2K6AA

Solution structure of eas d15 truncation mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
b'SATTIGPNTCSIDDYKPYCCQSMSGSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSFLIINAANCVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrophobin
publication title The Cys3-Cys4 loop of the hydrophobin EAS is not required for rodlet formation and surface activity.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Structural protein
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2008-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.520 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k6aA00
2FMCA 2K6AA 2LFNA
chains in the Genus database with same CATH superfamily
4IUUA 4LMQD 2AQ3B 2F0LA 2LXKA 5ELFA 1EOTA 1S5CD 2EYJA 1X56A 2QDBA 4KV6A 4HIOA 2OXPA 3H09A 3J81c 1WJJA 3QOLA 4LFCQ 4JC0A 5C3EB 4DUYL 1SYDA 2F0OA 1P8LA 1X3EA 1X54A 1W6JA 2F0FA 3A54A 3L9AX 3T56B 4QUCA 5FO8B 3LX0A 2XRSD 4H13C 4XIGS 2Z6KC 1PFNA 3UDFA 1S5FD 4BY1G 1D8LA 4MIUA 4H44C 3RZOH 2R7FA 5C5MA 4OIJA 1HNXL 4BBRG 3CQZB 2E74C 1U4RA 3RZDB 3G6JB 2D0PA 4JV5L 3DLLA 1TT2A 4BY1H 1WTWA 4JPBW 4JI2Q 3ULJA 2JEBI 5IGEA 1LABA 2IL8A 2N55A 1F77A 1UWVA 3VR2A 4BBRH 1RF2D 4DR5Q 1TXYA 1KL9A 2F0IA 3QR8A 3AYHB 2NUCA 3J80E 3CKIB 3K7AH 1CQVA 3H0GG 1C48A 4JI8Q 1IBMQ 4XQJA 3URYA 1UNSA 1BOSA 4OGQC 1II3A 1Q46A 3CCJA 3RR5A 1EYAA 4MN3A 5EPKA 4FXGC 3CCSA 5EQ0A 1TWFB 5CMDA 4DN4M 4POGA 5EPLA 3HOXB 3H0GH 3K0XA 3KYHC 1Y1VB 3MXPA 2HQEA 3C2PA 4XYOA 5IT9L 2A1AA 3RN2A 2PYKA 2K75A 4G57A 1PZID 1GKHA 2K52A 4HCSA 5IWAL 1VQ6A 1KRTA 4X62Q 5L37A 2CHBD 2EIFA 1N36Q 3EN2A 3RLFA 1E1TA 3OIPA 2M00A 3Q22A 2UXDL 1LTID 1BXTA 3A55A 1HNZQ 3GTLH 3HOVB 3DMUA 2OTJA 1CSPA 5C4JB 4LNQA 2KEDA 2CFMA 5D3IB 2MO0A 4BXXG 3OMGA 3KUPA 4TSSA 2E2HH 3H91A 1CA5A 5LMNL 4HIDA 3S2DH 3HOZB 3R2TA 4BXXH 5E4XA 1K83B 2RDFA 2BH8A 3M7GA 2E2IH 4WJWA 1EU3A 3I73A 5G3LD 2R7ZG 3BDLA 2ICIA 4IUNA 3I91A 3PF5A 2JA6G 1HXYD 1W6KA 1QNUA 2A69C 2RKSA 1VQEA 1GD7A 1EL0A 2VW9A 1EQVA 2R7ZH 2DUDA 1FNWA 2HCCA 3KFUA 4ZAIA 2K05A 2TSSA 4IFDI 2RHSB 5IYDG 1F9PA 1IHZA 1GUGA 4IURA 3BZKA 1LT5D 4DV2Q 3D6CA 4DV4Q 4J1MA 4PZ8A 4LFAL 2C5CA 4HJAA 3H15A 1QVCA 4HMJA 3CC4A 4XQQA 5IYDH 1HQRD 3OW7A 3L7ZC 3F2BA 4CJ1B 3F2CA 1H9MA 1I4RA 1HTLD 1QZGA 4PMBA 2I07B 3EBEA 1GUOA 4PNYA 3TP5A 3RUZA 4X66L 2AWOA 5NUCA 2UUBL 4OL7A 3OYYA 3ND8A 3E5SA 4A3IB 3SGIA 1RDPD 4ZUIA 1K9MC 2UUAL 4JYAL 5JJLA 4G7OC 1HUNA 1GOZA 5KYLA 1FJGQ 3GTMH 1VQNA 1SNCA 3PO2G 4IPDA 4H02A 4GLXA 3FVQA 1XNRL 3WDNA 5M3MH 3SXHA 2VQFQ 4JI6Q 3TEHB 1I4XA 1CKOA 4R1JA 4DV5Q 3ULLA 2Z9HA 4OWTB 1Z6HA 4UY8C 4DV1Q 3NQTA 2DJGC 4DF7A 1SYFA 3MHBA 1ENCA 5C44B 4K0KQ 5JEAJ 1YIJA 2NZOA 4DNRB 3GQBA 4A3KG 1N32Q 5E7NA 3FPPA 4HMIA 1X3FA 1VQDA 1O7ZA 4C3IB 4WJ4A 1E2ZA 4OONA 2IPKD 1G51A 4ILWA 5FOBB 2F3WA 2J0TD 2R6GA 1PH6A 3RD4A 4EQPA 4KKSA 3R8BA 4DU9A 4A3KH 1BCPF 5FLXL 4CKCA 4PMWA 1HR0L 3K58A 5EKIA 1X9NA 1S3OA 3CHBD 1B50A 3I4NB 3HOYB 4YY3L 1IBLQ 1YNXA 4A3EB 1EEFD 2A69D 1T5XD 3PUWA 1WCMB 1C9OA 2MP1A 3PV0A 4K8JA 1SR3A 2AUJD 3FPUB 4X6AH 5CV7A 1D7QA 1RD9D 5C3WA 5IGGA 1ILQA 2M2LA 2AHOB 2PZTA 1L0XB 4NB3A 3JC66 4A3LG 4AQYQ 4YIJA 3SEBA 2B2WA 4IJLA 3VR5A 3CCVA 1CKMA 2IHFA 4Z9CB 2YU9H 3I70A 3BS1A 1ZXTA 4JBWA 4QIWE 5M5XB 4AH6A 2HDLA 2IX0A 4A3LH 1U4LA 3K81C 2AMCB 1WOCA 1MBYA 1HNWQ 2EY5A 5FK9C 2Q2UA 2NVQH 4DAPA 4GN3B 1XMOQ 1AW7A 2B8FA 1OO9B 3FRPB 1HZAA 2F0QA 2K5NA 4A3MB 1EUJA 4EGVA 4B3SL 5FO9B 1I3QB 3MEHA 4FYDA 2ENBA 2MUYA 4HJ5A 4A3FG 1XTCD 4IUTA 4OO1G 2WV6D 1TWHH 1QCBD 1F2MA 3N52A 2VQEQ 2ID0A 2F0UA 4Y7NB 4NPSA 4A93B 4P75A 4XDXA 3I55A 1I94Q 4A3FH 1NNXA 2P5ZX 5JOBA 1KAWA 4HCEA 4OO1H 1ICFB 5KEEA 3KOJA 1JJ2A 3NK9A 1IW7C 2QW7A 5M9OA 5KYIA 4LJZC 2KCMA 2LY7A 4CDEC 4EX5A 3L3OC 5JJZA 3RLOA 4JI1Q 1PTOF 1Z7TA 2EY6A 1BDOA 3J81L 4I7AA 2UXCL 5LL6S 1EY8A 4ZK9B 1RHPA 2Q2HA 1O78A 5D3DA 4P2CB 1LTLA 2GVAA 3CC7A 3HRZC 3I8ZA 2CQOA 2EYHA 3RLNA 4XQNA 1LLRD 2K5DA 3KLSX 2MJ8A 1CK1A 2WB1B 4DXGA 2ZXRA 3NEMA 1GM5A 1JORA 5IYBG 2UU9Q 2E76C 1I6HB 1WFQA 4UP7A 2PNRC 3MVVA 1BQQT 3AU7A 4JI0L 3DUZA 4FXKC 2F4VQ 5IYBH 1XJVA 2NVYB 1PZKD 4DAVA 2B2VA 3FDTA 2K5HA 1S5DD 1C8CA 2PMZE 2RVLA 2L11A 3KK7A 3S2HH 4N9TA 3GTQH 3AEVA 4FVMA 3E9IA 4DR3L 5E3FA 3PCOB 4FF4A 1JE5A 5ELCA 2Z6BA 1MD2D 2JA8G 3BZDB 2EVBA 2WIIB 3GO5A 1PXUA 1IXRA 1PH7A 3D3RA 3BDOA 4IUQA 1AZPA 1OXUA 1EIFA 1RL2A 4DV7L 4J15A 1SE4A 4FDBA 3NTHA 4L5RC 2RA4A 3VA7A 1PTOC 4GN5A 2F0JA 1BCPD 1TY2A 2B2YA 3DWPA 1EWCA 2FHTA 1TWCB 1F9QA 3J7A5 1OXXK 1S5BD 1PRTF 1K0RA 1VQ4A 1C7YA 4AYBB 1PV4A 1YHBA 5LHY1 3SR1A 3I7FA 3D4DA 3EQLC 2NVXB 4JI3Q 2EXDA 2H1EA 5LMNW 1QNKA 1PH3A 3T13A 5M3FB 3L0OA 4DR1L 5C0XI 2K33A 3HP3A 1W2BA 3CQZH 4ALPA 3PQIA 3VYUA 3QO2A 3S17H 3RZDH 5ELNA 1SYBA 1K3BC 3JAMi 2ZJRA 3NSWA 2PQEA 2UUCL 2BDOA 2MPMA 4EQOA 2KVMA 4KKTA 4JI5Q 3TSSA 1EQQA 3I90A 2NB0A 2ES2A 3DEOA 5EGTA 1BO0A 4BBSG 2N49A 3T1HL 5JPMC 1AZQA 5CYUA 4KD4A 1D5MC 2QA4A 4KHPQ 4KY6A 4X3KA 3PMFA 2B2TC 3PIO3 4GOPC 3GTGB 1RJTA 2XRQD 1G91A 1TWFH 2XN9C 1K73C 3NXWA 2XGTA 3MXNB 4NMZA 2LXJA 4X3SA 4APVA 1CKNB 2FFKB 1WTQA 1L1OA 1K8OA 3S1MB 3WOFA 4XTCS 1YI2A 4LFCL 1Q3LA 1GUSA 1JOOA 1HZ9A 2PQAB 3S1NB 2ZTCA 1PRTC 2O2LD 2NN6G 1S4ZA 1JMCA 4B3MQ 4FP5D 4DAYB 4IJHA 4RHSA 1CQFA 1KNAA 3HOZG 3QG1A 4C1NI 1EY6A 2WAQG 5DNFA 3P20A 4R9WA 2NN6H 1R4QB 1NMFA 3IKJA 1I50B 1H95A 1IKMA 2JP1A 1SNQA 1WTPA 3Q24A 1F9SA 4DK3C 1JOQA 3TREA 4K5WA 1AP0A 3HOZH 3S14B 2L9HA 1FNUA 2VS1A 1KLUD 4DFAA 1A62A 4GN4B 3CCEA 1NSNS 1PTOD 1W3SA 2ZJPA 4JI2L 4HTHA 2A68C 5C3XA 3W2DA 2DN8A 3TBIB 4DR5L 1B3AA 4A75A 1FR3A 3CCUA 2QILA 5ELBA 4X3TA 4PZ7A 4DV3Q 4DXFA 1GHKA 1J5EQ 1Y14B 4JI8L 1Q81C 1IBML 1Y1WB 1N9WA 1O80A 4RA8A 3PIOA 3NE5B 2MQHA 5CORA 2VXWA 2IJ0A 3A56A 1TS5A 3PUXA 4QF4A 2PI2E 2Y0SG 2HIVA 2A8VA 1UE1A 1SLJA 1A2TA 5CV5A 1LTBD 3UDXA 3IRBA 3U58A 3GP7A 2HQLA 4LF9Q 3J80c 3G7LA 1Q8KA 3NBIA 1M90C 2L1BA 1JCKB 4X62L 4LAAA 2RSOA 1PFMA 1N36L 1Z47A 1JWUD 2F1MA 5GADC 3I4LA 5J22A 1C0AA 2EPBA 2X69A 4OXPA 1HNZL 5J39A 2A6EC 4A3IG 5EAYA 1CSQA 3QWNA 3I56A 3CCMA 2ZT9C 3BU2A 3O13A 1YBYA 3M7NA 4RH6A 3V96A 3OWEB 5DEHA 1GUTA 2KHJA 5DAUA 2HIXA 4OX9Q 1CTMA 3W1GA 1GXDC 4KJNA 4A3IH 1EU4A 1IBKQ 3HOUB 4K6LA 4A3GB 3CU7A 4FF1A 4KJOA 3I3CA 1H9RA 2MO1A 2Z6KA 2F03A 5M5WB 2RQXA 5C44G 3MFYA 1X55A 1SBBB 1XX8A 1PRTD 4C3IG 2JYOA 3GD7A 4H7BA 1ZYRC 1A15A 2K32A 1LTRD 1I4GA 4MZ9A 3CRKC 5C44H 2C35B 2IT1A 2ZXOA 4RGNA 2IWHA 4JG2A 3LWUA 1TWGH 2F3IA 4C3IH 1LTTD 3PIPA 1SNPA 1X3PA 4ABNA 1TR5A 4LUOA 1SAPA 2X6GA 2K01A 3MXNA 4DV2L 4DV4L 1CKNA 4QUFA 3I4NG 3X3NA 5IGBA 3HOYG 1EIHA 4DK0A 3KDFA 1WTVA 3DHQA 1WCMG 1WYDA 2L55A 4EQNA 2A68D 4LF6Q 2L0CA 5I2YA 2E2JB 1KRSA 1VF5C 4GKKQ 2PQAA 4ZQ3A 3I4NH 1NY4A 3MTSA 5CC4A 3HOYH 1KXLA 4A3EH 1VQBA 3GTJH 3S16B 3PGZA 2QEXA 1WCMH 2JA5G 1E2WA 4DAYA 1Z9FA 2OT2A 4R4TA 3C46A 2K4KA 1VQHA 4G4KA 1KC8C 3BJUA 3U9OA 3UDGA 1DOMA 5K36H 1UE7A 3IFDA 4CDDC 3NP8A 5KNDA 1PHJA 4ZKCB 1XXGA 2JA5H 3CMAA 4IOCA 3IL8A 3P1HA 1B9MA 3SE0A 3A8KE 4QIWB 4WRDA 1HQMC 5A2QL 2H4OA 1FVIA 4GLVB 3P7JA 2TMPA 2OF1A 4WJ3M 1FJGL 3UDIA 1X3QA 4GKJQ 1DYQA 1FYCA 1GHJA 2K6AA 2SNSA 1SNDA 3G6EA 3K59A 4A3JB 2BH2A 4KY7A 1S5ED 3KBXA 2VQFL 4JI6L 3SK6A 4OHJA 3NWSA 2CWPA 3F8TA 3TP7A 4DV5L 5CR3A 5M5XH 2KCNA 3M4OB 4P74A 5C4ZA 4DV1L 2B63B 2RHQB 4IFDJ 1OXVA 4A3MG 2A6ED 5D65A 3T51B 4K0KL 1E22A 1YJ9A 1JWMD 2AWNA 1N32L 4DV6Q 2Q8TA 1HZCA 1TY0A 5DM73 4RCOA 3HZXA 1VQ5A 1AFPA 2HT1A 4K6DA 4LF5Q 4A3MH 3JAME 1PYBA 1E24A 1SROA 1SNMA 4A93G 3T53B 4C2MB 1G6PA 2N88A 2F0TA 4NXMQ 1KABA 2K04A 4JCVE 3HKSA 4DR6Q 4K2KA 3H3VC 5IY0A 3FMCA 4UHVA 2JSOA 1VQFA 1T5EA 1UEBA 4GLAC 1DONA 1VQJA 4Y7NH 1VF7A 1IBLL 4A93H 2HUGA 1ZYRD 1K3RA 2NYZD 1BCPB 2NVTH 3QJYA 3G4SA 1XPOA 3K7UC 4CDCC 4KY5A 4R4IA 4LF4Q 2XNAC 2EYFA 5M3MG 2G9HD 2ASBA 2J4XA 2JXMB 3VA5A 2EE1A 1SE2A 3BVGA 1EY7A 4GZYC 1YNJC 4IFDG 1IL2A 2E5LQ 2WB1G 2WP8J 1E7ZA 1MI2A 2H5XA 4DR4Q 4AQYL 2A74C 3UI2A 4LF8Q 4IFDH 2PNHA 1M8AA 3IAYA 3E0EA 1PMRA 1G2SA 4BY7G 4MTKA 1ICWA 3HG9A 1HZBA 4DA2A 1XMQQ 3BYYB 5BR8Q 1SSOA 3D31A 1I5FA 1RCVD 1SYEA 1HNWL 2FMCA 5AJ3Q 