2K6GA

Solution structure of the dna binding brct domain from the large subunit of human replication factor c
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
109
structure length
109
Chain Sequence
KRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA bound BRCT domain from human Replication Factor C p140
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Replication factor C subunit 1
total genus 33
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2k6gA00
4ID3A 4Y2GA 1JNXX 4BMCA 2K7FA 4BU0A 3KTFA 3PXEA 1T29A 1Z56C 4OFBA 2JW5A 2K6GA 3QVGB 3SQDA 1T2UA 3II6X 3PC7A 3PA6A 4IFIA 1T2VA 3U3ZA 4U4AA 3L41A 2XNHA 2COKA 1N5OX 3FA2A 4Y18A 5ECGC 1CDZA 3T1NA 2D8MA 2E2WA 3EF0A 3T7IA 1OQAA 1T15A 3K0KA 3UEOA 3PXDA 4XQ0A 3OLCX 3PD7A 2VXBA 2LE0A 3PC8A 3K15A 3L46A 4BU1A 3SHTA 3T7KA 2WT8A 1KZYC 1L0BA 1Y98A 4N40A 3UENA 2L42A 2ETXA 2ADOA 3I0MA 3K16A 4IGKA 3SZMA 3AL2A 2EP8A 2COEA 2HTFA 2M2IA 1IMOA 3L40A 4XPZA 2VXCA 1IN1A 2NTEA 3T7JA 3PXCX 3AL3A 2XNKA 3K0HA 2R1ZA 3JVEA 3PXBA 2COUA 4JLUA 3HUFA 2INGX 1GZHB 2DUNA 2AZMA 3QVGA 3SHVA 3PC6A 1L7BA 2EBUA 3PXAA 3I0NA 3EF1A 3K05A 2EBWA 1WF6A 3PC8C 3HUEA 3COJA 4BMDA
chains in the Genus database with same CATH superfamily
2A5DA 3QELB 4KR7A 1P39A 4HWSA 3R5TA 1DLIA 3BJRA 4O4JF 2R47A 2O1SA 2XZPA 2FK7A 4Q4JB 3KUDA 4U6SA 3H13A 3NC1C 1UZUA 1Y82A 4NDAA 4BQEA 3TO5A 3D7LA 2FDXA 4DQ0A 4DJ5X 1GY8A 2R7NA 1GD1O 1P2TA 3DXXA 4P3XA 4DLWA 3KVOA 3SLGA 4BUZA 1LZLA 1UBRS 2DZDA 3MS2A 1UBFA 3M6MD 4I5IA 3DZBA 3R0ZA 4TVKA 5ELMA 3TLMA 1U2GA 2C1EA 1L5YA 3KK0A 2BGWA 1NG9A 2J5BA 1EH5A 5KYUB 3IGFA 2X3UA 3EQ7A 4P53A 4Q6WA 5DZSA 13PKA 3Q1KA 4GL4A 2W37A 1UC8A 4FX2A 5F1YA 5FLYA 5KNDA 1YZKA 3TPFA 3DVSX 4NCJA 4HVAA 1V1MA 4C7BA 1AVTA 4MLZA 1IE3A 2OYCA 3M6XA 2YXNA 2JZNA 3E9DA 5JMTA 1T4MA 4XR4A 2EJBA 3NUGA 3SHFA 4QZVA 2J5RA 2H3HA 1R00A 3GQVA 1ZN8A 3T0IA 1Z45A 2IP4A 1Z6ZA 4UBIA 1HZZC 1H66A 1IHYA 3VU9A 1DC6A 2D1RA 3DDWA 4UAJA 2V1UA 3VKWA 3WLTA 1Q57A 3CPEA 5ICFA 3Q85A 2G67A 3N39C 4O0MA 2FU5C 4GYKA 3RSQA 1MUUA 2VYVD 1BQ3A 2ZE7A 3A10A 3G5AA 2QG4A 4H7HA 1DQRA 3OIDA 3OX1A 1R5NA 1KC1A 3AGPA 3VPBA 3SVZA 3ELBA 4JDPA 2QQ5A 4C78A 4B7UA 2B37A 2W42A 1LSSA 1SC6A 5JDCC 4BASA 3ZCPA 4BO9A 1H65A 1RI3A 2XGMA 4RACA 5FV7A 1BGXT 3KXKA 4Q37A 3VI3B 1UAAA 3K9WA 4RVUA 2VAMA 3QXJA 4JLDA 5LUAA 1E58A 1F4PA 3BF8A 3EX7C 1E3WB 3HVIA 1PTJA 4ZYXA 4RDXA 1O96B 1Y48E 4PG4A 3V7WA 4WIAA 3ZD7A 1EUZA 1VG8A 5CURA 3F71A 2PS0A 1MQ9A 4BKMA 2COEA 3JRWA 4LMAA 5KOJB 1SKBA 1KARA 3EJWA 4YP5A 1QIMA 3MXTA 5JPIA 3BFKA 1HYHA 5KMGB 5EIWA 2E82A 3WQHA 5BSGA 4EI7A 1VSQA 4J7XA 1FZQA 5FIUA 3FSEA 1POWA 3TOCA 1GDDA 3B7PA 1E2JA 4YWHA 1XN4A 2Q4OA 5EIEA 1A8PA 5PGMA 2FX5A 1ADCA 3NT4A 4R8VA 2X6RA 2EGHA 2C4NA 3VKVA 2WSSD 1FYEA 1K3FA 4I8XA 4I9NA 2PZMA 3UBMA 2CN1A 2WV9A 2XCSB 4TLDA 5ALGA 3VOBA 3NASA 2AXNA 4RPCA 4DUGD 5AVWA 1G4HA 3O91A 3N70A 1CR6A 3UAXA 4BBJA 2R0QC 4DJDC 4URXR 1T9GS 1QK4A 3ITNA 1QTRA 2G8LA 4EB6A 5KTPA 4R1SA 4ZCMA 3FLBA 2HRQA 2PG3A 4B09A 3AHHA 3DQQA 2ZI7A 4POOA 1FUKA 2ZI9A 2WWVD 3ZS8A 4E4RA 1MLDA 1VSUA 1G66A 1NKSA 2C29D 4LFBB 2ORVA 2WF9A 4DF3A 1J5XA 1DAMA 2WVJA 4YT5A 2ZE6A 4X61A 5DYNA 5B7PA 2VPWA 3JZAA 1DRJA 2WSBA 5HIIA 3ZV3A 2FPIA 3OE4A 3W0LB 4C4RA 4OJMX 3IAXA 3HGQA 3NT2A 4IFEA 4Q93A 2O0JA 4DIOA 4PPGA 2AQHA 2DLDA 2G72A 4C0QC 4BFWA 5TSDA 4CF4A 4ID9A 2WW8A 3STTA 4PWZA 5JT1A 2BM0A 1OROA 3LQYA 3L0IB 4GM4A 1YCDA 2PGJA 3N1UA 5BYAA 1CY4A 1HYEA 4PLFA 4WESB 5DNUA 2Y1GA 2VEDA 1EQUA 2DH5A 3C4VA 4N3AA 4KR2A 4HGYA 1VYUA 2CL5A 1GR0A 2DUJA 4OLBA 1CB7A 5H16A 2BR4A 2WUFA 4I36A 1NY5A 2CWWA 2J07A 2C88A 3VC1A 1UBGA 3L0ZA 4FIZA 3HYLA 3TD6A 3SVTA 3EIWA 1IULA 5K3AA 2OHIA 2XOKD 1Q6ZA 4L08A 3SDSA 3UYLA 2P9BA 3MCUA 2LPMA 4DXHA 5MN6A 3A4VA 3GRZA 1IH8A 3TQRA 4IDHA 1ZK0A 4DLPA 5KYNA 3BXPA 2ZTLA 3E18A 2WY2D 3EC7A 4YJDA 1CR2A 4JLVA 4UVDA 3CX8A 2Y93A 3AQ4A 2QQEA 2A94A 5BN4A 3JZFA 3Q2IA 4NQZA 5TX7A 2OWEA 4Q00A 2H4XA 4PG6A 1U0BB 2Q29A 1X7ZB 1CP2A 1VI6A 5FTLA 1W76A 2FOXA 4X54A 1IVNA 2LBPA 2D2VA 3KYJB 2WDZA 4X91A 121PA 3VKFA 4EX6A 3QVMA 2XDQB 3BB3A 1H9BA 5IEJA 2RH8A 2ZJ5A 4BXOB 2PU5A 1C1YA 2RC6A 2RB4A 4ZT4A 3RWBA 1F0NA 4C0KA 3X43A 5FEUA 2C9OA 4ZAZA 5ICGA 2C0PA 1XMQB 4J16A 3VNUA 3B6KA 2CNLA 3KLMX 3RRFA 1FMCA 3OICA 1BS1A 1FEZA 1TT5A 2W70A 4RTSA 4WJZA 1Z5ZA 1Y63A 5AI4A 1G1MA 1GAEO 1AB6A 4NHOA 2XIQA 4IGAA 2FJPA 4MYDA 1V16A 5EIBC 4BP9A 3B8EA 1BFKA 1ZRSA 1UODA 2W58A 2IXAA 2X5JO 2KI5A 4G2TA 3I58A 4FQ5A 2PWYA 2EXXA 1PFWA 1H94A 2J30A 3DH0A 2G0TA 5KDDA 5M2QA 3PCRB 1T2CA 1RD4A 3W1EA 4CM9D 1DX6A 1BGWA 2NYAA 1HGXA 3CIFA 3OE7A 1YIDA 1VI2A 1YOVA 3BS4A 4BQIA 2YV4A 3D6VA 4TLMB 4A8JC 1IATA 2AMLA 1C1XA 2ZIAA 2DFKB 3L7AA 4IG4A 3OZDA 5BORA 4ZEXA 2RIPA 4WLVA 1XZFA 3U16A 2GJ8A 4NCNA 4H15A 1Z0JA 4K6GA 3U7FB 1QDEA 3WNZA 1S2OA 4JSYA 3C7CB 2CL6X 2FW7A 1ZUNB 1L5OA 1Y1TA 1FFCA 1SVUA 1R1DA 3I12A 3FKQA 4OQXA 2B20A 1YBMA 3DNPA 3H6GA 1L5HA 4PAWA 4Q05A 2PJZA 4XWOA 1A1VA 4PX5A 2QK4A 4P93A 1ZAYA 2VK1A 4MITA 2OCPA 5HRUA 1GUFA 2FPMA 2ZJ2A 5E6RA 2C58A 5CB8A 1GSAA 3C3KA 1XTIA 1NUQA 2IZ5A 3HABA 4FDTA 1X19A 2V03A 4ECEA 3WGUA 1B4DA 3W2TA 3WV5A 5AVZA 2R1VB 2G6TA 2I4MA 1OWMA 