2K60A

Nmr structure of calcium-loaded stim1 ef-sam
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
GSHMASSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Stromal interaction molecule 1)
publication title Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k60A02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2k60A01
2L5YA 5JRTA 1Z1VA 3SENA 3TADC 2LMRA 2QB1A 2LPEA 1PK1B 2QKQA 4MHVA 2E8MA 2FE9A 5KNIA 3K1RB 1LKYA 1F0MA 2KSOA 4RQNA 2DKXA 3BS5B 1UCVA 1X9XA 1X40A 2QB0A 5JTIA 3TACB 2EAPA 2E8PA 4NL9C 1B0XA 1PK3A 2K60A 2EAOA 4PZNA 2KG5A 2ESEA 5J8YC 2KMDA 2KIVA 3KKAC 3BQ7A 1LKYB 2QARA 2KSOB 3IDWA 2EANA 2F3NA 3TADA 5F3XB 1COKA 1SV0C 1SXEA 4PZOA 2F8KA 1PK1A 4IS7A 1OXJA 1SGGA 2DKZA 5JU5A 1RG6A 1SV4A 3SEIA 2DL0A 2K4PA 2GLEA 1JI7A 3BS5A 2KE7A 4NL9A 2E8NA 1V38A 1X66A 5L1MA 2EAMA 1B4FA 2ES6A 3BS7A 2B6GA 1UQVA 2D8CA 2Y9UA 2QB0B 2E8OA 2JV3A 3HILA 5J8YA 3KKAA 1DXSA 2D3DA 1SXDA 1WWVA 2YTUA 3H8MA 1OW5A 4NJ8A 1WWUA 1KW4A 2Y9TA 1SV0A 4RQMA 2QARB 2F44A 1V85A
chains in the Genus database with same CATH superfamily
3C1YA 2KOTA 4B9TA 2L5YA 1NJZA 3TZ1A 2K7CA 1BPZA 2O5GA 1PVQA 5IIOA 2A4JA 4J9LA 4R8UA 4YD2A 4C4RA 1UA0A 1QXPA 4ECSA 2M9GA 3QNMA 2WAQC 5DBBA 2Q4UA 2QKQA 4Z6CA 3WHTB 1SZPA 2LMUA 3CR2A 3ORYA 4GGFC 9ICIA 7ICVA 1D1OA 1F71A 2KSOA 3ZDAA 1PULA 3I5GC 1DMOA 3PJIA 2TN4A 2E1FA 1QX2A 5ALEA 1YX8A 3RR7A 1JRPA 4GAOA 4DF4A 1TOPA 5ALDA 5KT2A 4DF8A 3PW4A 2WB1C 3FYHA 3N7PD 3D76A 4MEWA 1F8HA 2K61A 2GOLA 3A8RA 4XJKB 5CSIA 1FEZA 1TAUA 4WQ2A 3OX5A 1ZACA 2AGOA 4DL6A 4PHEA 3QU7A 1Q80A 1DT7B 1S3PA 2PMZF 3CWGA 4M9LA 9ICRA 1SR6C 5A0LA 1IJ6A 2NXQA 2KFHA 3S6JA 1K96A 4ZCVA 7ICHA 4GXKA 2XI9A 1F54A 2LC5A 3DEEA 1RYUA 5L1LA 1HUZA 4NV0A 5T14A 8ICNA 4O9MA 1WDCB 5KG2A 3JPOA 4GFTA 2M0RA 4N5XA 1XO5A 1RM6C 4IR1A 2GLEA 4OR9B 1LV5A 5DKNA 3PR5B 3CR4X 3GIJA 4UAUA 1KQMB 3DD4A 4F93B 2ZN8A 5JOLA 4U7CA 2R18A 2PXIA 3DVEA 1TK5A 4PHPA 3FE9A 2IBKA 4KLEA 3HPOA 1WRKA 3LYSA 1XFZO 2FLNA 4YI8A 5J8YA 1NJWA 2XCPA 1UHUA 3NRZA 2W9BA 1IG6A 5FI6A 2JT3A 3TI0A 3CS1A 2JRFA 5KT4A 5KG4A 2I1QA 4Y2XA 3F45A 1WG8A 3NSOA 1NKBA 1IKUA 3GV5B 1AHRA 1RDFA 2ZIVA 4ECVA 1TAMA 9ICEA 1T94A 2NLNA 1EG3A 1PVAA 1X6JA 3TAQA 3C23A 4M47A 2LVIA 4E0DA 1DJGA 1ZQGA 2M49B 1CTRA 2KI4B 2Q91A 3C1VA 2CPRA 3M8RA 3OBVA 1N0YA 2KZZA 4ECZA 1HJPA 2HQWA 1LKYA 2JPOA 4KMOB 2E1EA 3M9MB 1XVJA 2BNXA 3PX6A 1N65A 4Q44A 4RQ7A 3FE8A 5KFRA 4RQ6A 5D49A 5AK3A 2W55A 5ALJA 2P35A 3RLZA 4C8OA 3JTDC 1ED1A 2KAVA 5G08A 2IHMA 1A03A 3EWAA 3V6KA 1QLSA 2LM4A 3TS5B 1W7IB 3NHTA 1Q3UA 4KLSA 4R64A 5DBCA 2ALZA 3CR5X 4RNMA 1ZJNA 4DRWA 1P28A 1ZYQA 3NSLA 1PUZA 2H3FA 1BODA 3QXGA 3IQOA 1ZQXA 3SS4A 2DPJA 2E5SA 3M7DA 7ICIA 2ZNEA 1S77D 2LM1A 3OSPA 9ICGA 3NXAA 2F76X 1N61A 3NVVA 1QX5B 2PQLA 1S6IA 3OJSA 2V4QA 1T7PA 3OHMB 4P5OE 1ZQOA 4R8UB 5KFQA 1J7QA 4NWIA 1M63B 1L3VA 2ZJ8A 7ICEA 5AERA 4KN4A 2JU0A 2PMZC 3VRNA 1L7MA 3KZXA 2AQ0A 4JB3A 1PZNA 2I5HA 4J9RA 5AFPA 1OUQA 4I2GA 2KQYA 2D8CA 3V7JA 2WCLA 4EBDA 1TFRA 2WF9A 4XUSA 4C8LA 3C5FA 1JROA 4QZFA 2C2DA 1TNWA 4YI9A 2HHSA 5FI2A 5TNCA 4F50A 4FTGA 4FQOA 3PZPA 4OJ5A 2YTUA 3CZTX 5J0TA 5ER4X 2LNKA 3G6VA 1QSYA 4YGEB 1NK7A 1S9FA 2NCOA 5J2KA 1UP5A 2HSZA 1KCYA 3DVJA 3GK2A 3H4BA 3FWCA 1Z00B 2BQUA 1UWOA 3MR5A 1ZFSA 2SASA 3GFKB 1CDNA 5AM1A 3TADC 2KGBC 4RQ8A 5AKIA 9ICKA 4GC6A 2HMXA 1NKEA 3F2DA 3N4MB 3SG3A 2LKYA 2XO7A 1KK8B 2E8MA 4B9SA 2JEIA 4P4MA 4F4YA 3A0HU 5KFEA 3LLEA 4FBTA 3BOWA 3H0MB 2IMWP 1XS9D 2B21A 2K7OA 4USAA 1X40A 3MC1A 1T4GA 3HRDD 1DGJA 1SCVA 4ELUA 2EAPA 1CNPA 2JH7A 2GTEA 2WNDA 4NL9C 4GXIA 3I5FC 4DS5A 1SMGA 2ZFDA 1SKWA 2NO5A 1NJXA 4OKHA 2NRWA 3KHGA 2JMGA 3IG8A 3MR3A 5KFSA 5B66U 3RH4A 8ICGA 1QVIY 3ZDCA 1TIZA 2W9BB 2QEVA 3OGNA 3QMEA 1OOJA 1SB3C 3AAJA 3PATA 5J2FA 2QARA 2KJ9A 3MDAA 5AI6A 4QJ4B 3HT3A 1DJHA 4JUZA 2F3NA 2MRLA 3B88A 2G9BA 2GGZA 3Q8RB 1DOQA 4AOMA 4XYNA 5KFCA 5DKRA 2L2EA 4NLKA 1NK5A 1RYRA 8ICJA 2OYYA 2H61C 4CFQA 5KG1A 2RQ5A 5CHGA 5AKKA 3ZDDA 1Y0VH 2HVIA 3TQ1A 2GWSA 5BPJA 2M0NA 4EENA 1IQ3A 1OQPA 5KTYA 4YGDB 1CLMA 1H8BA 4PT1A 2LAPA 3KHLA 4EYHB 3R1VA 1KFSA 4EZ9A 4I5JA 2COLB 5HYDA 2Y9UA 4F5NA 4I5LB 5KG7A 8ICEA 3SV4A 4RQ1A 5TISU 4XQ8A 3VROA 4C7ZA 1BF5A 4IQUA 3EG5B 1F5SA 4C4TA 1U45A 3J81j 3ZI4A 4M9GA 2FMQA 2VJ5A 3KHEA 9ICOA 2W9MA 2MLFC 3PR4A 3T79A 3GIMA 3ISDA 2WC8A 1O03A 1Q8KA 5KFIA 5AI9A 1A75B 2DQNB 3PLFB 1ZQTA 3D6JA 5D4BA 1K5OA 3KPXA 1BVSA 4Y2VA 1BJFA 3GILA 3GIKA 4F0ZB 5I8NA 2LPEA 5KFFA 4OZDA 2KTQA 3IRUA 1G4YR 1NX0A 1WYGA 2YMMA 3WK4A 1N48A 1BU3A 2XGQA 2HOFA 5KFMA 1ZQIA 3O2PA 1ZQUA 3E58A 1ZJMA 1NCZA 4OCZA 4F4KA 5ALMA 5K4LA 2QB0A 3DVKA 4NLNA 1QATA 1YUTA 2YMPA 3WXAA 1SSEB 2OS8C 2NRTA 1M31A 4I2JA 3BFBA 4MVFA 2DPIA 4PGYA 4MSPA 4YR2A 3CZ0A 2ESEA 1S6CA 1MF8B 1VDVA 1L3TA 1ZQAA 5ALHA 5KG5A 2HHXA 4F5RA 4IRDA 4Y2SA 1J7RA 2XGPA 4JMUA 2ZRSA 4QZEA 3IDWA 3RZSA 2QPTA 2HHQA 2OTGB 4Y2YA 3OPXA 4J03A 3TDIA 2JZBA 5HMLA 4YN4A 3IM1A 4YRUA 2G07A 3T5JA 2W3RA 4BX9C 4DFDA 1RK9A 1CM4A 3I5HB 2PI5A 1SV4A 4EELA 1U4BA 5IIJA 4DS7A 5CWRA 5ALFA 3GIIA 1OZOA 5IINA 2Y5IA 1SNLA 2LANA 5CPVA 2F8LA 1DGSA 4FS2A 3PX4A 2F2PA 1RYSA 2UVVA 3I28A 1ZQLA 2E8NA 7ICNA 3MDCA 3BFHA 3PO4A 1A2XA 1MR8A 3BOWB 3RRGA 4UPGA 1COOA 1EXNA 1CMGA 1U5IB 1NIWA 4MZLA 1U48A 3HILA 2BKEA 1FBVA 4KX3A 1ALVA 2PFQA 2Y1MA 2KFZA 1IQ5A 1SW8A 2NRXA 1T8EA 1SKSA 3V2LA 4F5QA 5I2OA 3AL0B 8ICVA 2FCEA 2OPOA 2ZRTA 2WC5A 2VA3A 1SL2A 3I5IC 9ICFA 1MXLC 1SV0A 2ISPA 2QARB 3T5LA 2CT9A 8ICIA 3BUWB 1T3QA 1NSHA 4HRHA 4I2BA 1XFWO 4XJKA 1TK8A 1S5LU 4NLCA 3PSTA 5J3XA 4UQGA 1IIPA 2QB1A 3ONNA 4JV2A 1N2DA 5AXIA 3UMBA 4P2YB 4DSKA 1S8OA 1L3UA 5J2EA 5GQQC 2HBKA 2BCQA 1KWOC 2Y4QA 5AM3A 4YD1A 2AGPA 3RBDA 1BR4B 5BOLA 2WCEA 5JTIA 1RJVA 2KBIA 3D78A 3D2SA 3WHUB 3L47A 9ICAA 1FIQA 3BJYA 3PMNA 3CYZA 3VCBA 2A1AA 3ZDBA 3BJHA 4PZNA 1NZBA 2LHLA 3ZD8A 1ZMZA 8ICWA 4KTQA 2KIVA 1DJZA 2YN4A 5PALA 3ZWHA 2M1UA 1ZQ1C 1PSBA 4F8RA 2P6BB 2W43A 3WKCA 2J6SA 5CJ7A 1JIHA 3C29A 3JPRA 1KFUS 2Y1NA 2F1HA 2KK0A 4IL1A 3EYZA 4FE3A 4ECUA 2ZG6A 1K94A 2HHUA 1XK4A 1U49A 1IG5A 3L5KA 3TARA 5AM5A 2EH9A 3E3RA 5KFVA 4MRYA 5FP0A 5CB1A 2K8CB 3E2EA 3L3FX 4PHDA 4IQVA 4DFJA 3KBBA 3GU3A 1C7YA 9ICUA 4GNKB 