4PHM A;  1S0O A;  3SG5 A;  2HHV A;  5IBW A;  5KG4 A;  2ZN9 A;  2M49 B;  4F4K A;  4HYK A;  1Y0V H;  4DOA A;  3JPR A;  4B9L A;  1X6I A;  1SL8 A;  2W7O A;  1MXE A;  2EAO A;  4UBB A;  5T14 A;  4ED3 A;  3IM1 A;  1IQ3 A;  5AI9 A;  2VA8 A;  1KFD A;  2F33 A;  3AQE A;  1ODB A;  4QZE A;  5HLO A;  2DPI A;  4IC9 A;  4QZI A;  3J81 j;  9ICU A;  3EZ5 A;  1SCM B;  2BCR A;  1ZMZ A;  2ZUD A;  1O03 A;  3PY8 A;  3S0D A;  2IS9 A;  4TUP A;  3TAC B;  5KFK A;  2WC6 A;  4FZN A;  4O5E A;  1NX2 A;  9ICE A;  1OQP A;  1KBU A;  2I2R E;  5GQQ C;  3SIA A;  5AK5 A;  1WDC B;  4QJF B;  2KHV A;  3ZI4 A;  4RQ0 A;  2V4Q A;  2O60 A;  4UAY A;  3PAL A;  5J0W A;  3R1O A;  4FBT A;  4JKT A;  1S0M A;  3CP8 A;  4C8L A;  5ALS A;  4UAV A;  1HEK A;  1VLB A;  8ICE A;  5CRX A;  2ZJA A;  3HRD D;  4UB3 A;  3RB3 A;  4M9N A;  2EC6 B;  1QSS A;  4NL9 A;  1S10 A;  2E1F A;  3IQQ A;  5KTY A;  3Q8S B;  3BOW B;  4B9U A;  1BPY A;  2L5X B;  3WKC A;  5AKH A;  1NX3 A;  2FI1 A;  1A76 A;  1Y88 A;  2ZUC A;  1PUZ A;  2F77 X;  3T3F A;  8ICK A;  1DVI A;  2H61 A;  1BG1 A;  2VJ5 A;  4Q04 A;  9ICJ A;  1F8H A;  4KLF A;  3RTV A;  1DF0 B;  3M9M B;  4IQU A;  2QB0 A;  3C5F A;  4KLO A;  4JWM A;  3NSI A;  3AEV A;  4XUS A;  5G5H A;  4BY4 A;  4QWA A;  5B66 U;  2KG5 A;  1C3Y A;  2ZJ5 A;  1IJ6 A;  2BKH B;  1KEJ A;  4L9M A;  3L5K A;  4A8E A;  3I28 A;  3EVR A;  2HVI A;  2SCP A;  5JRT A;  1ZD5 A;  2KVS A;  3ZDA A;  4R65 A;  7ICR A;  1PK3 A;  2FOT A;  2IOF K;  4RPY A;  4DQR A;  1H4B A;  2FDR A;  4MFA A;  3NXA A;  1X2I A;  4G9B A;  4UBC A;  1DJY A;  2LYH A;  1L7M A;  1X9W A;  4C8O A;  2R2I A;  5F9N A;  4IL6 U;  3EK7 A;  1V1G A;  3LLE A;  4BX9 C;  2CRX A;  3K75 D;  2ZNE A;  2C2D A;  4PGY A;  2JU0 A;  1BPX A;  4C0L A;  4M6W A;  3FWC A;  3KZX A;  2AAO A;  4DCC A;  4RNO A;  1SMG A;  3OJU A;  1FI6 A;  2E5S A;  5ALZ A;  2EH9 A;  2HQ8 A;  2JT0 A;  1BPD A;  5KFB A;  1Z2C B;  3H8W A;  2OH2 A;  2XO7 A;  3LWL A;  4A4C A;  4YVZ A;  8ICU A;  2FMS A;  4NL9 C;  3D0Y A;  1SWV A;  5EE0 A;  5KG5 A;  2ZRS A;  1J97 A;  2KFF A;  4QZG A;  2NCO A;  5DB6 A;  4C8M A;  3DEE A;  4RU9 A;  3VCB A;  1WG8 A;  3K1R B;  1QX5 B;  2K89 A;  3DV9 A;  3E58 A;  4PHK A;  4MSP A;  3IVT A;  4C8N A;  4YQW A;  4GC6 A;  4XJK A;  1G8I A;  2YML A;  8ICF A;  2KSO B;  4RT3 A;  3GIM A;  2KKP A;  5KFE A;  3WK8 A;  5ALU A;  1ZXI A;  