5DBOA 5FPPA 1AK1A 3FPGA 3FHCB 1EMDA 1ORRA 2PGXA 4J0GA 1RMYA 3EBOA 3DBHA 1VFNA 2PCJA 1IQ0A 4JP3A 1EXDA 4LF8B 2OD9A 3UFXA 2Q5QA 3IE2A 3P2EA 4NR0A 1Y6GA 4L7QA 3UNXA 1XCMA 3AEKA 3Q6MA 3QP9A 1ZI6A 2H9IA 4G8BA 3E48A 2BY4A 4OGGA 1V6AA 2B2XA 4L76A 4RD4A 1NFQA 2Q6KA 4WHMA 3KYBA 4TWAA 3EWIA 5B7GA 1GIAA 4DSTA 3RIHA 1QO0D 3ZCVA 2JH9A 2RB5A 3IPXA 2CWDA 5H3CA 1MXHA 1FRQA 1PV2A 4D4GA 4U7DA 2LIPA 3P5BA 4WZAE 1J8QA 1Z5UA 4KIGA 3UC9A 5J5CA 3PX2A 1SVNA 4JN6B 1U8ZA 1NP6A 1QF9A 2UXBB 4JI2B 2PT7A 1KEVA 4V03A 1DBVO 1IB0A 3PL1A 4XSGA 1OWOA 4IIXA 5JQGA 4EG0A 3LQ1A 3IKLA 1O94A 4FOLA 1DO8A 1QRDA 1U63A 2H5EA 4OI1A 3W3AA 3RARA 3VHLB 4XCXA 2JK1A 3F6YA 1SQSA 2KBFA 2VDOB 4J0JA 1DPGA 4H18A 4IRUB 1RM3A 2Q1UA 1I1OA 3WMGA 5K8VA 4QVIA 2NU9A 4P5EA 3IAM6 2QRPA 4AYWA 1XO1A 2A5YB 2VF7A 1Y8ZA 5L3VA 1W47A 4PTZA 2YWRA 3RK4A 2IHZA 3DEAA 3OEHA 1QGAA 1VCHA 2PV0A 4IIJB 1OGJA 1QMGA 1TJ4A 2O0LA 2EVWX 4Y6QA 1X7HA 3PDIA 4A2PA 2NNWB 5HKKA 1K68A 3ILSA 1KDRA 4YI5A 2IHNA 4QUHA 2A78A 1OT5A 1P2BA 1NVAA 3T3DA 4JC4A 5DCWA 3RCBA 3HDTA 3CLSC 1T5OA 1NVEA 2BMFA 3LUBA 2RGGA 3GJTA 4HQOA 4QDXA 3VPAA 4HNVA 3QV1A 1K66A 2YWGA 1F20A 3C5WP 4IHAA 4PCVA 4UE6A 1C9EA 4PNEA 5FWYA 1Z39A 3VHXB 1OA1A 2P6NA 9GPBA 1BXGA 3FDXA 1CFZA 2AE1A 3DAOA 4HB3A 4YGYA 4BS9A 5FRDA 2ZB8A 3VXKA 3EXHB 3LW8A 4TV9F 1KU0A 2H4JA 2Q5EA 3KZOA 2W4QA 4NE9A 2FSUA 4MQ4A 4KREA 5EKSA 3LLUA 4PLGA 2O7VA 3B60A 5JAMA 4NYIQ 1XKXA 1QOPB 3C1UA 1TD9A 3ICPA 3QUQA 4LJLA 3TLCA 3GCGA 2QVXX 5IBCA 2ZSFA 3B51X 3R9XB 3ZK8A 1TYCA 4W7IA 1U6KA 2VTKA 3GLIE 4ZOAA 5L45A 5P8WA 1U1GA 1ULAA 3BH7A 3CXUA 3L4SO 3TTXA 1U0OC 1EX1A 4K8RB 3LP8A 5A7FA 3GRRA 4RSGA 1LD3A 1I1HA 5KOHB 5BYKA 1S96A 3FPLA 4RZSA 5REQA 5JFOA 1LW6E 4BDTA 1M5UA 1S4MA 2C82A 5LZ4A 3QKRB 3MSCA 2Z08A 4DV2B 5DNCA 5AP9A 1RVV1 3ZXYA 1X39A 2NYUA 2C8VA 3S2EA 4BJ3A 3TZEA 1OTXA 1IEQA 1U9CA 3R40A 4FFOA 4K8OA 4YALA 4QEDA 2OV2A 3T52A 1UDCA 3R6GA 1NT4A 4B75A 4RMGA 3NONA 4OFWA 2ATCA 3ZHZA 4EG6A 4IFTA 3WGJA 4X64B 1OZHA 3X1ZA 4HPXB 4JCOA 3BGDA 4IZHA 5CLIA 4RGBA 3GG9A 4E2ZA 1C3LA 4HVCA 1AZWA 4PFKA 4F6RB 5ALJA 4MYHA 3UIEA 4P36A 1GGFA 3LOUA 3AHJA 1MD9A 2FB9A 1GTG1 1TZBA 3N0VA 1KI3A 4BVEA 2PL1A 1U9YA 5HFAA 3ANTA 4XKJA 3O2NA 5JJBA 3LT5A 3HJRA 3NRCA 1TEZA 4YJ2F 3ZI7A 1JR3D 4M1EA 3OLCX 1YJ5A 1KRHA 2WB4A 2XTNA 1G6KA 4UBLA 3T3MB 5FWXB 4AJEA 3PQ2A 3QFFA 5CA0F 5HRAA 3DBLA 2XWSA 4KPFC 3JZIA 2YHBA 4EKEA 3KKNA 5F7JA 5JY6A 4BMVA 5THQA 1H0KA 1ECBA 3B6IA 3LPMA 2ZU0C 1SUEA 3CVOA 3ZN2A 4AW9A 4EI9A 3SFZA 2W6IA 1GG9A 1ZN9A 2H5IA 1MPXA 3I5YA 1WTAA 3M1AA 2QORA 2JGMA 2EAUA 1E5LA 1GDTA 3LG2A 2CK3D 2BISA 1A88A 3QU7A 1BX1A 2ONZA 2QQGA 3SF8A 3V6MA 4B3JA 1N1DA 2CLSA 3DBRB 1GOTA 2R5NA 4WOJA 4M1OA 3T99A 5J4VA 1T1RA 3CCFA 4R1UA 5EIHA 4RHFA 5HQTA 1C4XA 3MFYA 3COVA 1I2CA 1N7IA 2CFSA 1ZD5A 4H35A 4BFYA 3LUJA 2DWUA 4M0MA 2YYAA 4BE7B 4DV3B 1E7QA 3B5JA 1GZ6A 1DBQA 2DXIA 1PGJA 2YJNA 2FZCA 2Q9CA 1WDTA 4KWHA 1L5QA 4QHYA 2HJVA 1QUEA 3PC6A 2JDID 3CJRA 4G1VA 4YBRA 2DBRA 1NJ6A 4NONA 5ETJA 5B1SA 3IELA 3ICWA 2HREA 4KXXA 1L5HB 2CLCX 3DZDA 4KO1S 1O6ZA 1OX6A 3DKIA 4BWGA 1GKKA 2W2QA 4QQFA 2PT6A 1F8XA 5C81A 3A7EA 2FEAA 1R4NB 2GLUA 4PRLA 2I87A 4YRKA 1Q83A 1NRXA 1Q7TA 1P2GA 1XNJA 2BHSA 1XZAA 4HUQB 3BB4A 3W5JA 2QW1A 3CGGA 2AV6A 1Z74A 2F00A 3RLFA 2DHCA 2W6ZA 4DSZA 1KQPA 2V45A 4L4ZA 4QXOA 3SR3A 1Z2NX 2VTDA 4PN7A 3NWEA 1QIEA 1XMVA 4JQZA 3RSFA 1V4VA 2X2PA 2WICA 3VFDA 4ZVPA 1AQ6A 1Z0FA 1TGYA 3OTHA 3U13A 4FLFA 3FBTA 4DTIA 3H2GA 4HWRA 3FCUB 4OA5A 4ARCA 2YCLA 4V1CA 5HOEA 1I3MA 1JEQA 4UATA 1MKYA 4D4MA 4MPPA 3I6IA 2OGWA 3QXHA 1L4KA 3WFIA 5TE9A 1O6BA 3DV0A 1CEQA 3LVFO 3WL8A 5K3DA 2F3SA 1OASA 4J1TC 3VVBA 4R2MA 4A10A 4D80A 5KPJA 1IONA 1JFRA 4JVOA 5C1IA 1GZ7A 4CI0B 1C7IA 5KC8A 4I50A 1OJ7A 4UVIA 2P3SA 3RHFA 1N6HA 3OOYA 1ISMA 4QPZA 3UAYA 2WZDA 2DRIA 3P2OA 1UF9A 4FU0A 1N4AA 1RLOA 4AT1A 3VKUA 1OVMA 4ZGWA 4ZJZA 3R8XA 1Q12A 2JCGA 2Z5GA 4HEJA 1N6OA 3BEOA 4TUYA 3IEVA 1ZG3A 2N9UA 3PQDA 4HQLA 3KKKA 2AHOA 3GNQA 1YR1A 2BFCA 4MQ5A 1WSBA 1ZMTA 2ENUA 1ZOPA 1A97A 2D8MA 3LQQA 4Q7JB 4M88A 4ZARA 4X44A 3J7AC 3GCWA 4MS4A 4YAKA 2ADFA 4TS3A 4QGBA 3HS3A 4ESVA 3PE6A 4IDPA 4NYMR 2HW8A 1AIPA 1EVZA 2A0WA 1TMOA 2YR0A 5DCUA 3S5UA 3GT3A 4M8LA 1IWOA 3PUWA 3EOBI 5EKTA 4WK0B 1J0EA 3FGZA 3VZPA 4F4DA 2HSGA 2XF8A 3RC1A 4DR3B 2J9FA 1J0CA 3GWGA 3X3HA 2MR6A 1QONA 4IVPA 3H05A 5DDIP 5FBKA 3O8RA 1QZTA 1US8A 1ZC4A 3IERA 5HVNA 2WLTA 1Q7BA 4PCAA 1DB3A 4UQOA 4ER3A 2E85A 2ODAA 2OZLB 1W34A 5TQJA 1IG0A 1F2UA 3ABRB 1R0BA 2W6JD 2VHQA 3L40A 1L7QA 3BCUA 3ADDA 4MMZB 2C99A 4AMYA 3AL3A 5F64A 5CP8A 3GO4A 2EOAA 3RDPA 2ZFUA 4NAUA 1ZISA 4R3UC 5FBRB 1TCAA 1GM5A 1DXOA 1VCNA 3FFBA 2VDRB 3DHWC 1YKSA 4TVSA 3C48A 3JD1A 4XWGA 2HJHA 1IUNA 1PHRA 1UEJA 2RKWA 3CWQA 3JVUA 4PCUA 1ZO8A 4Q4HB 2GZDA 4X1YB 5DXAA 3SC2B 3U0VA 3E82A 2OXEA 3AEXA 4HXGA 4GBMA 3Q5GA 1I94B 2J6CA 2EKBA 3DWIA 1MN6A 2MSNA 1WUTA 4LRQA 4AF7A 5LP6B 1TDJA 4WFIA 1EHIA 1KS2A 2XITA 3A1DA 1RPAA 4K03A 2DFDA 1VA4A 3JR3A 2ZI5A 1ES9A 3KU4A 2I2DA 5GONF 2QJWA 5EMMA 4DSOA 5BWOA 4RTRA 3AEQB 2VUUA 3KNZA 3G2OA 1ICIA 4MVCA 1SWWA 4EB6B 1UMBA 3C45A 5ALMA 4ER7A 1ECPA 1GSIA 1VCIA 2A1TS 3NHBA 5KSYA 2JK0A 3CY6A 3QPBA 