2NBFA 4BY7H 4LWCA 4RMFA 1XMOL 5EPJA 2PMZB 1CHPD 4MNOA 1G2TA 3MAQA 2EJGC 2G5DA 1Y8NB 4IPHA 2Z8LA 1FNVA 2OCEA 5EJWA 2Q8IB 1EEID 3K0YA 3GTOB 1HFGA 1PLFA 4RCNA 1ZKOA 2YTYA 1O7YA 4DPGA 3S9WA 3H0GB 3ICEA 2SDFA 2VQEL 1CHQD 4DAMA 1GUNA 4YHHQ 1E0BA 1I94L 2PO4A 5ELEA 4QB4A 1VQCA 2DNEA 3K5LA 2Q8RE 1TS3A 3J7AF 3L2PA 2EYPA 4M8AA 2JA7B 2MNAA 3VYSA 1BR9A 1N8RC 1ENFA 5JJKA 2I5LX 3CPWA 3H94A 3M3YH 2K1BA 4AYBG 5D14A 3UE1A 1FD7D 4JI1L 2E2HB 1BBWA 1WTOA 4UDUC 2ZTDA 1QE6A 2PCFB 4DUZQ 4A3BB 1TWCH 2B3GA 3OW2A 4IALA 3VDYA 3BDCA 2B2UC 2MHVA 2G9DA 3T4AC 5M3FG 1K8AC 3KF8B 1PTOB 3Q0AA 3S15B 1F2LA 2NVXH 3A5UA 1XWEA 4DK6C 2F52A 4A76A 2KEEA 3SDZA 5HGQA 1QVFA 2UU9L 3EJIA 5M3FH 1Y69U 1PA6A 4B9WA 2WAQE 1DZ1A 3M4QA 1YNJD 1JE4A 4IO9A 1MHWC 3FKIB 2JA6B 3CPFA 2IHEA 1NE3A 2O5JC 2EYLA 3LGJA 2F4VL 2RCFA 4DK1A 3CCRA 3ER0A 3FEWX 2F0SA 2VL6A 4WORA 1E1OA 2F0NA 2R7DA 3X3MA 3HKZB 3NQIA 4NDXA 2ZM6Q 1NJIC 1PH9A 1HJPA 2BOSA 2CCZA 2YV5A 4RGOS 1Q12A 4JBJA 4JW0A 2GN5A 4NP5A 3ZJYC 4JBKA 2E2DC 4DNIA 3STBC 1BBXC 3VR3A 4GS3A 1EYGA 3VR4A 4LUZA 2JK8A 1NBWA 3NPPA 2L12A 3MEFA 4CKEA 3GTGH 2KHIA 1VQOA 3E6ZX 1ENAA 4K5XA 1XNQQ 1G8ZD 1K0SA 2WINB 4BA2I 1A63A 2ATWA 2D5DA 5FO7B 3TZDA 2Y0SE 1BNZA 3J80L 1X32A 4Q0FA 3I4MB 2IX3A 1BUVT 4GOPB 1QG7A 4MHEA 2AUKA 3GTPH 1STNA 5I9PA 1FGUA 4LF7Q 5J1ZA 1D6EC 3NTKA 4UP8A 4O1NA 1R9TB 4XT3B 4ZUJA 4JI3L 1HRJA 2JN4A 5IT9E 1SDFA 4GNXC 1JR0D 3FHWA 2EY2A 3D8GA 3SK8A 1PRTB 1I50H 3PO2B 3J81i 1QILA 4DR2Q 5C4XB 4HR7B 5GAEC 3S1QH 1CZGA 1PYSB 3A7LA 1IZ6A 2B2VC 1EIGA 1STHA 4L63B 4R4QA 5HY6A 2FXQA 4A4IA 1OXTA 5I4DA 4EVOA 1SMYC 3HOWB 2O4XA 4B3RQ 1KNEA 4RGTA 4JI5L 3T1YQ 1HHVA 1RTOA 4C3JB 5E4WC 3MXUA 2WKDA 4DGZA 4G7ZC 4DNTB 1SNOA 1Y1WH 5IGFA 1GUWA 1IYJB 3K6OA 3N6RA 4PV1C 4KHPL 3U4VA 4PQXA 2HHHQ 5C3EG 4P71A 1B4OA 1WD1A 3D6WA 2YYZA 4ME3A 4OWXB 1YITA 4TRDA 1X65A 2B2YC 4KLKA 5GQOA 4FF3A 1CZWA 2Q2IA 3EVQA 5C3EH 4IQZA 1K8MA 5AFWA 1LV9A 2LS01 3A7AB 5I2XA 2KOLA 1SRUA 4YCUA 3CMEA 3CC2A 4JOIA 4B3ML 2OWOA 3KF8A 3D0FA 4JI4L 3CF5A 5C0XJ 5ELDA 1IW7D 4M1UB 1VQIA 3STBD 4A3GG 2K14A 3TP6A 1CM9A 2XTIA 1VQ8A 4KTAA 3DEPA 1STBA 3GV6A 1TQOA 1ET9A 1PVOA 4BS9A 1YVCA 1SFOB 1WTHA 2JJQA 1YJNA 4DV0Q 5I6YA 3H6MA 4A3GH 1X6OA 3U50C 1A0IA 3ERQA 3U9SA 4HSPA 5COYA 2VUMB 1NMGA 3I72A 3DXJC 1KIXA 1G291 1A8VA 2BE5C 4KHZA 4KKUA 1JOKA 1PFBA 2HD3A 1A2UA 1F2ZA 4HIKA 3P75A 1ESFA 3HOXG 2UXBQ 1DM0B 3DWQA 1Y1VG 2Q2TA 2ZTEA 1CA6A 4KK7A 4DV3L 4RG1A 1J5EL 2N3SA 4B9XA 3W3AA 3DM3A 4LK1C 4F7XA 2PW5A 3HOXH 1Y1VH 1LTSD 4A3FB 1L1OC 3S1RB 5C0XG 2BCOA 3PUVA 4ODGA 2B8GA 3HOVG 5EBDA 1NUCA 4K14A 2V4DA 1JQYD 4HSVA 4LF9L 4TVAB 1STAA 1VQLA 4XT1B 1STGA 2B2TA 4POFA 5C0XH 1SMYD 3T16A 4GOPA 2E2JH 3AMUA 1TS4A 2XIWA 3HOVH 5I6WA 3GV3A 4JI4Q 2CW0C 4JVZA 5C4JH 1H9SB 2KECA 3OSOA 2Z1CA 1K8GA 1QWYA 5A35A 2F4IA 2VY3A 5FLXE 5GAGC 1P16A 1LM0A 1ML0D 1SJHD 3K8AA 4XXEA 4F8MA 1Q1BA 1VQMA 4OX9L 1Q8IA 1K83H 3MFGA 1N33Q 1TVXA 5BN4A 1B44D 1IBKL 1SE3A 5IE8A 4DR7Q 3PUZA 3SK5A 2B63G 2XWJB 2WKCA 2DNCA 5T1GA 5LMUQ 4L6TB 2R92B 2WB1E 2R3ZA 4UPAA 4FNFA 3E9HA 1PH8A 2JQOA 4RHRA 1V1PB 1TWAB 2A73B 2NTSA 4P73A 3M4OH 2B63H 3I2ZA 2EQSA 1MJEA 4X65Q 1H9KA 3J7ZC 1UAPA 3GTKB 3S2HB 3PIP3 2D9UA 1XPRA 1J6QA 1DOKA 1ESRA 2L4NA 3CD6A 2RF4A 1BBUA 3OPOA 4IPGA 1SN8A 1A3TA 3RMHA 3W1BA 4HJ7A 4NXNQ 1VS0A 1HR0W 2DY7A 1HH2P 1CI3M 4RFBA 4C2MH 1SXTA 4TQUS 5FJ8H 3M4PA 2QF7A 2NWGA 4KI0A 4X64Q 1OTCA 4A3CG 4LF6L 2EDGA 2BE5D 2EZVA 2JA8B 1L0YB 4GKKL 3D4WA 5M5YB 1S40A 3QIAA 4G7HC 2LSSA 5ISRA 1E2VA 4A3CH 1AN8A 2GVBA 4R8IA 3KJPA 2XVSA 4R8NA 4A3DB 4B3TQ 1QOHA 1NR2A 2QCPX 4UP9A 3SHLA 2IY5B 2CWAA 5CBEE 4GKJL 4AYBE 3EIVA 1N34Q 1U5KA 3OWFA 2MGSA 2OQ0A 3S17B 5IP9G 1L0WA 1EQTA 1B1ZA 1G6ZA 2PZWA 3NBHB 1EZ8A 3OTOL 4YWLA 2CW0D 3LWEA 4TKOB 4MTNA 4ZRZA 3RNUA 5IP9H 3HFZB 5KIXA 3R2IA 3J81E 4DV6L 1ET6A 2F0GA 2ICEC 4ZCKA 5C4HA 1OXSC 3D4RA 1QUQB 3HS0C 4A3EG 4LF5L 2WFWA 4K2LA 3WWVA 3SVMA 4JI7Q 3K5NA 1V8QA 3W5OA 2F0EA 4L5TA 3GTOH 3KBGA 4BBSB 4NXML 1R4PB 5CV9A 5K36G 3KF6B 1NR4A 4DR6L 1J9OA 1SEBD 3U4ZA 2JA7G 2YTVA 5C5LA 1VQAA 2J7ZA 1KDBA 4DUYQ 5IYCG 1YHQA 1H9SA 3MXGA 2EYMA 3WOEA 3JAMc 3TDQA 1GJXA 1AH9A 3OOCA 4KD3A 3S24A 4LF4L 1I4HA 2JA7H 4F88A 1WVLA 4CJ2C 2K7VA 4A3BG 2BA0A 4PMCA 5TSSA 4QMGA 5IYCH 2Z4IA 3OMCA 4J8QA 4DKAC 5E1FA 1KQSA 5KNBA 1VQ7A 2EOTA 1GVPA 1HNXQ 4CJ0B 2CQAA 2E5LL 1ASZA 3ZYYX 1MGSA 2K03A 4DR4L 2I46A 4A3BH 1F2YA 3BG3A 4JV5Q 2K5QA 3PO3B 4LF8L 2E8GA 4BA1I 4KN4C 3OTOQ 3J81j 2XWBB 1BF4A 2WAQB 4O2DA 5BN5A 4ME5A 3OHXC 1JJCB 2LMCB 1XMQL 3PUYA 1PTOH 1I4QA 1V1PA 1QB5D 5BR8L 4FF2A 1PYWD 2R93B 1DCZA 1Y8PB 3S15H 2F0MA 2I0QA 4ZLTF 2DGYA 1RODA 3FKIG 3MA2B 4CDFC 5AJ3L 1HCZA 3SK4A 2AKWB 4C3HB 1HTPA 1RKNA 4C56C 2PPBC 1AEXA 1TIID 1I3QH 2BA1A 4ZKBB 3HKZG 4IN3A 2D62A 2A6HC 3FKIH 2JA6H 2OTLA 1MSHA 3TN2A 2OQKA 3M4YA 4QCLA 5IGDA 3ULPA 3AQQA 4ZYSA 1E3PA 1U4MA 4IUPA 5CBAE 4K8IA 5J3BA 2RCNA 5IWAQ 3TS0A 3TRZA 3K5MA 2VZAA 1HPCA 3ERSX 2F0PA 2IX1A 4YHHL 4JBMA 2MFIA 1KLGD 2R61A 2Y0SB 2KA7A 2UXDQ 1PH2A 1NAPA 2RDHA 3NUCA 1YJWA 1JB7A 1RTNA 3PSIA 5EKLA 3I4MG 5KRUA 2KCTA 4RAUC 4ID6A 1C4QA 1F9RA 1D2BA 5LMNQ 3CW2C 4R4CA 3RZOB 1EOVA 5DM63 3RN5A 3V2TA 2ZXPA 1SYCA 3I4MH 4DUZL 1J8IA 1IKLA 1XPUA 2YTXA 1WTRA 3CAMA 3BYTB 4BY1B 1JWSD 1VQ9A 3BVZA 1HA5A 5IP7G 4BBRB 2QEJC 3G48A 5C4XG 1D1KA 3NBHA 2DY8A 1R9TH 1SJED 1I6HH 1B53A 1YNNC 3K7AB 4HAEA 5IP7H 3E0JA 4YWMA 3PO2H 4X3UA 5C4XH 3HOWG 1LT6D 1DD2A 3TS2A 5FLMG 1UE5A 2KJXA 2XSCA 1QUQA 2E75C 2NVYH 5IODA 3HEJA 4C3JG 3TQYA 1TWGB 4KN7C 4GNXB 4PG3A 1Q1EA 2VB2X 3K5OA 4N8X1 4LFAQ 3HOWH 1T9HA 5KNCA 5DLQE 3KF6A 5FLMH 3Q6SA 5CV4A 1O7LA 2ZM6L 1QZHA 4C3JH 2L15A 1D1IA 4ULLA 3A5ZB 4N8FA 1VCIA 4YCVA 1ZEQX 1JT8A 1UUPA 4Y52H 3GTLB 1B2TA 2A5HA 1PH1A 3GTJB 4X66Q 1MIUA 3HGBA 2B2WC 1YHAA 1LO5D 2KHSA 4HIMA 2UUBQ 1XNQL 5ELOA 3VR6A 5JJIA 2RSNA 4L5QA 1LACA 1LTAD 2A6HD 3B6YA 4CHTB 3K57A 3S2DB 4JYAQ 2UUAQ 2JA5B 2F0HA 1V43A 1QJOA 1VQGA 5JEAG 4OO1I 2E2IB 4BWGB 1XNRQ 4IZ8A 4KMUC 3PF4A 4KHVA 4LF7L 2BDNA 1EQRA 1IYVA 4L8JA 5JEAH 5GAHC 2I5HA 2EJFC 2VUMG 2DJFC 1EFWA 2B2UA 4LFBL 2R7ZB 1LYLA 1SFOH 1ONLA 1SE8A 4DR2L 3ONAB 4E6IA 2Z0SA 3ND9A 5KGUA 2IW3A 1BVSA 3A8IE 3MWYW 1MSGA 2WACA 2FJ2A 2VUMH 1EYDA 3I4OA 3CRLC 4CBVA 2CVRA 4B3RL 2RBMA 5IT9c 3DM1A 4U68A 3Q23A 1HR0Q 3T1YL 1DXMA 1DOLA 3AB9A 3KLWA 1BCPC 2EXZA 5C6AA 2F3VA 1LTGD 1XTDA 4OEMB 4YY3Q 3NENA 3AFQA 1O7IA 1NTGA 3J7AV 1YNND 1B7YB 1KHIA 2HHHL 2FINB 2SNMA 1QVGA 1U0LA 2B29A 3A0JA 2NVTB 5JVH3 4OELB 3S1RH 1EY4A 4S3SA 4R4OA 4C1NK 3S1MH 1RIPA 1S72A 3UE0A 1HFNA 5CGKA 4OWWB 3S1NH 1FL0A 3A74A 1STYA 4HN7A 3GTMB 2D0OA 2KUMA 1L1OB 2B39A 1HA6A 4YWKA 5BN3A 3CXCA 2NZHA 4EQ5A 5M3MB 1EWIA 1VMPA 1Q7YC 4V190 3DWAA 4J6HA 3VYTA 2OEOA 1CFMA 5EKKA 2F0DA 3J7YW 4LFBQ 1PDQA 2A19A 3Q8DA 4O0AA 1JJGA 5T1IA 1YZ6A 3J80i 4F87A 3S14H 5CV8A 1LUZA 2R92G 1MKHA 2QGQA 2LFNA 4DV0L 3F2UA 2D2CC 1SYGA 4JK1C 3QB3A 1HUMA 4BY7B 1Y1WG 1D5XC 2K50A 3H3VI 4B3SQ 4QJFA 4GNXA 1Y8OB 2F0VA 2R92H 3KJOA 5FKAC 4A3KB 1H9JA 2K5WA 1EY9A 1EWHA 2KENA 3R93A 1YEZA 1TWAH 3EFXD 3BZCA 2UXBL 4IOAA 4K5VA 3VYRA 3EA6A 3QOJA 2X6LA 3CCLA 2GA4B 1EFID 4IPCA 4RWSC 5A2QE 1M1KC 1DGSA 4B08A 4FO2A 3GTKH 5JAVA 3G71A 3ITPA 3OIQA 1STEA 1NCVA 4XYQA 2ALYB 5GROA 2FMMA 4NKLA 1V1QA 1WTXA 2KCCA 3E3XA 1KDCA 2EYOA 2AQ2B 1B8AA 4QQBX 3TMEA 1D5ZC 2HCIA 2QKIC 1VMCA 2I5MX 2JA9A 5HURA 4JOIC 4L5SA 3M3YB 2JA8H 2UXCQ 3EROA 2CH4A 3KLRA 1EIYB 1M4VA 4U673 5M5YH 3HOUG 1PZJD 4A3DG 3AFPA 1Q90A 3TZUA 1FGBD 3JAML 2YU9B 2K5VA 1WI5A 1TKWB 4RKLA 3H3VH 3C1FA 4WFN3 3HOUH 4A3DH 3CCQA 1VDZA 1KDAA 4RKBA 1TS2A 2N78A 2SEBD 2NVQB 1WD0A 1JB3A 2JE6I 1N33L 4NW2A 1X3GA 4O42A 1A3VA 1Q86C 3NHHA 1KTKA 4QL5A 3MC0B 1L2FA 5M5WH 3GDEA 1AE2A 1Q82C 4DR7L 2F0WA 1V9PA 1EYCA 4JI0Q 1LT4D 2KQ3A 5K5PA 5LMUL 3C1EA 2VNUD 1K28A 1UE6A 3F1ZA 5I9OA 5FLXc 2JEAI 4LUVA 2L5TA 4QY7A 1B70B 4N9PA 1UEAB 3NELA 5IGCA 1TWHB 1ASYA 1XYIA 2NN6I 2VB3X 1TU2B 4OIKA 4CKBA 2K28A 1V1OA 5LL6X 3NWTA 2EJMA 4X65L 2SOBA 4DR3Q 3V05A 1A3UA 2F0KA 1B3QA 4QGUA 1BKBA 3CP0A 4AIMA 5CV6A 3A8JE 2M9VA 1IYUA 4H0LC 4HEDA 4NXNL 4PZ6A 3FP9A 1U4PA 4I65A 4V0BA 4DV7Q 5EBCA 3HKZE 3LNNA 1LT3D 4BBSH 4Q5VA 1I6VC 1EY5A 1EZ6A 4X64L 4UAIA 1IL8A 5IIFA 1VQKA 3S16H 5G3LF 1EY0A 3KDFB 4I7ZC 2ZJQA 2CH4W 4YCWA 3F2DA 3TP8A 5HGTA 1B9NA 2PW7A 2QDLA 2HDMA 3R3OA 2V1CC 4RGMA 3GTPB 1U9RA 3BVMA 4A3JG 1CT1D 2PZUA 3IFTA 1SMXA 1KD1C 4FXDA 1GO3E 1A6XA 1ILPA 2EY1A 3PO3G 1DJRD 4B3TL 4CGYB 5H1SE 3K80C 4DR1Q 1PH5A 3MZ5A 4A3JH 5JVG3 2Z4HA 2R93G 1N34L 3PO3H 1PFSA 5IOCA 3S1QB 5F2DA 3M9BA 2UUCQ 3KLSA 2AQ1B 2PI2A 2LKVA 4C3HG 2N8NA 5JPNC 2RDGA 4HJ8A 1PH4A 2KBNA 2R93H 3M85A 1CUKA 1KAAA 1AE3A 4P72A 5FJ8G 1JICA 3GTQB 2O5IC 3T1HQ 2NZ1D 4LW1A 4C3HH 1VQPA 2NTTA 3C3LA 1JC7A 4HJ9A 2CKZB 3NTIA 1I4PA 4IUVA 1MJCA 2C9OA 4JI7L