2I1Q A;  4KLL A;  3GK2 A;  4DSF A;  4F4Y A;  2KBM A;  5GTI U;  4EYI B;  1J1E A;  5J2B A;  2KVC A;  2QB1 A;  3GDX A;  3PR5 B;  2IMW P;  2D3D A;  1IQ5 A;  1D8L A;  2KI6 C;  4Y2Y A;  2LHI A;  2K8M B;  3SQI A;  4CF5 A;  3B88 A;  2K7D A;  4YMO A;  2CTN A;  2R18 A;  1N0Y A;  1A75 B;  1BJF A;  2XVT A;  3SEI A;  4ECW A;  1NJX A;  4EEN A;  3B87 A;  8ICA A;  1UUR A;  3QUT A;  2WF5 A;  2MAX A;  1S36 A;  1KFU S;  2ZIX B;  4USA A;  2BNX A;  4UAS A;  3CZ1 A;  4ORA B;  2K8A A;  1WCL A;  1DEK A;  1L7P A;  4RQ8 A;  5DLF A;  2I5H A;  1X42 A;  5EWF A;  1ZQH A;  5DDY A;  3RB4 A;  2V4R A;  4KLH A;  2QEO A;  4MZL A;  2I6X A;  3QXG A;  5ALM A;  3QU4 A;  3AMZ A;  4C7Y A;  1N56 A;  3EK4 A;  3TUY B;  2EAP A;  5AXI A;  1N2X A;  4F92 B;  4EBE A;  1RXV A;  3N7P D;  1TV9 A;  4DLG A;  5J0Y A;  3EPI A;  3M6K A;  1FW4 A;  4US8 A;  1J7Q A;  1RG6 A;  1T3Q A;  2AQ0 A;  3PO5 A;  1B7T Z;  5F9L A;  2W9C A;  4DLE A;  3PX4 A;  4DO9 A;  5HHI A;  1JFJ A;  1IWQ A;  3NSK A;  3CS1 A;  4CDG A;  5AFP A;  2HVH A;  1SR6 B;  5AIB A;  2JEG A;  2HOF A;  5KT7 A;  2H2K A;  1YX8 A;  5HMM A;  4GC7 A;  2LM1 A;  3TZ1 A;  1S1E A;  2F2A B;  4DFP A;  3TAD C;  3RJI A;  1B7T Y;  1TIZ A;  3HKZ F;  2H3F A;  1L8O A;  4DFK A;  2CN1 A;  7ICP A;  5BOL A;  8ICY A;  1KCY A;  5L1K A;  4KYN A;  3SG4 A;  2WF7 A;  1KQM C;  3OJS A;  1XNS A;  2YB4 A;  2KPH A;  1UHI A;  2ISO A;  1AQ6 A;  4NDD A;  3RAQ A;  4Z6F A;  2A1A A;  4DL7 A;  1DJH A;  4RQ6 A;  3IV6 A;  3PJI A;  3ICX A;  2E1E A;  5KG6 A;  4FO6 A;  1ZAC A;  2W43 A;  2VKQ A;  3SS4 A;  1TAQ A;  2RQ5 A;  3MGH A;  2WCF A;  3MR6 A;  2ZIU A;  3L47 A;  4M2P A;  3CLN A;  3H0R B;  4ED2 A;  2J6U A;  5ALH A;  2BBM A;  3PST A;  2G9B A;  4QZF A;  4XYN A;  1RK9 A;  3WK9 A;  1FF1 A;  3UMB A;  5ALQ A;  4O0I A;  5C0Y A;  4PT1 A;  5KFO A;  2Y1J A;  1CFD A;  2DUY A;  5DGB A;  1SXE A;  3BOW A;  4YGA A;  4GUK A;  2JNX A;  3BQ1 A;  1OE9 B;  2WF9 A;  4YR3 A;  1EH2 A;  2M7N A;  3UNW A;  3PW7 A;  5D69 A;  1DF0 A;  3NGD A;  2M9G A;  2C22 A;  1XSN A;  2M7L A;  2KFZ A;  3TFR A;  5TIS U;  2VJ4 A;  3R1P A;  1RQL A;  1U49 A;  5KNI A;  4QZA A;  1YX7 A;  2BBN A;  4DL5 A;  1OMV A;  4O3S A;  1LVC D;  2XC9 A;  2KMD A;  5E79 U;  3IG8 A;  2XCP A;  2P35 A;  1NP8 A;  5KT5 A;  3V6H A;  5J0S A;  5J2A A;  4C0J A;  1Y1X A;  5HKY A;  2K7C A;  1LKY A;  4FTG A;  