4DPMA 3SGLA 3S8YA 3FRIA 1L4BA 1OKKD 4L0CA 1R27A 1YCGA 2GM9A 1SO8A 3DDNA 3QX9A 4OHFA 1A7AA 1YASA 2XHZA 4JUCA 4E5UA 5U9CA 3BRWA 2JLXA 3NTLA 1YCHA 4WPGA 5BNFA 4B6QA 5E9WA 2BP7B 4HYYA 1DWQA 3OZ7A 1NKTA 2IWHA 3OFND 1E99A 2J6IA 3CZAA 1KSGA 1RP7A 3KD3A 3NRJA 2RHRA 2LVBA 3AERA 2BR5A 1AKTA 2HOQA 2EW8A 4L5IA 1JDBB 2QBYA 1B41A 2G40A 3C14C 4EKNB 5CDSA 3PJFA 5CB4A 4G5XA 5ADVA 5KMGA 2QVGA 3ASYA 3ZLVA 4OBXA 1U3VA 5DO9A 1HNZB 5DULA 3SHQA 1NQXA 3H8SA 1Y9JA 4XUGB 1P9NA 2WOJA 2B78A 2GQ0A 4NG5A 1W6UA 1RFGE 1XVLA 3OM9A 3DT8A 1ZMBA 1II9A 3B13B 4ZVQA 3SBDA 1J09A 5AKGA 4MP6A 5CEJA 1S6YA 1O96A 4FMBB 1P33A 2R6R1 1K5DA 4G1FA 1GFIA 4RBNA 3B5IA 8GPBA 4GX2A 4WFKA 3L06A 3CZPA 3FUWA 3IVCA 4EJFA 2REBA 1T1SA 2B7CA 1CUJA 2ASVA 3E9MA 4GM0A 1K0FA 1X2BA 4GKKB 1PGQA 1T2FA 1ENOA 1PHPA 4IL5A 1JBKA 2DF8A 4DB4A 3JY6A 4TKLA 4R2HA 1GGNA 3B2QA 3HK2A 3LYHA 2BMVA 3CN9A 1E0KA 2UYQA 1WDKA 3ZBUA 3PK0A 5HM6A 3DL0A 3DOCA 3M6UA 5EXSA 1V7CA 3LCJA 1QGZA 4IMJB 3UMRA 1GGEA 3C3WA 4KXMA 2I2AA 1DEOA 4XRRA 4CT0A 1V96A 2B1QA 1ODKA 1QSGA 1RRPA 3P9XA 4NV1A 5ANRB 3RI3A 4E1AA 4LI3X 2GBGA 3K15A 3BUSA 3CVXA 2YVUA 5LOVA 5E2AA 4TTIA 4AG3A 2HHJA 3WYAA 2ZB4A 4JAVC 5D87A 3U4DA 1UP7A 2IBMA 3LHIA 1Y98A 2H8KA 3FN4A 4DWVA 2I22A 2Y1WA 1NMXA 2B61A 3AM4A 2MTBA 3MJSA 4CM1A 3IPYA 3K4QA 2HQOA 4F2DA 1R37A 2BGGA 5KJCA 4AJLA 2W11A 1T43A 4QC2A 4QWMA 4JWTA 4IXTA 1KBQA 2OO5C 5KYTA 3I1YA 1CU1A 5KTNA 2H2FA 3P94A 2NVBA 4G4SO 3CCCA 4NAVA 1U02A 1XPRA 1ZONA 4B33A 3I2KA 4KQEA 5F76A 2P2NA 3HO1A 1JEEA 5BQPA 3RTCA 3K94A 2OORA 2VC2B 1BHQ1 3KUUA 1WB4A 4P58A 3GLSA 2KPOA 4ZCTA 2XCOA 2TYSB 5G0SA 3CM0A 3B6JA 5KSZA 2A2ZA 4L73A 4UQPA 3WYBA 3GUUA 4GLBA 3RWMB 2ZDGA 1ZD1A 1U8AA 4A2CA 3U3RA 2GASA 4DQVA 2IYNA 1ETUA 2F1OA 1ZHFA 3WK9A 1C8BA 3MT0A 2X0IA 2A30A 4KQ6A 4K0RA 2OZVA 1ULBA 3MOSA 4K87A 5D84A 1A8QA 2IZ6A 3OAAD 2ZITA 1MJNA 4GE3A 1NFFA 3NCTA 2RJ3A 5F3DA 5LIRA 1B14A 2PIDA 4RKFA 1E1KA 1ZXBA 3M0EA 4L8VA 4M0DA 1Z8FA 4D8YA 1YF3A 4YGXB 4FHZA 3TSCA 3W5BA 4CKCB 2Z09A 3AM3A 3ANSA 1YV9A 3KR2A 4ZODA 3TZLA 5BV0A 1A82A 2Z04A 1CCWA 4FGUA 4G86A 4J76A 3TMAA 5JCOC 1Z22A 4BMCA 2HPZA 1FP6A 3CZ4A 3QUSA 5L4NA 4YQFA 2Q21A 4KHZA 3H2YA 1NW4A 3DQZA 3HV0A 2HLHA 1CTQA 3UH0A 1KQFA 3NZEA 2H48A 3EFBA 1YI1A 4P7GA 4B31A 2JGDA 4MMXB 1HKUA 3D3WA 4LC0A 2R8OA 1PUJA 1UAYA 3CUUA 3AGQA 4YRGA 4Q12A 3TW8B 2IJGX 1XPOA 3HGMA 3LHDA 4KVGA 1T8UA 2HL6A 2BKUA 5HUHA 1EGMB 4H1TA 3Q8XB 4ZT6A 1NKVA 4JJZA 3H1PA 1PR1A 1MC1A 2GEDA 1PI3A 3CNOA 4XI9A 4I4NA 3ZGVA 1GV0A 1Y4ZA 1HT2E 3VC3A 3W4IA 1OFIA 1VDMA 2B1GA 3QI2A 3ZWNA 2B4TO 1UINA 1NXPA 2CXTA 2O3SA 2XF2A 4Q16A 4RVGA 5IBPA 2ZUCA 3NAQA 4BEBA 1VLVA 1CULC 1L8LA 3HPQA 4HDKB 5IZCC 4OK5A 4AK9A 4CIDA 5KNBD 5CIYA 3Q2OA 4CFYA 4PONA 2HA4A 1M2GA 2N75A 2QT9A 3INRA 3P9QA 1CEEA 2FK8A 1F4LA 3IUEA 4CTJA 3QX8A 4FDVA 3RTBA 3VGJA 3L1VA 1SUBA 3EGDA 3OQ6A 3ZHTA 2NAFA 3CKYA 1LJLA 5KKAA 3TIGA 7MDHA 4X62B 3A7DA 2Q1SA 4Q0MA 2GRUA 2RCYA 5ALQA 1V7PC 1GUAA 1GRVA 2IH4A 3MMPA 2O8DB 1LI7A 4KI7A 4HAWA 4QTUB 4BDSA 2B83A 1FVXA 2F43A 1L4LA 3W5IA 4O4IB 2GUGA 4FC6A 2PVSA 2P91A 4R5HA 4BZPA 3OPYI 5IM4F 3BMQB 4X41A 1N0WA 1XCPA 2J1LA 3IHWA 4DGSA 3BFJA 2W43A 3HFSA 4J29A 1R9NA 3D5EA 2PWAA 2YJ5A 1E63A 3JVVA 1ZXXA 4LSGA 5G4KB 3QWBA 4UFOA 1EUYA 4I6EA 4KN5A 5L6MB 3SC6A 2BD0A 5FBWB 3HWX1 4KVZA 3UWSA 3UMGA 2RG1A 3I45A 2E1RA 3OZGA 3PXCX 4H7KA 2XB6A 1C9NA 3D6JA 3H97A 3J81k 1L7NA 3B1VA 1G8FA 1UBSB 2ACWA 4MKXA 2BGIA 1E2NA 2JFHA 5TLSA 5IVKA 2QTZA 1Z5GA 1JV2B 5KZMB 3SYKA 3M6FA 1GUDA 3IP9A 5DGDA 3E03A 2XCLA 2R87A 1TQ8A 3GJ8A 2IE8A 3WOHA 2VTBB 3HCDA 3I32A 3ZBQA 4BMOB 1F9EA 1HDIA 3LQ4A 1IM2A 3VV2A 2JFUA 3EIUA 2FWMX 2NQ2C 2M1ZA 1B73A 2IITA 1HYGA 3NNSA 3V8EA 1NNI1 2H1HA 1IN4A 3C7AA 3GA5A 3ZY3A 5DYIA 1J7JA 2VDNB 3N8IA 3M2PA 2CKDA 4PN3A 3EQZA 3NH6A 1PDVA 2VLIA 3CSSA 1OYVA 1UJ5A 2QDKA 3R3WA 3DFUA 4N6GA 4WE3A 2J0SA 2C9CA 1NWHA 1SOWA 4L2IA 3REOA 1XZHA 4BFTA 2A1UA 4IAOA 4WNYA 4NJEA 3K7EA 3OT5A 1K27A 4JJGA 2BCJQ 5HF5A 3QMVA 2GN4A 5J9FA 2K6GA 1NLFA 4E30A 1IVYA 5CFMA 3K8QA 3AF0A 4KC0A 3G9XA 2XB9A 4KO8A 4NCKA 2FZLA 2N3ZA 4EUKA 4ZHQA 4NIMA 1XQWA 3F9RA 1O4VA 4MJXA 3ZDDA 1DKMA 2QXTA 1BAPA 4IRMA 5DI3A 3LU1A 2VNHA 1USUA 4PHHA 4RFSA 2HEIA 5FORA 1Z8HA 1Y5LA 3LK7A 3X2FA 4ZEVA 3F6RA 1SKYB 3GRFA 1KYXA 4UDXX 1GDHA 1ZD2P 3KQUA 5C7LO 3B6ZA 1YB4A 5AVVA 2HYIC 3RO7A 3CTMA 2DQ4A 4MW1A 4PZLA 3CR3C 3JQQA 3D8HA 1THMA 4U4AA 3KPUA 5EZYF 2WE8A 1J33A 2FEXA 3JYNA 2JFOA 4PFSA 3RG8A 2H17A 3Q3HA 4LGMA 1Z82A 2D5IA 2EKZA 1RWMA 3L0DA 3ZCRA 1Q7CA 5EJ2A 1ZA2A 4NMWA 1Y6JA 4XM0A 3SOZA 3NXSA 3NP7A 2JHCA 1WABA 2ZB3A 5DXJA 2VYQA 5JD5A 1DXHA 3D3EA 1CP3A 3FETA 4R8LA 5JCXA 3MCZA 3LP6A 2NQ8A 3NJ4A 1TVCA 1RACA 2VF5X 1TA4A 3CUWA 3D0RA 3DPIA 5DEOA 1E3MA 1BW9A 1TADA 2NUPA 2VDWB 5FOUA 2DHQA 4A15A 2XPCA 1TM2A 2ZWVA 5K7SA 4QUKA 4BFCA 1H23A 2YIMA 3QLTA 2NTYC 4LX0A 3PJRA 3RC7A 1MTZA 3MTJA 2JGRA 1BVHA 5EXTA 2FG7C 1IRIA 4X5OA 4LFCB 5BNWA 4RVFA 4BQRA 3WO0A 4ZMSA 1XCBA 4LV8B 2ZBQA 3RSZA 1QDLB 5E1MA 4ZYYA 8ADHA 3CA8A 4KQ9A 2X2FA 3OQOA 1EESA 1JIXA 3KELA 4MUNA 3UGQA 1WMAA 1YC5A 3I04M 3VVLA 3VSAA 2BBWA 1DC3A 2ONCA 4MV4A 4FYHA 6CHYA 4KMMA 3KOXA 4LXUA 3CR7A 1ZH6A 4D9MA 1FC0A 1J2RA 