2JZIA 5DKQA 2Z7JA 1ZQMA 2ASLA 2BCUA 2N1RA 4RPZA 2OWOA 3K75D 1QLKA 5HR6A 1TN4A 2QB0B 2PALA 2PFPA 1UT5A 3SG6A 2W04A 4FQTA 5EWGA 1DXSA 5KFAA 4TURA 3C28A 1SWWA 4MF8A 1L2OC 3BUXB 8ICKA 1B9AA 9ICSA 1JBAA 5DICA 2XY5A 2VANA 3DY9A 2RRDA 2KV2A 3WKBA 2HHTA 1K9KA 3JTDB 2F44A 2IOHA 5DDYA 2LLUA 4I2AA 2OEHA 1RWYA 3UMCA 1RZTA 4YMMA 5JRTA 8ICPA 1GO3F 4B9UA 2R8HA 2LUXA 2JZBB 4OV2A 4YBHB 3M8SA 4AQJA 1LINA 2HQ8A 1J7PA 3Q8QB 3EK4A 1NUBA 4Y2UA 1YZ7A 4B9NA 4K4IA 2HBMA 4CIDA 1MWNA 1K9UA 1AQ6A 3NGVA 2L0PA 2BHNA 2HOIA 1ODBA 5DB9A 5KG3A 4J9QA 3I1YA 3B87A 3HWTA 1UHHA 5KFPA 2JT8A 2RDJA 2OHFA 3NVZA 4ECQA 3Q8MA 4TUSA 1XSLA 1L8LA 4YMNA 2JXJA 4FO6A 1BPXA 1KK7Z 3FIAA 2KAXA 1B43A 2G09A 5DGAA 3RRHA 2AHOB 4FS1A 5CEHA 3R1PA 2LHIA 4C0KA 2GO7A 5J2AA 2R8JA 1GGWA 2ZJ5A 1FO4A 4JV0A 1IWQA 4I28A 2L98A 1T3NA 1F55A 1V9PA 3TFRA 1KRPA 5HR7A 2FLLA 2FCDA 4PHJA 3BQ7A 5J29A 1WRZA 9ICTA 4C8NA 1X9MA 4IJ7A 5KFUA 2NCPA 4NXZA 5ALKA 4P0QA 1RTP1 2JNXA 1XFXO 3KF9A 3CABA 3EVRA 2MAXA 3OHBA 9ICHA 3N7SC 2ATLA 5J2GA 2KHQA 3KOOA 4DLEA 1PK0D 4O3NA 3N7HA 3BZCA 2LI6A 2C2RA 4NY8A 2LE9B 4ED7A 4P4PA 3SEIA 2K4PA 1TKDA 3V72A 4JPZB 2KVCA 1JI7A 3QZ7A 2DUYA 1QSSA 3NTUA 2R2IA 2PVBA 3BXKA 1D9DA 5D69A 3LK9A 4C7YA 2UVWA 3N7RC 3RBEA 1Y1AA 3VB1A 3H8SA 1Z00A 5ALGA 2EAMA 1MXEA 1B4FA 4HRGA 5KFHA 1UQVA 3VRPA 2E8OA 1D8BA 3GK4X 7ICGA 3DXLA 1ORGA 3D75A 1LVCD 5ALZA 2XICA 2JC2A 2QLTA 3K4GA 2K8AA 3KZIU 3OGUA 1S5GZ 2MRDA 4N1FA 1OW5A 1TK0A 4QZ8A 3K21A 2G2BA 5HHIA 4PE7A 2P71A 3DYEA 1D8LA 3Q8PB 3PSPA 3B86A 3AQFA 1QCKA 1R6PA 3BUMB 1ZQPA 1VJ5A 1ZQVA 1J1DA 2Y0SF 4JWMA 3I5FB 4UBBA 5EWEA 1TCFA 1F4OA 2CNPA 3GK1A 4CGZA 1Z1VA 1A77A 2ISDA 1XO0A 1JUOA 1YRTB 5I2QA 4N1GA 4KX5A 1CEZA 2H3QA 5IIMA 4LJXA 2BGWA 4I5KA 3H40A 4PGQA 5L1IA 1BGXT 2FE9A 3JPNA 2BKIB 3VRRA 1GGZA 4RUCA 3MFHA 3IP4B 2HCFA 4X5VA 4YXMA 1JF2A 5KFGA 4QZDA 2AMIA 3L4AA 4O3RA 4I27A 7ICSA 4A4BA 1CUKA 1XFUO 2LCPA 4GPLB 5AI4A 3MR6A 4WRIA 4CDGA 1A0PA 4QW8A 4Z6EA 3EPIA 2C22A 1ZOTB 2IA6A 1QX7A 1K2HA 2KKVA 1QIWA 1QWVA 2BCVA 1VLBA 1BT6A 1VRKA 4O0IA 1YZ6A 7ICQA 3N28A 2PASA 2YB4A 1CDLA 1M45A 1CI4A 3MABA 5J0XA 4U8DA 2ASDA 4O5EA 1L7ZA 2DOQA 3BUOB 2CXYA 3NVWA 5CRXA 3M9OB 5DB6A 1WLZA 3JVTC 3KO0A 2WCMA 1XA5A 4I29A 3VC8A 5HLOA 1NK6A 1Z4OA 4DQSA 2UVRA 2KICA 2LYHA 8ICMA 1K8UA 4F4ZA 2FLPA 2LM5A 1U9LA 4HYKA 3SYZA 4CPVA 2DBYA 3LDAA 4BGDA 4CRXA 1JWDA 1DC1A 4CF5A 1IH0A 4C0LA 2LUCA 3PW2A 2E6WA 4Y2QA 2WCKA 2FOTA 2NYVA 4QWEA 1A75A 2WFAA 1CM1A 1X66A 1MA7A 1SL9A 2BBMA 1NOMA 3AMZA 1ZQYA 2LP3A 3EVUA 4F3OA 3BS7A 4R1EA 4DIRA 1ZQFA 2I2RE 2FMSA 2MLEC 1AROP 4INWA 4NQGA 1KL9A 1ZQEA 4QJ3B 2HHVA 1DJWA 1C20A 5ALVA 4ICBA 1KW4A 1S0VA 2BQ3A 2DF4B 4PPXA 1XSNA 4B9LA 4HAIA 1HEKA 1K90D 3ETLA 1UHKA 4YG2A 2ZTCA 2L50A 2OS8B 2QEOA 1BR1B 4P0QB 3PN7C 3SENA 4BWMA 4BXOA 4O3OA 4KITB 3RJGA 1K1SA 5IILA 2K4IA 2JEJA 3WK6A 5C5JA 3S0DA 2KSPA 4GUKA 2WF7A 4L9MA 4JV1A 2VIXA 3NVYA 2MUTA 2KYFA 3TUYB 2G5HB 5D7FA 2Y0SC 7ICUA 1QTXA 1UCVA 4OJLA 1YVHA 5CSJA 1AVSA 4UW9A 2W9AA 2IS9A 4M0AA 3C2MA 4MN0A 3TACB 2C28A 2ZKMX 1C7VA 2LP2A 4PHKA 3FDSA 1RXVA 3BQ1A 1J55A 4IRCA 2AQ4A 1QQ5A 2EAOA 5KFLA 4C0JA 1FF1A 1MN8A 5HKWA 3KKAC 8ICYA 3BFAA 1KFXL 2Y1JA 1QSLA 5KTQA 2DFLA 2PRUA 3D73A 2G06A 2W54A 4UAYA 2KFFA 4RPXA 2O60A 4RT2A 4KN7A 1RECA 3FC4A 1U5IA 1DJYA 2OH2A 2KHNA 3AKAA 1RQNA 2OXOA 9ICBA 1KFTA 4PZOA 4GGFA 2FMPA 2FPMA 2WCBA 3O78A 3S0GA 1RG6A 5DB8A 5DLGA 2LMVA 3MBYA 4QWCA 2QACA 4U6PA 3I5IB 3BQTA 4B9MA 3BS5A 1QIVA 1MQ3A 2HVHA 2Q4TA 4F4XA 1TNPA 3OJUA 1KQMC 1S76D 4PJ0U 2YB1A 2V9WA 1F44A 1CLBA 1G33A 4PHNA 3B0XA 1X9SA 2CBLA 4TUQA 5J2IA 4F2RA 1WCNA 3K1EA 5AM4A 4ECXA 1K95A 3D77A 1LA3A 4JD9A 1S26D 4BDPA 1IJ5A 4YMOA 4KLIA 2KEYA 5AKHA 5KL8B 4DS4A 1KWOB 2I94A 1C07A 1ZQQA 2XC9A 2MU2A 2CCMA 4DQIA 3BUNB 3HX0A 2KJ8A 3RJHA 8ICHA 4PE1A 5KG0A 4OVNF 7ICLA 4FZLA 1N5WA 2L2CA 3M9NB 5AANA 4IQWA 4DOAA 4PH5A 1L8OA 2J6UA 8ICAA 3SI8A 2Y1IA 3LVVA 2AH5A 3TDZA 4PL1A 2NO4A 5AEQA 2LVJA 3MGHA 2A1JA 3FM9A 3FWBA 2KI4C 2K89A 2CTNA 1DJIA 8ICRA 2FJUB 2DKXA 3SAFA 1ZOLA 4QZCA 5DLFA 3KFUF 1YUSA 3OB2B 4ZH4A 3IG5A 2GH1A 3RJEA 2BZFA 2K4EA 2F2OA 5ALQA 2FJYA 1L7OA 4UB8U 1KTQA 4F92B 1KEJA 2QEHA 3T3FA 3IQQA 2KD1A 5J0SA 1SKRA 1SL7A 2K60A 2L4IA 3HX4A 3TS5C 1DELA 2D8NA 1TRFA 3UPQA 2KMDA 1CFCA 4YGCB 1ZQHA 5L9XA 4NDBA 1C3ZA 3S0BA 4Y2RA 2XCAA 4DL7A 1YVLA 1LB2B 4Q8EA 3GV8B 4KYNA 1PRWA 3KEVA 1DTLA 2M9NA 1NJYA 4Q45A 1K9PA 1OXJA 3SAGA 4BXOB 9ICMA 3AN1A 3CGAA 3EK8A 3SG5A 2WF6A 4RPYA 4F4WA 2YY6A 1Y1UA 4CLNA 1B8CA 4DL2A 4J9NA 1SKTA 3G6XA 2F33A 2MUTB 4ECYA 2ZIXB 1MUXA 2M8UA 3NHIA 3JPQA 1CRXA 2M29A 3FS7A 5ALYA 4DLGA 3QU4A 5F9NA 2B1UA 1FW4A 1ZD5A 8ICTA 2ES6A 4YQWA 4RQ2A 4F5PA 1ECWA 3T5HA 2D6FC 4JWNA 4GLXA 1L7PA 2E3TA 2KFNA 4M6WB 3V6JA 1V97A 1JMSA 1B8RA 5KFWA 1UUSA 1NK4A 2D3DA 2WHEA 1N56A 2FJ6A 1BPEA 2K2AA 2V4RA 3D10A 5I2LA 2FPKA 4RZRA 1JUDA 3O0FA 4US8A 3B6XA 9ICJA 5AKJA 2JEFA 4AP9A 2DWQA 1Y1XA 2KAYA 1OZSA 2IOFA 4JQ0D 5KFZA 3ICBA 5ALPA 3M0WA 5J0QA 1KDHA 2RHFA 3Q8SB 3PV8A 4QZHA 1H4BA 4KLLA 4KLQA 3I5GB 1KSMA 2W8KA 3BS5B 5J0RA 3JPTA 3EKJA 4PE0A 1M39A 1X9XA 5AHXA 1OMDA 4ELVA 1YR5A 1TVAA 1NI3A 5F6TA 1J2MA 3B0YA 2JRZA 1NCYA 2A3VA 5CSFA 4E68A 3QX7A 2G0AA 1SK6D 3IVTA 4JWQA 4K4HA 2LLSA 3O6BA 4ED3A 2R8IA 2OCEA 1KFDA 2WCJA 2ZIWB 5J8YC 1BG1A 3H0RB 1SR6B 4NM2A 4IR9A 4M2PA 1B7TZ 1ZQZA 5AM0A 1LS8A 1S6JA 3RB4A 3NRWA 1S0NA 3O4XA 4QZIA 4G9BA 5KSZA 4OJPA 3TADA 5F3XB 2WORA 1RQLA 1Z1BA 4C0ZA 1UHJA 2K0JA 3R9KA 5KFDA 4ED1A 3CNHA 4DSIA 1CFPA 2IHNA 2O6KA 2KFGA 5IIKA 2AXTU 3AUOA 8ICOA 1K93D 5KU1A 1H38A 4ED0A 4RQ5A 2EC6C 1S1EA 1TUZA 2A1JB 4UARA 1ZQCA 3GZFA 1LVHA 2ZXHA 2M97A 5HKZA 4OJ6A 4NL9A 1CLLA 4YGAA 3MSEB 3PFVA 3LK1A 4WJ3B 2KJ5A 4USLA 3SG4A 1WUDA 1JSAA 2B6GA 2ZNDA 1Z19A 3ZD9A 3EPGA 2XY6A 3EUB2 4NM1A 4I2CA 4Q43A 3T5KA 2GV5A 3QEBZ 4CF4A 5AK5A 3A4UB 3SQIA 2W9CB 3SS3A 1KK7Y 4LVSA 4WQ3A 3UXPA 4PCWA 2HBLA 2WC6A 1HIWA 1XO1A 3RR8A 5ALTA 4PL2A 4QZBA 4J9KA 5AKXA 1TE2A 2Y9TA 4YVZA 2LVKA 2MBXA 2HW3A 2ZUCA 4B6JA 3UQ0A 4RQMA 5ALNA 3RJIA 9ICCA 2P70A 2M1KB 4ECRA 3DVMA 3CYMA 3QU9A 2H61A 2JT0A 2LV7A 2WOSA 1QLNA 4MFFA 3TANA 3QE9Y 3DF0B 9ICXA 3WKDA 5ER5A 2HETA 1S0MA 2L4HA 2WCHA 4EX6A 5HKYA 