2BEC A;  1QAT A;  1KL9 A;  4YGC B;  1CEZ A;  3PW5 A;  2FLP A;  4EZ9 A;  5DKQ A;  1F4Q A;  2YN4 A;  1XFV O;  3C2M A;  4KN7 A;  4DL2 A;  2MSN A;  4F5O A;  4IRK A;  9ICQ A;  1TNQ A;  4O3P A;  1T4G A;  3NVY A;  2ESE A;  4M47 A;  3F5A A;  5KFT A;  1TVA A;  9ICM A;  2KD1 A;  3B7A A;  2FCE A;  3M8R A;  3F2B A;  1QQ7 A;  2JEF A;  4Y2R A;  1X02 A;  2MA1 A;  2EC6 C;  2M0N A;  4F5N A;  2A4J A;  2WCM A;  5AKJ A;  1KWO C;  4P5O E;  1WRL A;  2ZJ8 A;  2BL0 C;  5KFX A;  3DF0 B;  2GTE A;  3C23 A;  4C4S A;  1ED1 A;  3UXP A;  2ERB A;  1ZQX A;  3PSP A;  1UP5 A;  3S0G A;  4PPX A;  1AVS A;  5DKN A;  3HKZ C;  4I2G A;  2FPL A;  1J55 A;  4RQ3 A;  3I5G C;  4AYB F;  1IM4 A;  1BNP A;  1QCK A;  1P7D A;  3BS7 A;  3QU9 A;  5CWR A;  1WY9 A;  4ED1 A;  1UHK A;  2KSO A;  1RJV A;  3CRX A;  1K90 D;  4B9S A;  5IIK A;  4RQ2 A;  1V97 A;  3CAB A;  3WNX B;  5BPJ A;  2AGO A;  4DFD A;  5KFZ A;  4GGF C;  8ICT A;  3Q8K A;  1ZQN A;  4DSJ A;  4UB5 A;  4KX3 A;  1DJX A;  3BQ2 A;  5ALJ A;  3ZDB A;  3N97 B;  1A75 A;  2JH1 A;  2QEB A;  5EE3 A;  3EUB 2;  3BYA A;  5EOZ A;  3GIK A;  1ZYQ A;  1NI3 A;  2JZB B;  2ZIX A;  4PZN A;  1SL0 A;  4KMO B;  1SY9 A;  2ZFD A;  1QAS A;  2MUT B;  4YMM A;  2PMY A;  4XA5 A;  2M9N A;  3H8J A;  3MR2 A;  2P71 A;  5HYD A;  2YTU A;  1ZRN A;  5IIL A;  2KGB C;  1CMG A;  1S8O A;  5AAN A;  1KN5 A;  1TAM A;  2H3Q A;  5J2D A;  4BJQ A;  2W04 A;  1JXL A;  3SV4 A;  3IP4 B;  1XO5 A;  1PK1 B;  1NX0 A;  3KHL A;  1PVA A;  4NWI A;  5DQG A;  3PZP A;  8ICC A;  1Z19 A;  4BWM A;  3QUC A;  1YVH A;  3DVK A;  3JPP A;  7ICF A;  5J0P A;  4DEZ A;  1JRP A;  4TUQ A;  3HW8 A;  7ICE A;  4J9S A;  1DTL A;  1YRU B;  3BQ3 A;  5DKW A;  5TZV A;  4CRX A;  4IQV A;  4EBD A;  7ICQ A;  5DB9 A;  4O3R A;  4JB3 A;  4P4O A;  4IJ7 A;  1XO1 A;  2R8G A;  3O4X A;  3AAK A;  3GV5 B;  9ICV A;  4C0K A;  1B9A A;  4YXJ A;  3Q8I A;  1SRA A;  3O6B A;  4HRG A;  5AI4 A;  1KQQ A;  1ZQV A;  2KDH A;  3OB2 B;  4LZG A;  2MU2 A;  2JXC A;  1JBA A;  2LC5 A;  1NK0 A;  1P28 A;  1ZQZ A;  3M6Z A;  4O3Q A;  2G0A A;  2KKV A;  5DDM A;  1V1F A;  2LHT A;  2ZTE A;  2WOR A;  1S6C A;  4NLG A;  4UAW A;  1K8U A;  4MF8 A;  2ZUB A;  3JTD C;  2RRD A;  3EKJ A;  9ICN A;  1ZUZ A;  1NK6 A;  5EE1 A;  3OPX A;  8ICS A;  4EEL A;  1TAU A;  1SWW A;  2PFN A;  3UM9 A;  3AKA A;  2BDP A;  1F5S A;  8ICL A;  2DFL A;  