2K60A

Nmr structure of calcium-loaded stim1 ef-sam
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
GSHMASSEDEKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insights into STIM1-mediated initiation of store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN (Stromal interaction molecule 1)
total genus 45
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2k60A02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2k60A01
1B4FA 1PK1A 2D8CA 1UCVA 2D3DA 5L1MA 1JI7A 1X40A 1RG6A 1Z1VA 2QKQA 3BS7A 2KE7A 1LKYA 4NJ8A 1SV0A 1F0MA 2GLEA 1DXSA 2QB0A 1WWUA 4IS7A 2DKZA 3H8MA 1OW5A 3BS5B 1X66A 2KMDA 5J8YA 4MHVA 2QARA 5F3XB 2F3NA 2LMRA 4RQMA 4PZNA 2K4PA 3BQ7A 1SV4A 1V85A 1SXDA 3TADA 2DL0A 3IDWA 2QARB 5J8YC 2B6GA 2E8PA 2JV3A 4PZOA 1PK1B 2F8KA 2KSOB 3K1RB 3HILA 3TADC 1SV0C 2QB0B 1X9XA 5KNIA 2ESEA 2LPEA 1UQVA 2Y9TA 1WWVA 2YTUA 1V38A 2Y9UA 5JU5A 2FE9A 2EANA 2KSOA 5JTIA 1PK3A 4NL9A 2ES6A 5JRTA 2QB1A 2E8MA 1B0XA 3BS5A 2EAOA 1SGGA 1OXJA 2KIVA 3KKAC 2E8OA 3SENA 1LKYB 4NL9C 1COKA 1KW4A 3KKAA 3TACB 2F44A 2EAPA 2EAMA 4RQNA 2KG5A 2DKXA 2K60A 1SXEA 3SEIA 2L5YA 2E8NA
chains in the Genus database with same CATH superfamily
3M7DA 8ICOA 3PR4A 4P4PA 4ECVA 4O9MA 5KFGA 5I94A 4YMNA 1RG6A 3WK6A 2KE7A 4FTGA 2HBJA 2RDIA 3RAXA 1S26D 2BDUA 1SYMA 3MR2A 4YD1A 1CNPA 1B47A 2B21A 4IQTA 4DSFA 2K2AA 3WK8A 2W9CB 4J9SA 4O3SA 2C22A 4PHMA 3D2QA 1N60A 4MF8A 9ICMA 1PVRA 2WF6A 4TQRA 4QIWF 3RJEA 1BU3A 1SSEB 5I2QA 4DS4A 3AU6A 4GAOA 2M7LA 4QZ8A 5HR6A 4P5OE 5F6TA 1J1DA 1SZPA 1TK8A 2JZBB 7ICJA 5KFLA 2ZUDA 3EPGA 1A03A 1F71A 1XWLA 1ZQLA 4K4GA 3EK8A 2VA8A 3DDHA 4OO1J 5EE1A 3HJEA 2M0NA 3RB4A 3OGNA 3V7JA 4RQ2A 3PW0A 1GGWA 1KL9A 1UHJA 2XY6A 2P70A 4CIDA 1N48A 2Y9TA 5CJ7A 3T5LA 3UXNA 3Q8QB 3BQ0A 1KFSA 3BDPA 5L1IA 4AYBF 1EXRA 2ZUCA 4BY5A 2ASDA 3KZIU 5ALUA 3NVVA 1RJVA 3MR6A 2BZFA 2HI0A 4KLHA 3T5KA 1NPQA 5I2OA 1L7OA 1OE9B 7ICGA 4PGYA 3AAJA 8ICFA 3OP0A 1MXEA 5KFXA 3THVA 8ICRA 3ALRA 3QUBA 1ZQBA 2JEJA 1A76A 4I2HA 5DB7A 4DS5A 3PX0A 1SGGA 2FPKA 1BPDA 3N7SC 2JULA 8ICLA 3K4GA 4OCZA 1KQMC 1NK0A 4ECSA 2M7NA 2K7OA 4DL3A 1QCKA 2PFPA 7ICMA 1M63B 2M1KB 1CM1A 2W3RA 5ALLA 4DQPA 4GBAA 1TAUA 4ELUA 3JPSA 1MF8B 5KFOA 2XGPA 3HKZC 1XVJA 1Z00B 1NI3A 2NZ0A 9ICUA 2K60A 3FC4A 5KFVA 8ICPA 3JTDB 3DVMA 3WK5A 5KFTA 7ICPA 3OSPA 3QU7A 3OSNA 1QIWA 1DT7B 3OX6A 1RFJA 4QZ9A 2C2DA 3TAPA 4TUSA 4I5KA 1UCVA 3KFUF 2W43A 4X5VA 4GGFC 3A4UB 2V53A 2Y1IA 4ELTA 1NCYA 3D75A 2H3VA 2JH7A 2QKQA 2WCJA 3GV5B 4NJ8A 3ZDEA 4GUKA 4IS7A 4M9GA 3K1ZA 2NV3A 5KT6A 1DMOA 1OOIX 4M47A 2JXLA 3I76A 9ICPA 2HHVA 4RU9A 4MHVA 4Q04A 4Q43A 1YZ6A 1MQ3A 1DELA 4RQ5A 2BCSA 1SKTA 4NLNA 2JU0A 1NX2A 4YI9A 4ZOHC 1UHIA 4UBBA 4M2OA 4EZ9A 5AM3A 2PVBA 3MSEB 2LMUA 3LK0A 5AM4A 1W7IB 2VJ4A 5IBWA 3OHBA 3DVEA 1ZD3A 2BCBA 3RF9A 4C0ZA 3PZPA 3Q8MA 2KJ9A 3GQCA 2DL0A 2NLNA 4MFCA 4C8MA 3QUQA 3R1VA 5J2CA 5AERA 4BJQA 2L51A 5J2IA 2TN4A 3GV8B 4F3OA 5KT4A 1B9AA 2JT3A 4O3NA 4YG2A 3EKHA 3ZD8A 2FCDA 3FDSA 2DGZA 1NP8A 1RXWA 2L98A 1X9XA 2JC2A 3RH4A 4PE1A 2AXTU 4F2SA 2JRFA 1QTXA 2B0CA 4EEKA 2I7AA 2AAOA 2YTUA 2KI6C 4DOAA 5DB9A 5J29A 2P6RA 1ZOTB 4MEWA 2IMWP 3GDXA 2JT0A 1OOJA 2Y1NA 3GIIA 2KAXA 1XFWO 4DCKA 5AHXA 5AK4A 5AM0A 4CDGA 3I5HC 1QV1A 2NRXA 1RK9A 3NVZA 3NS1A 5HYDA 4DF4A 3CW2C 1ZQVA 1AVSA 1YX7A 4UB1A 3EG5B 3FE9A 5J0WA 3KEVA 1QVIZ 4M9JA 1QLKA 1KSPA 4Y2SA 1MHOA 3KO0A 3I5HB 3D77A 1ZQMA 4I2BA 4OJLA 1OXJA 1A0PA 1QJTA 4KMUA 2W9AA 3F53A 2XC9A 4NL9C 1XO1A 3M8RA 1HEKA 1PVQA 3TACB 5TZVA 1DRGA 3PFVA 4F5PA 1W7JB 5CPVA 2QEBA 1DJZA 2RRDA 4F5OA 2KFGA 4MSPA 3I1YA 1ZQFA 3F2CA 2CPRA 1M39A 1ZQAA 4I2EA 2I1QA 3DEEA 3QU2A 1YRUB 5KFAA 2ZIUB 3V72A 3B0XA 4M0AA 3CR5X 1U48A 4QJFB 3OB1B 1K2HA 1A2XA 1U45A 3LL8B 1NK9A 2BPCA 4ED3A 1CUKA 9ICAA 1SKWA 1OZOA 2GLEA 1IQ5A 5KFBA 5DICA 4LVSA 4I2GA 3DF0A 1BT6A 1ZRMA 1IKUA 5IIKA 1X66A 5HHIA 2V4QA 4DSEA 3K75D 2OHFA 4XA5A 2WF5A 5AK3A 2GH1A 4IQWA 1MC8A 5BOMA 1L8LA 4GXKA 2MAZA 2A1AA 1MSWD 1GJYA 2LCPA 1W9ZA 2MUTB 2IHMA 2WC8A 1TK0A 3IP4B 1JMSA 4Z6EA 4O5KA 1ZQQA 3DXLA 2ASJA 2AJQA 4PHDA 2Q4TA 3SZ2A 1AP4A 3QXGA 3MGIA 4PHAA 5HLVA 4R66A 2KGBC 4F93B 4YCXA 1KQMB 4FS2A 2JV3A 2BGWA 4FZNA 8ICNA 2LM4A 3N7RC 3OBVA 3BQ3A 2MAXA 2ZIUA 3R72A 2F8KA 2KSOB 3K1RB 3TADC 3NSOA 2J6TA 2UVRA 1S5LU 3GIJA 1TN4A 5KG7A 4DFPA 4EENA 1D1OA 2W7OA 2WNDA 2ZIWB 3QRXA 1S0VA 1QASA 4DFKA 3SAHA 2K61A 5FYXA 5GQQC 3OHAA 1B1GA 1SL8A 4JPZB 2OWOA 1T3NA 1BOCA 1QIVA 2EANA 1Y1XA 3L4AA 5JTIA 2DOQA 1PZNA 1FI6A 3UM9A 1CDNA 7ICSA 2A19A 4KLMA 8ICAA 1NWDA 1DJWA 5HP4A 4HRHA 3SS4A 3RB3A 9ICOA 2W9BA 2G06A 1ALWA 1N0YA 3OPXA 3HPOA 1L7ZA 2HQWA 2KJ5A 3S0DA 2ZIXB 3HX4A 4YXMA 2GO7A 2EZXA 2WF7A 2I9GA 1N65A 1S5GY 1ZFSA 5EWEA 2BE6A 2KOBA 1J2NA 2KG5A 2LYBA 4FQOA 4BGDA 1HUZA 3C21A 1UT5A 3C1YA 1RROA 1TCOB 4NLZA 2FJYA 5DDYA 2AUCA 4MBEA 3BZKA 4F50A 4NDCA 1T4GA 3SS3A 2PFNA 2JOJA 4YVZA 1G4YR 2YMLA 2KVCA 5KFIA 2LP2A 5CSNA 2HCFA 1S97A 1D8YA 4BUGA 4BXOA 4A8EA 1Y1AA 2Y4QA 3BQ2A 5HKWA 5DKQA 4C0LA 1DXSA 1N5XA 1LA0A 2BNXA 3CTNA 4M6WB 4HYKA 4N1FA 3PY8A 4KN4A 5C0YA 1EJ3A 2ZXIA 3PSIA 1CFCA 1Y0VH 2O5GA 1KN5A 1KFDA 4QZFA 3QU5A 4N1GA 2I18A 8ICHA 3QU9A 3BQ7A 2WFAA 1RPLA 2ZIWA 4DQSA 2WORA 3BZCA 5ALWA 1SNLA 4QWAA 1Q3UA 2LUXA 2BKIB 4N5XA 2AGPA 5KG2A 2JTZA 5L9XA 4RPZA 3PO4A 5CWRA 1BLQA 2JH1A 2K8BB 4C80A 4DF8A 3EK7A 4A4BA 2LC5A 2WCBA 4UW9A 4WQ3A 2WCHA 3EVRA 5J2DA 2Q4UA 3MABA 4RUCA 3CS1A 4DSKA 2F8LA 2YB1A 1A6SA 3PN7C 3JPQA 1EXNA 5KT5A 4B9TA 7ICIA 5KFDA 1ZQEA 1ZD2P 2NRZA 4FO6A 4YP3A 1FF1A 2E8MA 3M0WA 4NM2A 4NDDA 3I5IB 4F92B 1BJFA 4AQJA 3L4PA 4YR2A 2L50A 2M49B 3RB6A 3OJUA 1L7PA 3QE9Y 2BAPA 2HBLA 2E3TA 2KHQA 3F2BA 2WTFA 3AU2A 3KF9A 4UAVA 5PALA 1NUBA 8ICTA 5GTHU 5J2KA 5ALRA 2FCEA 1XFXO 3WK9A 1COOA 5KFNA 1LA3A 1LVCD 2I94A 1CLMA 2W9CA 3CNHA 5DDMA 3GV7B 1RYSA 1K93D 4ZH4A 3H40A 1MN8A 9ICJA 1AQ6A 1GM0A 4Y2QA 1KCYA 4NXZA 5ALPA 1JF2A 3UPQA 1F4QA 1BNOA 2ZN8A 1T7PA 4UASA 2K4HA 4CF5A 4YN4A 1XFUO 5ALQA 4KLTA 4B9LA 3WKEA 1OZSA 3H8SA 3WK4A 3MGHA 1KSOA 2H8VA 2Y1MA 2RLTA 3LDAA 2LVIA 1AK8A 4C8NA 2KLDA 1DJGA 1BR1B 4QWCA 2DKZA 1XU4A 3HRDD 4JKTA 2K89A 4PT1A 1U9LA 3CGAA 1QQ7A 1BPXA 2KMDA 7ICUA 4PCWA 3V6HA 4DFJA 1XSLA 2A3VA 3WNXB 