3FHJA 4NU6A 4EJMA 4EZIA 5CDHA 1YMQA 1BOFA 5KAMA 3KJNA 4XAQA 2LR0A 2PO5A 2BRUA 1HDXA 3V8BA 2O48X 2H1VA 2I54A 1XDBA 1JSRA 5JZVA 3CLTD 5EUMA 4J43A 1QTNA 4QT0A 1AS0A 5DHTA 3MCVA 2O8BB 1L4MA 4C21A 2JHPA 3L1UA 3T7SA 5TIIA 4R71A 4FNMA 1XEFA 1UBHS 1AB5A 1SHZA 2EZ9A 4B5LA 1T3HA 4MW0A 3MT8A 1QHFA 2ATXA 4F4HA 3VSDA 1G8GA 3BIJA 2B8WA 3B8HA 4RXMA 1Z6GA 5LDGA 3TEMA 3NS7A 3GJZA 2CV0A 3ABIA 3F4KA 3ST7A 1ODJA 2J32A 3V46A 1U5AA 4RF3A 3PTZA 3ZJTA 3EIXA 3Q3GE 4PYNA 1QZZA 2BKVA 2V7VA 4YPOA 1YO6A 2QN2A 4GI1A 4O4HB 4XEUA 3ASVA 4RCYA 5IH3A 5FX2A 3TECE 2Q62A 4BU0A 2ZGVA 3O73A 4HWGA 1BD3A 1LLFA 4UAVA 4EI2A 1AOXA 4C4AA 4Z86A 4H4CA 5K0GA 2WWGA 4G5GA 4R41A 4KBFA 4MRNA 5BV1A 3GR6A 2BVNA 2AC2A 2ZSKA 5G02A 2F8SA 1YRWA 3CKLA 1L5NA 1V8PA 3PUKA 2XUFA 2EFJA 1B0AA 4LXHA 2OPHA 5F7ZA 2ZJ3A 1NMYA 3MVEA 4BX0A 4DADA 3SQDA 1U11A 4FFBA 1XCJA 2PEZA 2ZTUA 4Y2TA 1R8QA 2WILA 4CLRA 1BTOA 2HH9A 5EPOA 4DCTA 2HKIA 4PE5B 1T25A 1YBFA 3DB2A 1L8AA 2BM8A 2GEVA 3G13A 3I72A 4GPBA 5GPBA 3O6VA 4OXRA 2ADMA 1KAOA 3LFTA 2JLAA 2P0YA 3SQWA 4G0WA 1FNMA 1LDNA 2P62A 4JKYA 2C92A 3RVJA 5SY6A 3ZU5A 5AESA 5BMVF 1EFUA 1NULA 1Q0TA 1XAHA 3G2NA 4H16A 3I01A 4OI2A 4F0JA 3EDOA 4ZHQB 3C5HA 2J5QA 3CPSA 3A1FA 3OC6A 1MPTA 3DVAB 3D6TB 3KEGA 5LYJA 2JH8A 2WPDD 3GFVA 1J70A 1G5IA 3H99A 2A1UB 1Y7LA 5JMWA 5U4QA 3TAHA 2BKEA 1SKUA 3DOOA 4OSOA 4UD2A 2QB5A 7MHTA 1RZ3A 1WM1A 4EJSB 4EUHA 4XX0A 1H8ED 4TYYA 3DFIA 1UFQA 4ZQHA 3THYB 2ZUEA 1NBEA 2AH5A 1WHTB 2CMGA 4RVCA 1PWHA 4ZYZA 4OJYA 2HO5A 2O6HA 5DTEA 4L75A 5IVIA 2EJVA 5EEGA 4FI3C 1U9ZA 4MA4A 4UDNA 4C06A 1OU0A 1VIMA 3IIJA 1L7PA 2X8JB 3QE0A 1G2IA 3OWXA 5AFSA 3NV7A 1E98A 1UJNA 2X40A 4JLMA 3CF4G 3A4IA 3L92A 4Q4DA 1KEUA 1DIHA 1T9GR 2YVAA 4FQ7A 2ETXA 3LUKA 2WVHA 4R7TA 2QWXA 1CUYA 1CJUC 1AQNA 5AVKA 3ENVA 4RAQA 2MIIA 2F8LA 4NBLA 1LI5A 2F8MA 4EAAA 3S2ZA 3VNQA 1UFKA 4TMWA 1O95A 2EKLA 3FKSA 1RHUA 2PMBA 3AR3A 2JI7A 4XE5A 5FQNA 5DTMA 1V71A 3OC0A 1PQ4A 5BQOA 3SHOA 5BVGB 3HB4X 1FS5A 1H42A 1RABA 1YRLA 4M2LA 4M98A 5JY1A 3STYA 5KNCD 1Z26A 5HBGA 1PNRA 4LSMA 1SA0A 4D74A 2VNAA 1H0SA 3MQ4A 4B4VA 2XTJA 2ZJ1A 2NU8B 4DV4B 1B0ZA 2TS1A 2Z2YA 5CXXA 3OZFA 2JLVA 4V0MA 3FF4A 2RKBA 5J1SB 3QI7A 4NBSA 1NURA 5EI5A 1JHDA 2PXXA 2SCUA 1HE2A 1K8ZB 1KZHA 1VG0B 4J3FA 3H1AA 4CGZA 1X1RA 1NE7A 2CZCA 1FUYB 2FVXA 2ZE5A 4P3KA 4I1IA 1N5MA 2WFLA 4G1MB 2CF6A 5BYBA 1ZOIA 1EP3B 4M9XA 1KY4A 1OBFO 1Q5PA 4Q9HA 4HAZA 2H8GA 2ONKA 2FPXA 4YP0A 2BM1A 4RM2A 4QOJA 5EZQA 4QDTA 5CXUA 1H2BA 4CDRA 3LRXA 2XA1A 4Q21A 1TW2A 2WNHA 4E11A 3KZKA 5FFMA 4KYTA 3M49A 5K8JB 3C6YA 1XJ5A 4F93B 1PFQA 4FN5A 3IJRA 2H59A 3WLKX 3KSUA 4AVYA 3TQFA 3C3YA 3NDRA 1U65A 1UT8A 1DCKA 2O2CA 3AF3A 3BKWA 5SZIA 1ZK2A 2FZ5A 2PGLA 3URMA 4M0UA 3AJ9A 1BRMA 2B1RA 3WTCA 4CKXA 1AQUA 5ICMA 5BQ5A 2ZE8A 2UU9B 1P62B 4XVQA 3TNJA 1CJMA 2E6KA 4G5QA 1WAMA 4KZKA 4QPPA 3RVQA 2JVJA 2XRYA 4ML3A 5B2ZA 3RS5A 1YUNA 5AD1A 1UADA 4REQB 2ACEA 1Y34E 1T3LA 5KOIA 5IYZB 5HW0A 1RC0A 1Y9DA 3BXHA 1L7EA 1XVAA 2WHPB 3P0RA 5DYTA 1ZL2A 4DBZA 4YMTA 1CRPA 1ZJ6A 2AFIE 5EWLB 4BUCA 3M8KA 2XEDA 1P91A 4C2BA 1QQ7A 1YSCA 5ITZB 1KAEA 2ECFA 3B85A 3C5VA 4GC9A 3FTPA 3V42A 3WDSA 3ZNOA 5JXJA 3FE2A 2H3EA 3U60B 4FGJA 4NXNB 1BWSA 1XZJA 4XOIA 1M74A 4HGRA 4RLFA 2JGDB 4J2TA 4S1VA 4DQLA 5LXTB 2GBLC 2FZ4A 4RZQA 3R3YA 3OG9A 2FW0A 1X74A 2D0OB 2V5UA 3PXGA 3W6NA 1V6SA 5JXHA 4X7PA 5J40A 3WZMA 2AYXA 3MCWA 2IYWA 3EZFA 3UJ3X 3EWNA 3LP5A 3FRHA 3EF0A 3GZNA 3OIVA 1YZGA 4HHEA 4M1YA 4LXTA 4BVAA 3NBXX 3IEMA 2OHGA 4DZZA 1G6HA 4Y6SA 1N2XA 2HNBA 5CD9A 1GG2A 3BHMA 1LCIA 3AR2A 3RJTA 1K8YB 4WZAB 4BO4A 1YH3A 2YVLA 4Q01A 3D5QA 4UEQA 2D06A 1FPQA 1YDMA 3B52X 1ACJA 3CUYA 3U56A 4MQ6A 1CQPA 3JQFC 5ALUA 4RY8A 2Q8QA 1PDWA 3DE6X 4MV3A 4R8MA 4OXNA 5H3LA 2UUPA 3LC2O 3JQEA 2B2NA 1NLZA 4B2PA 5DGIA 3PWZA 1EFDN 1O97D 1USKA 5LIPA 4IJQA 3GVXA 4YAGA 1X9HA 4ZHSA 2HA5A 4MO2A 1A8SA 5FNVA 1Y8QB 3B53X 2HK7A 4XPZA 1E96A 5CVTA 1I24A 3EW7A 1S2DA 5I9BA 2FH5B 1CVLA 3UYKA 4DXAA 1NX9A 2O06A 3FPFA 2UAGA 2EQ5A 3UWOA 3KXLA 4JT8A 1NXXA 1CS0A 1GQQA 4NU5A 4EA6A 4EHJA 1UM8A 4EHLA 3O3MB 1BE8A 1RBZA 6REQB 3OHSX 2OFFA 3Q8LA 4WGGA 5A1JA 1Z6AA 1QYIA 3IOMA 3UJAA 3HKDB 1SAYA 3SZRA 3K71B 4MWBA 2IW3A 3E4DA 3V8RA 4B5KA 4G0VA 2EIXA 1U1IA 3PNKA 4HMOA 1W9MA 4URYR 4ISCA 3WDLA 3P9SA 3MOIA 4TTPA 5AUPB 3ZVNA 3FCYA 3HU3A 4I0WB 3VC7A 1O4WA 3I04A 4XJVA 4D46A 4DSAA 2GFQA 1QFJA 1JLKA 4OUDB 3ZWOA 3ZXIA 3GNLA 2DPXA 2W8BB 3I30X 5FPSA 4QA9A 1FNBA 4NBRA 2QRGA 4QGAA 1H1LB 2Q4EA 4O2LA 4N12A 3X1MA 4J1QA 2FR0A 5E95A 4AS3A 4AP6A 2P3QA 1Z06A 4KYVA 3PDUA 1NYRA 2NSDA 4F92B 5HUJA 2XTMA 2MMCA 1X1AA 3SE0A 2GO1A 1TNDA 2E89A 3H19A 3LWBA 3M5CA 3WXBA 1SBNE 2PD4A 3Q7EA 1Z28A 5F9FA 2HR1A 1WVMA 2VJCA 3JARB 2WTUA 4TSRA 2P9YA 3N7UA 3WL6A 4C43A 1JSCA 5BURA 3FYUC 3PYLA 4AKGA 1MX1A 1XCOA 3AIKA 5F3RA 4RS3A 1RXIA 1JA1A 4DCPA 4GPZA 1EYZA 2GHQA 3QU4A 1KDOA 2IYUA 1TYZA 2YZMA 4M3NA 1KOLA 2CB0A 2QSYA 3GYGA 3FLEA 5KWJA 1SKAA 3S2IA 2CLLB 2JBAA 1C3VA 2K5UA 1AM4D 3I6MA 3KSDO 3TG2A 2YYSA 4Q15A 2P6MA 4WVLA 3TGWA 1T2VA 4HDSB 2G76A 4TM7A 1Z37A 2QZJA 2UUAB 4K81B 4CUJA 2VPQA 3C70A 1DAEA 1AU9A 2AEFA 3S44A 3QVJA 1X0VA 3AI2A 5CT5A 1UIMA 1XQYA 4BEWA 4DM3A 1JHVA 