3C2L A;  2EGD A;  4LJX A;  3M9O B;  2KHN A;  3PM8 A;  4CCH A;  3PVX A;  2L50 A;  4Y2X A;  3V2L A;  1N60 A;  3NTU A;  5DQH A;  1EG4 A;  1XFU O;  1CFP A;  3C29 A;  2DOQ A;  1PK0 D;  7ICH A;  1DGU A;  1JXE A;  3MBY A;  2NZ0 A;  1DRG A;  2BCX A;  4P0P B;  2A3V A;  3RM1 A;  4RQ4 A;  2P70 A;  4I2I A;  5AKI A;  4F91 B;  1NK5 A;  4I2H A;  2HPS A;  8ICG A;  2MRL A;  3DVE A;  1QXP A;  5ALN A;  1A6S A;  3PAT A;  5KL8 B;  1UHU A;  4KIT B;  4P0Q B;  2P6R A;  3B6X A;  1CLL A;  2ZN8 A;  4M2Y A;  2OTG C;  5C5J A;  1XC9 A;  3EPG A;  4O5C A;  2IOH A;  2JH7 A;  3N4M B;  4N5X A;  3D2S A;  1MC8 A;  1ZQQ A;  4Z6C A;  1ZQA A;  3CZT X;  3AM9 A;  3BS5 B;  3T5L A;  3ZDC A;  1ZQF A;  1FEZ A;  5IIN A;  5DG8 A;  1Q3U A;  3SG2 A;  1PAL A;  1Q80 A;  1SNL A;  2VIX A;  2UVR A;  2BDU A;  1X40 A;  1Q3V A;  3BUM B;  9ICH A;  5AK3 A;  2W7P A;  2AMI A;  1ZQL A;  3HPO A;  2KNJ A;  1GO3 F;  4ZCV A;  5I2Q A;  5DG9 A;  4MRY A;  5EE9 A;  2G07 A;  2R8H A;  1UA1 A;  2GO7 A;  3UQ0 A;  4YD1 A;  3VRN A;  3HT3 A;  5ALV A;  3NHI A;  5J29 A;  1U48 A;  1JFK A;  2UVW A;  4NLC A;  2WCE A;  1FBV A;  3DF0 A;  4DS7 A;  3ETR A;  2BE4 A;  4JD9 A;  1AUI B;  2KAV A;  3NSL A;  2CNP A;  1K1Q A;  3HX4 A;  1NKB A;  4PAL A;  2BQU A;  3OB1 B;  5KT2 A;  2Y5I A;  1MHO A;  2LVK A;  1JF2 A;  3H7I A;  3KHE A;  2XID A;  1D9F A;  2E8N A;  4FFD A;  1QX7 A;  1FO4 A;  2W55 A;  1YTZ C;  2B0C A;  1E8A A;  1FFV A;  2K4E A;  2BCS A;  4M0A A;  2K8B B;  3DD4 A;  5I2L A;  3GK1 A;  1JC2 A;  2V9W A;  2EDU A;  1Q46 A;  3TI0 A;  2VA2 A;  3HX0 A;  4UB1 A;  2A19 A;  3NUQ A;  1CFC A;  2YMQ A;  4MHV A;  1NCX A;  3H8S A;  3EVU A;  4IL1 A;  3IHQ B;  3IF7 A;  1ZQW A;  2BZF A;  1N61 A;  2HHU A;  2G5I B;  1W9Z A;  5J0O A;  4GFJ A;  4Z6E A;  1ARO P;  2LYA A;  4C0Z A;  1KK7 Y;  1YRT B;  1BPE A;  1WYG A;  4ICA A;  3VGO A;  1ORG A;  2JZB A;  5KFH A;  2PRU A;  1DJG A;  2MUT A;  1S3P A;  3CNH A;  4X5V A;  1YR5 A;  2MRD A;  3ISC A;  4NM1 A;  5J0R A;  3L4L A;  4Q8E A;  4DWI A;  2OHF A;  1GM0 A;  3C21 A;  3GII A;  5ALG A;  1S0N A;  2UVV A;  1DK3 A;  3WXA A;  2KI6 D;  3OHA A;  3MFH A;  2QEH A;  1SB3 C;  5KFQ A;  2HF5 A;  1PK1 A;  5L1M A;  1KFX L;  1UPH A;  2K8C B;  2R8J A;  3NS1 A;  2JMG A;  3OHB A;  5AKZ A;  4DL6 A;  4RQ5 A;  3RBD A;  1D8Y A;  1NJY A;  4AP9 A;  1MQ2 A;  3JVT B;  2M1K B;  1OUQ A;  2KLD