1N62A 5L1LA 3IG8A 1UURA 5IINA 7ICHA 5DQIA 5F9LA 4DL6A 1Z2CB 2L4IA 2KBIA 2IOHA 2PI4A 5KFUA 1JSAA 2W04A 4ECXA 1AHRA 3SG4A 4ECUA 4I2JA 2KFHA 3MFHA 4JUZA 4WJ3B 4F71A 3PATA 1ZQWA 5FI6A 1KFXS 1NK4A 2HBMA 3CWGA 3RJIA 3Q8LA 3S0EA 4OJ6A 4CE6A 1DEKA 2FDRA 4AOMA 4JQ0D 2YY6A 3HILA 1R2UA 3H0LB 5AKLA 5HKYA 1JC2A 3A8RA 3FWCA 3PJIA 2VJ5A 1JRPA 4TNCA 3KZXA 1V9PA 4JWMA 4NLBA 2JWWA 1K1QA 4YMOA 1P28A 1QVIY 2BKEA 2HBKA 5KFKA 5EE0A 2I5HA 2NO4A 9ICRA 4P2HA 2HOQA 1V1GA 4PH5A 4I2DA 3BQ1A 3PALA 2LVVA 1JWDA 3SG7A 3C28A 1ZQYA 4C8OA 3BOWB 4XYNA 2NRVA 4NLGA 2IOFK 3RFAA 3KKAC 1CFPA 4QWBA 3V6KA 1SL2A 2IHNA 5AANA 5HMMA 4DLEA 1URJA 1SZHA 2FJ6A 5KSZA 3JPNA 4DSIA 3O0FA 2KIWA 4F2RA 2P66A 1NJYA 4P2YB 9ICIA 4OCIA 1C7YA 1HUOA 1IV8A 2YGUA 2KQYA 5BPJA 4C0JA 2E6WA 3G6XA 2R8GA 3SEIA 2L5YA 4KLDA 4HAIA 4GLXA 1C7WA 4MZLA 3F2DA 4O3PA 3UMBA 4PHPA 4F4XA 1H4BA 3KBBA 4MVFA 4RNMA 4EYHB 5J0RA 1SCMC 3FIAA 3G6YA 1S36A 3NRZA 1S6CA 5CB1A 1EG4A 3BS7A 1PALA 2PQLA 1WLMA 1CTRA 3FYHA 1FPWA 2KKPA 2P71A 4CRXA 1S0OA 5AM2A 3DYEA 4IRKA 1KQVA 4Z6CA 1BPYA 1F70A 4DOBA 2XO7A 2H61A 5JOLA 5KT7A 4F4ZA 1K8UA 1QXPA 1SMGA 2SASA 3MR5A 3M9MB 2ISOA 2P6BB 3OX5A 2LMRA 4NQGA 4DOCA 1UHHA 1J1EA 2R8KA 1PSRA 5G08A 4ED6A 1S9FA 4KLIA 3B86A 2BE4A 5CRXA 4NLKA 2H2KA 1WCNA 2BCVA 1NYAA 2AGOA 3RLZA 2F8PA 3EYZA 4P0PB 1VLBA 4U8DA 4GXIA 3UMGA 2AQ0A 4P4MA 4Q8FA 3NGVA 3RJJA 2FLPA 1DJYA 3N7HA 1G8IA 2F76X 3SAFA 2QB0B 5KL1B 2G0AA 2PSRA 5EE3A 2CT9A 1XFZO 2V9WA 5KTYA 3HCMA 2LNKA 3LVVA 3AAKA 4UAWA 4IJ7A 1A77A 3DF0B 3RBEA 4BWJA 2QACA 2KAYA 2XI9A 2YN4A 1KFXL 1X42A 4Y2TA 1SK6D 1DGVA 5D4BA 3O4XA 1OOHA 3UXOA 2C2EA 5B8IB 1DTLA 5HHHA 5DKNA 4A4CA 4NL9A 1NKBA 5TISU 3NVWA 4OD0A 3IM1A 1KEJA 3CLNA 3HWTA 5JJGA 4ICAA 2DPIA 1L3VA 5KFJA 4CPVA 4ED2A 3U26A 3QU4A 2W54A 3D76A 1N63A 2DQNB 5HMLA 4OV2A 2IBKA 2M97A 1F5SA 3F5EA 1YVHA 2LV7A 4LZGA 4MN0A 5AKKA 1TOPA 5AK5A 3CYMA 2OCEA 4ECZA 4RNOA 2BQ3A 2JTTA 1K5OA 1NCZA 3PX6A 3RR7A 1KWOC 1K9UA 3CZ2A 3LYSA 1B4FA 2J6UA 2K8CB 2K4IA 4Y2UA 1DF0B 5AKHA 1PK0D 2E1FA 1BG1A 3IHQB 4J9NA 1YRTB 2EHBA 2L2CA 1C3YA 4GIBA 2AQ4A 2BQUA 1Z19A 5DBBA 1GGZA 3RJKA 1F0MA 1SV0A 2BR0A 2F2OA 4ZCUA 1BF5A 5KG3A 1IGVA 1TUZA 4DFMA 2SCPA 4CFQA 2OEHA 2WAQF 3PSPA 1NJZA 4DRWA 1LB2B 3ZDCA 1WG8A 3NVYA 2LAPA 4PHJA 1YR5A 1BNPA 5BOLA 3KHGA 3TFSA 4PE4A 2YMQA 4RQ7A 1RECA 1CMFA 5ALXA 2KAVA 2LM1A 3H0MB 1YX8A 4B9UA 5DB8A 2PKEA 2KKVA 1TAQA 2O6KA 3B9JA 3OTQA 1J7QA 1B7TY 4F0ZB 2G08A 5ALTA 4ED8A 3KHEA 3V7KA 3V2LA 4YGEB 2UVWA 4Y2YA 2BCUA 2E8PA 4JWNA 2MA2A 2KFFA 1OMVA 3WKDA 1K94A 1PVBA 2GGMA 2W9BB 3K21A 2CN1A 4BDPA 2ZXHA 2JQ6A 1UQVA 5IIIA 1AUIB 1SB3C 1BMOA 4O3MA 2KV2A 1MUXA 1V38A 1X6IA 2A1JA 3EPIA 4MZJA 2Y9UA 1WCLA 3FM9A 5KG1A 1WY9A 4GFJA 3PMLA 2YMMA 2HOFA 4MEXA 2LLUA 4Y2PA 2ATLA 5AKXA 3F5AA 5HL1A 1PVAA 2R8JA 2VRGA 2PRUA 1KBUA 2OM6A 2ALZA 4UATA 2LYHA 2Y0SC 3BS5A 1DQEA 2G9BA 2LVJA 2WB1F 4PHKA 4USLA 3O4YA 4RPYA 3AEVA 4YFKA 5KFYA 5HKZA 3MFIA 2ZJ8A 2KGRA 5J2FA 1QQ5A 3C29A 2G5HB 3PM8A 3BUXB 5ALGA 3PMNA 9ICHA 4C4TA 4QZAA 4F72A 4PALA 4J9KA 2LI6A 2XVTA 1T94A 2FPMA 2H3QA 1H8BA 1YUTA 1K96A 5TNCA 1NNLA 1ZRNA 2JPOA 2NRTA 2KEYA 4IRDA 3EVUA 2QEVA 2KHVA 2DF4B 4PHEA 4KTQA 2M0RA 2D8CA 4PE7A 3JPTA 2DUYA 2PXIA 3QUCA 2BPGA 1TRFA 2KLEA 2BQRA 4RQ4A 3N7PD 4RNNA 5DQHA 3FAHA 3S6JA 4G3IA 3SIBA 2M3WA 2AMIA 3ISBA 1WWUA 2W7PA 3TI0A 4KLGA 2LP3A 3R1OA 3H8MA 1QSYA 3C2KA 2WCKA 2ZUBA 1J55A 3BS5B 4LJXA 1QLSA 1X9SA 4Q8EA 3O6BA 4DLGA 5F3XB 3WKAA 2GV5A 2HPSA 1TNPA 3LLEA 1UA1A 1Z4OA 3RJHA 2BCQA 1IRJA 5K89A 1D9DA 1ZACA 4YQWA 1H38A 1DJHA 3PM2A 4GGNA 3V6JA 4PHNA 3SG5A 2L2EA 4O3QA 4J9RA 2F3ZA 1YT3A 3ZNIA 3S0AA 2LBOA 5J3XA 1CB1A 4PZOA 2QPTA 3TDIA 3RH6A 1D9FA 1TNXA 1NKCA 5DLFA 5KT3A 2W8LA 1ZOLA 2MBXA 5KNIA 2D8NA 4MRYA 1RTP1 9ICLA 2LKYA 1C20A 5EOZA 2RHFA 2JGAA 4KITB 4QZDA 3MDAA 3ZDDA 2QEHA 1TNWA 1UHKA 4DSLA 8ICYA 2CXYA 7ICOA 1SL9A 3CABA 4YRUA 4UB3A 3RR8A 1BPEA 1A75B 2W3SA 1FEZA 2LMTA 3JPPA 2FLNA 1CEZA 1JX4A 1ZQCA 4IQUA 2EAOA 1KFUL 4PJ0U 3EW9A 4NDBA 4R65A 4MRXA 3TS5B 4YD2A 2P6UA 1WUDA 4KLJA 1IH0A 2E5SA 3SS5A 2MJWB 4QWEA 4TQSA 4BXOB 5EE9A 3BFBA 3AMZA 4QZEA 1U49A 2HQ8A 3LK1A 1CDMA 2BL0C 5CP2A 1IJ5A 5J0OA 4YR0A 4RZRA 4WQ2A 3D10A 4IL1A 1QX2A 1U4BA 4P0QB 2JNXA 3L5KA 2K7CA 4KN7A 1SR6C 4GC6A 2BL0B 3KHHA 3H8JA 2VA2A 1JALA 2HF5A 5B5EU 1N2XA 2BCRA 8ICZA 5AKYA 3D6JA 5L1MA 1XNSA 3I5GC 4IR9A 2HVIA 2LHLA 2YMPA 4OKHA 3A0BU 1J2MA 5AKGA 1X9MA 4DL5A 2QB0A 4U7CA 1Z1BA 3V7LA 8ICQA 3VRQA 5DGAA 1FIQA 2ZNDA 3AKBA 2KZMA 4M9NA 1L7NA 5J8YA 1TIZA 3AUOA 9ICKA 2F77X 2F2PA 2HMXA 1SL0A 2FLLA 3TDZA 5DGBA 1CDPA 1TVAA 2NRWA 9ICTA 4QJ4B 2KJ8A 2K4PA 5ALHA 5KT2A 1LKJA 3LVWA 5ALFA 4UB5A 3QZ7A 2KYFA 4EBCA 2BCAA 4XRHA 4US9A 4KYNA 3ICXA 3SG3A 3SMVA 2CBLA 1D8LA 5ALNA 1QATA 4Y2VA 3UO9A 2KPHA 2QARB 2EQYA 4CF4A 1IM4A 3SG2A 3TZ1A 2HHSA 3EKJA 5KL8B 1ZQZA 3L3FX 2JR5A 5ALVA 5A0LA 1BPZA 1S8OA 4KLLA 1XFRA 4QJ5B 5KU1A 1TTXA 3JPOA 5DG9A 1KK8B 1C7VA 3PX4A 4F5RA 4OJPA 1XO0A 2FMSA 5T14A 3NASA 1F4OA 1LV5A 3O2PA 4NV0A 1JXEA 3GIKA 2DPJA 3PSTA 4NM1A 2ZJ5A 4MEYA 2BBNA 2KOTA 2ES6A 4LZDA 3TQ1A 4JV1A 4P0QA 2WAQC 3MBYA 5ER4X 1ECWA 1M6YA 5KFWA 8ICEA 1DGSA 3WK7A 1U5IA 4QW8A 2KSPA 8ICUA 4F5QA 9ICSA 5GTIU 2L5XB 4XUSA 2AHOB 5L1JA 1N61A 1XFVO 2L4HA 3SG6A 1KW4A 5J0XA 4P0PA 1E8AA 2ZRSA 8ICCA 4EELA 2XY5A 1S6JA 2VA3A 4CFRA 5KG6A 3J81j 1Q80A 1UT8A 3ZI4A 4NLCA 4ORBB 4RQ0A 3TARA 4R64A 3PW7A 1Y1UA 1QS7A 1S5GZ 1K1SA 5E79U 4MFAA 4UB2A 4HRGA 2KVSA 9ICBA 3ORYA 3N4MB 1WDCB 5IIOA 3ZDBA 5AICA 4Z6DA 5EWGA 1F44A 1SL7A 2JEGA 4AYBC 4YGCB 3S0FA 2LYAA 3Q8RB 3M8SA 2F3YA 1IG6A 5AM1A 3IQOA 3I5FC 1S0MA 4DS7A 1JFJA 1NJWA 2KI4B 5HLOA 8ICIA 1B7TZ 3NUQA 1RM6C 3M9NB 9ICXA 4FBTA 4ORAB 4KMOB 3WU2U 1CFDA 4C0KA 3I5FB 1ZQOA 1JXLA 3BUNB 4PZNA 2Q0ZX 2XICA 5ALOA 1Y88A 1AROP 1Q8KA 2CCMA 1J7PA 1HIWA 4XJKB 1K90D 4YBHB 1SCVA 2JPTA 4DL4A 2WHEA 3TADA 3C5GA 2FMPA 4EBDA 7ICLA 3KD3A 1L3SA 5AFPA 1JUOA 1OMDA 2JXCA 2LM5A 2KK0A 2D6FC 4J03A 4AP9A 4RQ3A 3CR2A 2EDUA 2DFLA 4Y2JA 4M2QA 5AEQA 2KD1A 2MRLA 1L2OC 1OW4A 3BXKA 4J9MA 1S3PA 2M9GA 5CEHA 5FP0A 1FFUA 3RRHA 3PSFA 1CKKA 4F5NA 1CLBA 9ICVA 3Q8PB 2PASA 3LCPC 1FO4A 1QQ6A 3C2LA 4OVNF 1XYDA 4RQ1A 3SYZA 4R1EA 3S0GA 