chains in the Genus database with same CATH topology
4IUUA 4LMQD 2AQ3B 2F0LA 5ELFA 1EOTA 1S5CD 2EYJA 2QDBA 4KV6A 2OXPA 3H09A 3QOLA 5C3EB 1SYDA 2F0OA 1W6JA 2F0FA 3A54A 3L9AX 3T56B 4QUCA 5FO8B 3LX0A 2XRSD 4H13C 4XIGS 1PFNA 1S5FD 4MIUA 4H44C 5C5MA 4OIJA 3CQZB 2E74C 1U4RA 3RZDB 3G6JB 1TT2A 1WTWA 2JEBI 5IGEA 1LABA 2IL8A 2N55A 1F77A 3VR2A 1RF2D 2F0IA 2NUCA 3J80E 3CKIB 1CQVA 1C48A 4XQJA 3URYA 1UNSA 1BOSA 4OGQC 1II3A 1EYAA 4MN3A 5EPKA 4FXGC 5EQ0A 1TWFB 5CMDA 4DN4M 5EPLA 3HOXB 1Y1VB 3MXPA 2HQEA 3C2PA 4XYOA 5IT9L 2PYKA 4G57A 1PZID 4HCSA 2CHBD 3RLFA 3OIPA 2M00A 3Q22A 1LTID 1BXTA 3A55A 3HOVB 3DMUA 5C4JB 2KEDA 5D3IB 3OMGA 3KUPA 4TSSA 3H91A 1CA5A 3HOZB 3R2TA 5E4XA 1K83B 2RDFA 3M7GA 4WJWA 1EU3A 3I73A 5G3LD 3BDLA 2ICIA 4IUNA 3I91A 1HXYD 1W6KA 1QNUA 2A69C 2RKSA 1EL0A 1EQVA 1FNWA 2HCCA 4ZAIA 2K05A 2TSSA 4IFDI 1F9PA 1IHZA 1GUGA 4IURA 1LT5D 3D6CA 4J1MA 2C5CA 4HMJA 4XQQA 1HQRD 3OW7A 3L7ZC 4CJ1B 1H9MA 1I4RA 1HTLD 4PMBA 2I07B 1GUOA 4PNYA 3TP5A 3RUZA 2AWOA 5NUCA 4OL7A 3ND8A 3E5SA 4A3IB 1RDPD 4ZUIA 4G7OC 1HUNA 1GOZA 5KYLA 1SNCA 3FVQA 3WDNA 3SXHA 1I4XA 1Z6HA 3NQTA 4DF7A 1SYFA 3MHBA 1ENCA 5C44B 5JEAJ 4DNRB 3GQBA 3FPPA 4HMIA 4C3IB 1O7ZA 1E2ZA 2IPKD 4ILWA 5FOBB 2F3WA 2J0TD 2R6GA 3RD4A 4EQPA 4KKSA 3R8BA 4DU9A 1BCPF 5FLXL 4CKCA 4PMWA 3K58A 5EKIA 3CHBD 1B50A 3I4NB 3HOYB 4A3EB 1EEFD 2A69D 1T5XD 3PUWA 1WCMB 2MP1A 3PV0A 4K8JA 2AUJD 3FPUB 5CV7A 1RD9D 5C3WA 5IGGA 1ILQA 2M2LA 2PZTA 1L0XB 4YIJA 3SEBA 2B2WA 3VR5A 4Z9CB 3I70A 3BS1A 1ZXTA 4JBWA 5M5XB 2HDLA 2IX0A 1U4LA 1MBYA 2EY5A 5FK9C 4DAPA 1AW7A 2B8FA 1OO9B 3FRPB 2F0QA 4A3MB 4EGVA 5FO9B 1I3QB 3MEHA 4FYDA 2ENBA 2MUYA 1XTCD 4IUTA 4OO1G 2WV6D 1QCBD 1F2MA 3N52A 2ID0A 2F0UA 4Y7NB 4A93B 4XDXA 5JOBA 4HCEA 4OO1H 5KEEA 3NK9A 1IW7C 5M9OA 5KYIA 4LJZC 2LY7A 3L3OC 5JJZA 1PTOF 1Z7TA 2EY6A 1BDOA 3J81L 5LL6S 1EY8A 4ZK9B 1RHPA 1O78A 5D3DA 4P2CB 3HRZC 3I8ZA 2EYHA 4XQNA 1LLRD 2K5DA 3KLSX 2MJ8A 1CK1A 2WB1B 4DXGA 2ZXRA 1JORA 1I6HB 2E76C 2PNRC 3MVVA 1BQQT 3AU7A 3DUZA 4FXKC 2NVYB 1PZKD 4DAVA 2B2VA 3FDTA 1S5DD 1C8CA 2RVLA 2L11A 3KK7A 4N9TA 4FVMA 5E3FA 4FF4A 5ELCA 1MD2D 3BZDB 2EVBA 2WIIB 3GO5A 1PXUA 3D3RA 4IUQA 3BDOA 1AZPA 1OXUA 1SE4A 3NTHA 2RA4A 3VA7A 1PTOC 2F0JA 1BCPD 1TY2A 2B2YA 3DWPA 1EWCA 2FHTA 1TWCB 1F9QA 1OXXK 1S5BD 1PRTF 4AYBB 5LHY1 3SR1A 3D4DA 3EQLC 2NVXB 2H1EA 1QNKA 3T13A 5M3FB 5C0XI 2K33A 3HP3A 3VYUA 3QO2A 1SYBA 3NSWA 2PQEA 2BDOA 2MPMA 4EQOA 2KVMA 4KKTA 3TSSA 3I90A 2NB0A 3DEOA 5EGTA 1BO0A 5JPMC 1AZQA 5CYUA 4KD4A 1D5MC 4KY6A 4X3KA 3PMFA 2B2TC 3PIO3 3GTGB 1RJTA 2XRQD 1G91A 2XN9C 3NXWA 4X3SA 4NMZA 2FFKB 1WTQA 1K8OA 3S1MB 3WOFA 4XTCS 1Q3LA 1GUSA 1JOOA 3S1NB 1PRTC 2O2LD 2NN6G 1S4ZA 4FP5D 4RHSA 1CQFA 1KNAA 3QG1A 4C1NI 1EY6A 5DNFA 3P20A 4R9WA 2NN6H 1R4QB 3IKJA 1I50B 1IKMA 2JP1A 1SNQA 1WTPA 3Q24A 1F9SA 1JOQA 4K5WA 1AP0A 3S14B 2L9HA 1FNUA 1KLUD 4DFAA 1NSNS 1PTOD 4HTHA 2A68C 5C3XA 3W2DA 2DN8A 3TBIB 1B3AA 1FR3A 2QILA 5ELBA 4X3TA 4DXFA 1GHKA 1Y1WB 1O80A 4RA8A 3NE5B 5CORA 2VXWA 2IJ0A 3A56A 1TS5A 3PUXA 4QF4A 1A2TA 5CV5A 1LTBD 3GP7A 3G7LA 3NBIA 2L1BA 1JCKB 4LAAA 2RSOA 1PFMA 1Z47A 1JWUD 2F1MA 3I4LA 5J22A 2EPBA 2X69A 5J39A 2A6EC 3QWNA 2ZT9C 3O13A 3M7NA 4RH6A 3V96A 3OWEB 5DEHA 1GUTA 5DAUA 1CTMA 1GXDC 4KJNA 1EU4A 3HOUB 4K6LA 4A3GB 3CU7A 4FF1A 4KJOA 3I3CA 1H9RA 2F03A 5M5WB 2RQXA 3MFYA 1SBBB 1XX8A 1PRTD 4C3IG 2JYOA 3GD7A 4H7BA 1ZYRC 1A15A 2K32A 1LTRD 1I4GA 3CRKC 2IT1A 2ZXOA 4RGNA 2IWHA 3LWUA 1LTTD 1SNPA 1X3PA 4ABNA 1TR5A 1SAPA 2X6GA 2K01A 3MXNA 4QUFA 3X3NA 5IGBA 1EIHA 4DK0A 1WTVA 3DHQA 2L55A 4EQNA 2A68D 2L0CA 5I2YA 2E2JB 1VF5C 4ZQ3A 3MTSA 5CC4A 3S16B 1E2WA 4DAYA 2OT2A 3C46A 4G4KA 3U9OA 1DOMA 5K36H 3IFDA 3NP8A 5KNDA 4ZKCB 1XXGA 3IL8A 3P1HA 1B9MA 3SE0A 3A8KE 4QIWB 4WRDA 1HQMC 5A2QL 2H4OA 3P7JA 2TMPA 2OF1A 1X3QA 1DYQA 1FYCA 1GHJA 2K6AA 2SNSA 1SNDA 4A3JB 3K59A 4KY7A 1S5ED 3KBXA 3SK6A 4OHJA 3NWSA 3TP7A 5CR3A 2KCNA 3M4OB 5C4ZA 2B63B 4IFDJ 1OXVA 2A6ED 5D65A 3T51B 1JWMD 2AWNA 2Q8TA 1TY0A 5DM73 4RCOA 3HZXA 1AFPA 4K6DA 3JAME 1SNMA 3T53B 4C2MB 2N88A 2F0TA 1KABA 2K04A 4K2KA 3H3VC 3FMCA 2JSOA 1DONA 1T5EA 1VF7A 2HUGA 1ZYRD 2NYZD 1BCPB 3QJYA 4KY5A 2XNAC 2EYFA 2G9HD 2J4XA 2JXMB 3VA5A 2EE1A 1SE2A 3BVGA 1EY7A 4GZYC 1YNJC 4IFDG 2WP8J 1MI2A 2A74C 3UI2A 4IFDH 1M8AA 3IAYA 1PMRA 1G2SA 1ICWA 3HG9A 4DA2A 3BYYB 1SSOA 3D31A 1RCVD 1SYEA 2FMCA 2NBFA 5EPJA 2PMZB 1CHPD 1G2TA 3MAQA 2EJGC 1Y8NB 2Z8LA 1FNVA 5EJWA 2Q8IB 1EEID 3K0YA 3GTOB 1HFGA 1PLFA 4RCNA 1ZKOA 1O7YA 3S9WA 3H0GB 2SDFA 1CHQD 1GUNA 1E0BA 2PO4A 5ELEA 4QB4A 2DNEA 3K5LA 2Q8RE 1TS3A 3J7AF 2EYPA 4M8AA 2JA7B 3VYSA 1BR9A 1ENFA 3H94A 2K1BA 5D14A 1FD7D 2E2HB 1WTOA 4UDUC 1QE6A 2PCFB 4A3BB 4IALA 3BDCA 2B2UC 2MHVA 2G9DA 3T4AC 1PTOB 3Q0AA 3S15B 1F2LA 1XWEA 2KEEA 3SDZA 3EJIA 1Y69U 1DZ1A 4B9WA 1YNJD 1JE4A 3FKIB 2JA6B 2O5JC 2EYLA 4DK1A 3FEWX 2F0SA 4WORA 2F0NA 3X3MA 3HKZB 3NQIA 4NDXA 2BOSA 4RGOS 1Q12A 4NP5A 2E2DC 1BBXC 3VR3A 3VR4A 3NPPA 2L12A 4CKEA 3E6ZX 1ENAA 4K5XA 1G8ZD 2WINB 4BA2I 2D5DA 5FO7B 3TZDA 1BNZA 3J80L 1X32A 4Q0FA 3I4MB 2IX3A 1BUVT 1QG7A 4MHEA 2AUKA 1STNA 5I9PA 5J1ZA 1D6EC 3NTKA 4O1NA 1R9TB 4XT3B 4ZUJA 1HRJA 5IT9E 1SDFA 1JR0D 2EY2A 3D8GA 3SK8A 1PRTB 3PO2B 1QILA 5C4XB 4HR7B 1CZGA 3A7LA 2B2VC 1EIGA 1STHA 4L63B 1OXTA 5I4DA 4EVOA 1SMYC 3HOWB 2O4XA 1KNEA 4RGTA 1HHVA 1RTOA 4C3JB 5E4WC 3MXUA 2WKDA 4DGZA 4G7ZC 4DNTB 1SNOA 5IGFA 1GUWA 3K6OA 3N6RA 4PV1C 4PQXA 1B4OA 1WD1A 3D6WA 2YYZA 4TRDA 2B2YC 4FF3A 1CZWA 3EVQA 4IQZA 1K8MA 5AFWA 1LV9A 2LS01 3A7AB 5I2XA 2KOLA 3KF8A 5C0XJ 5ELDA 1IW7D 4M1UB 3TP6A 1CM9A 4KTAA 3DEPA 1STBA 3GV6A 1TQOA 1ET9A 4BS9A 1SFOB 5I6YA 3H6MA 3ERQA 3U9SA 4HSPA 5COYA 2VUMB 3I72A 3DXJC 1G291 2BE5C 4KHZA 4KKUA 1JOKA 1PFBA 1A2UA 1F2ZA 3P75A 1ESFA 1DM0B 3DWQA 1CA6A 4KK7A 4B9XA 3W3AA 4LK1C 4F7XA 2PW5A 1LTSD 4A3FB 3S1RB 5C0XG 2BCOA 3PUVA 4ODGA 2B8GA 5EBDA 1NUCA 4K14A 2V4DA 1JQYD 4HSVA 1STAA 4XT1B 1STGA 2B2TA 5C0XH 1SMYD 3T16A 3AMUA 1TS4A 2XIWA 5I6WA 3GV3A 2CW0C 1H9SB 2KECA 3OSOA 2Z1CA 1QWYA 5A35A 2F4IA 5FLXE 1ML0D 1SJHD 4XXEA 4F8MA 1Q1BA 1Q8IA 3MFGA 1TVXA 5BN4A 1B44D 1SE3A 3PUZA 3SK5A 2XWJB 2WKCA 2DNCA 5T1GA 4L6TB 2R92B 2R3ZA 4FNFA 4RHRA 1V1PB 1TWAB 2A73B 2NTSA 1H9KA 1UAPA 3GTKB 3S2HB 3PIP3 2D9UA 1DOKA 1ESRA 2L4NA 3OPOA 3RMHA 1A3TA 2DY7A 1CI3M 4RFBA 1SXTA 4TQUS 2QF7A 4KI0A 2NWGA 2EDGA 2BE5D 2EZVA 2JA8B 1L0YB 3D4WA 5M5YB 3QIAA 4G7HC 5ISRA 1E2VA 1AN8A 4R8IA 2XVSA 4R8NA 4A3DB 1QOHA 1NR2A 2QCPX 3SHLA 5CBEE 3OWFA 2MGSA 3S17B 1EQTA 1B1ZA 1G6ZA 2PZWA 1EZ8A 2CW0D 3LWEA 4TKOB 4ZRZA 5KIXA 3R2IA 3J81E 1ET6A 2F0GA 2ICEC 5C4HA 1OXSC 3D4RA 3HS0C 3SVMA 4K2LA 3K5NA 1V8QA 2F0EA 3KBGA 4BBSB 1R4PB 5CV9A 5K36G 1NR4A 1J9OA 1SEBD 5C5LA 2J7ZA 1KDBA 1H9SA 3MXGA 2EYMA 3WOEA 3TDQA 1GJXA 3OOCA 4KD3A 1I4HA 4F88A 1WVLA 4CJ2C 2K7VA 2BA0A 4PMCA 5TSSA 4QMGA 2Z4IA 3OMCA 4J8QA 5E1FA 5KNBA 2EOTA 4CJ0B 2CQAA 3ZYYX 1MGSA 2K03A 2I46A 1F2YA 3BG3A 2K5QA 3PO3B 4BA1I 4KN4C 2XWBB 1BF4A 2WAQB 5BN5A 4ME5A 3OHXC 2LMCB 1PTOH 1I4QA 3PUYA 1V1PA 1QB5D 4FF2A 2R93B 1PYWD 1DCZA 1Y8PB 2F0MA 4ZLTF 1RODA 3MA2B 1HCZA 3SK4A 4C3HB 1HTPA 1RKNA 4C56C 2PPBC 1AEXA 1TIID 2BA1A 4ZKBB 4IN3A 2D62A 2A6HC 1MSHA 3TN2A 3M4YA 4QCLA 5IGDA 4ZYSA 1U4MA 4IUPA 5CBAE 4K8IA 3K5MA 1HPCA 2F0PA 2IX1A 1KLGD 2R61A 2Y0SB 2KA7A 1NAPA 2RDHA 3NUCA 1RTNA 5EKLA 5KRUA 4RAUC 4ID6A 1C4QA 1F9RA 1D2BA 3RZOB 5DM63 3V2TA 2ZXPA 1SYCA 