A;  4F5Q A;  1KK8 C;  4DOC A;  8ICH A;  1N65 A;  4FQO A;  1ZJN A;  4I5N B;  4DFM A;  5AI0 A;  1L7Z A;  2JNF A;  5G08 A;  4R1E A;  1XFY O;  1TK0 A;  3PSF A;  3KZI U;  3LYS A;  3GV7 B;  4A4B A;  2WAQ F;  4ORB B;  3T5K A;  3OHM B;  4EYH B;  1XSP A;  1UWO A;  4QWD A;  5L1J A;  5KFS A;  3D78 A;  1MN8 A;  1QTM A;  2P66 A;  4CFR A;  4CNQ A;  1N5W A;  2KGR A;  4D1E A;  8ICP A;  1K94 A;  1K96 A;  4B9T A;  4Y2T A;  1WRK A;  2K7O A;  3WU2 U;  4B9M A;  3OBV A;  8ICW A;  3PFV A;  1HQV A;  3UO9 A;  1SKS A;  3RJE A;  9ICT A;  1TFR A;  5ALK A;  2FCD A;  3V7K A;  1IG5 A;  4KLU A;  4HAI A;  3JPS A;  1SZH A;  1S9F A;  1YUR A;  3H4S E;  4O5K A;  4KLM A;  4O3M A;  2KI4 C;  5CPV A;  1BLQ A;  3CYM A;  4R63 A;  1TWO A;  2JV3 A;  4ECV A;  5AKY A;  5KFY A;  3I5F B;  2H3I A;  5ALR A;  5AIC A;  3RF9 A;  2NO4 A;  3RJF A;  2J6S A;  1OOJ A;  2IHN A;  3BQ0 A;  2RLT A;  2CPR A;  1WCN A;  3S0E A;  3PV8 A;  1L3V A;  4INX A;  2GH1 A;  1MSW D;  2H61 C;  2HQW A;  2NO5 A;  2BPF A;  5J8Y A;  1C20 A;  4I5J A;  2JZI A;  5K4L A;  1R6P A;  5J0X A;  4OO1 J;  3UMG A;  3EVV A;  1YT3 A;  4BY5 A;  1L2O C;  4DFJ A;  3RJH A;  3H0M B;  1ZQD A;  1DEL A;  1DC1 A;  3PNC A;  5AER A;  1OOI X;  4C4T A;  4P0P A;  1ECW A;  3TS5 C;  4B9V A;  2JTZ A;  5B5E U;  2PMZ F;  5KFR A;  3C28 A;  2XY5 A;  2Y9T A;  3WKB A;  2KAX A;  3UQ2 A;  1CB1 A;  4OJ6 A;  1ALW A;  4F8R A;  3D2N A;  3PML A;  1JI7 A;  1OMR A;  5J2J A;  1M63 B;  4P0Q A;  1OXJ A;  4BWJ A;  2E6W A;  1EJ3 A;  5D4B A;  2K61 A;  3BDP A;  1J2N A;  1S6J A;  4J9O A;  2AXT U;  2L2E A;  3KKA A;  1DJW A;  4YRU A;  3BS5 A;  5ALO A;  3EYZ A;  4IQW A;  1J7P A;  3T5H A;  4GXI A;  1PVR A;  5ALE A;  1QWV A;  1IH0 A;  1QX2 A;  1WLM A;  4I5L B;  8ICZ A;  2HI0 A;  2W9A A;  1F71 A;  1XS9 D;  2WCL A;  2H3V A;  4ZOH C;  4F71 A;  1UHN A;  2LMU A;  2LVI A;  2BCU A;  1JF0 A;  3AKB A;  4KN4 A;  2G5H B;  3QEA Z;  4IR9 A;  4RQ1 A;  2WND A;  3DXL A;  1PVB A;  2ZND A;  1X9S A;  2JT3 A;  3I5I B;  2OS8 C;  1H8B A;  3KD3 A;  3D10 A;  3HWT A;  2KFG A;  3RH6 A;  4FQT A;  2HOQ A;  4YD2 A;  4NLN A;  3BUX B;  1TK5 A;  2W3R A;  1KFS A;  5CHG A;  1NPQ A;  5HKZ A;  5KG7 A;  3HCM A;  2WAQ C;  3SR6 A;  3A4U B;  5AM2 A;  3ICB A;  3V6J A;  1MF8 B;  2GGM A;  4DOB A;  4BDP A;  9ICG A;  3G6X A;  1JWD A;  4YI8 A;  4IR1 A;  4RUC A;  3TDU A;  1QTX