4JMUA 5J2GA 4DCCA 2ZIVB 4NWIA 1B0XA 4I27A 2W55A 4DQRA 1NX3A 2MU2A 1DK2A 4UAZA 1ZQJA 3H7IA 4WRIA 3CR4X 1MWNA 1N2DA 1QX7A 4BY4A 1TAMA 3BUWB 1UUSA 4UAUA 3PLFB 4I28A 5CHGA 4INWA 1G33A 2CNPA 3BFAA 4DEZA 4UAYA 4F8RA 4KLOA 5AKZA 3M1YA 3PN7B 1ZXIA 2XY7A 3IRUA 1X2IA 2G09A 3ZDAA 2P35A 3AN1A 1NX0A 2E8NA 3ETLA 5KFFA 9ICGA 1JN3A 3NGDA 3QX7A 3QZ8A 1TFRA 1TUJA 1IG5A 4C7ZA 2YQEA 3C1ZA 3OGUA 3MR3A 2K0JA 5FI7A 1Z3EB 2LE9B 4BX9C 3GILA 1A4PA 3VRNA 2EZZA 3ETRA 3ED5A 1KK7Z 2R8IA 7ICNA 5IIJA 1KK8C 1DOQA 5DBCA 4JWQA 4K4HA 2LMVA 3CZTX 4CGZA 2M9NA 2K4EA 1ZQTA 3KHLA 2Y1JA 3GK4X 1X9WA 3QEAZ 2W03A 2PFOA 2ZRTA 1PULA 1RWYA 7ICKA 3AQFA 4I5JA 1ZQKA 1UP5A 4TUQA 1VRKA 3CP8A 1NX1A 1A29A 2WC6A 3UMCA 1CLLA 4F91B 2DWQA 3NHIA 4KLFA 3VRPA 1M31A 5J8YC 2MA1A 1BGXT 3I5IC 4GFTA 1L8OA 2IOFA 1CI4A 1V1FA 3ICBA 1KTQA 2N1RA 5AIBA 9ICWA 1B8LA 4YR3A 5ALEA 3JPRA 1MR8A 2WCFA 1ZJNA 5DLGA 3GU3A 4U6PA 2J6SA 1MQ2A 4R63A 3GK1A 3M9OB 1WRZA 1KWOB 4R8UB 2JRZA 1P7DA 3DV9A 3GFKB 3D78A 3EVVA 3IN5A 3SV3A 2A1JB 2PFQA 1OQPA 2R2IA 3B87A 2XCAA 4DWIA 3BOWA 5JRTA 2B1UA 2XIDA 2H5XA 5ALKA 2ISPA 7ICRA 4INXA 3B88A 2WCEA 4PL2A 4CF3A 2EZYA 4DFDA 3MC1A 3Q8IA 4RPXA 3FWBA 2K7BA 1SKRA 1C07A 2CTNA 4KX5A 4RQNA 2HVHA 3H4BA 1NCXA 3HT3A 4KX3A 2OXOA 4I2IA 2ZKMX 1IWQA 3VRRA 2Z7JA 4ACOA 4RUAA 3E3RA 1NZBA 2W8KA 2ZN9A 1N5WA 1QWVA 2LHIA 3BJHA 1OOFA 3RTVA 1LINA 1SL1A 4PE0A 2ZNEA 2KZZA 4B9MA 1S77D 3LK9A 4ED1A 5CSFA 2KI4C 8ICXA 2XCPA 1WLZA 2ZG6A 1DK3A 1PK1A 4PGXA 1ZD5A 4F7FA 4B9VA 3RAQA 1KFTA 1NK6A 3TANA 4EX6A 2HOIA 2FOTA 7ICQA 4QWDA 1JFKA 1LKYA 1R6PA 4USAA 3M6KA 2I2RE 3C1VA 3T5HA 2EC6B 5AKIA 4JV2A 1V97A 2CRXA 1VJ5A 9ICFA 4C4RA 1TWOA 4O5EA 2BDPA 5KG4A 4I2FA 3PR5B 2ASLA 3F45A 1L3UA 2HETA 3KHRA 1CM4A 4E0DA 4G9BA 2HHTA 1X02A 5J2AA 3VC8A 5AI9A 1SV4A 1QSSA 1UHNA 3NSKA 3RH5A 1SCMB 1SKSA 1JUDA 1UWOA 3GZFA 1TCFA 1SRAA 4Y2XA 1Z4NA 3RJFA 8ICGA 1Y6WA 2OTGC 4KLSA 1Z4HA 2JEFA 4HREE 3C2MA 5KFRA 4KLEA 2RQ5A 3KOOA 4IL6U 5J0YA 4EEYA 2GTEA 3VB1A 1PSBA 4ED0A 1NIWA 2RGIA 1BODA 4FZLA 5JU5A 5CA7A 1XS9D 3L47A 4PGQA 1DVIA 1L7MA 2GWSA 2F2AB 3LWLA 3R1PA 3GK2A 1XK4A 3NSIA 3WXAA 2AU0A 2LLTA 5AM5A 4EBEA 1YUSA 5AK6A 3KTQA 1K95A 1F54A 1SPYA 1YZ7A 5F9NA 1QH9A 2FMQA 3NHTA 1XFYO 1LVHA 3SAGA 3HP6A 1QLNA 2ODGA 2OH2A 2ZTCA 5BPCA 1SWVA 2G07A 2H3FA 4P4OA 2H3IA 5EL2A 4CNQA 2VKQA 2ZTEA 1XK4C 1SIJA 3CYZA 4FS1A 5IILA 4ECWA 3WKBA 4J9QA 3H4SE 4DL7A 5C5JA 3H8WA 3WHUB 4TURA 3B6XA 1ZQRA 1DJIA 1SY9A 2WB1C 5KFEA 4RQ6A 3UQ0A 3QYPA 1SWWA 1IIOA 1IJ6A 4OJ5A 4M6WA 1BPBA 1WYGA 4YGBB 2YX8A 3AKAA 2PALA 1HJPA 4FE3A 9ICNA 1TK5A 2H3ZA 1RYRA 2WF8A 2K8MB 1DGJA 1ORGA 1X40A 1ZQ1C 5ALDA 1HT9A 4M2YA 3DVKA 1JBAA 5AI0A 1FW4A 2M29A 2VIXA 1WDCC 5KFQA 2HHUA 2ZJAA 4C7YA 3C5FA 8ICKA 2A4JA 1KK7Y 2JEIA 3TKAA 1S1EA 5DQGA 4RQ8A 2KQ6A 5DG8A 4M9LA 4AQIA 2XGQA 4GC7A 2NCPA 2ERBA 1TE2A 9ICEA 3H4DA 3QNMA 4E68A 5AI4A 2F1HA 1SXDA 3ONNA 1QSLA 2ZFDA 3OJSA 1QV0A 4DQIA 1HQVA 3O78A 1CFFA 1LXFC 1PVPA 1ZD4A 4GPLB 2HDOA 5KFHA 1A75A 4ECRA 1FBVA 3ZWHA 1SV0C 5KAIU 1XSNA 4YGDB 2PMZC 1KDHA 2ZIVA 1D8BA 1J97A 4K4IA 3IG5A 3T3FA 3EZ5A 1OMRA 1B8CA 3SR6A 3NTUA 5DG7A 2FPLA 4ECQA 3E0FA 5J0TA 4JB3A 5KFCA 3RBDA 1ZQIA 7ICFA 4FFDA 2KSOA 4RT3A 2OS8C 1K9PA 4I2AA 5AXIA 2WC5A 2R18A 3FE8A 5KG5A 1JF0A 1KRPA 2AH5A 5HNKA 4PPXA 3S0BA 1XO5A 4F4WA 1ZQGA 2KIVA 2K8AA 1L2OB 1M45A 4R8UA 2KHNA 5EWFA 2K2FA 2OPOA 1ZYQA 3MGVA 2OYYA 3WHTB 3DVJA 2ZTDA 4DUQA 8ICMA 4I5NB 3DZTA 1M46A 2ZIXA 3I28A 3IQQA 4I5LB 2NYVA 1U47A 1SXEA 3Q8SB 1AJ5A 3L4LA 4QIWC 3IV6A 3RJGA 2KDHA 1CDLA 1EG3A 2WCMA 1FI5A 3IF7A 2COLB 3PW5A 4NY8A 5I2LA 1RQLA 1PUZA 4UB4A 4J9OA 3T5JA 1JI7A 4DQQA 5KG0A 4ECTA 4C8LA 8ICWA 2E1EA 4MFFA 3M6ZA 5J2BA 4YGAA 1X6JA 3C23A 4O3RA 2JHDA 4DO9A 1Q46A 5ALIA 3QEBZ 3RRGA 3PVXA 5G5GA 2MLFC 2QARA 5J0PA 1UA0A 2UVVA 2M1UA 4ICBA 2GGZA 3B7AA 5KFPA 4QZCA 4RQMA 3N28A 3PNCA 1BR4B 2KBMA 5D69A 2GOLA 4UPGA 1L3TA 3KPXA 1IQ3A 1WRLA 1O08A 4B6JA 2L0PA 5D7FA 5AKEA 2E30A 3FS7A 1IXRA 5G5HA 2LANA 1WRKA 4IC9A 4O5CA 1YURA 4MF2A 3PSRA 5D46A 2BBMA 3VROA 3ZD9A 4O0IA 2F1JA 4ED7A 2KFZA 4UB8U 4L9MA 3BUMB 2ESEA 1OOGA 2MLEC 2BKHB 1WWVA 4DIRA 4YXJA 2JT8A 2HHQA 1N56A 1OUQA 2LLSA 4UBCA 4YI8A 5J2EA 3NXAA 2M8UA 2Y5IA 4UB6U 4EYIB 2WCLA 3JTDC 3TS5C 2CXJA 3BUOB 4PDZA 2KN7A 1TNQA 1S0NA 1PK3A 5DB6A 2KYCA 1DJXA 5AKJA 4US8A 3BJYA 1RYUA 4F4YA 3SQIA 4J9LA 4B9NA 3G6VA 3ISCA 4M2PA 3GIMA 1DGUA 1GO3F 3HKZF 3Q8KA 1COKA 3KKAA 1YUUA 2F44A 2EAPA 2EAMA 5B66U 2F1IA 1SW8A 4JD9A 2PMYA 4BWMA 3UXPA 4KLQA 2BPFA 4DL2A 2RP5A 3EWAA 2PI5A 2LVKA 3BYAA 5KTQA 2QLTA 1ZQXA 1DC1A 5J0UA 3I5GB 4PL1A 1ODBA 2F33A 1VDVA 2QDIA 4JK1A 1TKDA 5AIAA 2D3DA 1QX5B 1B22A 2OS8B 1XC9A 1Z1VA 1ZQPA 3D2SA 2LHTA 5AI6A 5JUMA 5J0QA 1ZQDA 2NO5A 3AL0B 2KNEA 3UQ2A 4XJKA 2IA6A 5KFSA 2Y0SF 4QZBA 1OW5A 3E58A 3TAQA 2W9MA 4D1EA 2KNJA 2KP7A 4OJOA 4CCHA 8ICSA 2F3NA 4Y2RA 3CZ0A 3CRXA 4IRCA 1RZTA 3TDUA 2VANA 4O3OA 1B8RA 3PW4A 1V85A 2I6XA 1XA5A 1C3ZA 1ZJMA 1EH2A 3D74A 5CSIA 5DKRA 8ICVA 3UNWA 3AM9A 4I2CA 8ICJA 3T79A 1ZMZA 1NSHA 3H0RB 2LPEA 4F4KA 3SV4A 3QMEA 1NOMA 4HSZA 2NXQA 2KZ3A 2BHNA 1Z00A 1RQNA 1S76D 1NZPA 1BVSA 1ZETA 1QTMA 3B0YA 5KFZA 4DSJA 1JROA 2H61C 2O60A 1SR6B 2MUTA 1U5IB 4UQGA 5CSJA 4B9SA 5I8NA 5J0SA 2R8HA 8ICBA 5DKWA 1TV9A 3DD4A 3R9KA 2WF9A 2AGQA 4JV0A 1MQ1A 5ALYA 3CDNA 5K4LA 1AJ4A 4FZMA 1RDFA 2KICA 1NJXA 3DY9A 2HSZA 2C2RA 2E8OA 4GXJA 3BFHA 5H2FU 1NK8A 1JIHA 3PV8A 2Q91A 1S10A 2EGDA 2LUCA 3JVTB 3D73A 4XQ8A 1J7OA 2DKXA 2W11A 4J9PA 5ER5A 4GNKB 4ELVA 5CR0A 3CZ1A 4QZGA 3K1EA 4RT2A 2MRDA 3OB2B 2MSNA 1K9KA 7ICVA 3BQTA 3PO5A 2OTGB 4YMMA 4QJ3B 1PRWA 4IR1A 5D3OA 2JXJA 3HX0A 5L1KA 2JZBA 4M9HA 3HW8A 3SI8A 3OHMB 1ALVA 2WOSA 1FFVA 5IIMA 3ISDA 1ZUZA 1UHUA 4IQVA 3TFRA 2KI6D 1XSPA 2FI1A 3EUB2 3VGOA 1ZQSA 3WKCA 3IVTA 2BCXA 5ALSA 3A0HU 3JVTC 3RZSA 1CRXA 4C8KA 3NRWA 1NK5A 9ICCA 1KQQA 3RM1A 5AI8A 4QNLA 5ALJA 1NKEA 3AQEA 4ECYA 1KSMA 1GQMA 4Q44A 2EH9A 3SJSA 2FJUB 1T8EA 2JNFA 3GOFA 4QZIA 4QW9A 2KFNA 2BECA 4M04A 4EX7A 3IDWA 1UPHA 5ALZA 4TUPA 1O03A 3EK4A 2B6GA 1EL4A 3TUYC 1T14A 2C28A 4C4SA 1PK1B 1F8HA 5KAFU 5HR7A 2NCOA 1KLNA 1L6NA 5DBAA 1LS8A 5KFMA 3N97B 3PW2A 1B43A 2G2BA 2EC6C 4KLUA 3SIAA 4MZKA 2JMGA 3TUYB 3QUTA 3D0YA 3VCBA 3MDCA 3FE6A 5AI5A 1KKXA 4FQTA 1F55A 4I29A 3D0YB 1MXLC 2PMZF 1ZQUA 3E2EA 1OSAA 2FE9A 1SBJA 2IS9A 5FI2A 1YVLA 3SD7A 1Q3VA 3RB0A 4ZCVA 1RXVA 1L5UA 2DBYA 1CMGA 4GGFA 2HHWA 2QB1A 7ICTA 1B4CA 2RDJA 2MHHA 2ISDA 2HHXA 2UVUA 5ALMA 4ETOA 1ZQHA 1ZQNA 4OZDA 3SENA 2V4RA 4MLWA 2G5IB 4Q45A 1J7RA 4CLNA 1IIPA 1LKYB 5D49A 3D2NA 4OR9B 5J2HA 4EZ6A 4ORCB 2JZIA 2KTQA 2K7DA 3LWMA 4FBUA 4QZHA 1S6IA 5J2JA 7ICEA 2PYQA 1DF0A 2HW3A 3NSLA 2YB4A 9ICQA 4UARA 1NK7A 1T3QA 1MA7A 4Z6FA 2QEOA 1ED1A 1KFUS 1YTZC