1J8IA 1IKLA 1WTRA 3BYTB 4BY1B 1JWSD 3BVZA 1HA5A 4BBRB 2QEJC 1D1KA 3NBHA 2DY8A 1SJED 1B53A 1YNNC 3K7AB 4HAEA 3E0JA 4X3UA 1LT6D 1DD2A 2KJXA 2XSCA 2E75C 5IODA 3HEJA 4C3JG 1TWGB 4KN7C 1Q1EA 2VB2X 3K5OA 5KNCA 3Q6SA 5CV4A 1O7LA 1D1IA 4ULLA 1VCIA 1ZEQX 1UUPA 3GTLB 1B2TA 2A5HA 3GTJB 3HGBA 2B2WC 1LO5D 2KHSA 3VR6A 2RSNA 1LACA 1LTAD 2A6HD 4CHTB 3K57A 3S2DB 2JA5B 2F0HA 1V43A 1QJOA 5JEAG 4OO1I 2E2IB 4BWGB 4IZ8A 4KMUC 4KHVA 2BDNA 1IYVA 4L8JA 5JEAH 2EJFC 2B2UA 2R7ZB 1ONLA 3ONAB 4E6IA 3ND9A 5KGUA 2IW3A 3A8IE 3MWYW 1MSGA 2WACA 2FJ2A 1EYDA 3CRLC 4CBVA 2CVRA 2RBMA 3DM1A 4U68A 3Q23A 1DXMA 1DOLA 3AB9A 1BCPC 2EXZA 5C6AA 2F3VA 1LTGD 3J7AV 1YNND 2FINB 2SNMA 2NVTB 5JVH3 1EY4A 4S3SA 4C1NK 1HFNA 5CGKA 1STYA 4HN7A 3GTMB 2KUMA 2B39A 1HA6A 5BN3A 5M3MB 1VMPA 4V190 3DWAA 4J6HA 3VYTA 2OEOA 1CFMA 5EKKA 2F0DA 3J7YW 1PDQA 5T1IA 4F87A 5CV8A 2LFNA 3F2UA 2D2CC 1SYGA 4JK1C 3QB3A 1HUMA 4BY7B 1D5XC 1Y8OB 2F0VA 5FKAC 4A3KB 1H9JA 2K5WA 1EY9A 1EWHA 3R93A 3EFXD 4K5VA 3VYRA 3EA6A 3QOJA 2X6LA 2GA4B 1EFID 4RWSC 5A2QE 4B08A 4FO2A 5JAVA 3ITPA 3OIQA 1STEA 1NCVA 4XYQA 2FMMA 4NKLA 1WTXA 2KCCA 1KDCA 2EYOA 2AQ2B 3TMEA 1D5ZC 2HCIA 2QKIC 1VMCA 5HURA 3M3YB 3EROA 3KLRA 1M4VA 4U673 1PZJD 1Q90A 3TZUA 1FGBD 3JAML 2YU9B 1TKWB 4RKLA 3C1FA 4WFN3 1VDZA 1KDAA 4RKBA 1TS2A 2NVQB 2SEBD 1WD0A 1JB3A 2JE6I 4NW2A 4O42A 1A3VA 3NHHA 1KTKA 3MC0B 2F0WA 1EYCA 1LT4D 2KQ3A 5K5PA 3C1EA 2VNUD 5I9OA 2JEAI 2L5TA 4N9PA 1UEAB 5IGCA 1TWHB 1XYIA 2NN6I 2VB3X 1TU2B 4OIKA 4CKBA 2K28A 1V1OA 5LL6X 3NWTA 2EJMA 2SOBA 3V05A 1A3UA 2F0KA 5CV6A 3A8JE 2M9VA 1IYUA 4H0LC 4HEDA 1U4PA 4I65A 4V0BA 5EBCA 1LT3D 3LNNA 4Q5VA 1I6VC 1EY5A 1EZ6A 4UAIA 1IL8A 5IIFA 5G3LF 1EY0A 4I7ZC 3TP8A 5HGTA 1B9NA 2PW7A 2HDMA 3R3OA 4RGMA 3GTPB 1U9RA 3BVMA 1CT1D 2PZUA 3IFTA 4FXDA 1A6XA 1ILPA 2EY1A 1DJRD 4CGYB 3MZ5A 5JVG3 2Z4HA 5IOCA 3S1QB 5F2DA 3KLSA 2AQ1B 2LKVA 4C3HG 5JPNC 2RDGA 3M85A 1KAAA 3GTQB 1JICA 2O5IC 2NZ1D 2NTTA 3C3LA 1JC7A 3NTIA 1I4PA 4IUVA 2C9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMC A;  2K6A A;  2LFN A; 
#chains in the Genus database with same CATH topology
 4IUU A;  4LMQ D;  2AQ3 B;  2F0L A;  2LXK A;  5ELF A;  1EOT A;  1S5C D;  2EYJ A;  1X56 A;  2QDB A;  4KV6 A;  4HIO A;  2OXP A;  3H09 A;  3J81 c;  1WJJ A;  3QOL A;  4LFC Q;  4JC0 A;  5C3E B;  4DUY L;  1SYD A;  2F0O A;  1P8L A;  1X3E A;  1X54 A;  1W6J A;  2F0F A;  3A54 A;  3L9A X;  3T56 B;  4QUC A;  5FO8 B;  3LX0 A;  2XRS D;  4H13 C;  4XIG S;  2Z6K C;  1PFN A;  3UDF A;  1S5F D;  4BY1 G;  1D8L A;  4MIU A;  4H44 C;  3RZO H;  2R7F A;  5C5M A;  4OIJ A;  1HNX L;  4BBR G;  3CQZ B;  2E74 C;  1U4R A;  3RZD B;  3G6J B;  2D0P A;  4JV5 L;  3DLL A;  1TT2 A;  4BY1 H;  1WTW A;  4JPB W;  4JI2 Q;  3ULJ A;  2JEB I;  5IGE A;  1LAB A;  2IL8 A;  2N55 A;  1F77 A;  1UWV A;  3VR2 A;  4BBR H;  1RF2 D;  4DR5 Q;  1TXY A;  1KL9 A;  2F0I A;  3QR8 A;  3AYH B;  2NUC A;  3J80 E;  3CKI B;  3K7A H;  1CQV A;  3H0G G;  1C48 A;  4JI8 Q;  1IBM Q;  4XQJ A;  3URY A;  1UNS A;  1BOS A;  4OGQ C;  1II3 A;  1Q46 A;  3CCJ A;  3RR5 A;  1EYA A;  4MN3 A;  5EPK A;  4FXG C;  3CCS A;  5EQ0 A;  1TWF B;  5CMD A;  4DN4 M;  4POG A;  5EPL A;  3HOX B;  3H0G H;  3K0X A;  3KYH C;  1Y1V B;  3MXP A;  2HQE A;  3C2P A;  4XYO A;  5IT9 L;  2A1A A;  3RN2 A;  2PYK A;  2K75 A;  4G57 A;  1PZI D;  1GKH A;  2K52 A;  4HCS A;  5IWA L;  1VQ6 A;  1KRT A;  4X62 Q;  5L37 A;  2CHB D;  2EIF A;  1N36 Q;  3EN2 A;  3RLF A;  1E1T A;  3OIP A;  2M00 A;  3Q22 A;  2UXD L;  1LTI D;  1BXT A;  3A55 A;  1HNZ Q;  3GTL H;  3HOV B;  3DMU A;  2OTJ A;  1CSP A;  5C4J B;  4LNQ A;  2KED A;  2CFM A;  5D3I B;  2MO0 A;  4BXX G;  3OMG A;  3KUP A;  4TSS A;  2E2H H;  3H91 A;  1CA5 A;  5LMN L;  4HID A;  3S2D H;  3HOZ B;  3R2T A;  4BXX H;  5E4X A;  1K83 B;  2RDF A;  2BH8 A;  3M7G A;  2E2I H;  4WJW A;  1EU3 A;  3I73 A;  5G3L D;  2R7Z G;  3BDL A;  2ICI A;  4IUN A;  3I91 A;  3PF5 A;  2JA6 G;  1HXY D;  1W6K A;  1QNU A;  2A69 C;  2RKS A;  1VQE A;  1GD7 A;  1EL0 A;  2VW9 A;  1EQV A;  2R7Z H;  2DUD A;  1FNW A;  2HCC A;  3KFU A;  4ZAI A;  2K05 A;  2TSS A;  4IFD I;  2RHS B;  5IYD G;  1F9P A;  1IHZ A;  1GUG A;  4IUR A;  3BZK A;  1LT5 D;  4DV2 Q;  3D6C A;  4DV4 Q;  4J1M A;  4PZ8 A;  4LFA L;  2C5C A;  4HJA A;  3H15 A;  1QVC A;  4HMJ A;  3CC4 A;  4XQQ A;  5IYD H;  1HQR D;  3OW7 A;  3L7Z C;  3F2B A;  4CJ1 B;  3F2C A;  1H9M A;  1I4R A;  1HTL D;  1QZG A;  4PMB A;  2I07 B;  3EBE A;  1GUO A;  4PNY A;  3TP5 A;  3RUZ A;  4X66 L;  2AWO A;  5NUC A;  2UUB L;  4OL7 A;  3OYY A;  3ND8 A;  3E5S A;  4A3I B;  3SGI A;  1RDP D;  4ZUI A;  1K9M C;  2UUA L;  4JYA L;  5JJL A;  4G7O C;  1HUN A;  1GOZ A;  5KYL A;  1FJG Q;  3GTM H;  1VQN A;  1SNC A;  3PO2 G;  4IPD A;  4H02 A;  4GLX A;  3FVQ A;  1XNR L;  3WDN A;  5M3M H;  3SXH A;  2VQF Q;  4JI6 Q;  3TEH B;  1I4X A;  1CKO A;  4R1J A;  4DV5 Q;  3ULL A;  2Z9H A;  4OWT B;  1Z6H A;  4UY8 C;  4DV1 Q;  3NQT A;  2DJG C;  4DF7 A;  1SYF A;  3MHB A;  1ENC A;  5C44 B;  4K0K Q;  5JEA J;  1YIJ A;  2NZO A;  4DNR B;  3GQB A;  4A3K G;  1N32 Q;  5E7N A;  3FPP A;  4HMI A;  1X3F A;  1VQD A;  1O7Z A;  4C3I B;  4WJ4 A;  1E2Z A;  4OON A;  2IPK D;  1G51 A;  4ILW A;  5FOB B;  2F3W A;  2J0T D;  2R6G A;  1PH6 A;  3RD4 A;  4EQP A;  4KKS A;  3R8B A;  4DU9 A;  4A3K H;  1BCP F;  5FLX L;  4CKC A;  4PMW A;  1HR0 L;  3K58 A;  5EKI A;  1X9N A;  1S3O A;  3CHB D;  1B50 A;  3I4N B;  3HOY B;  4YY3 L;  1IBL Q;  1YNX A;  4A3E B;  1EEF D;  2A69 D;  1T5X D;  3PUW A;  1WCM B;  1C9O A;  2MP1 A;  3PV0 A;  4K8J A;  1SR3 A;  2AUJ D;  3FPU B;  4X6A H;  5CV7 A;  1D7Q A;  1RD9 D;  5C3W A;  5IGG A;  1ILQ A;  2M2L A;  2AHO B;  2PZT A;  1L0X B;  4NB3 A;  3JC6 6;  4A3L G;  4AQY Q;  4YIJ A;  3SEB A;  2B2W A;  4IJL A;  3VR5 A;  3CCV A;  1CKM A;  2IHF A;  4Z9C B;  2YU9 H;  3I70 A;  3BS1 A;  1ZXT A;  4JBW A;  4QIW E;  5M5X B;  4AH6 A;  2HDL A;  2IX0 A;  4A3L H;  1U4L A;  3K81 C;  2AMC B;  1WOC A;  1MBY A;  1HNW Q;  2EY5 A;  5FK9 C;  2Q2U A;  2NVQ H;  4DAP A;  4GN3 B;  1XMO Q;  1AW7 A;  2B8F A;  1OO9 B;  3FRP B;  1HZA A;  2F0Q A;  2K5N A;  4A3M B;  1EUJ A;  4EGV A;  4B3S L;  5FO9 B;  1I3Q B;  3MEH A;  4FYD A;  2ENB A;  2MUY A;  4HJ5 A;  4A3F G;  1XTC D;  4IUT A;  4OO1 G;  2WV6 D;  1TWH H;  1QCB D;  1F2M A;  3N52 A;  2VQE Q;  2ID0 A;  2F0U A;  4Y7N B;  4NPS A;  4A93 B;  4P75 A;  4XDX A;  3I55 A;  1I94 Q;  4A3F H;  1NNX A;  2P5Z X;  5JOB A;  1KAW A;  4HCE A;  4OO1 H;  1ICF B;  5KEE A;  3KOJ A;  1JJ2 A;  3NK9 A;  1IW7 C;  2QW7 A;  5M9O A;  5KYI A;  4LJZ C;  2KCM A;  2LY7 A;  4CDE C;  4EX5 A;  3L3O C;  5JJZ A;  3RLO A;  4JI1 Q;  1PTO F;  1Z7T A;  2EY6 A;  1BDO A;  3J81 L;  4I7A A;  2UXC L;  5LL6 S;  1EY8 A;  4ZK9 B;  1RHP A;  2Q2H A;  1O78 A;  5D3D A;  4P2C B;  1LTL A;  2GVA A;  3CC7 A;  3HRZ C;  3I8Z A;  2CQO A;  2EYH A;  3RLN A;  4XQN A;  1LLR D;  2K5D A;  3KLS X;  2MJ8 A;  1CK1 A;  2WB1 B;  4DXG A;  2ZXR A;  3NEM A;  1GM5 A;  1JOR A;  5IYB G;  2UU9 Q;  2E76 C;  1I6H B;  1WFQ A;  4UP7 A;  2PNR C;  3MVV A;  1BQQ T;  3AU7 A;  4JI0 L;  3DUZ A;  4FXK C;  2F4V Q;  5IYB H;  1XJV A;  2NVY B;  1PZK D;  4DAV A;  2B2V A;  3FDT A;  2K5H A;  1S5D D;  1C8C A;  2PMZ E;  2RVL A;  2L11 A;  3KK7 A;  3S2H H;  4N9T A;  3GTQ H;  3AEV A;  4FVM A;  3E9I A;  4DR3 L;  5E3F A;  3PCO B;  4FF4 A;  1JE5 A;  5ELC A;  2Z6B A;  1MD2 D;  2JA8 G;  3BZD B;  2EVB A;  2WII B;  3GO5 A;  1PXU A;  1IXR A;  1PH7 A;  3D3R A;  3BDO A;  4IUQ A;  1AZP A;  1OXU A;  1EIF A;  1RL2 A;  4DV7 L;  4J15 A;  1SE4 A;  4FDB A;  3NTH A;  4L5R C;  2RA4 A;  3VA7 A;  1PTO C;  4GN5 A;  2F0J A;  1BCP D;  1TY2 A;  2B2Y A;  3DWP A;  1EWC A;  2FHT A;  1TWC B;  1F9Q A;  3J7A 5;  1OXX K;  1S5B D;  1PRT F;  1K0R A;  1VQ4 A;  1C7Y A;  4AYB B;  1PV4 A;  1YHB A;  5LHY 1;  3SR1 A;  3I7F A;  3D4D A;  3EQL C;  2NVX B;  4JI3 Q;  2EXD A;  2H1E A;  5LMN W;  1QNK A;  1PH3 A;  3T13 A;  5M3F B;  3L0O A;  4DR1 L;  5C0X I;  2K33 A;  3HP3 A;  1W2B A;  3CQZ H;  4ALP