2BECA 2KP7A 3K1RB 1F0MA 3V6HA 5AI5A 4QZAA 3JVTB 1A6SA 1ZQWA 4JKTA 1BNOA 3HJEA 1SRAA 5E79U 1OOHA 2C2EA 9ICLA 3EK7A 4YR3A 3SG2A 2E8PA 3LVWA 5DQIA 4GXJA 4FBUA 1M6YA 1B0XA 2PYQA 1GJYA 4YCXA 1AJ4A 4QZGA 2R8GA 2R8KA 3RM1A 2RP5A 4PHAA 1X9WA 2FPLA 3KD3A 2Q0ZX 2ZN9A 2AUCA 3SMVA 3JPSA 3B7AA 3LWMA 1KKXA 4PDZA 3NSKA 4US9A 2H3VA 1B8LA 4XA5A 8ICFA 3MFIA 2EANA 2JEGA 2I18A 1EL4A 2BCAA 3PSRA 1SBJA 1BNPA 2KLDA 5DB7A 8ICQA 4OJOA 4ICAA 3PALA 4KLGA 1OE9B 5KFOA 1PK1A 5J0UA 4DOBA 1LKJA 4Y2JA 1XNSA 1SGGA 2NRVA 5HMMA 1V1FA 2G5IB 5GTIU 2I7AA 2KGRA 1QV1A 4OCIA 4DQQA 2JXCA 4I2EA 3LK0A 5AK6A 1M46A 2EZZA 2HBJA 1IV8A 1QS7A 2V53A 3WNXB 1NWDA 7ICKA 3QUBA 1OOIX 2RLTA 3PX0A 2JH1A 5C0YA 4D1EA 4UBCA 1KQQA 5AIBA 1OMRA 2KVSA 3QYPA 2RDIA 4RQ0A 4UB1A 2MAZA 3ED5A 2I9GA 1JFKA 2BDPA 4CFRA 4M2YA 3B9JA 5KAIU 2KZ3A 1JFJA 1HT9A 1IRJA 2CRXA 4Q8FA 1J1EA 1BPYA 4P2HA 3UNWA 1S10A 5KFBA 2CXJA 5L1JA 3OTQA 2F1JA 1IGVA 2YX8A 1KLNA 2W8LA 4QWBA 5ALRA 2XY7A 1UURA 2NZ0A 5J0PA 3AKBA 5AKZA 3F2CA 3H8WA 2DGZA 3SIAA 2ZTEA 3A0BU 1UA1A 1LA0A 3LL8B 2FDRA 2G08A 1L3SA 2HPSA 1YT3A 3N97B 4UB6U 4EX7A 5J2DA 1NX2A 2IOFK 5BPCA 3SV3A 1ZQDA 2KOBA 4ACOA 4OD0A 3Q8KA 3CZ1A 3PW7A 1DF0A 3IF7A 3O4YA 3GV7B 5AM2A 4K4GA 5KG6A 2KNJA 2YMLA 3D0YB 5B8IB 4RNOA 2B0CA 5HNKA 1QH9A 3CTNA 4ORBB 2PFOA 4I2FA 1N62A 3RH6A 2ISOA 1KBUA 1JN3A 5TZVA 2MJWB 4DFPA 4B9VA 1N5XA 1FFVA 4O5KA 3UMGA 4QWDA 3CW2C 3RFAA 4MEXA 3ZNIA 2JR5A 4MZKA 5K89A 2BCBA 1N60A 3QZ8A 2QEBA 4EEYA 1IIOA 3VRQA 4YFKA 2M3WA 5EE1A 3F53A 4AYBF 2AJQA 3HW8A 4CNQA 3CRXA 4FZNA 2EZXA 4BUGA 1W9ZA 1MQ1A 1SPYA 3H7IA 2KIWA 1Z2CB 5KT7A 1DRGA 2BQRA 1PVRA 1L5UA 4J9MA 1BLQA 5EE0A 3UM9A 2HI0A 3WK5A 2ODGA 2MSNA 4YXJA 2AGQA 1ZQBA 1X02A 2KBMA 4AQIA 3C2LA 3ISCA 1S0OA 3FE6A 1CMFA 1P7DA 5L1MA 2ERBA 4MZJA 2JHDA 5ALUA 3BQ0A 1UHIA 5J2JA 4O3QA 3C21A 4J9OA 2KYCA 4GIBA 2ZJAA 2SCPA 2ZIUA 3UO9A 1D8YA 1S36A 3EZ5A 4KLTA 1C3YA 5HLVA 2H3IA 5AKGA 2BL0C 3UXNA 1URJA 1L6NA 3PY8A 4NJ8A 1ZD2P 2LHTA 4P4OA 4RQ4A 4KLJA 3ZDEA 1G8IA 5AK4A 8ICXA 4GBAA 1CDMA 2JGAA 2L5XB 2M7LA 7ICOA 2FI1A 1SCMC 3OSNA 4P0PA 4NLBA 4G3IA 2MA2A 3OB1B 1ZETA 4DO9A 3NASA 4RU9A 3RAXA 1NK0A 3PMLA 4O3PA 2LVVA 4Y2PA 1KSOA 1FI6A 1JALA 1PK1B 4A4CA 5FYXA 1E8AA 4PGXA 1DQEA 1PALA 5KAFU 1YX7A 4BY5A 1OMVA 4QW9A 7ICJA 3UQ2A 2MHHA 1XFVO 2OM6A 7ICFA 1DK2A 1BMOA 1NX3A 4DSLA 2WF8A 1YRUB 3DDHA 4RQ3A 2BPCA 1SY9A 5AKEA 4KLMA 3C1ZA 5G5HA 2UVUA 2NV3A 2NRZA 4QIWF 1QQ6A 1XFRA 2KHVA 3PO5A 3M1YA 1DVIA 3CDNA 2PI4A 3KHHA 2KG5A 2W7OA 3RJJA 2ZIXA 2KZMA 2BCXA 3C5GA 2ZUDA 2KSOB 1T14A 4YR0A 1RROA 7ICRA 3QUTA 2BPGA 1TNXA 4I5NB 1COKA 5ALLA 1NYAA 1SV0C 3PSFA 3ETRA 2W7PA 5JJGA 1SXEA 2PKEA 4CF3A 3CZ2A 4M6WA 4ORCB 3TKAA 1KSPA 2H3ZA 2WF5A 1CB1A 5GTHU 3GOFA 2DL0A 3K1ZA 2LYBA 4YP3A 8ICSA 1FPWA 1EG4A 1PVBA 4LZDA 4DL5A 2KN7A 1NP8A 1SL8A 1GM0A 1DF0B 2ASJA 4AYBC 9ICVA 1B22A 4C8MA 1SL0A 3S0AA 2K2FA 2KKPA 4KLUA 3EKHA 4ECWA 2YGUA 2BE6A 2JTZA 4UAVA 4FFDA 4MBEA 2JV3A 2VKQA 3I76A 3GDXA 3LCPC 4R63A 2ZUBA 2LLTA 4TUPA 5B5EU 2HF5A 1SXDA 3G6YA 4ED8A 1Z4HA 1CFFA 1JC2A 4M9NA 4XRHA 1Q46A 1WDCC 2YQEA 3NS1A 1XWLA 4R66A 4UAZA 3FAHA 4ECTA 2K8BB 1AUIB 1V85A 4FZMA 2A19A 1EH2A 3NGDA 1DK3A 3Q8IA 5KT3A 3RH5A 3RB3A 4GC7A 1QASA 4EBEA 9ICWA 4DL4A 1RPLA 2ZIWA 4MHVA 4UAWA 5EWFA 1XK4C 5HL1A 2PFNA 3HKZF 1CKKA 4QZ9A 4O3SA 1A4PA 1Z4NA 9ICPA 4UASA 2LYAA 9ICQA 1CDPA 2EHBA 2J6TA 4MEYA 2ZIVB 2HHWA 3RAQA 1NCXA 4QWAA 5ALIA 2LBOA 2MA1A 4GFJA 4DQPA 4JK1A 3SS5A 5AICA 1PK3A 2W11A 2EC6B 3RF9A 2ZIUB 1SL1A 4F72A 3BQ3A 4HREE 1L7NA 1K1QA 3RB0A 2JOJA 3KTQA 3NSIA 4F5OA 5DBAA 1LKYB 2F3YA 4ZCUA 2K7DA 3RTVA 1B1GA 5F9LA 1TNQA 2RGIA 1EJ3A 1WY9A 3ICXA 4F2SA 1JX4A 4RUAA 4UB2A 1UHNA 4MLWA 4MFAA 3AAKA 4QIWC 4P0PB 4EBCA 1QV0A 2ZXIA 4LZGA 3PM2A 3MGIA 2F8KA 4DUQA 4R65A 2EQYA 8ICBA 2W9CA 3TAPA 1RXWA 3AU2A 5DQGA 4QJFB 1TAQA 1NZPA 2JXLA 4BWJA 1A76A 5KFXA 2VJ4A 3BZKA 3HP6A 2ZTDA 2WCFA 1A29A 1BOCA 1TTXA 3BDPA 4ED2A 2F1IA 7ICTA 1JF0A 2KE7A 1KFXS 1U47A 1X6IA 5AKLA 2KI6C 1Y88A 5D46A 2L51A 4UATA 1V38A 1DGVA 5BOMA 5CSNA 2P6RA 5EE3A 4QNLA 3H4DA 3QUQA 1TUJA 5J2HA 5AI0A 3DF0A 3IN5A 1QVIZ 2KPHA 1X2IA 3BQ2A 1D9FA 2JWWA 1ZQNA 1L2OB 5DG9A 1XU4A 1J97A 1WWVA 1Y6WA 5HHHA 5KFNA 1AJ5A 4PE4A 1KQVA 1RFJA 5H2FU 4DEZA 3TFSA 4PALA 4BJQA 3WK7A 4O3MA 3AQEA 1ZQKA 4NLGA 1NK9A 1R2UA 4ORAB 2AU0A 3QEAZ 1ZRMA 1B7TY 1SIJA 4UB4A 1V1GA 4M2OA 3QU2A 2JPTA 4ZOHC 4QJ5B 5CA7A 8ICCA 2LMRA 2VA2A 3U26A 1MSWD 5D3OA 4DFKA 4TQSA 3HCMA 4TQRA 4Y2TA 4OO1J 4MFCA 2JTTA 3NUQA 4DSEA 5J0WA 2XVTA 5KNIA 3PNCA 4DSJA 2VA8A 5JUMA 3CLNA 4NDCA 5EL2A 4C80A 2BE4A 1ZQSA 3TUYC 2BPFA 4KLHA 1UPHA 3VGOA 4EYIB 3E0FA 1KFUL 3D74A 1EXRA 2PSRA 1PVPA 1SWVA 1X42A 1NNLA 5HP4A 1MQ2A 2VRGA 2M7NA 2P6UA 4PHMA 4ED6A 8ICLA 2AAOA 5KFJA 1LXFC 3OHAA 3R1OA 4M9JA 5IIIA 5FI7A 2W3SA 1BPBA 3HKZC 4Z6DA 3V7KA 5DGBA 4F91B 9ICNA 1GQMA 1KK8C 1MHOA 1ZXIA 3M6KA 1HQVA 3QRXA 1N63A 3R72A 3IV6A 1JXLA 5CR0A 4DCCA 1BPDA 3DV9A 3SAHA 7ICMA 7ICPA 3PM8A 4M2QA 2CN1A 1FFUA 5ALXA 3PW5A 4DCKA 4IS7A 4ETOA 1QTMA 1ZRNA 1HUOA 3L4LA 2HOQA 2DKZA 5DKWA 1C7WA 1DGUA 5I94A 3UXOA 1WLMA 4DOCA 2KNEA 3OX6A 2F8PA 3SJSA 3RB6A 1NK8A 2K4HA 4KMUA 4MF2A 2BBNA 1IXRA 2F77X 3Q8LA 2BR0A 5DQHA 3MR2A 3DZTA 5KFTA 4RT3A 4CE6A 2K7BA 2P66A 3BYAA 3CP8A 1NKCA 4IC9A 1DJXA 2PMYA 1XYDA 3S0EA 3H0LB 1S97A 1ZQJA 4C8KA 4F7FA 4F71A 3KKAA 3ISBA 4DWIA 4NLZA 5J2CA 4I2HA 4I2DA 1DEKA 1TCOB 2WAQF 5KFKA 3H8MA 1ZD3A 2F2AB 2KQ6A 1Q3VA 1AK8A 1YTZC 2I6XA 1UT8A 3THVA 2QDIA 3OP0A 4MRXA 3D0YA 5KL1B 4BY4A 5G5GA 5J0OA 2K8MB 3WK9A 5KFYA 4KLFA 3WU2U 3GQCA 4INXA 1KN5A 4YGBB 3WKEA 3SZ2A 1OOGA 2WB1F 2BKHB 5ALOA 4O5CA 3PW0A 1J2NA 3M6ZA 1OSAA 5AI8A 4HSZA 4IRKA 2KDHA 5KT6A 4TNCA 4RQNA 1OW4A 5ALWA 3D2QA 3RJFA 3SIBA 1B4CA 3MGVA 2KLEA 2GGMA 3RJKA 1ZUZA 5DDMA 1TV9A 2JQ6A 3TDUA 3SG7A 1W7JB 1XC9A 3LWLA 4KLOA 1PSRA 2H8VA 3C2KA 2BCSA 4DL3A 1Z3EB 2BAPA 5J2BA 3F5AA 4M9HA 1WRLA 4Q04A 1AP4A 5AKYA 2H2KA 2H5XA 3L4PA 5L1KA 1IM4A 2F3ZA 1MC8A 4DQRA 3QU5A 3SD7A 5DG8A 2BCRA 4EZ6A 3WKAA 5EE9A 1B47A 1CFDA 4I2IA 4NDDA 3S0FA 3D2NA 2KI6D 2XIDA 3F2BA 4DFMA 1O08A 3WK8A 4IL6U 2BL0B 3KHRA 5KT5A 4IQTA 3F5EA 1ALWA 1SZHA 5JU5A 3IHQB 4CCHA 1YURA 3EVVA 1XFYO 4RNNA 3PSIA 1OOFA 4M04A 1NPQA 4DSFA 2LMTA 2WTFA 3H4SE 1SCMB 3AM9A 1N2XA 3AEVA 3QUCA 8ICUA 1S5GY 4UB5A 5CP2A 3AU6A 1WCLA 1ZD4A 4UB3A 1QJTA 1F4QA 5J0YA 1QQ7A 5AIAA 4EEKA 3SR6A 3V7LA 3JPPA 4KLDA 1ZQRA 4ELTA 5EOZA 4J9SA 2EGDA 2OTGC 1J7OA 1JXEA 2BDUA 2W03A 2JULA 5ALSA 5IBWA 4J9PA 8ICZA 4C4SA 4A8EA 1YUUA 2EDUA 3I5HC 3EW9A 1XSPA 1WWUA 5DG7A 1NX1A 3PVXA 2JNFA 2HDOA 2EZYA 4GGNA 1SYMA 1F70A 2E30A 1FI5A 2YMQA 3ALRA 3H8JA 3PN7B 4Z6FA 1TWOA