chains in the Genus database with same CATH topology
1B4FA 3SS3A 5D3OA 1PK1A 2D8CA 4I5KA 1UCVA 2D3DA 5L1MA 2KLEA 1JI7A 1X40A 5I94A 5FI7A 1RG6A 1Z1VA 2QKQA 3BS7A 2KE7A 1LKYA 4NJ8A 1SV0A 1F0MA 2GLEA 3IVTA 1DXSA 2QB0A 2BNXA 2KLDA 1WWUA 4IS7A 2DKZA 3H8MA 4JKTA 1OW5A 3BS5B 1X66A 2KMDA 5J8YA 4MHVA 2QARA 5F3XB 1DELA 2F3NA 2LMRA 4RQMA 4PZNA 1W9ZA 2K4PA 1Z2CB 4I5JA 4GAOA 3BQ7A 3PM2A 1SV4A 1V85A 1SXDA 4KYNA 3TADA 2DL0A 3UO9A 3IDWA 5FI6A 2QARB 5J8YC 2B6GA 2E8PA 2JV3A 1Z4HA 4PZOA 1PK1B 3OBVA 1DEKA 3UNWA 2F8KA 2KSOB 3K1RB 3HILA 3TADC 1SV0C 2QB0B 1X9XA 5KNIA 2ESEA 2LPEA 1UQVA 2Y9TA 1WWVA 2YTUA 1V38A 2Y9UA 4IJ7A 4MEWA 5JU5A 2FE9A 2EANA 5HL1A 3O4XA 5FI2A 2KSOA 5JTIA 1PK3A 4NL9A 2ES6A 5JRTA 3EG5B 2QB1A 2E8MA 1B0XA 3BS5A 2EAOA 3KEVA 3SS4A 1SGGA 1OXJA 2KIVA 3KKAC 2E8OA 3SENA 3SS5A 2BAPA 1LKYB 4NL9C 1COKA 1KW4A 3KKAA 3TACB 2F44A 2EAPA 2EAMA 4RQNA 4GBAA 2KG5A 2DKXA 4I5NB 2K60A 2YGUA 4I5LB 1DC1A 1SXEA 3SEIA 2L5YA 2E8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4F A;  1PK1 A;  2D8C A;  1UCV A;  2D3D A;  5L1M A;  1JI7 A;  1X40 A;  1RG6 A;  1Z1V A;  2QKQ A;  3BS7 A;  2KE7 A;  1LKY A;  4NJ8 A;  1SV0 A;  1F0M A;  2GLE A;  1DXS A;  2QB0 A;  1WWU A;  4IS7 A;  2DKZ A;  3H8M A;  1OW5 A;  3BS5 B;  1X66 A;  2KMD A;  5J8Y A;  4MHV A;  2QAR A;  5F3X B;  2F3N A;  2LMR A;  4RQM A;  4PZN A;  2K4P A;  3BQ7 A;  1SV4 A;  1V85 A;  1SXD A;  3TAD A;  2DL0 A;  3IDW A;  2QAR B;  5J8Y C;  2B6G A;  2E8P A;  2JV3 A;  4PZO A;  1PK1 B;  2F8K A;  2KSO B;  3K1R B;  3HIL A;  3TAD C;  1SV0 C;  2QB0 B;  1X9X A;  5KNI A;  2ESE A;  2LPE A;  1UQV A;  2Y9T A;  1WWV A;  2YTU A;  1V38 A;  2Y9U A;  5JU5 A;  2FE9 A;  2EAN A;  2KSO A;  5JTI A;  1PK3 A;  4NL9 A;  2ES6 A;  5JRT A;  2QB1 A;  2E8M A;  1B0X A;  3BS5 A;  2EAO A;  1SGG A;  1OXJ A;  2KIV A;  3KKA C;  2E8O A;  3SEN A;  1LKY B;  4NL9 C;  1COK A;  1KW4 A;  3KKA A;  3TAC B;  2F44 A;  2EAP A;  2EAM A;  4RQN A;  2KG5 A;  2DKX A;  2K60 A;  1SXE A;  3SEI A;  2L5Y A;  2E8N A; 
#chains in the Genus database with same CATH topology
 3M7D A;  8ICO A;  3PR4 A;  4P4P A;  4ECV A;  4O9M A;  5KFG A;  5I94 A;  4YMN A;  1RG6 A;  3WK6 A;  2KE7 A;  4FTG A;  2HBJ A;  2RDI A;  3RAX A;  1S26 D;  2BDU A;  1SYM A;  3MR2 A;  4YD1 A;  1CNP A;  1B47 A;  2B21 A;  4IQT A;  4DSF A;  2K2A A;  3WK8 A;  2W9C B;  4J9S A;  4O3S A;  2C22 A;  4PHM A;  3D2Q A;  1N60 A;  4MF8 A;  9ICM A;  1PVR A;  2WF6 A;  4TQR A;  4QIW F;  3RJE A;  1BU3 A;  1SSE B;  5I2Q A;  4DS4 A;  3AU6 A;  4GAO A;  2M7L A;  4QZ8 A;  5HR6 A;  4P5O E;  5F6T A;  1J1D A;  1SZP A;  1TK8 A;  2JZB B;  7ICJ A;  5KFL A;  2ZUD A;  3EPG A;  1A03 A;  1F71 A;  1XWL A;  1ZQL A;  4K4G A;  3EK8 A;  2VA8 A;  3DDH A;  4OO1 J;  5EE1 A;  3HJE A;  2M0N A;  3RB4 A;  3OGN A;  3V7J A;  4RQ2 A;  3PW0 A;  1GGW A;  1KL9 A;  1UHJ A;  2XY6 A;  2P70 A;  4CID A;  1N48 A;  2Y9T A;  5CJ7 A;  3T5L A;  3UXN A;  3Q8Q B;  3BQ0 A;  1KFS A;  3BDP A;  5L1I A;  4AYB F;  1EXR A;  2ZUC A;  4BY5 A;  2ASD A;  3KZI U;  5ALU A;  3NVV A;  1RJV A;  3MR6 A;  2BZF A;  2HI0 A;  4KLH A;  3T5K A;  1NPQ A;  5I2O A;  1L7O A;  1OE9 B;  7ICG A;  4PGY A;  3AAJ A;  8ICF A;  3OP0 A;  1MXE A;  5KFX A;  3THV A;  8ICR A;  3ALR A;  3QUB A;  1ZQB A;  2JEJ A;  1A76 A;  4I2H A;  5DB7 A;  4DS5 A;  3PX0 A;  1SGG A;  2FPK A;  1BPD A;  3N7S C;  2JUL A;  8ICL A;  3K4G A;  4OCZ A;  1KQM C;  1NK0 A;  4ECS A;  2M7N A;  2K7O A;  4DL3 A;  1QCK A;  2PFP A;  7ICM A;  1M63 B;  2M1K B;  1CM1 A;  2W3R A;  5ALL A;  4DQP A;  4GBA A;  1TAU A;  4ELU A;  3JPS A;  1MF8 B;  5KFO A;  2XGP A;  3HKZ C;  1XVJ A;  1Z00 B;  1NI3 A;  2NZ0 A;  9ICU A;  2K60 A;  3FC4 A;  5KFV A;  8ICP A;  3JTD B;  3DVM A;  3WK5 A;  5KFT A;  7ICP A;  3OSP A;  3QU7 A;  3OSN A;  1QIW A;  1DT7 B;  3OX6 A;  1RFJ A;  4QZ9 A;  2C2D A;  3TAP A;  4TUS A;  4I5K A;  1UCV A;  3KFU F;  2W43 A;  4X5V A;  4GGF C;  3A4U B;  2V53 A;  2Y1I A;  4ELT A;  1NCY A;  3D75 A;  2H3V A;  2JH7 A;  2QKQ A;  2WCJ A;  3GV5 B;  4NJ8 A;  3ZDE A;  4GUK A;  4IS7 A;  4M9G A;  3K1Z A;  2NV3 A;  5KT6 A;  1DMO A;  1OOI X;  4M47 A;  2JXL A;  3I76 A;  9ICP A;  2HHV A;  4RU9 A;  4MHV A;  4Q04 A;  4Q43 A;  1YZ6 A;  1MQ3 A;  1DEL A;  4RQ5 A;  2BCS A;  1SKT A;  4NLN A;  2JU0 A;  1NX2 A;  4YI9 A;  4ZOH C;  1UHI A;  4UBB A;  4M2O A;  4EZ9 A;  5AM3 A;  2PVB A;  3MSE B;  2LMU A;  3LK0 A;  5AM4 A;  1W7I B;  2VJ4 A;  5IBW A;  3OHB A;  3DVE A;  1ZD3 A;  2BCB A;  3RF9 A;  4C0Z A;  3PZP A;  3Q8M A;  2KJ9 A;  3GQC A;  2DL0 A;  2NLN A;  4MFC A;  4C8M A;  3QUQ A;  3R1V A;  5J2C A;  5AER A;  4BJQ A;  2L51 A;  5J2I A;  2TN4 A;  3GV8 B;  4F3O A;  5KT4 A;  1B9A A;  2JT3 A;  4O3N A;  4YG2 A;  3EKH A;  3ZD8 A;  2FCD A;  3FDS A;  2DGZ A;  1NP8 A;  1RXW A;  2L98 A;  1X9X A;  2JC2 A;  3RH4 A;  4PE1 A;  2AXT U;  4F2S A;  2JRF A;  1QTX A;  2B0C A;  4EEK A;  2I7A A;  2AAO A;  2YTU A;  2KI6 C;  4DOA A;  5DB9 A;  5J29 A;  2P6R A;  1ZOT B;  4MEW A;  2IMW P;  3GDX A;  2JT0 A;  1OOJ A;  2Y1N A;  3GII A;  2KAX A;  1XFW O;  4DCK A;  5AHX A;  5AK4 A;  5AM0 A;  4CDG A;  3I5H C;  1QV1 A;  2NRX A;  1RK9 A;  3NVZ A;  3NS1 A;  5HYD A;  4DF4 A;  3CW2 C;  1ZQV A;  1AVS A;  1YX7 A;  4UB1 A;  3EG5 B;  3FE9 A;  5J0W A;  3KEV A;  1QVI Z;  4M9J A;  1QLK A;  1KSP A;  4Y2S A;  1MHO A;  3KO0 A;  3I5H B;  3D77 A;  1ZQM A;  4I2B A;  4OJL A;  1OXJ A;  1A0P A;  1QJT A;  4KMU A;  2W9A A;  3F53 A;  2XC9 A;  4NL9 C;  1XO1 A;  3M8R A;  1HEK A;  1PVQ A;  3TAC B;  5TZV A;  1DRG A;  3PFV A;  4F5P A;  1W7J B;  5CPV A;  2QEB A;  1DJZ A;  2RRD A;  4F5O A;  2KFG A;  