3IAUA 1CDZA 1E2PA 3QEJA 1G3RA 4IWNA 4LNHA 1ATIA 4FONA 2BGJA 1OZFA 2W0SA 2UYOA 1WBBA 3R7WA 4ZD6A 5JRZA 3UJNA 3D8UA 3I2GA 1QZUA 1K9SA 4I66A 2VH1A 4HDMB 1YFJA 2IIVA 3IVGA 4PHFA 3QTTA 4RVSA 2D6FA 5BN5B 3PPXA 1DAKA 4I9HA 5BN3A 5I6DA 1F1BA 2NO5A 2OCAA 3SJ7A 3RYCB 5IMBA 3D9QX 3C8MA 2GKGA 2JCXA 2HA6A 4KQMA 3S2GA 3HL0A 1MFZA 4ZU6X 1VIDA 4B4UA 5BUZA 5TY0A 1D6JA 1Q1NA 2AL7A 4PSAA 4WJKB 1JEAA 1CY0A 1FS4A 3NBKA 1O77A 4M37A 3K2EA 5F98A 3NTOA 1LNSA 5LNK6 3CX6A 1YCFA 1Z4IA 1RZRD 2J31A 2AFHE 1BH6A 3BBPA 1NOJA 4KP7A 3TLEA 5BMVB 3DE3X 4KI0A 1WSAA 2FSSA 4S12A 4Z4FA 4BE4A 2Z5FA 3EEIA 4WXEA 4ABYA 1BA3A 5C1BA 4F2HA 3CISA 3QTBA 4II3A 1OC2A 4ZQGA 3ZI4A 4F45A 2OO3A 2OYSA 1OFTA 2QR3A 1SIUA 1W5BA 3FNHA 5CVCA 4AAYA 4UNRA 2QL9A 3WMFA 3KTAA 3QJ5A 1GZVA 2D3WA 1A72A 2A5JA 1US8B 2F67A 3EUAA 3U4IA 2XNDA 1RM5A 2OCXA 4EA9A 3ELYA 1CFJA 2Z5VA 3HA2A 3NHZA 2GEBA 3AVXA 3M2TA 2X8BA 4IQ0A 2R8PA 3KR9A 3OCXA 4PVCA 5C5CA 5CU7A 3DLAA 1E4EA 2FSPA 1QM5A 2A0UA 1UWLA 1E66A 1YTLA 2QN9A 8AT1A 2QX6A 4ZVMA 1AGYA 3F7OA 4KUHA 4QRHA 1YBAA 4O2AA 2H29A 2IOYA 1XLTC 4XIFA 3HVHA 3U0BA 1MB0A 3KXPA 1EGHA 2REXB 4I4TF 5DWDA 5LD2C 3DLBA 2R4TA 3TQSA 4RORA 3PA8A 4A1FA 4LYGA 4XVUA 3F2IA 3CEMA 2BKXA 4C4ZA 1KU6A 3JVIA 3PIIA 2QKYA 4AY6A 3RS3A 3M6IA 4LHXA 4A1OA 4FGWA 4CLXA 1Y80A 2WJJA 3FJYA 4TUYB 2O2ZA 4XYEA 5K3FB 3NBFA 4O63O 4EB0A 3HVRA 1TGVA 3FYCA 5LB2A 1MQAA 3U49A 3QFSA 1MDFA 1LSUA 4NL4H 3U9LA 3Q7SA 1GVNB 3R09A 3K70B 1MO6A 1A76A 1C50A 1QVZA 3JZDA 5IVDA 2WEKA 2VCEA 4FS8A 4GI3A 5JSFA 1DDGA 2DR0A 1M8KA 4UM8B 1SWVA 4PYKA 1MHPA 2Z2KA 4MW5A 4BNWA 4PY2A 4JC0A 1NASA 2PKXA 4HUTA 3FFAA 2HWKA 4ZVTA 1GPH1 4TOIA 1CPYA 3EXIA 3G7NA 3O2SB 3PFNA 1RJWA 3PEUA 5TPWA 3S2UA 4CQMD 2P35A 5L40A 2OA0A 3DEZA 5EKXA 3I1JA 3JQAD 4JELA 4HBGA 1ZGJA 5HIMA 3IEXA 4C7MA 4UZSA 5HFNA 3OQNA 3VZQA 3C39A 1HDZA 4HF7A 1WD7A 4RK1A 3ENWA 1L9XA 1A9TA 2QZPA 2X22A 2X58A 3CW2A 3LA6A 2H1IA 3BDIA 3MD0A 1P2SA 2FDRA 2Q5JA 5AKKA 3VMFA 3G8BA 1AO0A 1XV5A 2BSQA 3AB7A 4MA0A 5FR1A 3NJRA 3RABA 5BV8A 4TKMA 1SCAA 1M0TA 1HDEA 4GL2A 3GPIA 5C2JB 3D0OA 1Y3DE 1UJ6A 1VPLA 4D0SA 2ZCVA 1E3SA 3E7WA 2P69A 1K2VN 3D7MA 4U2CA 3LWZA 4P0TA 3ID6C 2AOUB 4GOKA 1Y1PA 4H0NA 3V2UA 3PC3A 4IDBA 4JLBA 3VPXA 3H3XA 3UUWA 2Y0DA 3A4YA 2PRYA 2DC1A 2IYTA 5A3JA 4EW2A 1KZYC 1TYAE 2Z8XA 1IIBA 4NE2A 5ED4A 4IH4A 2WF8A 3UT5A 4XQEA 1LFDB 5J2TF 2VSNA 4QUBA 5G0WA 3W8DA 5BR1A 3WB2A 1UL1X 5EUCA 5IAJA 1NJFA 4B6SA 3N8NA 2E4VA 3HUTA 3K09C 1DC5A 5CIQA 4UPDA 1NBOA 3EZNA 2ATVA 2CXOA 1RAAA 2BSAA 1JHZA 3F2VA 3ASUA 1F6DA 3A2NA 4LWZA 3UFBA 5TVGA 4BGIA 4BJHB 5AVUA 3ZGXA 1WETA 2V74B 3LXRA 4INJA 4LHYA 5E6SA 5K6AA 4WJLA 3ANYB 4LDQA 1DVRA 1ZCFA 3A06A 4EY5A 4GI7A 2IEGA 2YJ3A 3TD2A 4IIVA 1E0AA 2YWHA 4HATA 2OQIA 5BQFA 2AMYA 3VH1A 2OSVA 1VIYA 1J90A 3W5HA 4Q4AA 1WXHA 4DLZA 3MT9A 3Q1LA 3C41J 5FO0A 4YRSA 4HRXA 4D3DA 3SU8A 3O8CA 3U80A 3P97A 5K3OA 1WXGA 1U1FA 2WIKA 1LRJA 2XQJA 1XKQA 2B5WA 3UGTA 4BMNA 3KKEA 2JJQA 4ALIA 3BA1A 3L8YA 4WT7A 4DBVO 2E55A 3RADC 5JNUA 4FE4A 2EV9A 2JIDA 1L2TA 3MJDA 2ZS8A 2CXNA 2IEDA 1P44A 4YAOA 1SC9A 4TMFA 4RGVA 1NRJB 3TMYA 4HH4A 3LY7A 3RU2A 2QR2A 4MB6A 2YHSA 1ZI8A 4IRXA 4LBYA 1HLDA 1R7RA 3ILXA 4ZAXA 5AM2A 4PZUA 2YHUA 5F52A 3S4YA 3IRVA 1DU4A 3AUSA 4OXIA 2CUTA 3F7MA 3SQXA 1JVSA 4N5IX 2FN8A 4OQNA 1FX0B 2OKGA 3AO0B 3VJKA 4RDHA 3WL7A 1Q16A 2QX7A 3EXAA 3CCBA 4RIHA 1LA2A 2X4GA 4C5AA 3NG1A 1ZGZA 3DV2A 3TZ6A 2IYLD 1KH1A 2ZYIA 1BKSB 4QOIA 5LU8A 3UXHA 1QR6A 1GN9A 4WMLA 5D3MA 5DM1A 4ZI3A 1JKFA 3ODGA 4FJ0A 1Z15A 3KQQA 3TTUA 4N76A 4XM2A 1HNNA 5JATA 4S2UA 5TMEA 2AWOA 2LDBA 3CLSD 3T7EA 4ZZ0A 4RZUA 3IP3A 3BD7A 4YO7A 2NG1A 2FR8A 4I4IA 1A50B 4A8PA 2PT9A 3HZZA 5ALIA 5ADHA 2YH2A 1S3SA 2HLDA 4INOA 4GOLD 2C7BA 1OHHD 3KWFA 3GRCA 3QU2A 1MRZA 3KB8A 4QULA 1EUDB 3T7IA 1UPXA 3PUIA 3OZSA 3VYVA 1NYTA 3FTNA 4G1CA 4Q1EA 3PD7A 4NY1A 2GZRA 3DGEC 5ARCA 5A4JA 1S4QA 2ZSJA 1JFSA 1XK6A 3MN1A 1KC3A 2QLBA 1VRCA 2AMFA 1F3LA 2H5JA 3AHEA 5TQVA 1UR5A 3ZE7A 1P1KA 3DFMA 5AXBA 1G7TA 3EQ2A 3GRPA 2VWHA 4IOKA 3LUPA 1G5RA 2VCYA 4QAQA 1C80A 3PVSA 3UWDA 3IUBA 1MORA 3FNIA 4WA8A 3SYLA 4CEJA 4HXEB 4N3GA 2BFEA 5TMBA 1A96A 2AQ8A 2O6LA 4LJ7A 4B81A 1QC5B 3BQ9A 3LF2A 1KFEB 2W6OA 4CZ2A 2GCIA 5DX1A 2ZRHA 3KVYA 4WBSA 1THGA 3CEJA 4QUDA 4O4LB 3PEEA 3TL2A 3LT4A 5DX0A 4MCHA 6GPBA 3ORSA 3HXOA 1KMMA 4K6FA 1LUAA 3LO8A 4Q18A 2QTCA 4P31A 3KWMA 3Q8WA 3PU6A 5CFRA 3UK6A 5IT5A 2ZTHA 3HYCA 2JH3A 2C8JA 3WGIA 1YA6A 1QNFA 3SBXA 3ZZNA 3VR5D 3HUFA 3DFZA 3RYFB 2FWRA 2QENA 4Z0TA 1N5JA 3KZNA 4JOQA 1PZNA 2G70A 3PP8A 4I5DA 1J8VA 2O7RA 2AOVA 2ZAYA 4U39A 4V0NA 2DT5A 4UXJA 5H5JA 2NU9B 2R00A 3H2KA 4N8EA 2BFAA 1ECJA 1WQ4A 5HMLA 1F0PA 1XTJA 2CMHA 3DMDA 3FBWA 3K6JA 5DHSA 2PR2A 4YCNA 4IMPA 1BA2A 2C4VA 3ITEA 3QMMA 4JSTA 1ZLXA 3I0ZA 1UDRA 3EHEA 4H60A 1DUIA 1ZESA 2RDMA 2Z9BA 3BRWD 3GCZA 4MVJH 3WMRA 5BN5A 3O8QA 4ZK6A 3PSHA 4Z5XA 4GGMX 4PFQA 2QJFA 1VDZA 3COJA 3HP1A 1B8PA 1EEHA 4IOJA 3UGKA 3HVKA 4Q9LA 1NQUA 3V97A 4F4JA 1KP3A 1E3LA 2DPMA 2NO4A 2ZYUX 2PS1A 1JI0A 2EF0A 4IVRA 4JKIA 4Q1BA 2Z56A 4GFDA 2I6XA 1W96A 3U4CA 3PWKA 1YDWA 4WEQA 1IHUA 3UMSA 5JNLA 3FTEA 1O95C 1UK8A 3A14A 3AIOA 3EY4A 1OTHA 5C8YB 2VRBA 3OM0A 