A;  4MFF A;  2A1J B;  1L8L A;  2SAS A;  2K60 A;  3QUB A;  3MGV A;  3HIL A;  4OCZ A;  4NQG A;  4MN0 A;  5KFN A;  5BOM A;  1SL2 A;  3BJY A;  1DQE A;  3RRG A;  4FZM A;  1NX1 A;  1B4C A;  4UAZ A;  2M8U A;  2NLN A;  3H4B A;  4FS2 A;  4DSL A;  1DXS A;  4YGB B;  3KKA C;  3I5H C;  2G08 A;  4OR9 B;  4USL A;  3T5J A;  3LWM A;  3ZD9 A;  5H2F U;  1SIJ A;  1NJW A;  4IRD A;  1CM4 A;  1DOQ A;  3ETL A;  3QE9 Y;  4I28 A;  4M9J A;  2BHN A;  1XSL A;  1LA0 A;  5HP4 A;  3FIA A;  2BCV A;  1BT6 A;  3PSI A;  2F2O A;  2P6B B;  3ALR A;  1B8L A;  1XFZ O;  3WHT B;  2AUC A;  4ICB A;  1NCZ A;  7ICT A;  1IG6 A;  5FI7 A;  3RJK A;  1L7O A;  1F70 A;  5AM3 A;  3I76 A;  4U6P A;  1QLN A;  4YG2 A;  4ED7 A;  5JTI A;  3RJG A;  4G3I A;  1H38 A;  1QSL A;  3BXK A;  2PFQ A;  4F2R A;  1QLK A;  5KU1 A;  4F2S A;  7ICS A;  2L0P A;  3BJH A;  1C07 A;  4ED0 A;  1B0X A;  2HBM A;  3WK6 A;  2PMZ C;  2JRZ A;  3SG3 A;  2K4H A;  1HT9 A;  1XWL A;  1DT7 B;  5CSN A;  2EZZ A;  3GIL A;  2Y1I A;  1Z4O A;  3PN7 B;  3OTQ A;  4F4W A;  4MZK A;  3LDA A;  2ES6 A;  2L51 A;  2NRX A;  2ISD A;  1JIH A;  3F53 A;  1A0P A;  1K9K A;  1F54 A;  2HBJ A;  5KG3 A;  2W03 A;  4CID A;  1AJ4 A;  1OW4 A;  1SZP A;  4ED8 A;  3NRZ A;  4EX7 A;  9ICF A;  1CMF A;  5D49 A;  1ZD2 P;  2JUL A;  3BFH A;  4GXK A;  2XI9 A;  1L7N A;  2PFP A;  4RPX A;  2WFA A;  1KSM A;  3K21 A;  3SG6 A;  3D73 A;  4CFQ A;  5L1I A;  5HHH A;  3TKA A;  2JRF A;  3SI8 A;  3O0F A;  4CE6 A;  3MR3 A;  1SCM C;  3AQF A;  1J7R A;  2NRZ A;  3MDA A;  1C3Z A;  1QIV A;  3FYH A;  2YQE A;  3GV8 B;  1RTP 1;  1FIQ A;  1KFU L;  4I2C A;  1MUX A;  7ICN A;  2B6G A;  2HHX A;  1J1D A;  2BE6 A;  4K4I A;  3OX6 A;  4QZD A;  3JPO A;  4RPZ A;  4DS4 A;  1F4O A;  3SG7 A;  4NLK A;  2Y1M A;  3F45 A;  4QJ5 B;  1WDC C;  1BU3 A;  1LVH A;  1XVJ A;  3WK7 A;  1TNW A;  5DB7 A;  1NUB A;  2KFN A;  2I94 A;  4PE1 A;  5KAI U;  5FI2 A;  1NNL A;  2M97 A;  4MF2 A;  3FM9 A;  4ZH4 A;  3E0F A;  1NZB A;  5K89 A;  2YY6 A;  2AGQ A;  4JV1 A;  2Q4T A;  2WC5 A;  4NDB A;  8ICJ A;  3N7R C;  4YBH B;  3BZK A;  2EHB A;  3PW4 A;  2KYF A;  1QJT A;  3N28 A;  3GQC A;  5KT6 A;  2QPT A;  2WF8 A;  3QYP A;  1SL1 A;  2NRV A;  1BGX T;  1TE2 A;  4RT2 A;  4F0Z B;  1LKJ A;  2JPO A;  3SS5 A;  3AU2 A;  4P2H A;  2GV5 A;  5J0U A;  3B9J A;  3PR4 A;  2F8K A;  2Z7J A;  1MQ1 A;  5IIJ A;  3KOO