4MSP A;  3I1Y A;  1ZQF A;  3F2C A;  2CPR A;  1M39 A;  1ZQA A;  4I2E A;  2I1Q A;  3DEE A;  3QU2 A;  1YRU B;  5KFA A;  2ZIU B;  3V72 A;  3B0X A;  4M0A A;  3CR5 X;  1U48 A;  4QJF B;  3OB1 B;  1K2H A;  1A2X A;  1U45 A;  3LL8 B;  1NK9 A;  2BPC A;  4ED3 A;  1CUK A;  9ICA A;  1SKW A;  1OZO A;  2GLE A;  1IQ5 A;  5KFB A;  5DIC A;  4LVS A;  4I2G A;  3DF0 A;  1BT6 A;  1ZRM A;  1IKU A;  5IIK A;  1X66 A;  5HHI A;  2V4Q A;  4DSE A;  3K75 D;  2OHF A;  4XA5 A;  2WF5 A;  5AK3 A;  2GH1 A;  4IQW A;  1MC8 A;  5BOM A;  1L8L A;  4GXK A;  2MAZ A;  2A1A A;  1MSW D;  1GJY A;  2LCP A;  1W9Z A;  2MUT B;  2IHM A;  2WC8 A;  1TK0 A;  3IP4 B;  1JMS A;  4Z6E A;  4O5K A;  1ZQQ A;  3DXL A;  2ASJ A;  2AJQ A;  4PHD A;  2Q4T A;  3SZ2 A;  1AP4 A;  3QXG A;  3MGI A;  4PHA A;  5HLV A;  4R66 A;  2KGB C;  4F93 B;  4YCX A;  1KQM B;  4FS2 A;  2JV3 A;  2BGW A;  4FZN A;  8ICN A;  2LM4 A;  3N7R C;  3OBV A;  3BQ3 A;  2MAX A;  2ZIU A;  3R72 A;  2F8K A;  2KSO B;  3K1R B;  3TAD C;  3NSO A;  2J6T A;  2UVR A;  1S5L U;  3GIJ A;  1TN4 A;  5KG7 A;  4DFP A;  4EEN A;  1D1O A;  2W7O A;  2WND A;  2ZIW B;  3QRX A;  1S0V A;  1QAS A;  4DFK A;  3SAH A;  2K61 A;  5FYX A;  5GQQ C;  3OHA A;  1B1G A;  1SL8 A;  4JPZ B;  2OWO A;  1T3N A;  1BOC A;  1QIV A;  2EAN A;  1Y1X A;  3L4A A;  5JTI A;  2DOQ A;  1PZN A;  1FI6 A;  3UM9 A;  1CDN A;  7ICS A;  2A19 A;  4KLM A;  8ICA A;  1NWD A;  1DJW A;  5HP4 A;  4HRH A;  3SS4 A;  3RB3 A;  9ICO A;  2W9B A;  2G06 A;  1ALW A;  1N0Y A;  3OPX A;  3HPO A;  1L7Z A;  2HQW A;  2KJ5 A;  3S0D A;  2ZIX B;  3HX4 A;  4YXM A;  2GO7 A;  2EZX A;  2WF7 A;  2I9G A;  1N65 A;  1S5G Y;  1ZFS A;  5EWE A;  2BE6 A;  2KOB A;  1J2N A;  2KG5 A;  2LYB A;  4FQO A;  4BGD A;  1HUZ A;  3C21 A;  1UT5 A;  3C1Y A;  1RRO A;  1TCO B;  4NLZ A;  2FJY A;  5DDY A;  2AUC A;  4MBE A;  3BZK A;  4F50 A;  4NDC A;  1T4G A;  3SS3 A;  2PFN A;  2JOJ A;  4YVZ A;  1G4Y R;  2YML A;  2KVC A;  5KFI A;  2LP2 A;  5CSN A;  2HCF A;  1S97 A;  1D8Y A;  4BUG A;  4BXO A;  4A8E A;  1Y1A A;  2Y4Q A;  3BQ2 A;  5HKW A;  5DKQ A;  4C0L A;  1DXS A;  1N5X A;  1LA0 A;  2BNX A;  3CTN A;  4M6W B;  4HYK A;  4N1F A;  3PY8 A;  4KN4 A;  5C0Y A;  1EJ3 A;  2ZXI A;  3PSI A;  1CFC A;  1Y0V H;  2O5G A;  1KN5 A;  1KFD A;  4QZF A;  3QU5 A;  4N1G A;  2I18 A;  8ICH A;  3QU9 A;  3BQ7 A;  2WFA A;  1RPL A;  2ZIW A;  4DQS A;  2WOR A;  3BZC A;  5ALW A;  1SNL A;  4QWA A;  1Q3U A;  2LUX A;  2BKI B;  4N5X A;  2AGP A;  5KG2 A;  2JTZ A;  5L9X A;  4RPZ A;  3PO4 A;  5CWR A;  1BLQ A;  2JH1 A;  2K8B B;  4C80 A;  4DF8 A;  3EK7 A;  4A4B A;  2LC5 A;  2WCB A;  4UW9 A;  4WQ3 A;  2WCH A;  3EVR A;  5J2D A;  2Q4U A;  3MAB A;  4RUC A;  3CS1 A;  4DSK A;  2F8L A;  2YB1 A;  1A6S A;  3PN7 C;  3JPQ A;  1EXN A;  5KT5 A;  4B9T A;  7ICI A;  5KFD A;  1ZQE A;  1ZD2 P;  2NRZ A;  4FO6 A;  4YP3 A;  1FF1 A;  2E8M A;  3M0W A;  4NM2 A;  4NDD A;  3I5I B;  4F92 B;  1BJF A;  4AQJ A;  3L4P A;  4YR2 A;  2L50 A;  2M49 B;  3RB6 A;  3OJU A;  1L7P A;  3QE9 Y;  2BAP A;  2HBL A;  2E3T A;  2KHQ A;  3F2B A;  2WTF A;  3AU2 A;  3KF9 A;  4UAV A;  5PAL A;  1NUB A;  8ICT A;  5GTH U;  5J2K A;  5ALR A;  2FCE A;  1XFX O;  3WK9 A;  1COO A;  5KFN A;  1LA3 A;  1LVC D;  2I94 A;  1CLM A;  2W9C A;  3CNH A;  5DDM A;  3GV7 B;  1RYS A;  1K93 D;  4ZH4 A;  3H40 A;  1MN8 A;  9ICJ A;  1AQ6 A;  1GM0 A;  4Y2Q A;  1KCY A;  4NXZ A;  5ALP A;  1JF2 A;  3UPQ A;  1F4Q A;  1BNO A;  2ZN8 A;  1T7P A;  4UAS A;  2K4H A;  4CF5 A;  4YN4 A;  1XFU O;  5ALQ A;  4KLT A;  4B9L A;  3WKE A;  1OZS A;  3H8S A;  3WK4 A;  3MGH A;  1KSO A;  2H8V A;  2Y1M A;  2RLT A;  3LDA A;  2LVI A;  1AK8 A;  4C8N A;  2KLD A;  1DJG A;  1BR1 B;  4QWC A;  2DKZ A;  1XU4 A;  3HRD D;  4JKT A;  2K89 A;  4PT1 A;  1U9L A;  3CGA A;  1QQ7 A;  1BPX A;  2KMD A;  7ICU A;  4PCW A;  3V6H A;  4DFJ A;  1XSL A;  2A3V A;  3WNX B;  1N62 A;  5L1L A;  3IG8 A;  1UUR A;  5IIN A;  7ICH A;  5DQI A;  5F9L A;  4DL6 A;  1Z2C B;  2L4I A;  2KBI A;  2IOH A;  2PI4 A;  5KFU A;  1JSA A;  2W04 A;  4ECX A;  1AHR A;  3SG4 A;  4ECU A;  4I2J A;  2KFH A;  3MFH A;  4JUZ A;  4WJ3 B;  4F71 A;  3PAT A;  1ZQW A;  5FI6 A;  1KFX S;  1NK4 A;  2HBM A;  3CWG A;  3RJI A;  3Q8L A;  3S0E A;  4OJ6 A;  4CE6 A;  1DEK A;  2FDR A;  4AOM A;  4JQ0 D;  2YY6 A;  3HIL A;  1R2U A;  3H0L B;  5AKL A;  5HKY A;  1JC2 A;  3A8R A;  3FWC A;  3PJI A;  2VJ5 A;  1JRP A;  4TNC A;  3KZX A;  1V9P A;  4JWM A;  4NLB A;  2JWW A;  1K1Q A;  4YMO A;  1P28 A;  1QVI Y;  2BKE A;  2HBK A;  5KFK A;  5EE0 A;  2I5H A;  2NO4 A;  9ICR A;  4P2H A;  2HOQ A;  1V1G A;  4PH5 A;  4I2D A;  3BQ1 A;  3PAL A;  2LVV A;  1JWD A;  3SG7 A;  3C28 A;  1ZQY A;  4C8O A;  3BOW B;  4XYN A;  2NRV A;  4NLG A;  2IOF K;  3RFA A;  3KKA C;  1CFP A;  4QWB A;  3V6K A;  1SL2 A;  2IHN A;  5AAN A;  5HMM A;  4DLE A;  1URJ A;  1SZH A;  2FJ6 A;  5KSZ A;  3JPN A;  4DSI A;  3O0F A;  2KIW A;  4F2R A;  2P66 A;  1NJY A;  4P2Y B;  9ICI A;  4OCI A;  1C7Y A;  1HUO A;  1IV8 A;  2YGU A;  2KQY A;  5BPJ A;  4C0J A;  2E6W A;  3G6X A;  2R8G A;  3SEI A;  2L5Y A;  4KLD A;  4HAI A;  4GLX A;  1C7W A;  4MZL A;  3F2D A;  4O3P A;  3UMB A;  4PHP A;  4F4X A;  1H4B A;  3KBB A;  4MVF A;  4RNM A;  4EYH B;  5J0R A;  1SCM C;  3FIA A;  3G6Y A;  1S36 A;  3NRZ A;  1S6C A;  5CB1 A;  1EG4 A;  3BS7 A;  1PAL A;  2PQL A;  1WLM A;  1CTR A;  3FYH A;  1FPW A;  2KKP A;  2P71 A;  4CRX A;  1S0O A;  5AM2 A;  3DYE A;  4IRK A;  1KQV A;  4Z6C A;  1BPY A;  1F70 A;  4DOB A;  2XO7 A;  2H61 A;  5JOL A;  5KT7 A;  4F4Z A;  1K8U A;  1QXP A;  1SMG A;  2SAS A;  3MR5 A;  3M9M B;  2ISO A;  2P6B B;  3OX5 A;  2LMR A;  4NQG A;  4DOC A;  1UHH A;  1J1E A;  2R8K A;  1PSR A;  5G08 A;  4ED6 A;  1S9F A;  4KLI A;  3B86 A;  2BE4 A;  5CRX A;  4NLK A;  2H2K A;  1WCN A;  2BCV A;  1NYA A;  2AGO A;  3RLZ A;  2F8P A;  3EYZ A;  4P0P B;  1VLB A;  4U8D A;  4GXI A;  3UMG A;  2AQ0 A;  4P4M A;  4Q8F A;  3NGV A;  3RJJ A;  2FLP A;  1DJY A;  3N7H A;  1G8I A;  2F76 X;  3SAF A;  2QB0 B;  5KL1 B;  2G0A A;  2PSR A;  5EE3 A;  2CT9 A;  1XFZ O;  2V9W A;  5KTY A;  3HCM A;  2LNK A;  3LVV A;  3AAK A;  4UAW A;  