chains in the Genus database with same CATH topology
2L5YA 5JRTA 1Z1VA 3SENA 3TADC 2LMRA 2QB1A 2LPEA 5D3OA 1PK1B 2QKQA 4I5KA 4MHVA 3OBVA 2E8MA 2FE9A 5KNIA 3K1RB 5HL1A 1LKYA 1F0MA 2KSOA 4RQNA 2BNXA 2DKXA 3BS5B 4JKTA 1UCVA 1X9XA 4GAOA 2KLEA 1X40A 2QB0A 5JTIA 3TACB 2EAPA 2E8PA 4NL9C 4MEWA 1B0XA 3IVTA 3SS5A 1PK3A 2K60A 5FI7A 2EAOA 4PZNA 1DELA 2KG5A 2ESEA 5J8YC 2KMDA 2KIVA 3KKAC 2BAPA 3BQ7A 1LKYB 2QARA 2KSOB 3IDWA 4IJ7A 2EANA 3SS4A 3O4XA 2F3NA 3TADA 5F3XB 4I5NB 1COKA 2KLDA 4KYNA 1SV0C 3KEVA 1W9ZA 1SXEA 4PZOA 1Z2CB 2F8KA 1PK1A 3PM2A 4IS7A 1OXJA 1SGGA 2DKZA 5JU5A 1RG6A 1SV4A 3SEIA 2DL0A 2K4PA 5I94A 2GLEA 1DC1A 1JI7A 3BS5A 2KE7A 4NL9A 2E8NA 1V38A 1X66A 5L1MA 2EAMA 1B4FA 2YGUA 2ES6A 3BS7A 2B6GA 1UQVA 2D8CA 4I5JA 2Y9UA 2QB0B 2E8OA 4I5LB 2JV3A 3HILA 5J8YA 3UO9A 3KKAA 3EG5B 1DXSA 2D3DA 5FI2A 1DEKA 3SS3A 1SXDA 1Z4HA 5FI6A 1WWVA 2YTUA 3H8MA 1OW5A 3UNWA 4NJ8A 1WWUA 1KW4A 2Y9TA 4GBAA 1SV0A 4RQMA 2QARB 2F44A 1V85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5Y A;  5JRT A;  1Z1V A;  3SEN A;  3TAD C;  2LMR A;  2QB1 A;  2LPE A;  1PK1 B;  2QKQ A;  4MHV A;  2E8M A;  2FE9 A;  5KNI A;  3K1R B;  1LKY A;  1F0M A;  2KSO A;  4RQN A;  2DKX A;  3BS5 B;  1UCV A;  1X9X A;  1X40 A;  2QB0 A;  5JTI A;  3TAC B;  2EAP A;  2E8P A;  4NL9 C;  1B0X A;  1PK3 A;  2K60 A;  2EAO A;  4PZN A;  2KG5 A;  2ESE A;  5J8Y C;  2KMD A;  2KIV A;  3KKA C;  3BQ7 A;  1LKY B;  2QAR A;  2KSO B;  3IDW A;  2EAN A;  2F3N A;  3TAD A;  5F3X B;  1COK A;  1SV0 C;  1SXE A;  4PZO A;  2F8K A;  1PK1 A;  4IS7 A;  1OXJ A;  1SGG A;  2DKZ A;  5JU5 A;  1RG6 A;  1SV4 A;  3SEI A;  2DL0 A;  2K4P A;  2GLE A;  1JI7 A;  3BS5 A;  2KE7 A;  4NL9 A;  2E8N A;  1V38 A;  1X66 A;  5L1M A;  2EAM A;  1B4F A;  2ES6 A;  3BS7 A;  2B6G A;  1UQV A;  2D8C A;  2Y9U A;  2QB0 B;  2E8O A;  2JV3 A;  3HIL A;  5J8Y A;  3KKA A;  1DXS A;  2D3D A;  1SXD A;  1WWV A;  2YTU A;  3H8M A;  1OW5 A;  4NJ8 A;  1WWU A;  1KW4 A;  2Y9T A;  1SV0 A;  4RQM A;  2QAR B;  2F44 A;  1V85 A; 
#chains in the Genus database with same CATH topology
 3C1Y A;  2KOT A;  4B9T A;  2L5Y A;  1NJZ A;  3TZ1 A;  2K7C A;  1BPZ A;  2O5G A;  1PVQ A;  5IIO A;  2A4J A;  4J9L A;  4R8U A;  4YD2 A;  4C4R A;  1UA0 A;  1QXP A;  4ECS A;  2M9G A;  3QNM A;  2WAQ C;  5DBB A;  2Q4U A;  2QKQ A;  4Z6C A;  3WHT B;  1SZP A;  2LMU A;  3CR2 A;  3ORY A;  4GGF C;  9ICI A;  7ICV A;  1D1O A;  1F71 A;  2KSO A;  3ZDA A;  1PUL A;  3I5G C;  1DMO A;  3PJI A;  2TN4 A;  2E1F A;  1QX2 A;  5ALE A;  1YX8 A;  3RR7 A;  1JRP A;  4GAO A;  4DF4 A;  1TOP A;  5ALD A;  5KT2 A;  4DF8 A;  3PW4 A;  2WB1 C;  3FYH A;  3N7P D;  3D76 A;  4MEW A;  1F8H A;  2K61 A;  2GOL A;  3A8R A;  4XJK B;  5CSI A;  1FEZ A;  1TAU A;  4WQ2 A;  3OX5 A;  1ZAC A;  2AGO A;  4DL6 A;  4PHE A;  3QU7 A;  1Q80 A;  1DT7 B;  1S3P A;  2PMZ F;  3CWG A;  4M9L A;  9ICR A;  1SR6 C;  5A0L A;  1IJ6 A;  2NXQ A;  2KFH A;  3S6J A;  1K96 A;  4ZCV A;  7ICH A;  4GXK A;  2XI9 A;  1F54 A;  2LC5 A;  3DEE A;  1RYU A;  5L1L A;  1HUZ A;  4NV0 A;  5T14 A;  8ICN A;  4O9M A;  1WDC B;  5KG2 A;  3JPO A;  4GFT A;  2M0R A;  4N5X A;  1XO5 A;  1RM6 C;  4IR1 A;  2GLE A;  4OR9 B;  1LV5 A;  5DKN A;  3PR5 B;  3CR4 X;  3GIJ A;  4UAU A;  1KQM B;  3DD4 A;  4F93 B;  2ZN8 A;  5JOL A;  4U7C A;  2R18 A;  2PXI A;  3DVE A;  1TK5 A;  4PHP A;  3FE9 A;  2IBK A;  4KLE A;  3HPO A;  1WRK A;  3LYS A;  1XFZ O;  2FLN A;  4YI8 A;  5J8Y A;  1NJW A;  2XCP A;  1UHU A;  3NRZ A;  2W9B A;  1IG6 A;  5FI6 A;  2JT3 A;  3TI0 A;  3CS1 A;  2JRF A;  5KT4 A;  5KG4 A;  2I1Q A;  4Y2X A;  3F45 A;  1WG8 A;  3NSO A;  1NKB A;  1IKU A;  3GV5 B;  1AHR A;  1RDF A;  2ZIV A;  4ECV A;  1TAM A;  9ICE A;  1T94 A;  2NLN A;  1EG3 A;  1PVA A;  1X6J A;  3TAQ A;  3C23 A;  4M47 A;  2LVI A;  4E0D A;  1DJG A;  1ZQG A;  2M49 B;  1CTR A;  2KI4 B;  2Q91 A;  3C1V A;  2CPR A;  3M8R A;  3OBV A;  1N0Y A;  2KZZ A;  4ECZ A;  1HJP A;  2HQW A;  1LKY A;  2JPO A;  4KMO B;  2E1E A;  3M9M B;  1XVJ A;  2BNX A;  3PX6 A;  1N65 A;  4Q44 A;  4RQ7 A;  3FE8 A;  5KFR A;  4RQ6 A;  5D49 A;  5AK3 A;  2W55 A;  5ALJ A;  2P35 A;  3RLZ A;  4C8O A;  3JTD C;  1ED1 A;  2KAV A;  5G08 A;  2IHM A;  1A03 A;  3EWA A;  3V6K A;  1QLS A;  2LM4 A;  3TS5 B;  1W7I B;  3NHT A;  1Q3U A;  4KLS A;  4R64 A;  5DBC A;  2ALZ A;  3CR5 X;  4RNM A;  1ZJN A;  4DRW A;  1P28 A;  1ZYQ A;  3NSL A;  1PUZ A;  2H3F A;  1BOD A;  3QXG A;  3IQO A;  1ZQX A;  3SS4 A;  2DPJ A;  2E5S A;  3M7D A;  7ICI A;  2ZNE A;  1S77 D;  2LM1 A;  3OSP A;  9ICG A;  3NXA A;  2F76 X;  1N61 A;  3NVV A;  1QX5 B;  2PQL A;  1S6I A;  3OJS A;  2V4Q A;  1T7P A;  3OHM B;  4P5O E;  1ZQO A;  4R8U B;  5KFQ A;  1J7Q A;  4NWI A;  1M63 B;  1L3V A;  2ZJ8 A;  7ICE A;  5AER A;  4KN4 A;  2JU0 A;  2PMZ C;  3VRN A;  1L7M A;  3KZX A;  2AQ0 A;  4JB3 A;  1PZN A;  2I5H A;  4J9R A;  5AFP A;  1OUQ A;  4I2G A;  2KQY A;  2D8C A;  3V7J A;  2WCL A;  4EBD A;  1TFR A;  2WF9 A;  4XUS A;  4C8L A;  3C5F A;  1JRO A;  4QZF A;  2C2D A;  1TNW A;  4YI9 A;  2HHS A;  5FI2 A;  5TNC A;  4F50 A;  4FTG A;  4FQO A;  3PZP A;  4OJ5 A;  2YTU A;  3CZT X;  5J0T A;  5ER4 X;  2LNK A;  3G6V A;  1QSY A;  4YGE B;  1NK7 A;  1S9F A;  2NCO A;  5J2K A;  1UP5 A;  2HSZ A;  1KCY A;  3DVJ A;  3GK2 A;  3H4B A;  3FWC A;  1Z00 B;  2BQU A;  1UWO A;  3MR5 A;  1ZFS A;  2SAS A;  3GFK B;  1CDN A;  5AM1 A;  3TAD C;  2KGB C;  4RQ8 A;  5AKI A;  9ICK A;  4GC6 A;  2HMX A;  1NKE A;  3F2D A;  3N4M B;  3SG3 A;  2LKY A;  2XO7 A;  1KK8 B;  2E8M A;  4B9S A;  2JEI A;  4P4M A;  4F4Y A;  3A0H U;  5KFE A;  3LLE A;  4FBT A;  3BOW A;  3H0M B;  2IMW P;  1XS9 D;  2B21 A;  2K7O A;  4USA A;  1X40 A;  3MC1 A;  