A;  1S26 D;  4YCX A;  2JEJ A;  4LVS A;  3TDI A;  4JWQ A;  2ZTC A;  3F5E A;  1J2M A;  1BR1 B;  2MAZ A;  3H0L B;  1KRP A;  4PHP A;  4I2E A;  2D8N A;  2DGZ A;  1X9X A;  5DBA A;  1SL7 A;  4DSI A;  1SL9 A;  5F3X B;  8ICQ A;  2W9M A;  4PHJ A;  4NV0 A;  1XFW O;  3RB6 A;  1DMO A;  3CGA A;  2Y0S F;  5AKE A;  4WQ2 A;  2VA3 A;  1GQM A;  4M2O A;  1CLM A;  4QNL A;  1J7O A;  4IRC A;  1X6J A;  5KFP A;  3V7L A;  4Y2Q A;  2BPC A;  4UB4 A;  2OPO A;  1SYM A;  3BZC A;  5I2O A;  2OCE A;  2OWO A;  2V53 A;  1R2U A;  2DF4 B;  1S77 D;  3D74 A;  1TNX A;  7ICK A;  3GK4 X;  5ALW A;  2K4I A;  2LM5 A;  5ALL A;  5KG0 A;  1CI4 A;  2KIV A;  2O6K A;  1EXN A;  1X66 A;  5ALT A;  2HHQ A;  1D9D A;  4QW9 A;  1RYR A;  2M29 A;  2WOS A;  4Y2U A;  9ICA A;  5A0L A;  4YFK A;  1QH9 A;  2F8L A;  1RM6 C;  5AM4 A;  5AM1 A;  3AAJ A;  1IXR A;  1CNP A;  9ICP A;  4QZ8 A;  4C7Z A;  2EZX A;  2HHT A;  9ICC A;  2PQL A;  3B0Y A;  2F3Y A;  3VRP A;  9ICI A;  3KO0 A;  4O9M A;  4KLT A;  2A1J A;  2N1R A;  3THV A;  2W54 A;  2LMT A;  3C2K A;  1IIO A;  3CTN A;  5AI8 A;  2CBL A;  2RGI A;  5I94 A;  4B9N A;  3L4A A;  3FDS A;  4NY8 A;  1LA3 A;  3BUO B;  3SAH A;  4CF4 A;  4ECR A;  2F3N A;  5KFL A;  2K0J A;  2KSP A;  2O5G A;  1U5I B;  5KSZ A;  1QV1 A;  4TUS A;  2L98 A;  1XFX O;  5AM0 A;  3RR7 A;  3KTQ A;  2ODG A;  1K9U A;  1WRZ A;  2KV2 A;  4OJ5 A;  5HNK A;  4PGQ A;  3GOF A;  1Z1B A;  1REC A;  3LL8 B;  4OVN F;  1MA7 A;  3WK4 A;  1NK9 A;  1EL4 A;  1UCV A;  1N5X A;  3VRQ A;  1SKT A;  5KFA A;  3MR5 A;  1Y6W A;  3AUO A;  3M1Y A;  2QLT A;  1T7P A;  1KKX A;  4QJ3 B;  2K4P A;  5ER5 A;  2JEI A;  2HW3 A;  3ED5 A;  4ETO A;  2UVU A;  1TTX A;  5DIC A;  4DCK A;  3LVW A;  4QIW F;  1ALV A;  5GTH U;  1NYA A;  4U7C A;  1L3T A;  3PW2 A;  2KLE A;  3LK1 A;  1ZQP A;  5AKL A;  1T3N A;  2PYQ A;  3BFA A;  5BPC A;  4ZCU A;  1ZQY A;  2MLF C;  3SAG A;  3R1V A;  3SIB A;  7ICI A;  3IRU A;  4ECU A;  2HSZ A;  4UAR A;  2K7B A;  3N7S C;  2XY6 A;  3CDN A;  3BUN B;  2LPE A;  2JR5 A;  3D77 A;  4RNM A;  4I2D A;  3K1Z A;  5KT3 A;  3PLF B;  2HMX A;  3FE9 A;  1SR6 C;  4YP3 A;  5DQI A;  9ICO A;  1B22 A;  1F44 A;  4PE4 A;  4UAU A;  3AL0 B;  4BGD A;  1ZJM A;  2Q0Z X;  5G5G A;  2Y0S C;  2KOT A;  1FFU A;  4PE7 A;  1U9L A;  4KTQ A;  4YGD B;  3RH5 A;  1TRF A;  5KFC A;  1W7J B;  4ECS A;  2IHM A;  1BPZ A;  4OZD