A;  3PQI A;  3VYU A;  3QO2 A;  3S17 H;  3RZD H;  5ELN A;  1SYB A;  1K3B C;  3JAM i;  2ZJR A;  3NSW A;  2PQE A;  2UUC L;  2BDO A;  2MPM A;  4EQO A;  2KVM A;  4KKT A;  4JI5 Q;  3TSS A;  1EQQ A;  3I90 A;  2NB0 A;  2ES2 A;  3DEO A;  5EGT A;  1BO0 A;  4BBS G;  2N49 A;  3T1H L;  5JPM C;  1AZQ A;  5CYU A;  4KD4 A;  1D5M C;  2QA4 A;  4KHP Q;  4KY6 A;  4X3K A;  3PMF A;  2B2T C;  3PIO 3;  4GOP C;  3GTG B;  1RJT A;  2XRQ D;  1G91 A;  1TWF H;  2XN9 C;  1K73 C;  3NXW A;  2XGT A;  3MXN B;  4NMZ A;  2LXJ A;  4X3S A;  4APV A;  1CKN B;  2FFK B;  1WTQ A;  1L1O A;  1K8O A;  3S1M B;  3WOF A;  4XTC S;  1YI2 A;  4LFC L;  1Q3L A;  1GUS A;  1JOO A;  1HZ9 A;  2PQA B;  3S1N B;  2ZTC A;  1PRT C;  2O2L D;  2NN6 G;  1S4Z A;  1JMC A;  4B3M Q;  4FP5 D;  4DAY B;  4IJH A;  4RHS A;  1CQF A;  1KNA A;  3HOZ G;  3QG1 A;  4C1N I;  1EY6 A;  2WAQ G;  5DNF A;  3P20 A;  4R9W A;  2NN6 H;  1R4Q B;  1NMF A;  3IKJ A;  1I50 B;  1H95 A;  1IKM A;  2JP1 A;  1SNQ A;  1WTP A;  3Q24 A;  1F9S A;  4DK3 C;  1JOQ A;  3TRE A;  4K5W A;  1AP0 A;  3HOZ H;  3S14 B;  2L9H A;  1FNU A;  2VS1 A;  1KLU D;  4DFA A;  1A62 A;  4GN4 B;  3CCE A;  1NSN S;  1PTO D;  1W3S A;  2ZJP A;  4JI2 L;  4HTH A;  2A68 C;  5C3X A;  3W2D A;  2DN8 A;  3TBI B;  4DR5 L;  1B3A A;  4A75 A;  1FR3 A;  3CCU A;  2QIL A;  5ELB A;  4X3T A;  4PZ7 A;  4DV3 Q;  4DXF A;  1GHK A;  1J5E Q;  1Y14 B;  4JI8 L;  1Q81 C;  1IBM L;  1Y1W B;  1N9W A;  1O80 A;  4RA8 A;  3PIO A;  3NE5 B;  2MQH A;  5COR A;  2VXW A;  2IJ0 A;  3A56 A;  1TS5 A;  3PUX A;  4QF4 A;  2PI2 E;  2Y0S G;  2HIV A;  2A8V A;  1UE1 A;  1SLJ A;  1A2T A;  5CV5 A;  1LTB D;  3UDX A;  3IRB A;  3U58 A;  3GP7 A;  2HQL A;  4LF9 Q;  3J80 c;  3G7L A;  1Q8K A;  3NBI A;  1M90 C;  2L1B A;  1JCK B;  4X62 L;  4LAA A;  2RSO A;  1PFM A;  1N36 L;  1Z47 A;  1JWU D;  2F1M A;  5GAD C;  3I4L A;  5J22 A;  1C0A A;  2EPB A;  2X69 A;  4OXP A;  1HNZ L;  5J39 A;  2A6E C;  4A3I G;  5EAY A;  1CSQ A;  3QWN A;  3I56 A;  3CCM A;  2ZT9 C;  3BU2 A;  3O13 A;  1YBY A;  3M7N A;  4RH6 A;  3V96 A;  3OWE B;  5DEH A;  1GUT A;  2KHJ A;  5DAU A;  2HIX A;  4OX9 Q;  1CTM A;  3W1G A;  1GXD C;  4KJN A;  4A3I H;  1EU4 A;  1IBK Q;  3HOU B;  4K6L A;  4A3G B;  3CU7 A;  4FF1 A;  4KJO A;  3I3C A;  1H9R A;  2MO1 A;  2Z6K A;  2F03 A;  5M5W B;  2RQX A;  5C44 G;  3MFY A;  1X55 A;  1SBB B;  1XX8 A;  1PRT D;  4C3I G;  2JYO A;  3GD7 A;  4H7B A;  1ZYR C;  1A15 A;  2K32 A;  1LTR D;  1I4G A;  4MZ9 A;  3CRK C;  5C44 H;  2C35 B;  2IT1 A;  2ZXO A;  4RGN A;  2IWH A;  4JG2 A;  3LWU A;  1TWG H;  2F3I A;  4C3I H;  1LTT D;  3PIP A;  1SNP A;  1X3P A;  4ABN A;  1TR5 A;  4LUO A;  1SAP A;  2X6G A;  2K01 A;  3MXN A;  4DV2 L;  4DV4 L;  1CKN A;  4QUF A;  3I4N G;  3X3N A;  5IGB A;  3HOY G;  1EIH A;  4DK0 A;  3KDF A;  1WTV A;  3DHQ A;  1WCM G;  1WYD A;  2L55 A;  4EQN A;  2A68 D;  4LF6 Q;  2L0C A;  5I2Y A;  2E2J B;  1KRS A;  1VF5 C;  4GKK Q;  2PQA A;  4ZQ3 A;  3I4N H;  1NY4 A;  3MTS A;  5CC4 A;  3HOY H;  1KXL A;  4A3E H;  1VQB A;  3GTJ H;  3S16 B;  3PGZ A;  2QEX A;  1WCM H;  2JA5 G;  1E2W A;  4DAY A;  1Z9F A;  2OT2 A;  4R4T A;  3C46 A;  2K4K A;  1VQH A;  4G4K A;  1KC8 C;  3BJU A;  3U9O A;  3UDG A;  1DOM A;  5K36 H;  1UE7 A;  3IFD A;  4CDD C;  3NP8 A;  5KND A;  1PHJ A;  4ZKC B;  1XXG A;  2JA5 H;  3CMA A;  4IOC A;  3IL8 A;  3P1H A;  1B9M A;  3SE0 A;  3A8K E;  4QIW B;  4WRD A;  1HQM C;  5A2Q L;  2H4O A;  1FVI A;  4GLV B;  3P7J A;  2TMP A;  2OF1 A;  4WJ3 M;  1FJG L;  3UDI A;  1X3Q A;  4GKJ Q;  1DYQ A;  1FYC A;  1GHJ A;  2K6A A;  2SNS A;  1SND A;  3G6E A;  3K59 A;  4A3J B;  2BH2 A;  4KY7 A;  1S5E D;  3KBX A;  2VQF L;  4JI6 L;  3SK6 A;  4OHJ A;  3NWS A;  2CWP A;  3F8T A;  3TP7 A;  4DV5 L;  5CR3 A;  5M5X H;  2KCN A;  3M4O B;  4P74 A;  5C4Z A;  4DV1 L;  2B63 B;  2RHQ B;  4IFD J;  1OXV A;  4A3M G;  2A6E D;  5D65 A;  3T51 B;  4K0K L;  1E22 A;  1YJ9 A;  1JWM D;  2AWN A;  1N32 L;  4DV6 Q;  2Q8T A;  1HZC A;  1TY0 A;  5DM7 3;  4RCO A;  3HZX A;  1VQ5 A;  1AFP A;  2HT1 A;  4K6D A;  4LF5 Q;  4A3M H;  3JAM E;  1PYB A;  1E24 A;  1SRO A;  1SNM A;  4A93 G;  3T53 B;  4C2M B;  1G6P A;  2N88 A;  2F0T A;  4NXM Q;  1KAB A;  2K04 A;  4JCV E;  3HKS A;  4DR6 Q;  4K2K A;  3H3V C;  5IY0 A;  3FMC A;  4UHV A;  2JSO A;  1VQF A;  1T5E A;  1UEB A;  4GLA C;  1DON A;  1VQJ A;  4Y7N H;  1VF7 A;  1IBL L;  4A93 H;  2HUG A;  1ZYR D;  1K3R A;  2NYZ D;  1BCP B;  2NVT H;  3QJY A;  3G4S A;  1XPO A;  3K7U C;  4CDC C;  4KY5 A;  4R4I A;  4LF4 Q;  2XNA C;  2EYF A;  5M3M G;  2G9H D;  2ASB A;  2J4X A;  2JXM B;  3VA5 A;  2EE1 A;  1SE2 A;  3BVG A;  1EY7 A;  4GZY C;  1YNJ C;  4IFD G;  1IL2 A;  2E5L Q;  2WB1 G;  2WP8 J;  1E7Z A;  1MI2 A;  2H5X A;  4DR4 Q;  4AQY L;  2A74 C;  3UI2 A;  4LF8 Q;  4IFD H;  2PNH A;  1M8A A;  3IAY A;  3E0E A;  1PMR A;  1G2S A;  4BY7 G;  4MTK A;  1ICW A;  3HG9 A;  1HZB A;  4DA2 A;  1XMQ Q;  3BYY B;  5BR8 Q;  1SSO A;  3D31 A;  1I5F A;  1RCV D;  1SYE A;  1HNW L;  2FMC A;  5AJ3 Q;  2NBF A;  4BY7 H;  4LWC A;  4RMF A;  1XMO L;  5EPJ A;  2PMZ B;  1CHP D;  4MNO A;  1G2T A;  3MAQ A;  2EJG C;  2G5D A;  1Y8N B;  4IPH A;  2Z8L A;  1FNV A;  2OCE A;  5EJW A;  2Q8I B;  1EEI D;  3K0Y A;  3GTO B;  1HFG A;  1PLF A;  4RCN A;  1ZKO A;  2YTY A;  1O7Y A;  4DPG A;  3S9W A;  3H0G B;  3ICE A;  2SDF A;  2VQE L;  1CHQ D;  4DAM A;  1GUN A;  4YHH Q;  1E0B A;  1I94 L;  2PO4 A;  5ELE A;  4QB4 A;  1VQC A;  2DNE A;  3K5L A;  2Q8R E;  1TS3 A;  3J7A F;  3L2P A;  2EYP A;  4M8A A;  2JA7 B;  2MNA A;  3VYS A;  1BR9 A;  1N8R C;  1ENF A;  5JJK A;  2I5L X;  3CPW A;  3H94 A;  3M3Y H;  2K1B A;  4AYB G;  5D14 A;  3UE1 A;  1FD7 D;  4JI1 L;  2E2H B;  1BBW A;  1WTO A;  4UDU C;  2ZTD A;  1QE6 A;  2PCF B;  4DUZ Q;  4A3B B;  1TWC H;  2B3G A;  3OW2 A;  4IAL A;  3VDY A;  3BDC A;  2B2U C;  2MHV A;  2G9D A;  3T4A C;  5M3F G;  1K8A C;  3KF8 B;  1PTO B;  3Q0A A;  3S15 B;  1F2L A;  2NVX H;  3A5U A;  1XWE A;  4DK6 C;  2F52 A;  4A76 A;  2KEE A;  3SDZ A;  5HGQ A;  1QVF A;  2UU9 L;  3EJI A;  5M3F H;  1Y69 U;  1PA6 A;  4B9W A;  2WAQ E;  1DZ1 A;  3M4Q A;  1YNJ D;  1JE4 A;  4IO9 A;  1MHW C;  3FKI B;  2JA6 B;  3CPF A;  2IHE A;  1NE3 A;  2O5J C;  2EYL A;  3LGJ A;  2F4V L;  2RCF A;  4DK1 A;  3CCR A;  3ER0 A;  3FEW X;  2F0S A;  2VL6 A;  4WOR A;  1E1O A;  2F0N A;  2R7D A;  3X3M A;  3HKZ B;  3NQI A;  4NDX A;  2ZM6 Q;  1NJI C;  1PH9 A;  1HJP A;  2BOS A;  2CCZ A;  2YV5 A;  4RGO S;  1Q12 A;  4JBJ A;  4JW0 A;  2GN5 A;  4NP5 A;  3ZJY C;  4JBK A;  2E2D C;  4DNI A;  3STB C;  1BBX C;  3VR3 A;  4GS3 A;  1EYG A;  3VR4 A;  4LUZ A;  2JK8 A;  1NBW A;  3NPP A;  2L12 A;  3MEF A;  4CKE A;  3GTG H;  2KHI A;  1VQO A;  3E6Z X;  1ENA A;  4K5X A;  1XNQ Q;  1G8Z D;  1K0S A;  2WIN B;  4BA2 I;  1A63 A;  2ATW A;  2D5D A;  5FO7 B;  3TZD A;  2Y0S E;  1BNZ A;  3J80 L;  1X32 A;  4Q0F A;  3I4M B;  2IX3 A;  1BUV T;  4GOP B;  1QG7 A;  4MHE A;  2AUK A;  3GTP H;  1STN A;  5I9P A;  1FGU A;  4LF7 Q;  5J1Z A;  1D6E C;  3NTK A;  4UP8 A;  4O1N A;  1R9T B;  4XT3 B;  4ZUJ A;  4JI3 L;  1HRJ A;  2JN4 A;  5IT9 E;  1SDF A;  4GNX C;  1JR0 D;  3FHW A;  2EY2 A;  3D8G A;  3SK8 A;  1PRT B;  1I50 H;  3PO2 B;  3J81 i;  1QIL A;  4DR2 Q;  5C4X B;  4HR7 B;  5GAE C;  3S1Q H;  1CZG A;  1PYS B;  3A7L A;  1IZ6 A;  2B2V C;  1EIG A;  1STH A;  4L63 B;  4R4Q A;  5HY6 A;  2FXQ A;  4A4I A;  1OXT A;  5I4D A;  4EVO A;  1SMY C;  3HOW B;  2O4X A;  4B3R Q;  1KNE A;  4RGT A;  4JI5 L;  3T1Y Q;  1HHV A;  1RTO A;  4C3J B;  5E4W C;  3MXU A;  2WKD A;  4DGZ A;  4G7Z C;  4DNT B;  1SNO A;  1Y1W H;  5IGF A;  1GUW A;  1IYJ B;  3K6O A;  3N6R A;  4PV1 C;  4KHP L;  3U4V A;  4PQX A;  2HHH Q;  5C3E G;  4P71 A;  1B4O A;  1WD1 A;  3D6W A;  2YYZ A;  4ME3 A;  4OWX B;  1YIT A;  4TRD A;  1X65 A;  2B2Y C;  4KLK A;  5GQO A;  4FF3 A;  1CZW A;  2Q2I A;  3EVQ A;  5C3E H;  4IQZ A;  1K8M A;  5AFW A;  1LV9 A;  2LS0 1;  3A7A B;  5I2X A;  2KOL A;  1SRU A;  4YCU A;  3CME A;  3CC2 A;  4JOI A;  4B3M L;  2OWO