4IJ7 A;  1A77 A;  3DF0 B;  3RBE A;  4BWJ A;  2QAC A;  2KAY A;  2XI9 A;  2YN4 A;  1KFX L;  1X42 A;  4Y2T A;  1SK6 D;  1DGV A;  5D4B A;  3O4X A;  1OOH A;  3UXO A;  2C2E A;  5B8I B;  1DTL A;  5HHH A;  5DKN A;  4A4C A;  4NL9 A;  1NKB A;  5TIS U;  3NVW A;  4OD0 A;  3IM1 A;  1KEJ A;  3CLN A;  3HWT A;  5JJG A;  4ICA A;  2DPI A;  1L3V A;  5KFJ A;  4CPV A;  4ED2 A;  3U26 A;  3QU4 A;  2W54 A;  3D76 A;  1N63 A;  2DQN B;  5HML A;  4OV2 A;  2IBK A;  2M97 A;  1F5S A;  3F5E A;  1YVH A;  2LV7 A;  4LZG A;  4MN0 A;  5AKK A;  1TOP A;  5AK5 A;  3CYM A;  2OCE A;  4ECZ A;  4RNO A;  2BQ3 A;  2JTT A;  1K5O A;  1NCZ A;  3PX6 A;  3RR7 A;  1KWO C;  1K9U A;  3CZ2 A;  3LYS A;  1B4F A;  2J6U A;  2K8C B;  2K4I A;  4Y2U A;  1DF0 B;  5AKH A;  1PK0 D;  2E1F A;  1BG1 A;  3IHQ B;  4J9N A;  1YRT B;  2EHB A;  2L2C A;  1C3Y A;  4GIB A;  2AQ4 A;  2BQU A;  1Z19 A;  5DBB A;  1GGZ A;  3RJK A;  1F0M A;  1SV0 A;  2BR0 A;  2F2O A;  4ZCU A;  1BF5 A;  5KG3 A;  1IGV A;  1TUZ A;  4DFM A;  2SCP A;  4CFQ A;  2OEH A;  2WAQ F;  3PSP A;  1NJZ A;  4DRW A;  1LB2 B;  3ZDC A;  1WG8 A;  3NVY A;  2LAP A;  4PHJ A;  1YR5 A;  1BNP A;  5BOL A;  3KHG A;  3TFS A;  4PE4 A;  2YMQ A;  4RQ7 A;  1REC A;  1CMF A;  5ALX A;  2KAV A;  2LM1 A;  3H0M B;  1YX8 A;  4B9U A;  5DB8 A;  2PKE A;  2KKV A;  1TAQ A;  2O6K A;  3B9J A;  3OTQ A;  1J7Q A;  1B7T Y;  4F0Z B;  2G08 A;  5ALT A;  4ED8 A;  3KHE A;  3V7K A;  3V2L A;  4YGE B;  2UVW A;  4Y2Y A;  2BCU A;  2E8P A;  4JWN A;  2MA2 A;  2KFF A;  1OMV A;  3WKD A;  1K94 A;  1PVB A;  2GGM A;  2W9B B;  3K21 A;  2CN1 A;  4BDP A;  2ZXH A;  2JQ6 A;  1UQV A;  5III A;  1AUI B;  1SB3 C;  1BMO A;  4O3M A;  2KV2 A;  1MUX A;  1V38 A;  1X6I A;  2A1J A;  3EPI A;  4MZJ A;  2Y9U A;  1WCL A;  3FM9 A;  5KG1 A;  1WY9 A;  4GFJ A;  3PML A;  2YMM A;  2HOF A;  4MEX A;  2LLU A;  4Y2P A;  2ATL A;  5AKX A;  3F5A A;  5HL1 A;  1PVA A;  2R8J A;  2VRG A;  2PRU A;  1KBU A;  2OM6 A;  2ALZ A;  4UAT A;  2LYH A;  2Y0S C;  3BS5 A;  1DQE A;  2G9B A;  2LVJ A;  2WB1 F;  4PHK A;  4USL A;  3O4Y A;  4RPY A;  3AEV A;  4YFK A;  5KFY A;  5HKZ A;  3MFI A;  2ZJ8 A;  2KGR A;  5J2F A;  1QQ5 A;  3C29 A;  2G5H B;  3PM8 A;  3BUX B;  5ALG A;  3PMN A;  9ICH A;  4C4T A;  4QZA A;  4F72 A;  4PAL A;  4J9K A;  2LI6 A;  2XVT A;  1T94 A;  2FPM A;  2H3Q A;  1H8B A;  1YUT A;  1K96 A;  5TNC A;  1NNL A;  1ZRN A;  2JPO A;  2NRT A;  2KEY A;  4IRD A;  3EVU A;  2QEV A;  2KHV A;  2DF4 B;  4PHE A;  4KTQ A;  2M0R A;  2D8C A;  4PE7 A;  3JPT A;  2DUY A;  2PXI A;  3QUC A;  2BPG A;  1TRF A;  2KLE A;  2BQR A;  4RQ4 A;  3N7P D;  4RNN A;  5DQH A;  3FAH A;  3S6J A;  4G3I A;  3SIB A;  2M3W A;  2AMI A;  3ISB A;  1WWU A;  2W7P A;  3TI0 A;  4KLG A;  2LP3 A;  3R1O A;  3H8M A;  1QSY A;  3C2K A;  2WCK A;  2ZUB A;  1J55 A;  3BS5 B;  4LJX A;  1QLS A;  1X9S A;  4Q8E A;  3O6B A;  4DLG A;  5F3X B;  3WKA A;  2GV5 A;  2HPS A;  1TNP A;  3LLE A;  1UA1 A;  1Z4O A;  3RJH A;  2BCQ A;  1IRJ A;  5K89 A;  1D9D A;  1ZAC A;  4YQW A;  1H38 A;  1DJH A;  3PM2 A;  4GGN A;  3V6J A;  4PHN A;  3SG5 A;  2L2E A;  4O3Q A;  4J9R A;  2F3Z A;  1YT3 A;  3ZNI A;  3S0A A;  2LBO A;  5J3X A;  1CB1 A;  4PZO A;  2QPT A;  3TDI A;  3RH6 A;  1D9F A;  1TNX A;  1NKC A;  5DLF A;  5KT3 A;  2W8L A;  1ZOL A;  2MBX A;  5KNI A;  2D8N A;  4MRY A;  1RTP 1;  9ICL A;  2LKY A;  1C20 A;  5EOZ A;  2RHF A;  2JGA A;  4KIT B;  4QZD A;  3MDA A;  3ZDD A;  2QEH A;  1TNW A;  1UHK A;  4DSL A;  8ICY A;  2CXY A;  7ICO A;  1SL9 A;  3CAB A;  4YRU A;  4UB3 A;  3RR8 A;  1BPE A;  1A75 B;  2W3S A;  1FEZ A;  2LMT A;  3JPP A;  2FLN A;  1CEZ A;  1JX4 A;  1ZQC A;  4IQU A;  2EAO A;  1KFU L;  4PJ0 U;  3EW9 A;  4NDB A;  4R65 A;  4MRX A;  3TS5 B;  4YD2 A;  2P6U A;  1WUD A;  4KLJ A;  1IH0 A;  2E5S A;  3SS5 A;  2MJW B;  4QWE A;  4TQS A;  4BXO B;  5EE9 A;  3BFB A;  3AMZ A;  4QZE A;  1U49 A;  2HQ8 A;  3LK1 A;  1CDM A;  2BL0 C;  5CP2 A;  1IJ5 A;  5J0O A;  4YR0 A;  4RZR A;  4WQ2 A;  3D10 A;  4IL1 A;  1QX2 A;  1U4B A;  4P0Q B;  2JNX A;  3L5K A;  2K7C A;  4KN7 A;  1SR6 C;  4GC6 A;  2BL0 B;  3KHH A;  3H8J A;  2VA2 A;  1JAL A;  2HF5 A;  5B5E U;  1N2X A;  2BCR A;  8ICZ A;  5AKY A;  3D6J A;  5L1M A;  1XNS A;  3I5G C;  4IR9 A;  2HVI A;  2LHL A;  2YMP A;  4OKH A;  3A0B U;  1J2M A;  5AKG A;  1X9M A;  4DL5 A;  2QB0 A;  4U7C A;  1Z1B A;  3V7L A;  8ICQ A;  3VRQ A;  5DGA A;  1FIQ A;  2ZND A;  3AKB A;  2KZM A;  4M9N A;  1L7N A;  5J8Y A;  1TIZ A;  3AUO A;  9ICK A;  2F77 X;  2F2P A;  2HMX A;  1SL0 A;  2FLL A;  3TDZ A;  5DGB A;  1CDP A;  1TVA A;  2NRW A;  9ICT A;  4QJ4 B;  2KJ8 A;  2K4P A;  5ALH A;  5KT2 A;  1LKJ A;  3LVW A;  5ALF A;  4UB5 A;  3QZ7 A;  2KYF A;  4EBC A;  2BCA A;  4XRH A;  4US9 A;  4KYN A;  3ICX A;  3SG3 A;  3SMV A;  2CBL A;  1D8L A;  5ALN A;  1QAT A;  4Y2V A;  3UO9 A;  2KPH A;  2QAR B;  2EQY A;  4CF4 A;  1IM4 A;  3SG2 A;  3TZ1 A;  2HHS A;  3EKJ A;  5KL8 B;  1ZQZ A;  3L3F X;  2JR5 A;  5ALV A;  5A0L A;  1BPZ A;  1S8O A;  4KLL A;  1XFR A;  4QJ5 B;  5KU1 A;  1TTX A;  3JPO A;  5DG9 A;  1KK8 B;  1C7V A;  3PX4 A;  4F5R A;  4OJP A;  1XO0 A;  2FMS A;  5T14 A;  3NAS A;  1F4O A;  1LV5 A;  3O2P A;  4NV0 A;  1JXE A;  3GIK A;  2DPJ A;  3PST A;  4NM1 A;  2ZJ5 A;  4MEY A;  2BBN A;  2KOT A;  2ES6 A;  4LZD A;  3TQ1 A;  4JV1 A;  4P0Q A;  2WAQ C;  3MBY A;  5ER4 X;  1ECW A;  1M6Y A;  5KFW A;  8ICE A;  1DGS A;  3WK7 A;  1U5I A;  4QW8 A;  2KSP A;  8ICU A;  4F5Q A;  9ICS A;  5GTI U;  2L5X B;  4XUS A;  2AHO B;  5L1J A;  1N61 A;  1XFV O;  2L4H A;  3SG6 A;  1KW4 A;  5J0X A;  4P0P A;  1E8A A;  2ZRS A;  8ICC A;  4EEL A;  2XY5 A;  1S6J A;  2VA3 A;  4CFR A;  5KG6 A;  3J81 j;  1Q80 A;  1UT8 A;  3ZI4 A;  4NLC A;  4ORB B;  4RQ0 A;  3TAR A;  4R64 A;  3PW7 A;  1Y1U A;  1QS7 A;  1S5G Z;  1K1S A;  5E79 U;  4MFA A;  4UB2 A;  4HRG A;  2KVS A;  9ICB A;  3ORY A;  3N4M B;  1WDC B;  5IIO A;  3ZDB A;  5AIC A;  4Z6D A;  5EWG A;  1F44 A;  1SL7 A;  2JEG A;  4AYB C;  4YGC B;  3S0F A;  2LYA A;  3Q8R B;  3M8S A;  2F3Y A;  1IG6 A;  5AM1 A;  3IQO A;  3I5F C;  1S0M A;  4DS7 A;  1JFJ A;  1NJW A;  2KI4 B;  5HLO A;  8ICI A;  1B7T