1EJ2A 3TNFA 4QSMA 1KI6A 2CDAA 1SUSA 2WAOA 4MUGA 4Q1CA 4PLTA 1L5GB 3CNQS 3TXAA 4MOWA 2B4YA 2HD4A 3NI2A 5KNCH 2H57A 1THZA 3UK2A 1C0PA 3K0FB 2J87A 3M1YA 3WGTA 1JSZA 3FCXA 1V9SA 3RYIB 3E2IA 4AFNA 3TTYA 2YX1A 5CCXA 1MA0A 5IYZF 5KUTA 1N1GA 5CTJA 1T0HB 4KGXA 4L6AA 3R76A 4YJGA 4OHPA 3BMOB 5M5BA 5C53B 1JFLA 1O5OA 2H4WA 4E5SA 4PGMA 2JD0A 3ACDA 3BBLA 4EYOA 1FTYA 2C2HA 2VKQA 2NAPA 4PG5A 3BGWA 4ARIA 1UKVY 1VQ1A 2MSCB 3HG7A 4CKBB 2OFXA 1ULZA 3MNFA 2D3TA 5JYBA 1C7ZA 1PQYA 2WU4A 3NGMA 3JARA 4KDCA 3T6KA 1JH9A 4Z4GA 2AEJA 4UASA 10MHA 3SC3A 4Z4IA 1Y1SA 4UM7A 3T3GA 1Z29A 3KYCA 5J2UF 4A7PA 4KZPA 5H68A 1E1QD 3CW8X 4E7PA 2EU8A 2OV8A 3KKQA 4B9AA 5AKYA 3UW3A 2R1UA 3LY9A 3B7WA 1NNUA 5ECGC 3IE1A 5IJ0A 2E5WA 1VBMA 3PNYA 4FEEA 1VA5A 4AZWA 2WAXA 2OLEA 3L82B 2FXVA 4IKOA 2IZ1A 2PIAA 3JX9A 4LV6A 1B93A 3MWEB 1XJWA 4YI3A 1ADJA 1PT6A 4AUEA 3CVVA 3DFKA 4A8JA 1JZSA 4RPIA 2I0FA 1SOMA 2ZUFA 2Q5LA 4CRWB 3U7QB 4M49A 2GXSA 5CMLA 2IUYA 1C1XB 1L3CA 2PXCA 3I28A 5CH8A 1EWTA 1UOOA 3PFCA 4IG9A 2YV1A 2ST1A 2FQQA 3OD1A 3PKIA 2F64A 3D43A 5ELLA 4IHKA 2L42A 3TW6A 4BQOA 5JH7A 2PX3A 4JP8A 1XOIA 3KQYA 3D4IA 1VKHA 5JS6A 1L7VC 4M8SA 1KZ1A 5FADA 2O23A 1EWKA 4HGQA 3WYNA 4ARUA 4TZKA 2A92A 2HDHA 3ADKA 3MWLA 3GLIA 1WS6A 4V3BA 1QFYA 2EEPA 3A27A 1K6MA 1LGYA 1D2EA 4HXYA 4ZU1X 3V1LA 4C0BA 4HAOA 2H63A 4CIWA 2CXPA 1V16B 3JQBA 3L4JA 1RU3A 3EEFA 1SBCA 5I4CA 1A9SA 1TW3A 3HNRA 4JU8A 3V8MA 4GI5A 3SZLA 3F3KA 1TZKA 2W83A 4DT1A 1RMQA 1DKLA 1RPJA 2VPZA 1NTOA 4HDCA 4RF2A 3WZLA 1JG4A 2XUKA 4BO3A 4CLRB 5IANA 5A05A 4JHLA 3NATA 1YJ8A 2P77A 3AKZA 2P1RA 5FB3A 3QZUA 4CN9A 2VAPA 4OIMA 2WTXA 4KO4S 4NV3A 4P9NA 4W9NA 4HPJB 2NVUB 4LJKA 3ADBA 1G8JA 4F96A 1BX3A 1CX9B 1QHYA 1X7ZA 1KZ7B 5C8YF 3OCCA 4HTAA 4D99A 4JV5B 5AVRA 5GZ3A 5LMCA 4Y1FA 3HCWA 3PUVA 2I33A 4BNIA 2QAGB 5KTYA 2IXDA 3B3AA 4KWIA 5JCOA 1EWRA 3T5BA 1T5SA 5JZOA 1EQAA 1AQIA 1G2QA 1W9HA 3H5IA 3H5AA 3CONA 3N3BC 3HBJA 4CFSA 1F12A 3EIEA 1W36B 1X8XA 4V24A 4R2JA 4WNAA 3HRKA 1Z38A 4FOOA 5CX4A 2R7KA 5DV9A 4ESEA 3ZEAA 4GDFA 3CZ5A 3LKBA 3ONNA 3RT7A 2I2WA 4RFVA 1P5RA 2BGTA 3TLZA 1XGKA 5KDLA 1II0A 5BUQA 2YFKA 4Q03A 5L3QB 1EFKA 4V2UA 1HSOA 1TJNA 3DJYA 4MQUA 3GL9A 4J07A 4E31A 3GDOA 4UD6A 3PJDA 2AW5A 1MAWA 2VJDA 4MRSA 5TT1A 2O2HA 3L43A 4NOMA 3RWOA 1ZQ1A 3TR6A 2AG5A 1RCTE 2CNWD 2LP4Y 2VAVA 3TQIA 4MQLA 3U9SA 1KIMA 3DDOA 4M87A 4YREA 4IIEA 2J4CA 4GWKA 3Q5DA 5HQJA 3WYDA 1RXWA 3ETHA 1SB9A 2GERA 4ZREA 4FB5A 4K86A 3PLNA 1ZJZA 2DU8A 4LJRA 3OESA 3KOYA 4MROA 2FPIB 3VYTB 1IN7A 3KUKA 2XNSA 4WD3A 2FXIA 1JXAA 1CIVA 1CG6A 2BZ0A 3IVAA 3JVDA 5GY7A 2FZKA 5IAKA 1JX6A 2BFFB 2NP6A 2PKYX 3OI7A 4KK3A 4PEVA 3SNHA 2YIJA 3O3CA 3TOVA 5H4GA 1C1DA 2FKNA 3PDWA 3THSA 4HNTA 3GP8A 1V5IA 2CYAA 2Q46A 3GNSA 2VJBA 3MS7A 2QRJA 4TT3D 4M22A 4F12A 2WQZA 5IJ9A 2PS3A 2PUDA 1A9XA 4WA7A 3M6WA 1IUOA 3RRMA 4OBWA 3ZY6A 1HUQA 1VHJA 1VPEA 3NEPX 3UHPA 4JBWA 3I2IA 4A0RA 5HTKA 1LXCA 1GQFA 2J5XA 2WFLB 3H83A 1NSYA 4AS2A 1CZLA 3KYDA 1EUCA 1SHUX 2I6GA 4K28A 4DYHA 4RENA 4MVJP 4Z9YA 4Y0AA 3RVOA 2QAJA 4JJ8A 4WNIA 5JSUA 4N41A 2HQBA 1ISGA 1WCYA 3FUTA 4WLUA 4HN4B 4MEAA 3PQ8A 1MOSA 1G291 4J1TA 1ZSVA 3WMXA 3OIUA 1JEDA 4YCMA 3D54D 5HKAA 1F14A 4ND8A 1DC4A 2DY0A 3KT3A 4GBJA 4JB2A 3AVPA 2XYPA 4N65A 3RVDA 3WXMA 5TDHA 2VXCA 4L95C 2CBZA 1Z7GA 4B35A 1VJ1A 2PLWA 2Q6OA 5H82A 2RHTA 1MAHA 2W93A 2CEKA 1AGRA 1EVJA 3V3TA 821PA 5LNK1 4ILEA 2HIGA 4KXNA 3PBKA 5A4IS 1ZBQA 3OU6A 2G77B 2WA1A 1AMNA 3RU9A 1V0JA 3U4QA 1QRTA 3C5CA 3DVLA 3QWHA 1NVDA 4Z49A 1QO7A 3R6DA 2PSDA 2PKQO 2C9BA 3B1YA 3G6WA 3R5JA 5FI3A 3STHA 4YAIA 1MIOA 3T9AA 1WW2A 4QPDA 3T34A 4IIBA 2V7QD 4MARA 5LKAA 1V8DA 1U7XA 1X87A 3UMJA 2WTAA 1SVLA 3OZAA 5JAQA 5C4GB 2HF8A 1CQZA 4WK6A 4IIHA 2UUBB 5EVCA 4GPEA 2C2GA 1RRVA 2KLHA 1KBZA 4TWIA 1PK9A 1XXHA 1FLDA 1RP1A 2I7CA 2YOGA 1J06A 1O7JA 1NSFA 4RQTA 4ZVKA 4DAEA 5HP4A 4HS9A 1NJ5A 1SUCA 2PZAA 3R44A 2IXBA 4EAQA 3I52A 1AGNA 4X84A 1ZSYA 2FWPA 4EJSA 1ZC3A 3AXTA 4B3BA 3FZNA 1PJ3A 1QZXA 2EBFX 4CIBA 1SBIA 4HNUA 4KYIB 2GF9A 2WYOA 5A3SA 3ABQB 1QAQA 3V7YA 3UCFA 2PQ6A 1IJFA 3O4JA 1R4MB 3CMCO 1PJ4A 2R62A 4HK4A 3NYQA 2IVZA 5C5DA 3BC1A 4CM8B 5B1IA 2X13A 4LZPA 4V0RA 5I7AA 4MULA 5I8PA 4E15A 2PAAA 2AN3A 1YNOA 2ZJ8A 2O2EA 5CVVA 5B37A 2CT8A 4HTFB 1C0KA 1QQ6A 2PZ8A 1K1EA 2R3SA 4FGZA 4MVJG 4NMXB 2N1BA 3OBBA 3VZRA 3V6LA 1NY6A 1PDOA 1A27A 3CLHA 1KJ9A 3PRJA 2E4AA 3V3KA 4F7DA 3MAAC 4U63A 3FDIA 3RJ9A 4LDNA 1HDGO 4ZVNA 4DILA 3G0HA 1ZHHA 1HRDA 3GROA 3LF1A 1KAHA 1J97A 2IHUA 1VJRA 3ZK7A 3NYWA 4HLDA 4NBKA 4QARA 4IO1A 4JHXA 1L4NA 1XD2B 2ALJA 4Q1AA 1VBFA 3UQYS 2VCHA 5GIOE 1H3EA 1EFHA 1Z0ZA 3ENZA 1EUQA 1E2EA 1X1EA 4RGQA 1K5HA 4YYZA 1IXYA 3MHPA 2P9FA 2PRKA 2YWFA 1O1YA 1SEPA 1XN1A 4F5YA 1BU8A 3S7TA 3U5ZB 2QLFA 1RPNA 1LBQA 4FR2A 3SHWA 1T0JB 3VMMA 3B9QA 3FVWA 1NZJA 4WKGA 1RZVA 3TSAA 1T34A 3ASZA 5EHGA 2ABWA 1Y8RA 1YZUA 1WEKA 1J22A 1OA0A 3HRIA 3ZDQA 5KPDA 3LIIA 2BFFA 1WNFA 4WZBB 1ZH8A 2FSHA 4WKBA 4XASA 1Q0RA 2B7LA 4OGWA 5AVYA 4H1VA 3DYIA 1QRAA 3N0WA 2O19A 1BVUA 4Q66C 1UM9A 5CTAA 4YLGA 2AA3A 3P9ZA 4UJ3A 2FYTA 3BMNA 2DG2A 1QS0A 2C9MA 4JI6B 4D9BA 5FTKA 3ZV6A 1PJBA 1NLUA 5AKIA 1NXQA 3I9JA 4MA5A 4P5PA 4LHSA 3LDHA 