1T4G A;  3HRD D;  1DGJ A;  1SCV A;  4ELU A;  2EAP A;  1CNP A;  2JH7 A;  2GTE A;  2WND A;  4NL9 C;  4GXI A;  3I5F C;  4DS5 A;  1SMG A;  2ZFD A;  1SKW A;  2NO5 A;  1NJX A;  4OKH A;  2NRW A;  3KHG A;  2JMG A;  3IG8 A;  3MR3 A;  5KFS A;  5B66 U;  3RH4 A;  8ICG A;  1QVI Y;  3ZDC A;  1TIZ A;  2W9B B;  2QEV A;  3OGN A;  3QME A;  1OOJ A;  1SB3 C;  3AAJ A;  3PAT A;  5J2F A;  2QAR A;  2KJ9 A;  3MDA A;  5AI6 A;  4QJ4 B;  3HT3 A;  1DJH A;  4JUZ A;  2F3N A;  2MRL A;  3B88 A;  2G9B A;  2GGZ A;  3Q8R B;  1DOQ A;  4AOM A;  4XYN A;  5KFC A;  5DKR A;  2L2E A;  4NLK A;  1NK5 A;  1RYR A;  8ICJ A;  2OYY A;  2H61 C;  4CFQ A;  5KG1 A;  2RQ5 A;  5CHG A;  5AKK A;  3ZDD A;  1Y0V H;  2HVI A;  3TQ1 A;  2GWS A;  5BPJ A;  2M0N A;  4EEN A;  1IQ3 A;  1OQP A;  5KTY A;  4YGD B;  1CLM A;  1H8B A;  4PT1 A;  2LAP A;  3KHL A;  4EYH B;  3R1V A;  1KFS A;  4EZ9 A;  4I5J A;  2COL B;  5HYD A;  2Y9U A;  4F5N A;  4I5L B;  5KG7 A;  8ICE A;  3SV4 A;  4RQ1 A;  5TIS U;  4XQ8 A;  3VRO A;  4C7Z A;  1BF5 A;  4IQU A;  3EG5 B;  1F5S A;  4C4T A;  1U45 A;  3J81 j;  3ZI4 A;  4M9G A;  2FMQ A;  2VJ5 A;  3KHE A;  9ICO A;  2W9M A;  2MLF C;  3PR4 A;  3T79 A;  3GIM A;  3ISD A;  2WC8 A;  1O03 A;  1Q8K A;  5KFI A;  5AI9 A;  1A75 B;  2DQN B;  3PLF B;  1ZQT A;  3D6J A;  5D4B A;  1K5O A;  3KPX A;  1BVS A;  4Y2V A;  1BJF A;  3GIL A;  3GIK A;  4F0Z B;  5I8N A;  2LPE A;  5KFF A;  4OZD A;  2KTQ A;  3IRU A;  1G4Y R;  1NX0 A;  1WYG A;  2YMM A;  3WK4 A;  1N48 A;  1BU3 A;  2XGQ A;  2HOF A;  5KFM A;  1ZQI A;  3O2P A;  1ZQU A;  3E58 A;  1ZJM A;  1NCZ A;  4OCZ A;  4F4K A;  5ALM A;  5K4L A;  2QB0 A;  3DVK A;  4NLN A;  1QAT A;  1YUT A;  2YMP A;  3WXA A;  1SSE B;  2OS8 C;  2NRT A;  1M31 A;  4I2J A;  3BFB A;  4MVF A;  2DPI A;  4PGY A;  4MSP A;  4YR2 A;  3CZ0 A;  2ESE A;  1S6C A;  1MF8 B;  1VDV A;  1L3T A;  1ZQA A;  5ALH A;  5KG5 A;  2HHX A;  4F5R A;  4IRD A;  4Y2S A;  1J7R A;  2XGP A;  4JMU A;  2ZRS A;  4QZE A;  3IDW A;  3RZS A;  2QPT A;  2HHQ A;  2OTG B;  4Y2Y A;  3OPX A;  4J03 A;  3TDI A;  2JZB A;  5HML A;  4YN4 A;  3IM1 A;  4YRU A;  2G07 A;  3T5J A;  2W3R A;  4BX9 C;  4DFD A;  1RK9 A;  1CM4 A;  3I5H B;  2PI5 A;  1SV4 A;  4EEL A;  1U4B A;  5IIJ A;  4DS7 A;  5CWR A;  5ALF A;  3GII A;  1OZO A;  5IIN A;  2Y5I A;  1SNL A;  2LAN A;  5CPV A;  2F8L A;  1DGS A;  4FS2 A;  3PX4 A;  2F2P A;  1RYS A;  2UVV A;  3I28 A;  1ZQL A;  2E8N A;  7ICN A;  3MDC A;  3BFH A;  3PO4 A;  1A2X A;  1MR8 A;  3BOW B;  3RRG A;  4UPG A;  1COO A;  1EXN A;  1CMG A;  1U5I B;  1NIW A;  4MZL A;  1U48 A;  3HIL A;  2BKE A;  1FBV A;  4KX3 A;  1ALV A;  2PFQ A;  2Y1M A;  2KFZ A;  1IQ5 A;  1SW8 A;  2NRX A;  1T8E A;  1SKS A;  3V2L A;  4F5Q A;  5I2O A;  3AL0 B;  8ICV A;  2FCE A;  2OPO A;  2ZRT A;  2WC5 A;  2VA3 A;  1SL2 A;  3I5I C;  9ICF A;  1MXL C;  1SV0 A;  2ISP A;  2QAR B;  3T5L A;  2CT9 A;  8ICI A;  3BUW B;  1T3Q A;  1NSH A;  4HRH A;  4I2B A;  1XFW O;  4XJK A;  1TK8 A;  1S5L U;  4NLC A;  3PST A;  5J3X A;  4UQG A;  1IIP A;  2QB1 A;  3ONN A;  4JV2 A;  1N2D A;  5AXI A;  3UMB A;  4P2Y B;  4DSK A;  1S8O A;  1L3U A;  5J2E A;  5GQQ C;  2HBK A;  2BCQ A;  1KWO C;  2Y4Q A;  5AM3 A;  4YD1 A;  2AGP A;  3RBD A;  1BR4 B;  5BOL A;  2WCE A;  5JTI A;  1RJV A;  2KBI A;  3D78 A;  3D2S A;  3WHU B;  3L47 A;  9ICA A;  1FIQ A;  3BJY A;  3PMN A;  3CYZ A;  3VCB A;  2A1A A;  3ZDB A;  3BJH A;  4PZN A;  1NZB A;  2LHL A;  3ZD8 A;  1ZMZ A;  8ICW A;  4KTQ A;  2KIV A;  1DJZ A;  2YN4 A;  5PAL A;  3ZWH A;  2M1U A;  1ZQ1 C;  1PSB A;  4F8R A;  2P6B B;  2W43 A;  3WKC A;  2J6S A;  5CJ7 A;  1JIH A;  3C29 A;  3JPR A;  1KFU S;  2Y1N A;  2F1H A;  2KK0 A;  4IL1 A;  3EYZ A;  4FE3 A;  4ECU A;  2ZG6 A;  1K94 A;  2HHU A;  1XK4 A;  1U49 A;  1IG5 A;  3L5K A;  3TAR A;  5AM5 A;  2EH9 A;  3E3R A;  5KFV A;  4MRY A;  5FP0 A;  5CB1 A;  2K8C B;  3E2E A;  3L3F X;  4PHD A;  4IQV A;  4DFJ A;  3KBB A;  3GU3 A;  1C7Y A;  9ICU A;  4GNK B;  2JZI A;  5DKQ A;  2Z7J A;  1ZQM A;  2ASL A;  2BCU A;  2N1R A;  4RPZ A;  2OWO A;  3K75 D;  1QLK A;  5HR6 A;  1TN4 A;  2QB0 B;  2PAL A;  2PFP A;  1UT5 A;  3SG6 A;  2W04 A;  4FQT A;  5EWG A;  1DXS A;  5KFA A;  4TUR A;  3C28 A;  1SWW A;  4MF8 A;  1L2O C;  3BUX B;  8ICK A;  1B9A A;  9ICS A;  1JBA A;  5DIC A;  2XY5 A;  2VAN A;  3DY9 A;  2RRD A;  2KV2 A;  3WKB A;  2HHT A;  1K9K A;  3JTD B;  2F44 A;  2IOH A;  5DDY A;  2LLU A;  4I2A A;  2OEH A;  1RWY A;  3UMC A;  1RZT A;  4YMM A;  5JRT A;  8ICP A;  1GO3 F;  4B9U A;  2R8H A;  2LUX A;  2JZB B;  4OV2 A;  4YBH B;  3M8S A;  4AQJ A;  1LIN A;  2HQ8 A;  1J7P A;  3Q8Q B;  3EK4 A;  1NUB A;  4Y2U A;  1YZ7 A;  4B9N A;  4K4I A;  2HBM A;  4CID A;  1MWN A;  1K9U A;  1AQ6 A;  3NGV A;  2L0P A;  2BHN A;  2HOI A;  1ODB A;  5DB9 A;  5KG3 A;  4J9Q A;  3I1Y A;  3B87 A;  3HWT A;  1UHH A;  5KFP A;  2JT8 A;  2RDJ A;  2OHF A;  3NVZ A;  4ECQ A;  3Q8M A;  4TUS A;  1XSL A;  1L8L A;  4YMN A;  2JXJ A;  4FO6 A;  1BPX A;  1KK7 Z;  3FIA A;  2KAX A;  1B43 A;  2G09 A;  5DGA A;  3RRH A;  2AHO B;  4FS1 A;  5CEH A;  3R1P A;  2LHI A;  4C0K A;  2GO7 A;  5J2A A;  2R8J A;  1GGW A;  2ZJ5 A;  1FO4 A;  4JV0 A;  1IWQ A;  4I28 A;  2L98 A;  1T3N A;  1F55 A;  1V9P A;  3TFR A;  1KRP A;  5HR7 A;  2FLL A;  2FCD A;  4PHJ A;  3BQ7 A;  5J29 A;  1WRZ A;  9ICT A;  4C8N A;  1X9M A;  4IJ7 A;  5KFU A;  2NCP A;  4NXZ A;  5ALK A;  4P0Q A;  1RTP 1;  2JNX A;  1XFX O;  3KF9 A;  3CAB A;  3EVR A;  2MAX A;  3OHB A;  9ICH A;  3N7S C;  2ATL A;  5J2G A;  2KHQ A;  3KOO A;  4DLE A;  1PK0 D;  4O3N A;  3N7H A;  3BZC A;  2LI6 A;  2C2R A;  4NY8 A;  2LE9 B;  4ED7 A;  4P4P A;  3SEI A;  2K4P A;  1TKD A;  3V72 A;  4JPZ B;  2KVC A;  1JI7 A;  3QZ7 A;  2DUY A;  1QSS A;  3NTU A;  2R2I A;  2PVB A;  3BXK A;  1D9D A;  5D69 A;  3LK9 A;  4C7Y A;  2UVW A;  3N7R C;  3RBE A;  1Y1A A;  3VB1 A;  3H8S A;  1Z00 A;  5ALG A;  2EAM A;  1MXE A;  1B4F A;  4HRG A;  5KFH A;  1UQV A;  3VRP A;  2E8O A;  1D8B A;  3GK4 X;  7ICG A;  3DXL A;  1ORG A;  3D75 A;  1LVC D;  5ALZ A;  2XIC A;  2JC2 A;  2QLT A;  3K4G A;  2K8A A;  3KZI U;  3OGU A;  1S5G Z;  2MRD A;  4N1F