Z;  3NUQ A;  1RM6 C;  3M9N B;  9ICX A;  4FBT A;  4ORA B;  4KMO B;  3WU2 U;  1CFD A;  4C0K A;  3I5F B;  1ZQO A;  1JXL A;  3BUN B;  4PZN A;  2Q0Z X;  2XIC A;  5ALO A;  1Y88 A;  1ARO P;  1Q8K A;  2CCM A;  1J7P A;  1HIW A;  4XJK B;  1K90 D;  4YBH B;  1SCV A;  2JPT A;  4DL4 A;  2WHE A;  3TAD A;  3C5G A;  2FMP A;  4EBD A;  7ICL A;  3KD3 A;  1L3S A;  5AFP A;  1JUO A;  1OMD A;  2JXC A;  2LM5 A;  2KK0 A;  2D6F C;  4J03 A;  4AP9 A;  4RQ3 A;  3CR2 A;  2EDU A;  2DFL A;  4Y2J A;  4M2Q A;  5AEQ A;  2KD1 A;  2MRL A;  1L2O C;  1OW4 A;  3BXK A;  4J9M A;  1S3P A;  2M9G A;  5CEH A;  5FP0 A;  1FFU A;  3RRH A;  3PSF A;  1CKK A;  4F5N A;  1CLB A;  9ICV A;  3Q8P B;  2PAS A;  3LCP C;  1FO4 A;  1QQ6 A;  3C2L A;  4OVN F;  1XYD A;  4RQ1 A;  3SYZ A;  4R1E A;  3S0G A;  4JMU A;  5J2G A;  4DCC A;  2ZIV B;  4NWI A;  1B0X A;  4I27 A;  2W55 A;  4DQR A;  1NX3 A;  2MU2 A;  1DK2 A;  4UAZ A;  1ZQJ A;  3H7I A;  4WRI A;  3CR4 X;  1MWN A;  1N2D A;  1QX7 A;  4BY4 A;  1TAM A;  3BUW B;  1UUS A;  4UAU A;  3PLF B;  4I28 A;  5CHG A;  4INW A;  1G33 A;  2CNP A;  3BFA A;  4DEZ A;  4UAY A;  4F8R A;  4KLO A;  5AKZ A;  3M1Y A;  3PN7 B;  1ZXI A;  2XY7 A;  3IRU A;  1X2I A;  2G09 A;  3ZDA A;  2P35 A;  3AN1 A;  1NX0 A;  2E8N A;  3ETL A;  5KFF A;  9ICG A;  1JN3 A;  3NGD A;  3QX7 A;  3QZ8 A;  1TFR A;  1TUJ A;  1IG5 A;  4C7Z A;  2YQE A;  3C1Z A;  3OGU A;  3MR3 A;  2K0J A;  5FI7 A;  1Z3E B;  2LE9 B;  4BX9 C;  3GIL A;  1A4P A;  3VRN A;  2EZZ A;  3ETR A;  3ED5 A;  1KK7 Z;  2R8I A;  7ICN A;  5IIJ A;  1KK8 C;  1DOQ A;  5DBC A;  4JWQ A;  4K4H A;  2LMV A;  3CZT X;  4CGZ A;  2M9N A;  2K4E A;  1ZQT A;  3KHL A;  2Y1J A;  3GK4 X;  1X9W A;  3QEA Z;  2W03 A;  2PFO A;  2ZRT A;  1PUL A;  1RWY A;  7ICK A;  3AQF A;  4I5J A;  1ZQK A;  1UP5 A;  4TUQ A;  1VRK A;  3CP8 A;  1NX1 A;  1A29 A;  2WC6 A;  3UMC A;  1CLL A;  4F91 B;  2DWQ A;  3NHI A;  4KLF A;  3VRP A;  1M31 A;  5J8Y C;  2MA1 A;  1BGX T;  3I5I C;  4GFT A;  1L8O A;  2IOF A;  1CI4 A;  1V1F A;  3ICB A;  1KTQ A;  2N1R A;  5AIB A;  9ICW A;  1B8L A;  4YR3 A;  5ALE A;  3JPR A;  1MR8 A;  2WCF A;  1ZJN A;  5DLG A;  3GU3 A;  4U6P A;  2J6S A;  1MQ2 A;  4R63 A;  3GK1 A;  3M9O B;  1WRZ A;  1KWO B;  4R8U B;  2JRZ A;  1P7D A;  3DV9 A;  3GFK B;  3D78 A;  3EVV A;  3IN5 A;  3SV3 A;  2A1J B;  2PFQ A;  1OQP A;  2R2I A;  3B87 A;  2XCA A;  4DWI A;  3BOW A;  5JRT A;  2B1U A;  2XID A;  2H5X A;  5ALK A;  2ISP A;  7ICR A;  4INX A;  3B88 A;  2WCE A;  4PL2 A;  4CF3 A;  2EZY A;  4DFD A;  3MC1 A;  3Q8I A;  4RPX A;  3FWB A;  2K7B A;  1SKR A;  1C07 A;  2CTN A;  4KX5 A;  4RQN A;  2HVH A;  3H4B A;  1NCX A;  3HT3 A;  4KX3 A;  2OXO A;  4I2I A;  2ZKM X;  1IWQ A;  3VRR A;  2Z7J A;  4ACO A;  4RUA A;  3E3R A;  1NZB A;  2W8K A;  2ZN9 A;  1N5W A;  1QWV A;  2LHI A;  3BJH A;  1OOF A;  3RTV A;  1LIN A;  1SL1 A;  4PE0 A;  2ZNE A;  2KZZ A;  4B9M A;  1S77 D;  3LK9 A;  4ED1 A;  5CSF A;  2KI4 C;  8ICX A;  2XCP A;  1WLZ A;  2ZG6 A;  1DK3 A;  1PK1 A;  4PGX A;  1ZD5 A;  4F7F A;  4B9V A;  3RAQ A;  1KFT A;  1NK6 A;  3TAN A;  4EX6 A;  2HOI A;  2FOT A;  7ICQ A;  4QWD A;  1JFK A;  1LKY A;  1R6P A;  4USA A;  3M6K A;  2I2R E;  3C1V A;  3T5H A;  2EC6 B;  5AKI A;  4JV2 A;  1V97 A;  2CRX A;  1VJ5 A;  9ICF A;  4C4R A;  1TWO A;  4O5E A;  2BDP A;  5KG4 A;  4I2F A;  3PR5 B;  2ASL A;  3F45 A;  1L3U A;  2HET A;  3KHR A;  1CM4 A;  4E0D A;  4G9B A;  2HHT A;  1X02 A;  5J2A A;  3VC8 A;  5AI9 A;  1SV4 A;  1QSS A;  1UHN A;  3NSK A;  3RH5 A;  1SCM B;  1SKS A;  1JUD A;  1UWO A;  3GZF A;  1TCF A;  1SRA A;  4Y2X A;  1Z4N A;  3RJF A;  8ICG A;  1Y6W A;  2OTG C;  4KLS A;  1Z4H A;  2JEF A;  4HRE E;  3C2M A;  5KFR A;  4KLE A;  2RQ5 A;  3KOO A;  4IL6 U;  5J0Y A;  4EEY A;  2GTE A;  3VB1 A;  1PSB A;  4ED0 A;  1NIW A;  2RGI A;  1BOD A;  4FZL A;  5JU5 A;  5CA7 A;  1XS9 D;  3L47 A;  4PGQ A;  1DVI A;  1L7M A;  2GWS A;  2F2A B;  3LWL A;  3R1P A;  3GK2 A;  1XK4 A;  3NSI A;  3WXA A;  2AU0 A;  2LLT A;  5AM5 A;  4EBE A;  1YUS A;  5AK6 A;  3KTQ A;  1K95 A;  1F54 A;  1SPY A;  1YZ7 A;  5F9N A;  1QH9 A;  2FMQ A;  3NHT A;  1XFY O;  1LVH A;  3SAG A;  3HP6 A;  1QLN A;  2ODG A;  2OH2 A;  2ZTC A;  5BPC A;  1SWV A;  2G07 A;  2H3F A;  4P4O A;  2H3I A;  5EL2 A;  4CNQ A;  2VKQ A;  2ZTE A;  1XK4 C;  1SIJ A;  3CYZ A;  4FS1 A;  5IIL A;  4ECW A;  3WKB A;  4J9Q A;  3H4S E;  4DL7 A;  5C5J A;  3H8W A;  3WHU B;  4TUR A;  3B6X A;  1ZQR A;  1DJI A;  1SY9 A;  2WB1 C;  5KFE A;  4RQ6 A;  3UQ0 A;  3QYP A;  1SWW A;  1IIO A;  1IJ6 A;  4OJ5 A;  4M6W A;  1BPB A;  1WYG A;  4YGB B;  2YX8 A;  3AKA A;  2PAL A;  1HJP A;  4FE3 A;  9ICN A;  1TK5 A;  2H3Z A;  1RYR A;  2WF8 A;  2K8M B;  1DGJ A;  1ORG A;  1X40 A;  1ZQ1 C;  5ALD A;  1HT9 A;  4M2Y A;  3DVK A;  1JBA A;  5AI0 A;  1FW4 A;  2M29 A;  2VIX A;  1WDC C;  5KFQ A;  2HHU A;  2ZJA A;  4C7Y A;  3C5F A;  8ICK A;  2A4J A;  1KK7 Y;  2JEI A;  3TKA A;  1S1E A;  5DQG A;  4RQ8 A;  2KQ6 A;  5DG8 A;  4M9L A;  4AQI A;  2XGQ A;  4GC7 A;  2NCP A;  2ERB A;  1TE2 A;  9ICE A;  3H4D A;  3QNM A;  4E68 A;  5AI4 A;  2F1H A;  1SXD A;  3ONN A;  1QSL A;  2ZFD A;  3OJS A;  1QV0 A;  4DQI A;  1HQV A;  3O78 A;  1CFF A;  1LXF C;  1PVP A;  1ZD4 A;  4GPL B;  2HDO A;  5KFH A;  1A75 A;  4ECR A;  1FBV A;  3ZWH A;  1SV0 C;  5KAI U;  1XSN A;  4YGD B;  2PMZ C;  1KDH A;  2ZIV A;  1D8B A;  1J97 A;  4K4I A;  3IG5 A;  3T3F A;  3EZ5 A;  1OMR A;  1B8C A;  3SR6 A;  3NTU A;  5DG7 A;  2FPL A;  4ECQ A;  3E0F A;  5J0T A;  4JB3 A;  5KFC A;  3RBD A;  1ZQI A;  7ICF A;  4FFD A;  2KSO A;  4RT3 A;  2OS8 C;  1K9P A;  4I2A A;  5AXI A;  2WC5 A;  2R18 A;  3FE8 A;  5KG5 A;  1JF0 A;  1KRP A;  2AH5 A;  5HNK A;  4PPX A;  3S0B A;  1XO5 A;  4F4W A;  1ZQG A;  2KIV A;  2K8A A;  1L2O B;  1M45 A;  4R8U A;  2KHN A;  5EWF A;  2K2F A;  2OPO A;  1ZYQ A;  3MGV A;  2OYY A;  3WHT B;  3DVJ A;  2ZTD A;  4DUQ A;  8ICM A;  4I5N B;  3DZT A;  1M46 A;  2ZIX A;  3I28 A;  3IQQ A;  4I5L B;  2NYV A;  1U47 A;  1SXE A;  3Q8S B;  1AJ5 A;  3L4L A;  4QIW C;  3IV6 A;  3RJG A;  2KDH A;  1CDL A;  1EG3 A;  2WCM A;  1FI5 A;  3IF7 A;  2COL B;  3PW5 A;  4NY8 