3P9IA 1IUKA 3RKRA 3S7ZA 5CBKA 2ID7A 2ODPA 1AMUA 1P73A 3HGTA 5FCDA 3U3MA 5AKLA 1RI5A 1ZMRA 4GQIA 2VHJA 4RF4A 5I5EA 3FWPA 3O8OA 3DOFA 1HZZA 4TLEA 1GVHA 1H22A 3EODA 1YFLA 1LX6A 4RNDB 3IQIX 2IX9A 1QJ4A 2WJZB 2J41A 1J1UA 2XUDA 1EFAA 3BTSA 4CMKA 3OQPA 4LDRA 3FTQA 2BGNA 3RD5A 2NVWA 3T8YA 3QYJA 4LBZA 3WLRA 4UFPA 4GR4A 2GSWA 4RVDA 2EG9A 3SQLA 3SQOA 1DX4A 1MEOA 2ZBRA 4JP5A 4PZ9A 5JHGB 2F1JA 2O07A 3HC7A 2X9NA 2DWOA 2YHIB 2WWTA 2YXLA 2FEOA 3WK4A 5BR8B 1N3LA 1C3EA 3AZOA 3H2SA 3WSTA 2NUPB 3H2BA 4KQHA 1BW9B 1NGSA 2PEYA 2P75A 3B9PA 4B7XA 3GEEA 4MDYA 3GNTA 3EC1A 1FP4A 3CRMA 1TIKA 3LPLA 3UXMA 3VTFA 3WR5A 1R18A 3GHHA 2ZJOA 3TE6A 4BVJA 3WWDA 3GBVA 3IUSA 4AQDA 4KLZA 2ICAA 5EP4A 4L3OA 2AJCA 3PFKA 5JD4A 3GW8A 2Q1YA 4ZV4A 2PKWA 1YMVA 2OBMA 1OH5A 2R6FA 2DKOA 5EGNA 5U1PA 4AJKA 4B3FX 2CUNA 4ER0A 1NU8A 2VS1A 3WMWA 2VHZA 3SR0A 2YZGA 2KB0A 2IIBA 1QIJA 1CVIA 4GVPA 4HS4A 3V8PA 4DUPA 3K9QO 2BI7A 1KH2A 3VPGA 4D0GA 2ZRIA 2WU3A 2J67A 2Q6LA 3WBJA 4LJAA 5K8UA 3G8YA 5KKCA 3KDSE 1SUAA 1N5KA 5FUYA 1YR6A 4LDJA 3QIVA 1HG0A 1ZWLA 2I6UA 4Q3CA 4M21A 4TLBA 4UTVA 3ETEA 3OIFA 2JGAA 1I51A 3MTDA 4NE7A 4E5VA 5J3JA 2Z8YM 5KWEA 2YMPA 2Q2OA 2FWNA 1WB6A 4J7UA 1QANA 5C1PA 4YPVA 3DO8A 4R31A 4IS2A 5B55A 1CNEA 4GQAA 1NHGA 1Q11A 4TRJA 4EG8A 1C4KA 2VKTA 3EVZA 3N5CA 5FUVA 1AZTA 4OQPA 4W5RA 1G2OA 3USZA 5CYOA 3IQGX 1I6LA 1L8XA 2GBIA 1DT3A 3HBNA 3OP4A 5IKOA 3RS7A 2JI8A 4IM7A 3WADA 2SECE 4C22A 4E5MA 2NLOA 1G5HA 2XYRA 1ABEA 4HLUC 1ZNWA 5JARA 4A8JB 4YCAA 3QSYA 1D04A 3GFBA 2WHQA 1CETA 3LCMA 5HEKA 1U7ZA 4QDZA 1O95D 3GRUA 4P82A 2I8AA 4K6MA 4NNJA 5ECYA 1XFDA 2IYSA 1W87A 2MSKA 2P2ZA 5FWAA 5FP0A 2ZRLA 1NLMA 1O57A 3IL2A 1LDEA 4PZ0A 4C0XA 4J6EA 1P0PA 2WKPA 4DHEA 2ENWA 1JHUA 4ZEOA 2QEQA 5A3VA 3A31A 4UKDA 4D5EA 2IDMA 2JD1A 2C2OA 3BAFA 3GEPA 1IHPA 4CN8A 1C3OA 1RXEA 1BSVA 1U0SY 3DOJA 3DR5A 1M2FA 2NZUG 3HJBA 5TQ2B 3ZBTA 1DCMA 4HD8A 4JB8A 2QMYA 3GFOA 3W8FA 4MP8A 4AN1A 5CA1F 1K5PA 1JA0A 4RSMA 1FY2A 2QU7A 4MAFA 3P26A 4Y6PA 3K70C 3ZHVA 5TEWA 3NMUF 3ZDCA 4B3SB 2IHYA 1SHJA 3WAKA 4NOKA 2HLNA 4QBGB 2TECE 4N6OA 1M34B 3EVGA 4RHYA 5AK5A 4FSDA 5AM0A 4ZVOA 1YQQA 4ES6A 4PIPA 4YCJA 1SQ0A 1H2EA 1CK4A 4B82A 2QZ4A 3VO2A 3L8FA 1T1JA 1DQZA 1U80A 1OWLA 2OV1A 4JVLA 4MYTA 4QGHA 3VX4A 2V5AA 4DR5B 3MF4A 5HXAA 3BIFA 3LWNA 1L7BA 3OJXA 1V11B 2V3WA 5DIFA 4CETA 3THWA 2Q8NA 1GL9B 3QFRA 1G1AA 2XYQA 4WERA 4XDGA 5D3QA 4AY4A 1HM5A 1KO7A 1F6WA 4LQLA 4DANA 3BMCB 3HJCA 4RU1A 2RAFA 4ZOBA 5ER9A 2C04A 3E7DA 3HDVA 3PXXA 1NJSA 2O5EA 5JZMA 3BCSA 3IAM1 4OX9Y 4L28A 1P1BA 4C6SA 4UOQA 4BNJA 4DGQA 2DUMA 5FLKA 4BKUA 4LOAA 4I1RA 4W9NC 5BSEA 4G0NA 3EGDB 5DCYA 4XH9B 4X92A 5ITWA 1AS2A 2HK9A 4IGIA 2FPGB 4LJ4A 3L7BA 2JJ8A 4X1IB 4LVOA 3QKSB 1NRWA 1I9GA 2XRMA 1SOAA 3K1TA 1F2DA 1ZVKA 1GHTA 3N2KB 4H6WA 4HWKA 1GGVA 4RLHA 1D2NA 5THXA 3HE3A 4MIYA 3EGIA 4BIIA 3IAAA 1PW5A 1Y7HA 1SXJD 2E21A 3L5KA 4EKGA 1GO2A 2VDKB 2J5KA 2BGKA 5IULC 3F8SA 1BMFA 3KALA 2F1HA 4J8PA 1H6AA 5JHHB 2PUFA 4BNNA 1G3IA 4U7TB 1XKTA 2AJ8A 2XLCA 2YUTA 3K8OE 3CF6R 2I4NA 2XH8A 4G8JA 5KNDD 1U0LA 4P32A 5AVXA 4R8KA 2FX3A 3M6LA 4TXHA 4XJSA 4OK3A 4R6XA 3GLGA 3TVTA 4ON9A 3LNTA 1SC1A 4F60A 3A8TA 2ORWA 5EY5B 2OCDA 1DRVA 1WPXA 3QHAA 4QJIA 3ACCA 4OX9B 3M5PA 4NX2A 1ISJA 5IPFA 1G7CA 5FEMA 5KB3A 2LD4A 2QN7A 3EZYA 3K0BA 3O21A 2NX2A 2VJMB 5GONB 1JPVA 5COQA 1HORA 4Z4QA 4JASB 1USIA 1ULHA 4PLPA 4RTPA 3S1LA 3HKCB 1NNSA 2G71A 4PIMA 2I29A 2WIDA 3WKAA 3HJUA 4YRTA 3OP1A 1U2SA 1K6JA 2BMEA 3DDSA 4P86A 4BLUA 4LEIA 5D7NA 3OU2A 2UZ4A 1VGRA 4IWXA 1NJ1A 4RV9A 3SVLA 5KNDH 1AE1A 4BFZA 2B94A 4UNNA 3EA0A 1TT7A 1ONOA 3BWCA 3EPKA 4F3RA 1ZCJA 2O2YA 4MWTA 4WXHA 5ALNA 2GO7A 4C20A 1U2EA 1IJKA 3QOXA 5AHWA 2VOEA 3LDUA 4Q19A 4EPVA 5FYDA 4KWTA 4FXOA 3G85A 1HKHA 2GAIA 3PUXA 4XR9A 4EPXA 2DERA 1M1NB 1WCXA 1GTVA 1YE3A 1N32B 3W2IA 3R3ZA 4X6LA 4KKVA 3DZIA 4XWWA 3AEUA 4LI0A 4B9EA 1BH2A 5C8DA 3INYA 2FA9A 2GCNA 1FDIA 3G9TA 5AH0A 5DFAA 1I3LA 3LCVB 5LBIA 3OMLA 1XROA 3RUFA 2F3PA 1HG1A 1Y9ZA 4PHGA 4CIAA 4V0ME 4JI1B 3HQ4O 1GKIA 5M29A 5I8WA 2ZSAA 3LD9A 5CEEA 4L9AA 3JASA 4U2GA 2ZS9A 3GRVA 1K97A 2KLBA 1QFMA 3MTBA 4KTVE 1PGOA 3D8BA 3RK1A 4F6CA 1GNSA 3B3JA 5KS2A 2GN1A 4MI9A 4BJ6A 4F9EA 3HXQA 2HQSA 4YV2A 3L04A 4BNFA 2ID9A 1MMFB 3BE8A 3FHOA 2BGUA 2VSXA 2DT8A 1I6KA 5KNBH 2V6MA 4LTMA 1PV4A 4UDOA 4AG6A 2HEGA 1XMJA 4V38A 4EG4A 4CODB 1QX4A 3BF7A 2QUAA 4O5AA 1XL0A 1GA6A 4C7XA 2WWYA 2Q9UA 4QYMA 3TOXA 1BN6A 4D8WA 2WU1A 3F6SA 3H9JA 3RIMA 2OENG 4S0ZA 1ZIDA 2BEJA 2R8EA 1NF8A 2QTAA 2WMYA 2EFHB 3QU9A 4C7OB 4AZ3B 2HIMA 1N2BA 5AJYA 1MV5A 4Q3EA 2WIBA 1CNFA 1IOZA 1Q3TA 1TQ2A 2C5AA 4GMHA 4N7MA 4P3OA 5E7MA 4ZI5A 4DM7A 4DRXA 1J24A 1S8NA 4KLAA 1E4YA 2D2EA 2VJOA 7GPBA 2KWIA 5EE3A 2ZIWB 1HA3A 2OOSA 1DINA 4Z4HA 4UUBA 4YIKA 3CWCA 3QWAA 5JLJA 2DE0X 3EY9A 4LJSA 1I0LA 1U5BB 3EEYA 2ZB7A 1NP3A 1Q44A 2J9RA 1X7DA 3Q11A 2BLLA 4DLVA 5KDOA 3EGXA 5JS7A 3W06A 1YS1X 3SZ3A 3MJTA 1UCFA 1PEYA 4AWBA 3FXAA 5DGHA 1H05A 4D3XA 3PS9A 3NIDB 2G1KA 4JT9A 4Y9DA 4C4SA 2DMRA 5COBA 1KMHA 3MMZA 3B36A 4UHKA 3TL6A 1NMZA 4DY6A 2C9DA 5G1OA 5FI1B 2NGRA 3P1JA 4IF4A 2VOJA 4X6YA 4DG8A 4PXSA 5KJFA 2R6CA 3RVPA 4E2YA 2GRJA 2WYUA 4OQYA 4IINA 