A;  1OW5 A;  1TK0 A;  4QZ8 A;  3K21 A;  2G2B A;  5HHI A;  4PE7 A;  2P71 A;  3DYE A;  1D8L A;  3Q8P B;  3PSP A;  3B86 A;  3AQF A;  1QCK A;  1R6P A;  3BUM B;  1ZQP A;  1VJ5 A;  1ZQV A;  1J1D A;  2Y0S F;  4JWM A;  3I5F B;  4UBB A;  5EWE A;  1TCF A;  1F4O A;  2CNP A;  3GK1 A;  4CGZ A;  1Z1V A;  1A77 A;  2ISD A;  1XO0 A;  1JUO A;  1YRT B;  5I2Q A;  4N1G A;  4KX5 A;  1CEZ A;  2H3Q A;  5IIM A;  4LJX A;  2BGW A;  4I5K A;  3H40 A;  4PGQ A;  5L1I A;  1BGX T;  2FE9 A;  3JPN A;  2BKI B;  3VRR A;  1GGZ A;  4RUC A;  3MFH A;  3IP4 B;  2HCF A;  4X5V A;  4YXM A;  1JF2 A;  5KFG A;  4QZD A;  2AMI A;  3L4A A;  4O3R A;  4I27 A;  7ICS A;  4A4B A;  1CUK A;  1XFU O;  2LCP A;  4GPL B;  5AI4 A;  3MR6 A;  4WRI A;  4CDG A;  1A0P A;  4QW8 A;  4Z6E A;  3EPI A;  2C22 A;  1ZOT B;  2IA6 A;  1QX7 A;  1K2H A;  2KKV A;  1QIW A;  1QWV A;  2BCV A;  1VLB A;  1BT6 A;  1VRK A;  4O0I A;  1YZ6 A;  7ICQ A;  3N28 A;  2PAS A;  2YB4 A;  1CDL A;  1M45 A;  1CI4 A;  3MAB A;  5J0X A;  4U8D A;  2ASD A;  4O5E A;  1L7Z A;  2DOQ A;  3BUO B;  2CXY A;  3NVW A;  5CRX A;  3M9O B;  5DB6 A;  1WLZ A;  3JVT C;  3KO0 A;  2WCM A;  1XA5 A;  4I29 A;  3VC8 A;  5HLO A;  1NK6 A;  1Z4O A;  4DQS A;  2UVR A;  2KIC A;  2LYH A;  8ICM A;  1K8U A;  4F4Z A;  2FLP A;  2LM5 A;  1U9L A;  4HYK A;  3SYZ A;  4CPV A;  2DBY A;  3LDA A;  4BGD A;  4CRX A;  1JWD A;  1DC1 A;  4CF5 A;  1IH0 A;  4C0L A;  2LUC A;  3PW2 A;  2E6W A;  4Y2Q A;  2WCK A;  2FOT A;  2NYV A;  4QWE A;  1A75 A;  2WFA A;  1CM1 A;  1X66 A;  1MA7 A;  1SL9 A;  2BBM A;  1NOM A;  3AMZ A;  1ZQY A;  2LP3 A;  3EVU A;  4F3O A;  3BS7 A;  4R1E A;  4DIR A;  1ZQF A;  2I2R E;  2FMS A;  2MLE C;  1ARO P;  4INW A;  4NQG A;  1KL9 A;  1ZQE A;  4QJ3 B;  2HHV A;  1DJW A;  1C20 A;  5ALV A;  4ICB A;  1KW4 A;  1S0V A;  2BQ3 A;  2DF4 B;  4PPX A;  1XSN A;  4B9L A;  4HAI A;  1HEK A;  1K90 D;  3ETL A;  1UHK A;  4YG2 A;  2ZTC A;  2L50 A;  2OS8 B;  2QEO A;  1BR1 B;  4P0Q B;  3PN7 C;  3SEN A;  4BWM A;  4BXO A;  4O3O A;  4KIT B;  3RJG A;  1K1S A;  5IIL A;  2K4I A;  2JEJ A;  3WK6 A;  5C5J A;  3S0D A;  2KSP A;  4GUK A;  2WF7 A;  4L9M A;  4JV1 A;  2VIX A;  3NVY A;  2MUT A;  2KYF A;  3TUY B;  2G5H B;  5D7F A;  2Y0S C;  7ICU A;  1QTX A;  1UCV A;  4OJL A;  1YVH A;  5CSJ A;  1AVS A;  4UW9 A;  2W9A A;  2IS9 A;  4M0A A;  3C2M A;  4MN0 A;  3TAC B;  2C28 A;  2ZKM X;  1C7V A;  2LP2 A;  4PHK A;  3FDS A;  1RXV A;  3BQ1 A;  1J55 A;  4IRC A;  2AQ4 A;  1QQ5 A;  2EAO A;  5KFL A;  4C0J A;  1FF1 A;  1MN8 A;  5HKW A;  3KKA C;  8ICY A;  3BFA A;  1KFX L;  2Y1J A;  1QSL A;  5KTQ A;  2DFL A;  2PRU A;  3D73 A;  2G06 A;  2W54 A;  4UAY A;  2KFF A;  4RPX A;  2O60 A;  4RT2 A;  4KN7 A;  1REC A;  3FC4 A;  1U5I A;  1DJY A;  2OH2 A;  2KHN A;  3AKA A;  1RQN A;  2OXO A;  9ICB A;  1KFT A;  4PZO A;  4GGF A;  2FMP A;  2FPM A;  2WCB A;  3O78 A;  3S0G A;  1RG6 A;  5DB8 A;  5DLG A;  2LMV A;  3MBY A;  4QWC A;  2QAC A;  4U6P A;  3I5I B;  3BQT A;  4B9M A;  3BS5 A;  1QIV A;  1MQ3 A;  2HVH A;  2Q4T A;  4F4X A;  1TNP A;  3OJU A;  1KQM C;  1S76 D;  4PJ0 U;  2YB1 A;  2V9W A;  1F44 A;  1CLB A;  1G33 A;  4PHN A;  3B0X A;  1X9S A;  2CBL A;  4TUQ A;  5J2I A;  4F2R A;  1WCN A;  3K1E A;  5AM4 A;  4ECX A;  1K95 A;  3D77 A;  1LA3 A;  4JD9 A;  1S26 D;  4BDP A;  1IJ5 A;  4YMO A;  4KLI A;  2KEY A;  5AKH A;  5KL8 B;  4DS4 A;  1KWO B;  2I94 A;  1C07 A;  1ZQQ A;  2XC9 A;  2MU2 A;  2CCM A;  4DQI A;  3BUN B;  3HX0 A;  2KJ8 A;  3RJH A;  8ICH A;  4PE1 A;  5KG0 A;  4OVN F;  7ICL A;  4FZL A;  1N5W A;  2L2C A;  3M9N B;  5AAN A;  4IQW A;  4DOA A;  4PH5 A;  1L8O A;  2J6U A;  8ICA A;  3SI8 A;  2Y1I A;  3LVV A;  2AH5 A;  3TDZ A;  4PL1 A;  2NO4 A;  5AEQ A;  2LVJ A;  3MGH A;  2A1J A;  3FM9 A;  3FWB A;  2KI4 C;  2K89 A;  2CTN A;  1DJI A;  8ICR A;  2FJU B;  2DKX A;  3SAF A;  1ZOL A;  4QZC A;  5DLF A;  3KFU F;  1YUS A;  3OB2 B;  4ZH4 A;  3IG5 A;  2GH1 A;  3RJE A;  2BZF A;  2K4E A;  2F2O A;  5ALQ A;  2FJY A;  1L7O A;  4UB8 U;  1KTQ A;  4F92 B;  1KEJ A;  2QEH A;  3T3F A;  3IQQ A;  2KD1 A;  5J0S A;  1SKR A;  1SL7 A;  2K60 A;  2L4I A;  3HX4 A;  3TS5 C;  1DEL A;  2D8N A;  1TRF A;  3UPQ A;  2KMD A;  1CFC A;  4YGC B;  1ZQH A;  5L9X A;  4NDB A;  1C3Z A;  3S0B A;  4Y2R A;  2XCA A;  4DL7 A;  1YVL A;  1LB2 B;  4Q8E A;  3GV8 B;  4KYN A;  1PRW A;  3KEV A;  1DTL A;  2M9N A;  1NJY A;  4Q45 A;  1K9P A;  1OXJ A;  3SAG A;  4BXO B;  9ICM A;  3AN1 A;  3CGA A;  3EK8 A;  3SG5 A;  2WF6 A;  4RPY A;  4F4W A;  2YY6 A;  1Y1U A;  4CLN A;  1B8C A;  4DL2 A;  4J9N A;  1SKT A;  3G6X A;  2F33 A;  2MUT B;  4ECY A;  2ZIX B;  1MUX A;  2M8U A;  3NHI A;  3JPQ A;  1CRX A;  2M29 A;  3FS7 A;  5ALY A;  4DLG A;  3QU4 A;  5F9N A;  2B1U A;  1FW4 A;  1ZD5 A;  8ICT A;  2ES6 A;  4YQW A;  4RQ2 A;  4F5P A;  1ECW A;  3T5H A;  2D6F C;  4JWN A;  4GLX A;  1L7P A;  2E3T A;  2KFN A;  4M6W B;  3V6J A;  1V97 A;  1JMS A;  1B8R A;  5KFW A;  1UUS A;  1NK4 A;  2D3D A;  2WHE A;  1N56 A;  2FJ6 A;  1BPE A;  2K2A A;  2V4R A;  3D10 A;  5I2L A;  2FPK A;  4RZR A;  1JUD A;  3O0F A;  4US8 A;  3B6X A;  9ICJ A;  5AKJ A;  2JEF A;  4AP9 A;  2DWQ A;  1Y1X A;  2KAY A;  1OZS A;  2IOF A;  4JQ0 D;  5KFZ A;  3ICB A;  5ALP A;  3M0W A;  5J0Q A;  1KDH A;  2RHF A;  3Q8S B;  3PV8 A;  4QZH A;  1H4B A;  4KLL A;  4KLQ A;  3I5G B;  1KSM A;  2W8K A;  3BS5 B;  5J0R A;  3JPT A;  3EKJ A;  4PE0 A;  1M39 A;  1X9X A;  5AHX A;  1OMD A;  4ELV A;  1YR5 A;  1TVA A;  1NI3 A;  5F6T A;  1J2M A;  3B0Y A;  2JRZ A;  1NCY A;  2A3V A;  5CSF A;  4E68 A;  3QX7 A;  2G0A A;  1SK6 D;  3IVT A;  4JWQ A;  4K4H A;  2LLS A;  3O6B A;  4ED3 A;  2R8I A;  2OCE A;  1KFD A;  2WCJ A;  2ZIW B;  5J8Y C;  1BG1 A;  3H0R B;  1SR6 B;  4NM2 A;  4IR9 A;  4M2P A;  1B7T Z;  1ZQZ A;  5AM0 A;  1LS8 A;  1S6J A;  3RB4 A;  3NRW A;  1S0N A;  3O4X A;  4QZI A;  4G9B A;  5KSZ A;  4OJP A;  3TAD A;  5F3X B;  2WOR A;  1RQL A;  1Z1B A;  4C0Z A;  1UHJ A;  2K0J A;  3R9K A;  5KFD A;  4ED1 A;  3CNH A;  4DSI A;  1CFP A;  2IHN A;  2O6K A;  2KFG A;  5IIK A;  2AXT U;  3AUO A;  8ICO A;  1K93 D;  5KU1 A;  1H38 A;  4ED0 A;  4RQ5 A;  2EC6 