A;  4OCI A;  1GGZ A;  2OYY A;  1D8B A;  2DQN B;  2NV3 A;  1TK8 A;  4LZD A;  7ICV A;  4XQ8 A;  5DBC A;  5J2F A;  2LMR A;  1KFX S;  1L3U A;  1B43 A;  3AN1 A;  3RRH A;  2E8M A;  4M9L A;  3LCP C;  4F72 A;  1A03 A;  2MLE C;  3PX6 A;  2PKE A;  2WTF A;  2F44 A;  4ECT A;  4MZJ A;  3QUQ A;  7ICM A;  2MBX A;  2FMQ A;  5EWG A;  1K2H A;  4J9L A;  2F8P A;  4JK1 A;  3FWB A;  1IKU A;  3KBB A;  2BKI B;  4OJO A;  1WUD A;  3GU3 A;  4PH5 A;  1LV5 A;  4YGE B;  1XU4 A;  2YMM A;  4ECQ A;  1KQM B;  5KL1 B;  1TKD A;  2LP2 A;  4YN4 A;  4Q45 A;  4Y2S A;  2W8L A;  1ZOL A;  3PW0 A;  1NJZ A;  1TCF A;  5DB8 A;  1SPY A;  4F93 B;  3KF9 A;  3DVJ A;  4ECZ A;  8ICO A;  2KEY A;  1OW5 A;  5AK4 A;  3QX7 A;  3PN7 C;  1K9P A;  2M1U A;  3V72 A;  5HL1 A;  2LNK A;  5FI6 A;  1ZQG A;  4CLN A;  2E8P A;  1ZQE A;  3CZ0 A;  2LCP A;  1XO0 A;  2LLT A;  3BUW B;  4QZH A;  3SYZ A; 
#chains in the Genus database with same CATH homology
 2DKZ A;  2F8K A;  4GBA A;  3KEV A;  1LKY B;  2K4P A;  1V85 A;  3UNW A;  4PZN A;  2DL0 A;  2BNX A;  3SS3 A;  2QAR A;  2Y9T A;  5FI7 A;  2QAR B;  1X9X A;  1DEK A;  2KE7 A;  2QB0 A;  1JI7 A;  2L5Y A;  2KLE A;  2QB0 B;  5F3X B;  5KNI A;  2YTU A;  5JTI A;  1OXJ A;  3IDW A;  2EAM A;  1SGG A;  2KMD A;  1B0X A;  2KG5 A;  3PM2 A;  1PK1 A;  1F0M A;  3KKA A;  2LPE A;  5JU5 A;  1PK1 B;  5L1M A;  1B4F A;  1KW4 A;  3BS5 A;  2EAP A;  4RQM A;  1SV0 C;  3BS5 B;  4RQN A;  1LKY A;  3EG5 B;  5JRT A;  3H8M A;  1DC1 A;  4MEW A;  2ES6 A;  1COK A;  1PK3 A;  2DKX A;  2KLD A;  4I5L B;  1RG6 A;  1Z1V A;  1X40 A;  4I5N B;  2E8O A;  4I5K A;  4IJ7 A;  1Z4H A;  2ESE A;  5D3O A;  2KIV A;  2LMR A;  3O4X A;  3TAD C;  1UQV A;  1X66 A;  1Z2C B;  2E8M A;  4PZO A;  4KYN A;  1WWV A;  2EAO A;  4NL9 C;  3OBV A;  4NJ8 A;  2B6G A;  3UO9 A;  3TAD A;  2F44 A;  1SV0 A;  3K1R B;  2FE9 A;  2K60 A;  2E8N A;  1SXD A;  3IVT A;  5I94 A;  3HIL A;  3TAC B;  3SS4 A;  5FI2 A;  3BS7 A;  4GAO A;  2JV3 A;  2QKQ A;  2YGU A;  2KSO A;  1WWU A;  5J8Y C;  2KSO B;  2F3N A;  2BAP A;  4IS7 A;  1V38 A;  1OW5 A;  4MHV A;  3SEN A;  1DXS A;  3KKA C;  4JKT A;  2QB1 A;  2D3D A;  5HL1 A;  5J8Y A;  2GLE A;  4I5J A;  3BQ7 A;  2D8C A;  2Y9U A;  5FI6 A;  1W9Z A;  2E8P A;  1SV4 A;  1SXE A;  4NL9 A;  3SS5 A;  1UCV A;  1DEL A;  2EAN A;  3SEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...