4TRRA 4L6IA 3W2GA 2IKQA 1UMBB 2RONA 3P9CA 1D1PA 5T3UA 4CG3A 2XOKA 3PXDA 2ZIUB 3Q72A 2HV8A 4BQPA 3BILA 1D5CA 1TJ5A 4TTTS 1T26A 4RD2A 3WIUA 1ZIPA 3IQHX 3A9CA 1E1MA 3NVAA 2ZXUA 1D2MA 2GTIA 2P11A 5KVVA 4PR0A 2C7VA 4ZCQA 4BV8A 3WY9A 3IALA 1PZXA 1K92A 5M04A 3OFSA 4IWYA 1CUWA 2Q50A 4LGVA 4TV8B 4E3ZA 1FNCA 2H07A 2BMAA 5CCDA 1RAFA 3AB3A 3L7MA 4ZJUA 3GJXC 3IQXA 3UV7A 1D0VA 5JCJD 4Z7JA 1OLSB 3QX3A 3WLQA 3OPMA 1USVA 3A1NA 3U4GA 4ESOA 1HFEL 2CF5A 1WY5A 2DM6A 1E1CB 5HIKA 4PHTA 5TPWB 2KM1A 3K6SA 3T3HA 2BIFA 4KPUB 4UUPA 3VR1A 3GEGA 1FK8A 3EYWA 5KQMA 3ZJ4A 3UJ6A 3T35A 1MFPA 4IXNA 3ZYZA 1F2UB 4QREA 1S1CA 1PFVA 4JLAA 3L0BA 2QV7A 5AVTA 5CYGA 4JMLA 4RUKA 2XMPA 1U7PA 4R9RA 4HZUB 3BG5A 3VSCA 2A9PA 2JGLA 3EOZA 3U61B 2J9FB 3EB9A 5DBIA 2IUSA 4KXLA 1ND5A 2WI8A 3FJ1A 3OZUA 3E9ZA 1JT2A 4KN6A 4YJFA 2P30A 4C7KA 1ML4A 1WE2A 2WG0A 2F2TA 4RY0A 1IXKA 3E9NA 3LBYA 4OKIA 4GH5A 4UTXA 1C7RA 1TM1E 2HJRA 1UBEA 2XGSA 4JC5A 4BL5A 1E9RA 1JEOA 1U7DA 2P2LA 4Z3DA 4D43A 4RDCA 1PVDA 4HQRA 1I4EB 1LPMA 1QGED 3IR5A 5ENZA 3H0EA 3OHPA 1M2VB 3R9KA 4AY3A 3H3JA 2JIPA 1R6BX 1ZGBA 1GCAA 3M81A 1Y4UA 1HQDA 2BFCB 3K9LA 4HNSA 4C7JA 5JECA 3RB8A 2ZCJA 4DM4A 4MW6A 4YJFB 1QIHA 2I1WA 3C3EA 1JG7A 3VDXA 2R6JA 2DCMA 2QZ9A 4HZUA 3R9IA 1MX3A 2I66A 3VBEA 5IH7A 4KIWA 1EB9A 4MR8A 2A59A 4FFDA 2ZIEA 3Q40A 3AL0C 5EERA 3NVKI 3QLUC 1INLA 1I36A 5CLGA 4RTJA 2ZSUA 1BJKA 1J8MF 4OAPA 1SHTX 2WG1A 4KXUA 1HEYA 4AMBA 2BH2A 3K5HA 4N49A 1KGDA 1NRIA 4V1CB 1E20A 1EK2A 1P4GA 4YFYA 4ZO7A 1OLSA 3K9NA 4UVGA 3LGXA 1YZLA 4U2DA 4XYMA 2H08A 3WFZA 4TZTA 3RGWS 1CUBA 4YECA 1YQXA 3ZK9A 5B36A 5I7OA 4X3CA 5BRNA 1SU4A 1ONBA 3GGSA 3IEPA 4S0XA 5TT0A 3E6AA 4TVOA 4A82A 2GCOB 4F9GA 3PT5A 3UM9A 2C2WA 2PKRA 2J7PD 1T15A 2TMDA 3V4VB 4KQ2A 3LVBA 4HUQA 4FXPA 5AT1A 4RJTA 5AKZA 5JDCA 1XP8A 1M3SA 4B8ZA 2WYIA 1YTUA 4OG2A 4QM6A 3F4BA 3DVRX 4TV9B 2GZAA 3DT9A 1FTGA 1ZIOA 3IC5A 3IR6A 1UBCA 3GJQA 2JVKA 3AR6A 5E1OA 3VYWA 2CE7A 1RTTA 2HK8A 4H4EA 1X1QA 1X14A 1XHEA 1U31A 4IP0A 5BPFA 5LQKA 4DQKA 3P9YA 5CFPA 3H8VA 1I0ZA 4QQNA 5ALHA 4PXYA 4RVOA 5KEIA 1W7AA 5KSWB 2GWRA 1O94D 1S3FA 1H4SA 2R7MA 5A6SA 3JQDA 4MVYA 2DKNA 2ZRFA 3OCYA 2AFRA 1N0VC 4GRIA 4JQSA 4P5DA 3P27A 3MQ2A 2RBKA 1FBTA 4RZIA 4DDVA 4GKAA 1G7SA 1U8UA 2F9LA 3R3UA 4IDAA 4EEKA 2XE4A 5A02A 5JC1A 3IIEA 2MT9A 3RSCA 1Y7IA 4EQ6A 4IDCA 1ETHA 3WC4A 4OYHA 3WIOA 3LQKA 1P1IA 3F9CA 4WOCA 4WCFC 3HFRA 1BDBA 4QUEA 3N8KA 4BTVA 3IJPA 3T5DA 2QSZA 2C4WA 4LKOA 2P78A 3X1KA 3L6RA 4KN9S 1HWYA 1CDOA 1SCDA 1GGJA 2QM8A 3TQTA 2RD2A 1GTRA 3BL8A 1TMGE 1K5GA 3H3FA 1ZNZA 4AZ3A 3PKJA 2GI4A 4PW0A 4YJ2A 1EJ0A 5DE3A 4O3FA 2AKEA 4TZ0A 2JLZA 4A5SA 2M32A 4U5QA 4C6HA 2WU8A 4TRNA 3GLHB 3RTAA 4UTRA 1KPIA 3CXRA 3PC8C 2FHPA 3D4PA 4JFRA 2EBHX 2JASA 4NULA 4E14A 1QHGA 4OUDA 1LS6A 3QBEA 3SJUA 1Z16A 2YYYA 3DKPA 2QD3A 1XRRA 4H7DA 3X1JA 5HF6A 4E13A 3HYSA 4F11A 4Z7OB 5KHAA 3QQPA 2G5TA 4NABA 2H16A 1DE0A 2JC3A 2NUTB 2VFAA 3G7UA 3LH5A 3F6CA 3WE7A 3F6BX 4CF6A 4F5DA 4I5EA 2B5OA 4LTNA 1ZA1A 4TMVA 3NW9A 2A9KA 4NBUA 4OP1A 4XUEA 1IQUA 1XYYA 1QRUA 3WQQA 1TM7E 2Q45A 3L6DA 1X1BA 2QTVB 6REQA 3SJZA 1I6MA 3FOBA 4FHGA 3VRHA 2ZBEA 1NI3A 1OV4A 2BF4A 4A73A 2B4RO 4K40A 3HBAA 4D81A 4F2GA 3LT0A 5EJEA 2IXEA 4AMVA 2I6TA 1F0KA 1I4LD 3S70A 4B43A 3KS9A 5AM4A 1VJTA 4ZIRB 1BDMA 1N0IA 1Q84A 1SUDA 2P2YA 4WK4B 1M1NA 1QVWA 1J56A 1S02A 1A3CA 1Y8QA 1JIKA 5T4EA 1UFRA 4C76A 1YRQA 1MOPA 3M9WA 4AY5A 2FG6C 3OD5A 3KQWA 1UJ2A 4HDRA 5B58T 4UM5A 1IVSA 3KSZO 1USWA 4OM8A 1AKQA 4RYDA 3UWPA 1ZUD1 2C9YA 2H2DA 3CC8A 4JLOA 5H59A 3W5VA 3WLLA 4BB5A 4EJ2A 3QFHA 3T3NA 1Y81A 1IPHA 3DD5A 3JALB 5A0VA 2QTRA 2DB3A 3DL4A 2BLNA 3OOSA 4DYDA 1GNTA 2JARA 1NR7A 1SKQA 1DV1A 3ZWXA 1U04A 2GILA 4BO5A 5JSHA 5IKXA 2OVFA 2RHJA 3M4NA 1Z4MA 4BEJA 3L0SA 1NN1A 1PJAA 4MW4A 3K8ZA 2PMDA 3O1LA 2FRDC 4ICIA 4XFJA 3NHRA 1LLDA 1YJCA 4FDLA 1EQ2A 5LQDA 2Q99A 4BRWA 3HXKA 3I01M 4V1CI 5LDDC 5NLLA 1ZS9A 3BXXA 3R1IA 4I5GA 2LTAA 1CUIA 4UHCA 2FUCA 4ASUD 2A9QA 3HLYA 3IURA 3BXOA 1P0QA 1QJCA 1VPDA 2VP3A 3BDAA 4HX9A 4XD7A 4CQLA 5GM2A 4Q3BA 4QBHA 5LXTA 3KR0A 2J8ZA 2PTGA 5E3IA 3W78A 3AIMA 3MIZA 3NEAA 1WV1A 3T5TA 4AJPA 2AOXA 4AM8A 3AVWA 2DBYA 1K89A 5ITZA 4X6UA 4MV6A 2HBRA 4CW7A 3B9BA 3SKXA 1W0CA 2YDXA 4I1UA 5EWLA 5LZ8A 3TQQA 2OVBA 2QUKA 3UB3A 2ZI4A 1V9CA 3G23A 1KY5A 1RLIA 1NVFA 2NXEA 3OE5A 3IHKA 4G0YA 2OBBA 2H1RA 4NEHB 4OB6A 5GAJA 3OQVA 4BNGA 1JI3A 1WL8A 1E9VA 2QSUA 7REQA 3CE6A 1FPMA 3JTEA 5IU6A 4HT3B 4JLUA 2P6PA 3IOEA 5DXFA 3L1KA 2VBFA 5K0LA 3S6JA 3KR1A 5F35A 2RJNA 1K75A 1K8QA 4P33A 1R6AA 2CNKA 2Q9AA 1G19A 1V5FA 2YASA 3EZGA 5D00A 3TLXA 4F38A 4R0NA 3B48A 3QUAA 4X1IA 4OREX 5EXDA 1SC3A 1TTHA 3TTTA 1UPFA 2X6TA 4NZZA 2WWFA 4NESA 4C3ZA 3UA3A 1CZRA 1EB8A 3C6XA 4LMPA 4UJ5A 4DIKA 4B8YA 3GT7A 3FYSA 2HJGA 1CR4A 3H4VA 3LFUA 3UCXA 4MSUA 4OB8A 4W63A 1CUVA 2YC4C 4IEIA 3T94A 1F6BA 3T3EA 5KVCA 5M7EA 2II6A 3FBGA 4EFKA 4WN3A 5ALZA 4V0SA 3DFFA 2W4MA 4C29A 5B3JA 2ZZKA 4F85A 4KSCA 3U6BA 3R7BA 2UZ1B 5K6TA 1N9GA 1OLOA 3CEPB 5H70A 3I83A 5IUJC 2K2WA 2W90A 3M33A 1T6XA 4ZQIA 3SYRA 3BCHA 1MEEA 3G5UA 3O93A 2IWRA 1BHSA 3PGVA 1XZLA 2SCUB 4FEYA 5FFFA 3FW1A 3AEKB 1KI4A 3V7UA 2RGBA 3KVNA 2G7MC