C;  1S1E A;  1TUZ A;  2A1J B;  4UAR A;  1ZQC A;  3GZF A;  1LVH A;  2ZXH A;  2M97 A;  5HKZ A;  4OJ6 A;  4NL9 A;  1CLL A;  4YGA A;  3MSE B;  3PFV A;  3LK1 A;  4WJ3 B;  2KJ5 A;  4USL A;  3SG4 A;  1WUD A;  1JSA A;  2B6G A;  2ZND A;  1Z19 A;  3ZD9 A;  3EPG A;  2XY6 A;  3EUB 2;  4NM1 A;  4I2C A;  4Q43 A;  3T5K A;  2GV5 A;  3QEB Z;  4CF4 A;  5AK5 A;  3A4U B;  3SQI A;  2W9C B;  3SS3 A;  1KK7 Y;  4LVS A;  4WQ3 A;  3UXP A;  4PCW A;  2HBL A;  2WC6 A;  1HIW A;  1XO1 A;  3RR8 A;  5ALT A;  4PL2 A;  4QZB A;  4J9K A;  5AKX A;  1TE2 A;  2Y9T A;  4YVZ A;  2LVK A;  2MBX A;  2HW3 A;  2ZUC A;  4B6J A;  3UQ0 A;  4RQM A;  5ALN A;  3RJI A;  9ICC A;  2P70 A;  2M1K B;  4ECR A;  3DVM A;  3CYM A;  3QU9 A;  2H61 A;  2JT0 A;  2LV7 A;  2WOS A;  1QLN A;  4MFF A;  3TAN A;  3QE9 Y;  3DF0 B;  9ICX A;  3WKD A;  5ER5 A;  2HET A;  1S0M A;  2L4H A;  2WCH A;  4EX6 A;  5HKY A;  2BEC A;  2KP7 A;  3K1R B;  1F0M A;  3V6H A;  5AI5 A;  4QZA A;  3JVT B;  1A6S A;  1ZQW A;  4JKT A;  1BNO A;  3HJE A;  1SRA A;  5E79 U;  1OOH A;  2C2E A;  9ICL A;  3EK7 A;  4YR3 A;  3SG2 A;  2E8P A;  3LVW A;  5DQI A;  4GXJ A;  4FBU A;  1M6Y A;  1B0X A;  2PYQ A;  1GJY A;  4YCX A;  1AJ4 A;  4QZG A;  2R8G A;  2R8K A;  3RM1 A;  2RP5 A;  4PHA A;  1X9W A;  2FPL A;  3KD3 A;  2Q0Z X;  2ZN9 A;  2AUC A;  3SMV A;  3JPS A;  3B7A A;  3LWM A;  1KKX A;  4PDZ A;  3NSK A;  4US9 A;  2H3V A;  1B8L A;  4XA5 A;  8ICF A;  3MFI A;  2EAN A;  2JEG A;  2I18 A;  1EL4 A;  2BCA A;  3PSR A;  1SBJ A;  1BNP A;  2KLD A;  5DB7 A;  8ICQ A;  4OJO A;  4ICA A;  3PAL A;  4KLG A;  1OE9 B;  5KFO A;  1PK1 A;  5J0U A;  4DOB A;  1LKJ A;  4Y2J A;  1XNS A;  1SGG A;  2NRV A;  5HMM A;  1V1F A;  2G5I B;  5GTI U;  2I7A A;  2KGR A;  1QV1 A;  4OCI A;  4DQQ A;  2JXC A;  4I2E A;  3LK0 A;  5AK6 A;  1M46 A;  2EZZ A;  2HBJ A;  1IV8 A;  1QS7 A;  2V53 A;  3WNX B;  1NWD A;  7ICK A;  3QUB A;  1OOI X;  2RLT A;  3PX0 A;  2JH1 A;  5C0Y A;  4D1E A;  4UBC A;  1KQQ A;  5AIB A;  1OMR A;  2KVS A;  3QYP A;  2RDI A;  4RQ0 A;  4UB1 A;  2MAZ A;  3ED5 A;  2I9G A;  1JFK A;  2BDP A;  4CFR A;  4M2Y A;  3B9J A;  5KAI U;  2KZ3 A;  1JFJ A;  1HT9 A;  1IRJ A;  2CRX A;  4Q8F A;  1J1E A;  1BPY A;  4P2H A;  3UNW A;  1S10 A;  5KFB A;  2CXJ A;  5L1J A;  3OTQ A;  2F1J A;  1IGV A;  2YX8 A;  1KLN A;  2W8L A;  4QWB A;  5ALR A;  2XY7 A;  1UUR A;  2NZ0 A;  5J0P A;  3AKB A;  5AKZ A;  3F2C A;  3H8W A;  2DGZ A;  3SIA A;  2ZTE A;  3A0B U;  1UA1 A;  1LA0 A;  3LL8 B;  2FDR A;  2G08 A;  1L3S A;  2HPS A;  1YT3 A;  3N97 B;  4UB6 U;  4EX7 A;  5J2D A;  1NX2 A;  2IOF K;  5BPC A;  3SV3 A;  1ZQD A;  2KOB A;  4ACO A;  4OD0 A;  3Q8K A;  3CZ1 A;  3PW7 A;  1DF0 A;  3IF7 A;  3O4Y A;  3GV7 B;  5AM2 A;  4K4G A;  5KG6 A;  2KNJ A;  2YML A;  3D0Y B;  5B8I B;  4RNO A;  2B0C A;  5HNK A;  1QH9 A;  3CTN A;  4ORB B;  2PFO A;  4I2F A;  1N62 A;  3RH6 A;  2ISO A;  1KBU A;  1JN3 A;  5TZV A;  2MJW B;  4DFP A;  4B9V A;  1N5X A;  1FFV A;  4O5K A;  3UMG A;  4QWD A;  3CW2 C;  3RFA A;  4MEX A;  3ZNI A;  2JR5 A;  4MZK A;  5K89 A;  2BCB A;  1N60 A;  3QZ8 A;  2QEB A;  4EEY A;  1IIO A;  3VRQ A;  4YFK A;  2M3W A;  5EE1 A;  3F53 A;  4AYB F;  2AJQ A;  3HW8 A;  4CNQ A;  3CRX A;  4FZN A;  2EZX A;  4BUG A;  1W9Z A;  1MQ1 A;  1SPY A;  3H7I A;  2KIW A;  1Z2C B;  5KT7 A;  1DRG A;  2BQR A;  1PVR A;  1L5U A;  4J9M A;  1BLQ A;  5EE0 A;  3UM9 A;  2HI0 A;  3WK5 A;  2ODG A;  2MSN A;  4YXJ A;  2AGQ A;  1ZQB A;  1X02 A;  2KBM A;  4AQI A;  3C2L A;  3ISC A;  1S0O A;  3FE6 A;  1CMF A;  1P7D A;  5L1M A;  2ERB A;  4MZJ A;  2JHD A;  5ALU A;  3BQ0 A;  1UHI A;  5J2J A;  4O3Q A;  3C21 A;  4J9O A;  2KYC A;  4GIB A;  2ZJA A;  2SCP A;  2ZIU A;  3UO9 A;  1D8Y A;  1S36 A;  3EZ5 A;  4KLT A;  1C3Y A;  5HLV A;  2H3I A;  5AKG A;  2BL0 C;  3UXN A;  1URJ A;  1L6N A;  3PY8 A;  4NJ8 A;  1ZD2 P;  2LHT A;  4P4O A;  4RQ4 A;  4KLJ A;  3ZDE A;  1G8I A;  5AK4 A;  8ICX A;  4GBA A;  1CDM A;  2JGA A;  2L5X B;  2M7L A;  7ICO A;  2FI1 A;  1SCM C;  3OSN A;  4P0P A;  4NLB A;  4G3I A;  2MA2 A;  3OB1 B;  1ZET A;  4DO9 A;  3NAS A;  4RU9 A;  3RAX A;  1NK0 A;  3PML A;  4O3P A;  2LVV A;  4Y2P A;  1KSO A;  1FI6 A;  1JAL A;  1PK1 B;  4A4C A;  5FYX A;  1E8A A;  4PGX A;  1DQE A;  1PAL A;  5KAF U;  1YX7 A;  4BY5 A;  1OMV A;  4QW9 A;  7ICJ A;  3UQ2 A;  2MHH A;  1XFV O;  2OM6 A;  7ICF A;  1DK2 A;  1BMO A;  1NX3 A;  4DSL A;  2WF8 A;  1YRU B;  3DDH A;  4RQ3 A;  2BPC A;  1SY9 A;  5AKE A;  4KLM A;  3C1Z A;  5G5H A;  2UVU A;  2NV3 A;  2NRZ A;  4QIW F;  1QQ6 A;  1XFR A;  2KHV A;  3PO5 A;  3M1Y A;  1DVI A;  3CDN A;  2PI4 A;  3KHH A;  2KG5 A;  2W7O A;  3RJJ A;  2ZIX A;  2KZM A;  2BCX A;  3C5G A;  2ZUD A;  2KSO B;  1T14 A;  4YR0 A;  1RRO A;  7ICR A;  3QUT A;  2BPG A;  1TNX A;  4I5N B;  1COK A;  5ALL A;  1NYA A;  1SV0 C;  3PSF A;  3ETR A;  2W7P A;  5JJG A;  1SXE A;  2PKE A;  4CF3 A;  3CZ2 A;  4M6W A;  4ORC B;  3TKA A;  1KSP A;  2H3Z A;  2WF5 A;  1CB1 A;  5GTH U;  3GOF A;  2DL0 A;  3K1Z A;  2LYB A;  4YP3 A;  8ICS A;  1FPW A;  1EG4 A;  1PVB A;  4LZD A;  4DL5 A;  2KN7 A;  1NP8 A;  1SL8 A;  1GM0 A;  1DF0 B;  2ASJ A;  4AYB C;  9ICV A;  1B22 A;  4C8M A;  1SL0 A;  3S0A A;  2K2F A;  2KKP A;  4KLU A;  3EKH A;  4ECW A;  2YGU A;  2BE6 A;  2JTZ A;  4UAV A;  4FFD A;  4MBE A;  2JV3 A;  2VKQ A;  3I76 A;  3GDX A;  3LCP C;  4R63 A;  2ZUB A;  2LLT A;  4TUP A;  5B5E U;  2HF5 A;  1SXD A;  3G6Y A;  4ED8 A;  1Z4H A;  1CFF A;  1JC2 A;  4M9N A;  4XRH A;  1Q46 A;  1WDC C;  2YQE A;  3NS1 A;  1XWL A;  4R66 A;  4UAZ A;  3FAH A;  4ECT A;  2K8B B;  1AUI B;  1V85 A;  4FZM A;  2A19 A;  1EH2 A;  3NGD A;  1DK3 A;  3Q8I A;  5KT3 A;  3RH5 A;  3RB3 A;  4GC7 A;  1QAS A;  4EBE A;  9ICW A;  4DL4 A;  1RPL A;  2ZIW A;  4MHV A;  4UAW A;  5EWF A;  1XK4 C;  5HL1 A;  2PFN A;  3HKZ F;  1CKK A;  4QZ9 A;  4O3S A;  1A4P A;  1Z4N A;  9ICP A;  4UAS A;  2LYA A;  9ICQ A;  1CDP A;  2EHB A;  2J6T A;  4MEY A;  2ZIV B;  2HHW A;  3RAQ A;  1NCX A;  4QWA A;  5ALI A;  2LBO A;  2MA1 A;  4GFJ A;  4DQP A;  4JK1 A;  3SS5 A;  5AIC A;  1PK3 A;  2W11 A;  2EC6 B;  3RF9 A;  2ZIU B;  1SL1 A;  