A;  3KF8 A;  3D0F A;  4JI4 L;  3CF5 A;  5C0X J;  5ELD A;  1IW7 D;  4M1U B;  1VQI A;  3STB D;  4A3G G;  2K14 A;  3TP6 A;  1CM9 A;  2XTI A;  1VQ8 A;  4KTA A;  3DEP A;  1STB A;  3GV6 A;  1TQO A;  1ET9 A;  1PVO A;  4BS9 A;  1YVC A;  1SFO B;  1WTH A;  2JJQ A;  1YJN A;  4DV0 Q;  5I6Y A;  3H6M A;  4A3G H;  1X6O A;  3U50 C;  1A0I A;  3ERQ A;  3U9S A;  4HSP A;  5COY A;  2VUM B;  1NMG A;  3I72 A;  3DXJ C;  1KIX A;  1G29 1;  1A8V A;  2BE5 C;  4KHZ A;  4KKU A;  1JOK A;  1PFB A;  2HD3 A;  1A2U A;  1F2Z A;  4HIK A;  3P75 A;  1ESF A;  3HOX G;  2UXB Q;  1DM0 B;  3DWQ A;  1Y1V G;  2Q2T A;  2ZTE A;  1CA6 A;  4KK7 A;  4DV3 L;  4RG1 A;  1J5E L;  2N3S A;  4B9X A;  3W3A A;  3DM3 A;  4LK1 C;  4F7X A;  2PW5 A;  3HOX H;  1Y1V H;  1LTS D;  4A3F B;  1L1O C;  3S1R B;  5C0X G;  2BCO A;  3PUV A;  4ODG A;  2B8G A;  3HOV G;  5EBD A;  1NUC A;  4K14 A;  2V4D A;  1JQY D;  4HSV A;  4LF9 L;  4TVA B;  1STA A;  1VQL A;  4XT1 B;  1STG A;  2B2T A;  4POF A;  5C0X H;  1SMY D;  3T16 A;  4GOP A;  2E2J H;  3AMU A;  1TS4 A;  2XIW A;  3HOV H;  5I6W A;  3GV3 A;  4JI4 Q;  2CW0 C;  4JVZ A;  5C4J H;  1H9S B;  2KEC A;  3OSO A;  2Z1C A;  1K8G A;  1QWY A;  5A35 A;  2F4I A;  2VY3 A;  5FLX E;  5GAG C;  1P16 A;  1LM0 A;  1ML0 D;  1SJH D;  3K8A A;  4XXE A;  4F8M A;  1Q1B A;  1VQM A;  4OX9 L;  1Q8I A;  1K83 H;  3MFG A;  1N33 Q;  1TVX A;  5BN4 A;  1B44 D;  1IBK L;  1SE3 A;  5IE8 A;  4DR7 Q;  3PUZ A;  3SK5 A;  2B63 G;  2XWJ B;  2WKC A;  2DNC A;  5T1G A;  5LMU Q;  4L6T B;  2R92 B;  2WB1 E;  2R3Z A;  4UPA A;  4FNF A;  3E9H A;  1PH8 A;  2JQO A;  4RHR A;  1V1P B;  1TWA B;  2A73 B;  2NTS A;  4P73 A;  3M4O H;  2B63 H;  3I2Z A;  2EQS A;  1MJE A;  4X65 Q;  1H9K A;  3J7Z C;  1UAP A;  3GTK B;  3S2H B;  3PIP 3;  2D9U A;  1XPR A;  1J6Q A;  1DOK A;  1ESR A;  2L4N A;  3CD6 A;  2RF4 A;  1BBU A;  3OPO A;  4IPG A;  1SN8 A;  1A3T A;  3RMH A;  3W1B A;  4HJ7 A;  4NXN Q;  1VS0 A;  1HR0 W;  2DY7 A;  1HH2 P;  1CI3 M;  4RFB A;  4C2M H;  1SXT A;  4TQU S;  5FJ8 H;  3M4P A;  2QF7 A;  2NWG A;  4KI0 A;  4X64 Q;  1OTC A;  4A3C G;  4LF6 L;  2EDG A;  2BE5 D;  2EZV A;  2JA8 B;  1L0Y B;  4GKK L;  3D4W A;  5M5Y B;  1S40 A;  3QIA A;  4G7H C;  2LSS A;  5ISR A;  1E2V A;  4A3C H;  1AN8 A;  2GVB A;  4R8I A;  3KJP A;  2XVS A;  4R8N A;  4A3D B;  4B3T Q;  1QOH A;  1NR2 A;  2QCP X;  4UP9 A;  3SHL A;  2IY5 B;  2CWA A;  5CBE E;  4GKJ L;  4AYB E;  3EIV A;  1N34 Q;  1U5K A;  3OWF A;  2MGS A;  2OQ0 A;  3S17 B;  5IP9 G;  1L0W A;  1EQT A;  1B1Z A;  1G6Z A;  2PZW A;  3NBH B;  1EZ8 A;  3OTO L;  4YWL A;  2CW0 D;  3LWE A;  4TKO B;  4MTN A;  4ZRZ A;  3RNU A;  5IP9 H;  3HFZ B;  5KIX A;  3R2I A;  3J81 E;  4DV6 L;  1ET6 A;  2F0G A;  2ICE C;  4ZCK A;  5C4H A;  1OXS C;  3D4R A;  1QUQ B;  3HS0 C;  4A3E G;  4LF5 L;  2WFW A;  4K2L A;  3WWV A;  3SVM A;  4JI7 Q;  3K5N A;  1V8Q A;  3W5O A;  2F0E A;  4L5T A;  3GTO H;  3KBG A;  4BBS B;  4NXM L;  1R4P B;  5CV9 A;  5K36 G;  3KF6 B;  1NR4 A;  4DR6 L;  1J9O A;  1SEB D;  3U4Z A;  2JA7 G;  2YTV A;  5C5L A;  1VQA A;  2J7Z A;  1KDB A;  4DUY Q;  5IYC G;  1YHQ A;  1H9S A;  3MXG A;  2EYM A;  3WOE A;  3JAM c;  3TDQ A;  1GJX A;  1AH9 A;  3OOC A;  4KD3 A;  3S24 A;  4LF4 L;  1I4H A;  2JA7 H;  4F88 A;  1WVL A;  4CJ2 C;  2K7V A;  4A3B G;  2BA0 A;  4PMC A;  5TSS A;  4QMG A;  5IYC H;  2Z4I A;  3OMC A;  4J8Q A;  4DKA C;  5E1F A;  1KQS A;  5KNB A;  1VQ7 A;  2EOT A;  1GVP A;  1HNX Q;  4CJ0 B;  2CQA A;  2E5L L;  1ASZ A;  3ZYY X;  1MGS A;  2K03 A;  4DR4 L;  2I46 A;  4A3B H;  1F2Y A;  3BG3 A;  4JV5 Q;  2K5Q A;  3PO3 B;  4LF8 L;  2E8G A;  4BA1 I;  4KN4 C;  3OTO Q;  3J81 j;  2XWB B;  1BF4 A;  2WAQ B;  4O2D A;  5BN5 A;  4ME5 A;  3OHX C;  1JJC B;  2LMC B;  1XMQ L;  3PUY A;  1PTO H;  1I4Q A;  1V1P A;  1QB5 D;  5BR8 L;  4FF2 A;  1PYW D;  2R93 B;  1DCZ A;  1Y8P B;  3S15 H;  2F0M A;  2I0Q A;  4ZLT F;  2DGY A;  1ROD A;  3FKI G;  3MA2 B;  4CDF C;  5AJ3 L;  1HCZ A;  3SK4 A;  2AKW B;  4C3H B;  1HTP A;  1RKN A;  4C56 C;  2PPB C;  1AEX A;  1TII D;  1I3Q H;  2BA1 A;  4ZKB B;  3HKZ G;  4IN3 A;  2D62 A;  2A6H C;  3FKI H;  2JA6 H;  2OTL A;  1MSH A;  3TN2 A;  2OQK A;  3M4Y A;  4QCL A;  5IGD A;  3ULP A;  3AQQ A;  4ZYS A;  1E3P A;  1U4M A;  4IUP A;  5CBA E;  4K8I A;  5J3B A;  2RCN A;  5IWA Q;  3TS0 A;  3TRZ A;  3K5M A;  2VZA A;  1HPC A;  3ERS X;  2F0P A;  2IX1 A;  4YHH L;  4JBM A;  2MFI A;  1KLG D;  2R61 A;  2Y0S B;  2KA7 A;  2UXD Q;  1PH2 A;  1NAP A;  2RDH A;  3NUC A;  1YJW A;  1JB7 A;  1RTN A;  3PSI A;  5EKL A;  3I4M G;  5KRU A;  2KCT A;  4RAU C;  4ID6 A;  1C4Q A;  1F9R A;  1D2B A;  5LMN Q;  3CW2 C;  4R4C A;  3RZO B;  1EOV A;  5DM6 3;  3RN5 A;  3V2T A;  2ZXP A;  1SYC A;  3I4M H;  4DUZ L;  1J8I A;  1IKL A;  1XPU A;  2YTX A;  1WTR A;  3CAM A;  3BYT B;  4BY1 B;  1JWS D;  1VQ9 A;  3BVZ A;  1HA5 A;  5IP7 G;  4BBR B;  2QEJ C;  3G48 A;  5C4X G;  1D1K A;  3NBH A;  2DY8 A;  1R9T H;  1SJE D;  1I6H H;  1B53 A;  1YNN C;  3K7A B;  4HAE A;  5IP7 H;  3E0J A;  4YWM A;  3PO2 H;  4X3U A;  5C4X H;  3HOW G;  1LT6 D;  1DD2 A;  3TS2 A;  5FLM G;  1UE5 A;  2KJX A;  2XSC A;  1QUQ A;  2E75 C;  2NVY H;  5IOD A;  3HEJ A;  4C3J G;  3TQY A;  1TWG B;  4KN7 C;  4GNX B;  4PG3 A;  1Q1E A;  2VB2 X;  3K5O A;  4N8X 1;  4LFA Q;  3HOW H;  1T9H A;  5KNC A;  5DLQ E;  3KF6 A;  5FLM H;  3Q6S A;  5CV4 A;  1O7L A;  2ZM6 L;  1QZH A;  4C3J H;  2L15 A;  1D1I A;  4ULL A;  3A5Z B;  4N8F A;  1VCI A;  4YCV A;  1ZEQ X;  1JT8 A;  1UUP A;  4Y52 H;  3GTL B;  1B2T A;  2A5H A;  1PH1 A;  3GTJ B;  4X66 Q;  1MIU A;  3HGB A;  2B2W C;  1YHA A;  1LO5 D;  2KHS A;  4HIM A;  2UUB Q;  1XNQ L;  5ELO A;  3VR6 A;  5JJI A;  2RSN A;  4L5Q A;  1LAC A;  1LTA D;  2A6H D;  3B6Y A;  4CHT B;  3K57 A;  3S2D B;  4JYA Q;  2UUA Q;  2JA5 B;  2F0H A;  1V43 A;  1QJO A;  1VQG A;  5JEA G;  4OO1 I;  2E2I B;  4BWG B;  1XNR Q;  4IZ8 A;  4KMU C;  3PF4 A;  4KHV A;  4LF7 L;  2BDN A;  1EQR A;  1IYV A;  4L8J A;  5JEA H;  5GAH C;  2I5H A;  2EJF C;  2VUM G;  2DJF C;  1EFW A;  2B2U A;  4LFB L;  2R7Z B;  1LYL A;  1SFO H;  1ONL A;  1SE8 A;  4DR2 L;  3ONA B;  4E6I A;  2Z0S A;  3ND9 A;  5KGU A;  2IW3 A;  1BVS A;  3A8I E;  3MWY W;  1MSG A;  2WAC A;  2FJ2 A;  2VUM H;  1EYD A;  3I4O A;  3CRL C;  4CBV A;  2CVR A;  4B3R L;  2RBM A;  5IT9 c;  3DM1 A;  4U68 A;  3Q23 A;  1HR0 Q;  3T1Y L;  1DXM A;  1DOL A;  3AB9 A;  3KLW A;  1BCP C;  2EXZ A;  5C6A A;  2F3V A;  1LTG D;  1XTD A;  4OEM B;  4YY3 Q;  3NEN A;  3AFQ A;  1O7I A;  1NTG A;  3J7A V;  1YNN D;  1B7Y B;  1KHI A;  2HHH L;  2FIN B;  2SNM A;  1QVG A;  1U0L A;  2B29 A;  3A0J A;  2NVT B;  5JVH 3;  4OEL B;  3S1R H;  1EY4 A;  4S3S A;  4R4O A;  4C1N K;  3S1M H;  1RIP A;  1S72 A;  3UE0 A;  1HFN A;  5CGK A;  4OWW B;  3S1N H;  1FL0 A;  3A74 A;  1STY A;  4HN7 A;  3GTM B;  2D0O A;  2KUM A;  1L1O B;  2B39 A;  1HA6 A;  4YWK A;  5BN3 A;  3CXC A;  2NZH A;  4EQ5 A;  5M3M B;  1EWI A;  1VMP A;  1Q7Y C;  4V19 0;  3DWA A;  4J6H A;  3VYT A;  2OEO A;  1CFM A;  5EKK A;  2F0D A;  3J7Y W;  4LFB Q;  1PDQ A;  2A19 A;  3Q8D A;  4O0A A;  1JJG A;  5T1I A;  1YZ6 A;  3J80 i;  4F87 A;  3S14 H;  5CV8 A;  1LUZ A;  2R92 G;  1MKH A;  2QGQ A;  2LFN A;  4DV0 L;  3F2U A;  2D2C C;  1SYG A;  4JK1 C;  3QB3 A;  1HUM A;  4BY7 B;  1Y1W G;  1D5X C;  2K50 A;  3H3V I;  4B3S Q;  4QJF A;  4GNX A;  1Y8O B;  2F0V A;  2R92 H;  3KJO A;  5FKA C;  4A3K B;  1H9J A;  2K5W A;  1EY9 A;  1EWH A;  2KEN A;  3R93 A;  1YEZ A;  1TWA H;  3EFX D;  3BZC A;  2UXB L;  4IOA A;  4K5V A;  3VYR A;  3EA6 A;  3QOJ A;  2X6L A;  3CCL A;  2GA4 B;  1EFI D;  4IPC A;  4RWS C;  5A2Q E;  1M1K C;  1DGS A;  4B08 A;  4FO2 A;  3GTK H;  5JAV A;  3G71 A;  3ITP A;  3OIQ A;  1STE A;  1NCV A;  4XYQ A;  2ALY B;  5GRO A;  2FMM A;  4NKL A;  1V1Q A;  1WTX A;  2KCC A;  3E3X A;  1KDC A;  2EYO A;  2AQ2 B;  1B8A A;  4QQB X;  3TME A;  1D5Z C;  2HCI A;  2QKI C;  1VMC A;  2I5M X;  2JA9 A;  5HUR A;  4JOI C;  4L5S A;  3M3Y B;  2JA8 H;  2UXC Q;  3ERO A;  2CH4 A;  3KLR