A;  5I2L A;  1RQL A;  1PUZ A;  4UB4 A;  4J9O A;  3T5J A;  1JI7 A;  4DQQ A;  5KG0 A;  4ECT A;  4C8L A;  8ICW A;  2E1E A;  4MFF A;  3M6Z A;  5J2B A;  4YGA A;  1X6J A;  3C23 A;  4O3R A;  2JHD A;  4DO9 A;  1Q46 A;  5ALI A;  3QEB Z;  3RRG A;  3PVX A;  5G5G A;  2MLF C;  2QAR A;  5J0P A;  1UA0 A;  2UVV A;  2M1U A;  4ICB A;  2GGZ A;  3B7A A;  5KFP A;  4QZC A;  4RQM A;  3N28 A;  3PNC A;  1BR4 B;  2KBM A;  5D69 A;  2GOL A;  4UPG A;  1L3T A;  3KPX A;  1IQ3 A;  1WRL A;  1O08 A;  4B6J A;  2L0P A;  5D7F A;  5AKE A;  2E30 A;  3FS7 A;  1IXR A;  5G5H A;  2LAN A;  1WRK A;  4IC9 A;  4O5C A;  1YUR A;  4MF2 A;  3PSR A;  5D46 A;  2BBM A;  3VRO A;  3ZD9 A;  4O0I A;  2F1J A;  4ED7 A;  2KFZ A;  4UB8 U;  4L9M A;  3BUM B;  2ESE A;  1OOG A;  2MLE C;  2BKH B;  1WWV A;  4DIR A;  4YXJ A;  2JT8 A;  2HHQ A;  1N56 A;  1OUQ A;  2LLS A;  4UBC A;  4YI8 A;  5J2E A;  3NXA A;  2M8U A;  2Y5I A;  4UB6 U;  4EYI B;  2WCL A;  3JTD C;  3TS5 C;  2CXJ A;  3BUO B;  4PDZ A;  2KN7 A;  1TNQ A;  1S0N A;  1PK3 A;  5DB6 A;  2KYC A;  1DJX A;  5AKJ A;  4US8 A;  3BJY A;  1RYU A;  4F4Y A;  3SQI A;  4J9L A;  4B9N A;  3G6V A;  3ISC A;  4M2P A;  3GIM A;  1DGU A;  1GO3 F;  3HKZ F;  3Q8K A;  1COK A;  3KKA A;  1YUU A;  2F44 A;  2EAP A;  2EAM A;  5B66 U;  2F1I A;  1SW8 A;  4JD9 A;  2PMY A;  4BWM A;  3UXP A;  4KLQ A;  2BPF A;  4DL2 A;  2RP5 A;  3EWA A;  2PI5 A;  2LVK A;  3BYA A;  5KTQ A;  2QLT A;  1ZQX A;  1DC1 A;  5J0U A;  3I5G B;  4PL1 A;  1ODB A;  2F33 A;  1VDV A;  2QDI A;  4JK1 A;  1TKD A;  5AIA A;  2D3D A;  1QX5 B;  1B22 A;  2OS8 B;  1XC9 A;  1Z1V A;  1ZQP A;  3D2S A;  2LHT A;  5AI6 A;  5JUM A;  5J0Q A;  1ZQD A;  2NO5 A;  3AL0 B;  2KNE A;  3UQ2 A;  4XJK A;  2IA6 A;  5KFS A;  2Y0S F;  4QZB A;  1OW5 A;  3E58 A;  3TAQ A;  2W9M A;  4D1E A;  2KNJ A;  2KP7 A;  4OJO A;  4CCH A;  8ICS A;  2F3N A;  4Y2R A;  3CZ0 A;  3CRX A;  4IRC A;  1RZT A;  3TDU A;  2VAN A;  4O3O A;  1B8R A;  3PW4 A;  1V85 A;  2I6X A;  1XA5 A;  1C3Z A;  1ZJM A;  1EH2 A;  3D74 A;  5CSI A;  5DKR A;  8ICV A;  3UNW A;  3AM9 A;  4I2C A;  8ICJ A;  3T79 A;  1ZMZ A;  1NSH A;  3H0R B;  2LPE A;  4F4K A;  3SV4 A;  3QME A;  1NOM A;  4HSZ A;  2NXQ A;  2KZ3 A;  2BHN A;  1Z00 A;  1RQN A;  1S76 D;  1NZP A;  1BVS A;  1ZET A;  1QTM A;  3B0Y A;  5KFZ A;  4DSJ A;  1JRO A;  2H61 C;  2O60 A;  1SR6 B;  2MUT A;  1U5I B;  4UQG A;  5CSJ A;  4B9S A;  5I8N A;  5J0S A;  2R8H A;  8ICB A;  5DKW A;  1TV9 A;  3DD4 A;  3R9K A;  2WF9 A;  2AGQ A;  4JV0 A;  1MQ1 A;  5ALY A;  3CDN A;  5K4L A;  1AJ4 A;  4FZM A;  1RDF A;  2KIC A;  1NJX A;  3DY9 A;  2HSZ A;  2C2R A;  2E8O A;  4GXJ A;  3BFH A;  5H2F U;  1NK8 A;  1JIH A;  3PV8 A;  2Q91 A;  1S10 A;  2EGD A;  2LUC A;  3JVT B;  3D73 A;  4XQ8 A;  1J7O A;  2DKX A;  2W11 A;  4J9P A;  5ER5 A;  4GNK B;  4ELV A;  5CR0 A;  3CZ1 A;  4QZG A;  3K1E A;  4RT2 A;  2MRD A;  3OB2 B;  2MSN A;  1K9K A;  7ICV A;  3BQT A;  3PO5 A;  2OTG B;  4YMM A;  4QJ3 B;  1PRW A;  4IR1 A;  5D3O A;  2JXJ A;  3HX0 A;  5L1K A;  2JZB A;  4M9H A;  3HW8 A;  3SI8 A;  3OHM B;  1ALV A;  2WOS A;  1FFV A;  5IIM A;  3ISD A;  1ZUZ A;  1UHU A;  4IQV A;  3TFR A;  2KI6 D;  1XSP A;  2FI1 A;  3EUB 2;  3VGO A;  1ZQS A;  3WKC A;  3IVT A;  2BCX A;  5ALS A;  3A0H U;  3JVT C;  3RZS A;  1CRX A;  4C8K A;  3NRW A;  1NK5 A;  9ICC A;  1KQQ A;  3RM1 A;  5AI8 A;  4QNL A;  5ALJ A;  1NKE A;  3AQE A;  4ECY A;  1KSM A;  1GQM A;  4Q44 A;  2EH9 A;  3SJS A;  2FJU B;  1T8E A;  2JNF A;  3GOF A;  4QZI A;  4QW9 A;  2KFN A;  2BEC A;  4M04 A;  4EX7 A;  3IDW A;  1UPH A;  5ALZ A;  4TUP A;  1O03 A;  3EK4 A;  2B6G A;  1EL4 A;  3TUY C;  1T14 A;  2C28 A;  4C4S A;  1PK1 B;  1F8H A;  5KAF U;  5HR7 A;  2NCO A;  1KLN A;  1L6N A;  5DBA A;  1LS8 A;  5KFM A;  3N97 B;  3PW2 A;  1B43 A;  2G2B A;  2EC6 C;  4KLU A;  3SIA A;  4MZK A;  2JMG A;  3TUY B;  3QUT A;  3D0Y A;  3VCB A;  3MDC A;  3FE6 A;  5AI5 A;  1KKX A;  4FQT A;  1F55 A;  4I29 A;  3D0Y B;  1MXL C;  2PMZ F;  1ZQU A;  3E2E A;  1OSA A;  2FE9 A;  1SBJ A;  2IS9 A;  5FI2 A;  1YVL A;  3SD7 A;  1Q3V A;  3RB0 A;  4ZCV A;  1RXV A;  1L5U A;  2DBY A;  1CMG A;  4GGF A;  2HHW A;  2QB1 A;  7ICT A;  1B4C A;  2RDJ A;  2MHH A;  2ISD A;  2HHX A;  2UVU A;  5ALM A;  4ETO A;  1ZQH A;  1ZQN A;  4OZD A;  3SEN A;  2V4R A;  4MLW A;  2G5I B;  4Q45 A;  1J7R A;  4CLN A;  1IIP A;  1LKY B;  5D49 A;  3D2N A;  4OR9 B;  5J2H A;  4EZ6 A;  4ORC B;  2JZI A;  2KTQ A;  2K7D A;  3LWM A;  4FBU A;  4QZH A;  1S6I A;  5J2J A;  7ICE A;  2PYQ A;  1DF0 A;  2HW3 A;  3NSL A;  2YB4 A;  9ICQ A;  4UAR A;  1NK7 A;  1T3Q A;  1MA7 A;  4Z6F A;  2QEO A;  1ED1 A;  1KFU S;  1YTZ C; 
#chains in the Genus database with same CATH homology
 1B4F A;  3SS3 A;  5D3O A;  1PK1 A;  2D8C A;  4I5K A;  1UCV A;  2D3D A;  5L1M A;  2KLE A;  1JI7 A;  1X40 A;  5I94 A;  5FI7 A;  1RG6 A;  1Z1V A;  2QKQ A;  3BS7 A;  2KE7 A;  1LKY A;  4NJ8 A;  1SV0 A;  1F0M A;  2GLE A;  3IVT A;  1DXS A;  2QB0 A;  2BNX A;  2KLD A;  1WWU A;  4IS7 A;  2DKZ A;  3H8M A;  4JKT A;  1OW5 A;  3BS5 B;  1X66 A;  2KMD A;  5J8Y A;  4MHV A;  2QAR A;  5F3X B;  1DEL A;  2F3N A;  2LMR A;  4RQM A;  4PZN A;  1W9Z A;  2K4P A;  1Z2C B;  4I5J A;  4GAO A;  3BQ7 A;  3PM2 A;  1SV4 A;  1V85 A;  1SXD A;  4KYN A;  3TAD A;  2DL0 A;  3UO9 A;  3IDW A;  5FI6 A;  2QAR B;  5J8Y C;  2B6G A;  2E8P A;  2JV3 A;  1Z4H A;  4PZO A;  1PK1 B;  3OBV A;  1DEK A;  3UNW A;  2F8K A;  2KSO B;  3K1R B;  3HIL A;  3TAD C;  1SV0 C;  2QB0 B;  1X9X A;  5KNI A;  2ESE A;  2LPE A;  1UQV A;  2Y9T A;  1WWV A;  2YTU A;  1V38 A;  2Y9U A;  4IJ7 A;  4MEW A;  5JU5 A;  2FE9 A;  2EAN A;  5HL1 A;  3O4X A;  5FI2 A;  2KSO A;  5JTI A;  1PK3 A;  4NL9 A;  2ES6 A;  5JRT A;  3EG5 B;  2QB1 A;  2E8M A;  1B0X A;  3BS5 A;  2EAO A;  3KEV A;  3SS4 A;  1SGG A;  1OXJ A;  2KIV A;  3KKA C;  2E8O A;  3SEN A;  3SS5 A;  2BAP A;  1LKY B;  4NL9 C;  1COK A;  1KW4 A;  3KKA A;  3TAC B;  2F44 A;  2EAP A;  2EAM A;  4RQN A;  4GBA A;  2KG5 A;  2DKX A;  4I5N B;  2K60 A;  2YGU A;  4I5L B;  1DC1 A;  1SXE A;  3SEI A;  2L5Y A;  2E8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...