4F72 A;  3BQ3 A;  4HRE E;  1L7N A;  1K1Q A;  3RB0 A;  2JOJ A;  3KTQ A;  3NSI A;  4F5O A;  5DBA A;  1LKY B;  2F3Y A;  4ZCU A;  2K7D A;  3RTV A;  1B1G A;  5F9L A;  1TNQ A;  2RGI A;  1EJ3 A;  1WY9 A;  3ICX A;  4F2S A;  1JX4 A;  4RUA A;  4UB2 A;  1UHN A;  4MLW A;  4MFA A;  3AAK A;  4QIW C;  4P0P B;  4EBC A;  1QV0 A;  2ZXI A;  4LZG A;  3PM2 A;  3MGI A;  2F8K A;  4DUQ A;  4R65 A;  2EQY A;  8ICB A;  2W9C A;  3TAP A;  1RXW A;  3AU2 A;  5DQG A;  4QJF B;  1TAQ A;  1NZP A;  2JXL A;  4BWJ A;  1A76 A;  5KFX A;  2VJ4 A;  3BZK A;  3HP6 A;  2ZTD A;  2WCF A;  1A29 A;  1BOC A;  1TTX A;  3BDP A;  4ED2 A;  2F1I A;  7ICT A;  1JF0 A;  2KE7 A;  1KFX S;  1U47 A;  1X6I A;  5AKL A;  2KI6 C;  1Y88 A;  5D46 A;  2L51 A;  4UAT A;  1V38 A;  1DGV A;  5BOM A;  5CSN A;  2P6R A;  5EE3 A;  4QNL A;  3H4D A;  3QUQ A;  1TUJ A;  5J2H A;  5AI0 A;  3DF0 A;  3IN5 A;  1QVI Z;  2KPH A;  1X2I A;  3BQ2 A;  1D9F A;  2JWW A;  1ZQN A;  1L2O B;  5DG9 A;  1XU4 A;  1J97 A;  1WWV A;  1Y6W A;  5HHH A;  5KFN A;  1AJ5 A;  4PE4 A;  1KQV A;  1RFJ A;  5H2F U;  4DEZ A;  3TFS A;  4PAL A;  4BJQ A;  3WK7 A;  4O3M A;  3AQE A;  1ZQK A;  4NLG A;  1NK9 A;  1R2U A;  4ORA B;  2AU0 A;  3QEA Z;  1ZRM A;  1B7T Y;  1SIJ A;  4UB4 A;  1V1G A;  4M2O A;  3QU2 A;  2JPT A;  4ZOH C;  4QJ5 B;  5CA7 A;  8ICC A;  2LMR A;  2VA2 A;  3U26 A;  1MSW D;  5D3O A;  4DFK A;  4TQS A;  3HCM A;  4TQR A;  4Y2T A;  4OO1 J;  4MFC A;  2JTT A;  3NUQ A;  4DSE A;  5J0W A;  2XVT A;  5KNI A;  3PNC A;  4DSJ A;  2VA8 A;  5JUM A;  3CLN A;  4NDC A;  5EL2 A;  4C80 A;  2BE4 A;  1ZQS A;  3TUY C;  2BPF A;  4KLH A;  1UPH A;  3VGO A;  4EYI B;  3E0F A;  1KFU L;  3D74 A;  1EXR A;  2PSR A;  1PVP A;  1SWV A;  1X42 A;  1NNL A;  5HP4 A;  1MQ2 A;  2VRG A;  2M7N A;  2P6U A;  4PHM A;  4ED6 A;  8ICL A;  2AAO A;  5KFJ A;  1LXF C;  3OHA A;  3R1O A;  4M9J A;  5III A;  5FI7 A;  2W3S A;  1BPB A;  3HKZ C;  4Z6D A;  3V7K A;  5DGB A;  4F91 B;  9ICN A;  1GQM A;  1KK8 C;  1MHO A;  1ZXI A;  3M6K A;  1HQV A;  3QRX A;  1N63 A;  3R72 A;  3IV6 A;  1JXL A;  5CR0 A;  4DCC A;  1BPD A;  3DV9 A;  3SAH A;  7ICM A;  7ICP A;  3PM8 A;  4M2Q A;  2CN1 A;  1FFU A;  5ALX A;  3PW5 A;  4DCK A;  4IS7 A;  4ETO A;  1QTM A;  1ZRN A;  1HUO A;  3L4L A;  2HOQ A;  2DKZ A;  5DKW A;  1C7W A;  1DGU A;  5I94 A;  3UXO A;  1WLM A;  4DOC A;  2KNE A;  3OX6 A;  2F8P A;  3SJS A;  3RB6 A;  1NK8 A;  2K4H A;  4KMU A;  4MF2 A;  2BBN A;  1IXR A;  2F77 X;  3Q8L A;  2BR0 A;  5DQH A;  3MR2 A;  3DZT A;  5KFT A;  4RT3 A;  4CE6 A;  2K7B A;  2P66 A;  3BYA A;  3CP8 A;  1NKC A;  4IC9 A;  1DJX A;  2PMY A;  1XYD A;  3S0E A;  3H0L B;  1S97 A;  1ZQJ A;  4C8K A;  4F7F A;  4F71 A;  3KKA A;  3ISB A;  4DWI A;  4NLZ A;  5J2C A;  4I2H A;  4I2D A;  1DEK A;  1TCO B;  2WAQ F;  5KFK A;  3H8M A;  1ZD3 A;  2F2A B;  2KQ6 A;  1Q3V A;  1AK8 A;  1YTZ C;  2I6X A;  1UT8 A;  3THV A;  2QDI A;  3OP0 A;  4MRX A;  3D0Y A;  5KL1 B;  4BY4 A;  5G5G A;  5J0O A;  2K8M B;  3WK9 A;  5KFY A;  4KLF A;  3WU2 U;  3GQC A;  4INX A;  1KN5 A;  4YGB B;  3WKE A;  3SZ2 A;  1OOG A;  2WB1 F;  2BKH B;  5ALO A;  4O5C A;  3PW0 A;  1J2N A;  3M6Z A;  1OSA A;  5AI8 A;  4HSZ A;  4IRK A;  2KDH A;  5KT6 A;  4TNC A;  4RQN A;  1OW4 A;  5ALW A;  3D2Q A;  3RJF A;  3SIB A;  1B4C A;  3MGV A;  2KLE A;  2GGM A;  3RJK A;  1ZUZ A;  5DDM A;  1TV9 A;  2JQ6 A;  3TDU A;  3SG7 A;  1W7J B;  1XC9 A;  3LWL A;  4KLO A;  1PSR A;  2H8V A;  3C2K A;  2BCS A;  4DL3 A;  1Z3E B;  2BAP A;  5J2B A;  3F5A A;  4M9H A;  1WRL A;  4Q04 A;  1AP4 A;  5AKY A;  2H2K A;  2H5X A;  3L4P A;  5L1K A;  1IM4 A;  2F3Z A;  1MC8 A;  4DQR A;  3QU5 A;  3SD7 A;  5DG8 A;  2BCR A;  4EZ6 A;  3WKA A;  5EE9 A;  1B47 A;  1CFD A;  4I2I A;  4NDD A;  3S0F A;  3D2N A;  2KI6 D;  2XID A;  3F2B A;  4DFM A;  1O08 A;  3WK8 A;  4IL6 U;  2BL0 B;  3KHR A;  5KT5 A;  4IQT A;  3F5E A;  1ALW A;  1SZH A;  5JU5 A;  3IHQ B;  4CCH A;  1YUR A;  3EVV A;  1XFY O;  4RNN A;  3PSI A;  1OOF A;  4M04 A;  1NPQ A;  4DSF A;  2LMT A;  2WTF A;  3H4S E;  1SCM B;  3AM9 A;  1N2X A;  3AEV A;  3QUC A;  8ICU A;  1S5G Y;  4UB5 A;  5CP2 A;  3AU6 A;  1WCL A;  1ZD4 A;  4UB3 A;  1QJT A;  1F4Q A;  5J0Y A;  1QQ7 A;  5AIA A;  4EEK A;  3SR6 A;  3V7L A;  3JPP A;  4KLD A;  1ZQR A;  4ELT A;  5EOZ A;  4J9S A;  2EGD A;  2OTG C;  1J7O A;  1JXE A;  2BDU A;  2W03 A;  2JUL A;  5ALS A;  5IBW A;  4J9P A;  8ICZ A;  4C4S A;  4A8E A;  1YUU A;  2EDU A;  3I5H C;  3EW9 A;  1XSP A;  1WWU A;  5DG7 A;  1NX1 A;  3PVX A;  2JNF A;  2HDO A;  2EZY A;  4GGN A;  1SYM A;  1F70 A;  2E30 A;  1FI5 A;  2YMQ A;  3ALR A;  3H8J A;  3PN7 B;  4Z6F A;  1TWO A; 
#chains in the Genus database with same CATH homology
 2L5Y A;  5JRT A;  1Z1V A;  3SEN A;  3TAD C;  2LMR A;  2QB1 A;  2LPE A;  5D3O A;  1PK1 B;  2QKQ A;  4I5K A;  4MHV A;  3OBV A;  2E8M A;  2FE9 A;  5KNI A;  3K1R B;  5HL1 A;  1LKY A;  1F0M A;  2KSO A;  4RQN A;  2BNX A;  2DKX A;  3BS5 B;  4JKT A;  1UCV A;  1X9X A;  4GAO A;  2KLE A;  1X40 A;  2QB0 A;  5JTI A;  3TAC B;  2EAP A;  2E8P A;  4NL9 C;  4MEW A;  1B0X A;  3IVT A;  3SS5 A;  1PK3 A;  2K60 A;  5FI7 A;  2EAO A;  4PZN A;  1DEL A;  2KG5 A;  2ESE A;  5J8Y C;  2KMD A;  2KIV A;  3KKA C;  2BAP A;  3BQ7 A;  1LKY B;  2QAR A;  2KSO B;  3IDW A;  4IJ7 A;  2EAN A;  3SS4 A;  3O4X A;  2F3N A;  3TAD A;  5F3X B;  4I5N B;  1COK A;  2KLD A;  4KYN A;  1SV0 C;  3KEV A;  1W9Z A;  1SXE A;  4PZO A;  1Z2C B;  2F8K A;  1PK1 A;  3PM2 A;  4IS7 A;  1OXJ A;  1SGG A;  2DKZ A;  5JU5 A;  1RG6 A;  1SV4 A;  3SEI A;  2DL0 A;  2K4P A;  5I94 A;  2GLE A;  1DC1 A;  1JI7 A;  3BS5 A;  2KE7 A;  4NL9 A;  2E8N A;  1V38 A;  1X66 A;  5L1M A;  2EAM A;  1B4F A;  2YGU A;  2ES6 A;  3BS7 A;  2B6G A;  1UQV A;  2D8C A;  4I5J A;  2Y9U A;  2QB0 B;  2E8O A;  4I5L B;  2JV3 A;  3HIL A;  5J8Y A;  3UO9 A;  3KKA A;  3EG5 B;  1DXS A;  2D3D A;  5FI2 A;  1DEK A;  3SS3 A;  1SXD A;  1Z4H A;  5FI6 A;  1WWV A;  2YTU A;  3H8M A;  1OW5 A;  3UNW A;  4NJ8 A;  1WWU A;  1KW4 A;  2Y9T A;  4GBA A;  1SV0 A;  4RQM A;  2QAR B;  2F44 A;  1V85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...