A;  1EIY B;  1M4V A;  4U67 3;  5M5Y H;  3HOU G;  1PZJ D;  4A3D G;  3AFP A;  1Q90 A;  3TZU A;  1FGB D;  3JAM L;  2YU9 B;  2K5V A;  1WI5 A;  1TKW B;  4RKL A;  3H3V H;  3C1F A;  4WFN 3;  3HOU H;  4A3D H;  3CCQ A;  1VDZ A;  1KDA A;  4RKB A;  1TS2 A;  2N78 A;  2SEB D;  2NVQ B;  1WD0 A;  1JB3 A;  2JE6 I;  1N33 L;  4NW2 A;  1X3G A;  4O42 A;  1A3V A;  1Q86 C;  3NHH A;  1KTK A;  4QL5 A;  3MC0 B;  1L2F A;  5M5W H;  3GDE A;  1AE2 A;  1Q82 C;  4DR7 L;  2F0W A;  1V9P A;  1EYC A;  4JI0 Q;  1LT4 D;  2KQ3 A;  5K5P A;  5LMU L;  3C1E A;  2VNU D;  1K28 A;  1UE6 A;  3F1Z A;  5I9O A;  5FLX c;  2JEA I;  4LUV A;  2L5T A;  4QY7 A;  1B70 B;  4N9P A;  1UEA B;  3NEL A;  5IGC A;  1TWH B;  1ASY A;  1XYI A;  2NN6 I;  2VB3 X;  1TU2 B;  4OIK A;  4CKB A;  2K28 A;  1V1O A;  5LL6 X;  3NWT A;  2EJM A;  4X65 L;  2SOB A;  4DR3 Q;  3V05 A;  1A3U A;  2F0K A;  1B3Q A;  4QGU A;  1BKB A;  3CP0 A;  4AIM A;  5CV6 A;  3A8J E;  2M9V A;  1IYU A;  4H0L C;  4HED A;  4NXN L;  4PZ6 A;  3FP9 A;  1U4P A;  4I65 A;  4V0B A;  4DV7 Q;  5EBC A;  3HKZ E;  3LNN A;  1LT3 D;  4BBS H;  4Q5V A;  1I6V C;  1EY5 A;  1EZ6 A;  4X64 L;  4UAI A;  1IL8 A;  5IIF A;  1VQK A;  3S16 H;  5G3L F;  1EY0 A;  3KDF B;  4I7Z C;  2ZJQ A;  2CH4 W;  4YCW A;  3F2D A;  3TP8 A;  5HGT A;  1B9N A;  2PW7 A;  2QDL A;  2HDM A;  3R3O A;  2V1C C;  4RGM A;  3GTP B;  1U9R A;  3BVM A;  4A3J G;  1CT1 D;  2PZU A;  3IFT A;  1SMX A;  1KD1 C;  4FXD A;  1GO3 E;  1A6X A;  1ILP A;  2EY1 A;  3PO3 G;  1DJR D;  4B3T L;  4CGY B;  5H1S E;  3K80 C;  4DR1 Q;  1PH5 A;  3MZ5 A;  4A3J H;  5JVG 3;  2Z4H A;  2R93 G;  1N34 L;  3PO3 H;  1PFS A;  5IOC A;  3S1Q B;  5F2D A;  3M9B A;  2UUC Q;  3KLS A;  2AQ1 B;  2PI2 A;  2LKV A;  4C3H G;  2N8N A;  5JPN C;  2RDG A;  4HJ8 A;  1PH4 A;  2KBN A;  2R93 H;  3M85 A;  1CUK A;  1KAA A;  1AE3 A;  4P72 A;  5FJ8 G;  1JIC A;  3GTQ B;  2O5I C;  3T1H Q;  2NZ1 D;  4LW1 A;  4C3H H;  1VQP A;  2NTT A;  3C3L A;  1JC7 A;  4HJ9 A;  2CKZ B;  3NTI A;  1I4P A;  4IUV A;  1MJC A;  2C9O A;  4JI7 L; 
#chains in the Genus database with same CATH homology
 4IUU A;  4LMQ D;  2AQ3 B;  2F0L A;  5ELF A;  1EOT A;  1S5C D;  2EYJ A;  2QDB A;  4KV6 A;  2OXP A;  3H09 A;  3QOL A;  5C3E B;  1SYD A;  2F0O A;  1W6J A;  2F0F A;  3A54 A;  3L9A X;  3T56 B;  4QUC A;  5FO8 B;  3LX0 A;  2XRS D;  4H13 C;  4XIG S;  1PFN A;  1S5F D;  4MIU A;  4H44 C;  5C5M A;  4OIJ A;  3CQZ B;  2E74 C;  1U4R A;  3RZD B;  3G6J B;  1TT2 A;  1WTW A;  2JEB I;  5IGE A;  1LAB A;  2IL8 A;  2N55 A;  1F77 A;  3VR2 A;  1RF2 D;  2F0I A;  2NUC A;  3J80 E;  3CKI B;  1CQV A;  1C48 A;  4XQJ A;  3URY A;  1UNS A;  1BOS A;  4OGQ C;  1II3 A;  1EYA A;  4MN3 A;  5EPK A;  4FXG C;  5EQ0 A;  1TWF B;  5CMD A;  4DN4 M;  5EPL A;  3HOX B;  1Y1V B;  3MXP A;  2HQE A;  3C2P A;  4XYO A;  5IT9 L;  2PYK A;  4G57 A;  1PZI D;  4HCS A;  2CHB D;  3RLF A;  3OIP A;  2M00 A;  3Q22 A;  1LTI D;  1BXT A;  3A55 A;  3HOV B;  3DMU A;  5C4J B;  2KED A;  5D3I B;  3OMG A;  3KUP A;  4TSS A;  3H91 A;  1CA5 A;  3HOZ B;  3R2T A;  5E4X A;  1K83 B;  2RDF A;  3M7G A;  4WJW A;  1EU3 A;  3I73 A;  5G3L D;  3BDL A;  2ICI A;  4IUN A;  3I91 A;  1HXY D;  1W6K A;  1QNU A;  2A69 C;  2RKS A;  1EL0 A;  1EQV A;  1FNW A;  2HCC A;  4ZAI A;  2K05 A;  2TSS A;  4IFD I;  1F9P A;  1IHZ A;  1GUG A;  4IUR A;  1LT5 D;  3D6C A;  4J1M A;  2C5C A;  4HMJ A;  4XQQ A;  1HQR D;  3OW7 A;  3L7Z C;  4CJ1 B;  1H9M A;  1I4R A;  1HTL D;  4PMB A;  2I07 B;  1GUO A;  4PNY A;  3TP5 A;  3RUZ A;  2AWO A;  5NUC A;  4OL7 A;  3ND8 A;  3E5S A;  4A3I B;  1RDP D;  4ZUI A;  4G7O C;  1HUN A;  1GOZ A;  5KYL A;  1SNC A;  3FVQ A;  3WDN A;  3SXH A;  1I4X A;  1Z6H A;  3NQT A;  4DF7 A;  1SYF A;  3MHB A;  1ENC A;  5C44 B;  5JEA J;  4DNR B;  3GQB A;  3FPP A;  4HMI A;  4C3I B;  1O7Z A;  1E2Z A;  2IPK D;  4ILW A;  5FOB B;  2F3W A;  2J0T D;  2R6G A;  3RD4 A;  4EQP A;  4KKS A;  3R8B A;  4DU9 A;  1BCP F;  5FLX L;  4CKC A;  4PMW A;  3K58 A;  5EKI A;  3CHB D;  1B50 A;  3I4N B;  3HOY B;  4A3E B;  1EEF D;  2A69 D;  1T5X D;  3PUW A;  1WCM B;  2MP1 A;  3PV0 A;  4K8J A;  2AUJ D;  3FPU B;  5CV7 A;  1RD9 D;  5C3W A;  5IGG A;  1ILQ A;  2M2L A;  2PZT A;  1L0X B;  4YIJ A;  3SEB A;  2B2W A;  3VR5 A;  4Z9C B;  3I70 A;  3BS1 A;  1ZXT A;  4JBW A;  5M5X B;  2HDL A;  2IX0 A;  1U4L A;  1MBY A;  2EY5 A;  5FK9 C;  4DAP A;  1AW7 A;  2B8F A;  1OO9 B;  3FRP B;  2F0Q A;  4A3M B;  4EGV A;  5FO9 B;  1I3Q B;  3MEH A;  4FYD A;  2ENB A;  2MUY A;  1XTC D;  4IUT A;  4OO1 G;  2WV6 D;  1QCB D;  1F2M A;  3N52 A;  2ID0 A;  2F0U A;  4Y7N B;  4A93 B;  4XDX A;  5JOB A;  4HCE A;  4OO1 H;  5KEE A;  3NK9 A;  1IW7 C;  5M9O A;  5KYI A;  4LJZ C;  2LY7 A;  3L3O C;  5JJZ A;  1PTO F;  1Z7T A;  2EY6 A;  1BDO A;  3J81 L;  5LL6 S;  1EY8 A;  4ZK9 B;  1RHP A;  1O78 A;  5D3D A;  4P2C B;  3HRZ C;  3I8Z A;  2EYH A;  4XQN A;  1LLR D;  2K5D A;  3KLS X;  2MJ8 A;  1CK1 A;  2WB1 B;  4DXG A;  2ZXR A;  1JOR A;  1I6H B;  2E76 C;  2PNR C;  3MVV A;  1BQQ T;  3AU7 A;  3DUZ A;  4FXK C;  2NVY B;  1PZK D;  4DAV A;  2B2V A;  3FDT A;  1S5D D;  1C8C A;  2RVL A;  2L11 A;  3KK7 A;  4N9T A;  4FVM A;  5E3F A;  4FF4 A;  5ELC A;  1MD2 D;  3BZD B;  2EVB A;  2WII B;  3GO5 A;  1PXU A;  3D3R A;  4IUQ A;  3BDO A;  1AZP A;  1OXU A;  1SE4 A;  3NTH A;  2RA4 A;  3VA7 A;  1PTO C;  2F0J A;  1BCP D;  1TY2 A;  2B2Y A;  3DWP A;  1EWC A;  2FHT A;  1TWC B;  1F9Q A;  1OXX K;  1S5B D;  1PRT F;  4AYB B;  5LHY 1;  3SR1 A;  3D4D A;  3EQL C;  2NVX B;  2H1E A;  1QNK A;  3T13 A;  5M3F B;  5C0X I;  2K33 A;  3HP3 A;  3VYU A;  3QO2 A;  1SYB A;  3NSW A;  2PQE A;  2BDO A;  2MPM A;  4EQO A;  2KVM A;  4KKT A;  3TSS A;  3I90 A;  2NB0 A;  3DEO A;  5EGT A;  1BO0 A;  5JPM C;  1AZQ A;  5CYU A;  4KD4 A;  1D5M C;  4KY6 A;  4X3K A;  3PMF A;  2B2T C;  3PIO 3;  3GTG B;  1RJT A;  2XRQ D;  1G91 A;  2XN9 C;  3NXW A;  4X3S A;  4NMZ A;  2FFK B;  1WTQ A;  1K8O A;  3S1M B;  3WOF A;  4XTC S;  1Q3L A;  1GUS A;  1JOO A;  3S1N B;  1PRT C;  2O2L D;  2NN6 G;  1S4Z A;  4FP5 D;  4RHS A;  1CQF A;  1KNA A;  3QG1 A;  4C1N I;  1EY6 A;  5DNF A;  3P20 A;  4R9W A;  2NN6 H;  1R4Q B;  3IKJ A;  1I50 B;  1IKM A;  2JP1 A;  1SNQ A;  1WTP A;  3Q24 A;  1F9S A;  1JOQ A;  4K5W A;  1AP0 A;  3S14 B;  2L9H A;  1FNU A;  1KLU D;  4DFA A;  1NSN S;  1PTO D;  4HTH A;  2A68 C;  5C3X A;  3W2D A;  2DN8 A;  3TBI B;  1B3A A;  1FR3 A;  2QIL A;  5ELB A;  4X3T A;  4DXF A;  1GHK A;  1Y1W B;  1O80 A;  4RA8 A;  3NE5 B;  5COR A;  2VXW A;  2IJ0 A;  3A56 A;  1TS5 A;  3PUX A;  4QF4 A;  1A2T A;  5CV5 A;  1LTB D;  3GP7 A;  3G7L A;  3NBI A;  2L1B A;  1JCK B;  4LAA A;  2RSO A;  1PFM A;  1Z47 A;  1JWU D;  2F1M A;  3I4L A;  5J22 A;  2EPB A;  2X69 A;  5J39 A;  2A6E C;  3QWN A;  2ZT9 C;  3O13 A;  3M7N A;  4RH6 A;  3V96 A;  3OWE B;  5DEH A;  1GUT A;  5DAU A;  1CTM A;  1GXD C;  4KJN A;  1EU4 A;  3HOU B;  4K6L A;  4A3G B;  3CU7 A;  4FF1 A;  4KJO A;  3I3C A;  1H9R A;  2F03 A;  5M5W B;  2RQX A;  3MFY A;  1SBB B;  1XX8 A;  1PRT D;  4C3I G;  2JYO A;  3GD7 A;  4H7B A;  1ZYR C;  1A15 A;  2K32 A;  1LTR D;  1I4G A;  3CRK C;  2IT1 A;  2ZXO A;  4RGN A;  2IWH A;  3LWU A;  1LTT D;  1SNP A;  1X3P A;  4ABN A;  1TR5 A;  1SAP A;  2X6G A;  2K01 A;  3MXN A;  4QUF A;  3X3N A;  5IGB A;  1EIH A;  4DK0 A;  1WTV A;  3DHQ A;  2L55 A;  4EQN A;  2A68 D;  2L0C A;  5I2Y A;  2E2J B;  1VF5 C;  4ZQ3 A;  3MTS A;  5CC4 A;  3S16 B;  1E2W A;  4DAY A;  2OT2 A;  3C46 A;  4G4K A;  3U9O A;  1DOM A;  5K36 H;  3IFD A;  3NP8 A;  5KND A;  4ZKC B;  1XXG A;  3IL8 A;  3P1H A;  1B9M A;  3SE0 A;  3A8K E;  4QIW B;  4WRD A;  1HQM C;  5A2Q L;  2H4O A;  3P7J A;  2TMP A;  2OF1 A;  1X3Q A;  1DYQ A;  1FYC A;  1GHJ A;  2K6A A;  2SNS A;  1SND A;  4A3J B;  3K59 A;  4KY7 A;  1S5E D;  3KBX A;  3SK6 A;  4OHJ A;  3NWS A;  3TP7 A;  5CR3 A;  2KCN A;  3M4O B;  5C4Z A;  2B63 B;  4IFD J;  1OXV A;  2A6E D;  5D65 A;  3T51 B;  1JWM D;  2AWN A;  2Q8T A;  1TY0 A;  5DM7 3;  4RCO A;  3HZX A;  1AFP A;  4K6D A;  3JAM E;  1SNM A;  3T53 B;  4C2M B;  2N88 A;  2F0T A;  1KAB A;  2K04 A;  4K2K A;  3H3V C;  3FMC A;  2JSO A;  1DON A;  1T5E A;  1VF7 A;  2HUG A;  1ZYR D;  2NYZ D;  1BCP B;  3QJY A;  4KY5 A;  2XNA C;  2EYF A;  2G9H D;  2J4X A;  2JXM B;  3VA5 A;  2EE1 A;  1SE2 A;  3BVG A;  1EY7 A;  4GZY C;  1YNJ C;  4IFD G;  2WP8 J;  1MI2 A;  2A74 C;  3UI2 A;  4IFD H;  1M8A A;  3IAY A;  1PMR A;  1G2S A;  1ICW A;  3HG9 A;  4DA2 A;  3BYY B;  1SSO A;  3D31 A;  1RCV D;  1SYE A;  2FMC A;  2NBF A;  5EPJ A;  2PMZ B;  1CHP D;  1G2T A;  3MAQ A;  2EJG C;  1Y8N B;  2Z8L A;  1FNV A;  5EJW A;  2Q8I B;  1EEI D;  3K0Y A;  3GTO B;  1HFG A;  1PLF A;  4RCN A;  1ZKO A;  1O7Y A;  3S9W A;  3H0G B;  2SDF A;  1CHQ D;  1GUN A;  1E0B A;  2PO4 A;  5ELE A;  4QB4 A;  2DNE A;  3K5L A;  2Q8R E;  1TS3 A;  3J7A F;  2EYP A;  4M8A A;  2JA7 B;  3VYS A;  1BR9 A;  1ENF A;  3H94 A;  2K1B A;  5D14 A;  1FD7 D;  2E2H B;  1WTO A;  4UDU C;  1QE6 A;  2PCF B;  4A3B B;  4IAL A;  3BDC A;  2B2U C;  2MHV A;  2G9D A;  3T4A C;  1PTO B;  3Q0A A;  3S15 B;  1F2L A;  1XWE A;  2KEE A;  3SDZ A;  3EJI A;  1Y69 U;  1DZ1 A;  4B9W A;  1YNJ D;  1JE4 A;  3FKI B;  2JA6 B;  2O5J C;  2EYL A;  4DK1 A;  3FEW X;  2F0S A;  4WOR A;  2F0N A;  3X3M A;  3HKZ B;  3NQI A;  4NDX A;  2BOS A;  4RGO S;  1Q12 A;  4NP5 A;  2E2D C;  1BBX C;  3VR3 A;  3VR4 A;  3NPP A;  2L12 A;  4CKE A;  3E6Z X;  1ENA A;  4K5X A;  1G8Z D;  2WIN B;  4BA2 I;  2D5D A;  5FO7 B;  3TZD A;  1BNZ A;  3J80 L;  1X32 A;  4Q0F A;  3I4M B;  2IX3 A;  1BUV T;  1QG7 A;  4MHE A;  2AUK A;  1STN A;  5I9P A;  5J1Z A;  1D6E C;  3NTK A;  4O1N A;  1R9T B;  4XT3 B;  4ZUJ A;  1HRJ A;  5IT9 E;  1SDF A;  1JR0 D;  2EY2 A;  3D8G A;  3SK8 A;  1PRT B;  3PO2 B;  1QIL A;  5C4X B;  4HR7 B;  1CZG A;  3A7L A;  2B2V C;  1EIG A;  1STH A;  4L63 B;  1OXT A;  5I4D A;  4EVO A;  1SMY C;  3HOW B;  2O4X A;  1KNE A;  4RGT A;  1HHV A;  1RTO A;  4C3J B;  5E4W C;  3MXU A;  2WKD A;  4DGZ A;  4G7Z C;  4DNT B;  1SNO A;  5IGF A;  1GUW A;  3K6O A;  3N6R A;  4PV1 C;  4PQX A;  1B4O A;  1WD1 A;  3D6W A;  2YYZ A;  4TRD A;  2B2Y C;  4FF3 A;  1CZW A;  3EVQ A;  4IQZ A;  1K8M A;  5AFW A;  1LV9 A;  2LS0 1;  3A7A B;  5I2X A;  2KOL A;  3KF8 A;  5C0X J;  5ELD A;  1IW7 D;  4M1U B;  3TP6 A;  1CM9 A;  4KTA A;  3DEP A;  1STB A;  3GV6 A;  1TQO A;  1ET9 A;  4BS9 A;  1SFO B;  5I6Y A;  3H6M A;  3ERQ A;  3U9S A;  4HSP A;  5COY A;  2VUM B;  3I72 A;  3DXJ C;  1G29 1;  2BE5 C;  4KHZ A;  4KKU A;  1JOK A;  1PFB A;  1A2U A;  1F2Z A;  3P75 A;  1ESF A;  1DM0 B;  3DWQ A;  1CA6 A;  4KK7 A;  4B9X A;  3W3A A;  4LK1 C;  4F7X A;  2PW5 A;  1LTS D;  4A3F B;  3S1R B;  5C0X G;  2BCO A;  3PUV A;  4ODG A;  2B8G A;  5EBD A;  1NUC A;  4K14 A;  2V4D A;  1JQY D;  4HSV A;  1STA A;  4XT1 B;  1STG A;  2B2T A;  5C0X H;  1SMY D;  3T16 A;  3AMU A;  1TS4 A;  2XIW A;  5I6W A;  3GV3 A;  2CW0 C;  1H9S B;  2KEC A;  3OSO A;  2Z1C A;  1QWY A;  5A35 A;  2F4I A;  5FLX E;  1ML0 D;  1SJH D;  4XXE A;  4F8M A;  1Q1B A;  1Q8I A;  3MFG A;  1TVX A;  5BN4 A;  1B44 D;  1SE3 A;  3PUZ A;  3SK5 A;  2XWJ B;  2WKC A;  2DNC A;  5T1G A;  4L6T B;  2R92 B;  2R3Z A;  4FNF A;  4RHR A;  1V1P B;  1TWA B;  2A73 B;  2NTS A;  1H9K A;  1UAP A;  3GTK B;  3S2H B;  3PIP 3;  2D9U A;  1DOK A;  1ESR A;  2L4N A;  3OPO A;  3RMH A;  1A3T A;  2DY7 A;  1CI3 M;  4RFB A;  1SXT A;  4TQU S;  2QF7 A;  4KI0 A;  2NWG A;  2EDG A;  2BE5 D;  2EZV A;  2JA8 B;  1L0Y B;  3D4W A;  5M5Y B;  3QIA A;  4G7H C;  5ISR A;  1E2V A;  1AN8 A;  4R8I A;  2XVS A;  4R8N A;  4A3D B;  1QOH A;  1NR2 A;  2QCP X;  3SHL A;  5CBE E;  3OWF A;  2MGS A;  3S17 B;  1EQT A;  1B1Z A;  1G6Z A;  2PZW A;  1EZ8 A;  2CW0 D;  3LWE A;  4TKO B;  4ZRZ A;  5KIX A;  3R2I A;  3J81 E;  1ET6 A;  2F0G A;  2ICE C;  5C4H A;  1OXS C;  3D4R A;  3HS0 C;  3SVM A;  4K2L A;  3K5N A;  1V8Q A;  2F0E A;  3KBG A;  4BBS B;  1R4P B;  5CV9 A;  5K36 G;  1NR4 A;  1J9O A;  1SEB D;  5C5L A;  2J7Z A;  1KDB A;  1H9S A;  3MXG A;  2EYM A;  3WOE A;  3TDQ A;  1GJX A;  3OOC A;  4KD3 A;  1I4H A;  4F88 A;  1WVL A;  4CJ2 C;  2K7V A;  2BA0 A;  4PMC A;  5TSS A;  4QMG A;  2Z4I A;  3OMC A;  4J8Q A;  5E1F A;  5KNB A;  2EOT A;  4CJ0 B;  2CQA A;  3ZYY X;  1MGS A;  2K03 A;  2I46 A;  1F2Y A;  3BG3 A;  2K5Q A;  3PO3 B;  4BA1 I;  4KN4 C;  2XWB B;  1BF4 A;  2WAQ B;  5BN5 A;  4ME5 A;  3OHX C;  2LMC B;  1PTO H;  1I4Q A;  3PUY A;  1V1P A;  1QB5 D;  4FF2 A;  2R93 B;  1PYW D;  1DCZ A;  1Y8P B;  2F0M A;  4ZLT F;  1ROD A;  3MA2 B;  1HCZ A;  3SK4 A;  4C3H B;  1HTP A;  1RKN A;  4C56 C;  2PPB C;  1AEX A;  1TII D;  2BA1 A;  4ZKB B;  4IN3 A;  2D62 A;  2A6H C;  1MSH A;  3TN2 A;  3M4Y A;  4QCL A;  5IGD A;  4ZYS A;  1U4M A;  4IUP A;  5CBA E;  4K8I A;  3K5M A;  1HPC A;  2F0P A;  2IX1 A;  1KLG D;  2R61 A;  2Y0S B;  2KA7 A;  1NAP A;  2RDH A;  3NUC A;  1RTN A;  5EKL A;  5KRU A;  4RAU C;  4ID6 A;  1C4Q A;  1F9R A;  1D2B A;  3RZO B;  5DM6 3;  3V2T A;  2ZXP A;  1SYC A;  1J8I A;  1IKL A;  1WTR A;  3BYT B;  4BY1 B;  1JWS D;  3BVZ A;  1HA5 A;  4BBR B;  2QEJ C;  1D1K A;  3NBH A;  2DY8 A;  1SJE D;  1B53 A;  1YNN C;  3K7A B;  4HAE A;  3E0J A;  4X3U A;  1LT6 D;  1DD2 A;  2KJX A;  2XSC A;  2E75 C;  5IOD A;  3HEJ A;  4C3J G;  1TWG B;  4KN7 C;  1Q1E A;  2VB2 X;  3K5O A;  5KNC A;  3Q6S A;  5CV4 A;  1O7L A;  1D1I A;  4ULL A;  1VCI A;  1ZEQ X;  1UUP A;  3GTL B;  1B2T A;  2A5H A;  3GTJ B;  3HGB A;  2B2W C;  1LO5 D;  2KHS A;  3VR6 A;  2RSN A;  1LAC A;  1LTA D;  2A6H D;  4CHT B;  3K57 A;  3S2D B;  2JA5 B;  2F0H A;  1V43 A;  1QJO A;  5JEA G;  4OO1 I;  2E2I B;  4BWG B;  4IZ8 A;  4KMU C;  4KHV A;  2BDN A;  1IYV A;  4L8J A;  5JEA H;  2EJF C;  2B2U A;  2R7Z B;  1ONL A;  3ONA B;  4E6I A;  3ND9 A;  5KGU A;  2IW3 A;  3A8I E;  3MWY W;  1MSG A;  2WAC A;  2FJ2 A;  1EYD A;  3CRL C;  4CBV A;  2CVR A;  2RBM A;  3DM1 A;  4U68 A;  3Q23 A;  1DXM A;  1DOL A;  3AB9 A;  1BCP C;  2EXZ A;  5C6A A;  2F3V A;  1LTG D;  3J7A V;  1YNN D;  2FIN B;  2SNM A;  2NVT B;  5JVH 3;  1EY4 A;  4S3S A;  4C1N K;  1HFN A;  5CGK A;  1STY A;  4HN7 A;  3GTM B;  2KUM A;  2B39 A;  1HA6 A;  5BN3 A;  5M3M B;  1VMP A;  4V19 0;  3DWA A;  4J6H A;  3VYT A;  2OEO A;  1CFM A;  5EKK A;  2F0D A;  3J7Y W;  1PDQ A;  5T1I A;  4F87 A;  5CV8 A;  2LFN A;  3F2U A;  2D2C C;  1SYG A;  4JK1 C;  3QB3 A;  1HUM A;  4BY7 B;  1D5X C;  1Y8O B;  2F0V A;  5FKA C;  4A3K B;  1H9J A;  2K5W A;  1EY9 A;  1EWH A;  3R93 A;  3EFX D;  4K5V A;  3VYR A;  3EA6 A;  3QOJ A;  2X6L A;  2GA4 B;  1EFI D;  4RWS C;  5A2Q E;  4B08 A;  4FO2 A;  5JAV A;  3ITP A;  3OIQ A;  1STE A;  1NCV A;  4XYQ A;  2FMM A;  4NKL A;  1WTX A;  2KCC A;  1KDC A;  2EYO A;  2AQ2 B;  3TME A;  1D5Z C;  2HCI A;  2QKI C;  1VMC A;  5HUR A;  3M3Y B;  3ERO A;  3KLR A;  1M4V A;  4U67 3;  1PZJ D;  1Q90 A;  3TZU A;  1FGB D;  3JAM L;  2YU9 B;  1TKW B;  4RKL A;  3C1F A;  4WFN 3;  1VDZ A;  1KDA A;  4RKB A;  1TS2 A;  2NVQ B;  2SEB D;  1WD0 A;  1JB3 A;  2JE6 I;  4NW2 A;  4O42 A;  1A3V A;  3NHH A;  1KTK A;  3MC0 B;  2F0W A;  1EYC A;  1LT4 D;  2KQ3 A;  5K5P A;  3C1E A;  2VNU D;  5I9O A;  2JEA I;  2L5T A;  4N9P A;  1UEA B;  5IGC A;  1TWH B;  1XYI A;  2NN6 I;  2VB3 X;  1TU2 B;  4OIK A;  4CKB A;  2K28 A;  1V1O A;  5LL6 X;  3NWT A;  2EJM A;  2SOB A;  3V05 A;  1A3U A;  2F0K A;  5CV6 A;  3A8J E;  2M9V A;  1IYU A;  4H0L C;  4HED A;  1U4P A;  4I65 A;  4V0B A;  5EBC A;  1LT3 D;  3LNN A;  4Q5V A;  1I6V C;  1EY5 A;  1EZ6 A;  4UAI A;  1IL8 A;  5IIF A;  5G3L F;  1EY0 A;  4I7Z C;  3TP8 A;  5HGT A;  1B9N A;  2PW7 A;  2HDM A;  3R3O A;  4RGM A;  3GTP B;  1U9R A;  3BVM A;  1CT1 D;  2PZU A;  3IFT A;  4FXD A;  1A6X A;  1ILP A;  2EY1 A;  1DJR D;  4CGY B;  3MZ5 A;  5JVG 3;  2Z4H A;  5IOC A;  3S1Q B;  5F2D A;  3KLS A;  2AQ1 B;  2LKV A;  4C3H G;  5JPN C;  2RDG A;  3M85 A;  1KAA A;  3GTQ B;  1JIC A;  2O5I C;  2NZ1 D;  2NTT A;  3C3L A;  1JC7 A;  3NTI A;  1I4P A;  4IUV A;  2C9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...