2K6XA

Autoregulation of a group 1 bacterial sigma factor involves the formation of a region 1.1- induced compacted structure
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
GSHMPQIERRIKKLISLGKKKGYITYEDIDKAFPPDFEGFDTNLIERIHEELEKHGINIVENEPEEEEISAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor rpoD
publication title Autoregulation of a Group 1 Bacterial Sigma Factor Involves the Formation of a Region 1.1 - Induced Compacted Structure
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.120 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 2k6xA00
4KN7X 4KN4X 4JK1X 4KMUX 2K6XA
chains in the Genus database with same CATH superfamily
1R4AE 1MCXA 3L8NA 3USWA 3BRXA 1SAVA 4KN7X 3TW5A 1W3WA 4JXHA 4JMOA 2Q4CA 1YCNA 4Q2SA 4FHRB 1HVFA 3ABSA 2R09A 1KU1A 1HVDA 1N00A 2ZOCA 2HSNA 1ANNA 1C1KA 1N44A 1N41A 4JK1X 1AXNA 1BCYA 2QEZA 3ANYA 1BC3A 1RE0B 2RANA 1YIIA 1HM6A 2XO3A 3SWVA 2H0LA 1XT0B 1ANXA 1BCZA 3USYA 2ZHIA 2VXGA 2HYVA 1R8QE 4A4PA 4MDVA 2K6XA 1LKVX 2H0MA 3AJCA 1AVRA 1AVHA 1XJLA 2IE7A 1YGMA 3ABQA 1HAKA 3HJLA 1ANWA 3AO0A 3LTLA 1AVCA 2II2A 4EVFA 1DK5A 4D7QA 3ABOA 1HVEA 4C7PA 1S9DE 2IICA 1ALAA 2XO2A 1W45A 2ZHJA 4L5MA 4Z21A 2H0KA 2IE6A 1M9IA 4C0AA 1BC9A 1HVGA 4JWLA 4D7RA 4KN4X 1AOWA 2HYWA 2HYUA 3SOHB 1A8BA 4KMUX 4FQ0C 1BCWA 1BC1A 1DM5A 3ABRA 1W7BA 1AEIA 1I4AA 1XSZA 1PBVA 1AIIA 1BC0A 1QC7A 1UPTB 4JMIA 4HREA 1R8ME 2OY9A 1A8AA 1YJ0A 4EVHA 1Q8DA 1BO9A 4OIYA 1R8SE 4X9PA 2R0DA 1N42A 1G5NA 4MDUA
chains in the Genus database with same CATH topology
3HJLA 1XT0B 3L8NA 3LTLA 4KMUX 4FQ0C 4D7QA 3USWA 3USYA 4C7PA 4KN7X 1S9DE 3TW5A 1R8QE 4JXHA 4A4PA 2K6XA 4JMOA 1LKVX 1XSZA 4FHRB 1PBVA 4L5MA 4Z21A 2R09A 1KU1A 3AJCA 1QC7A 4C0AA 2HSNA 4JMIA 1BC9A 1R8ME 4JWLA 4D7RA 4KN4X 4JK1X 1Q8DA 4OIYA 1R8SE 2R0DA 1RE0B 3SOHB 3SWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 X;  4KN4 X;  4JK1 X;  4KMU X;  2K6X A; 
#chains in the Genus database with same CATH topology
 1R4A E;  1MCX A;  3L8N A;  3USW A;  3BRX A;  1SAV A;  4KN7 X;  3TW5 A;  1W3W A;  4JXH A;  4JMO A;  2Q4C A;  1YCN A;  4Q2S A;  4FHR B;  1HVF A;  3ABS A;  2R09 A;  1KU1 A;  1HVD A;  1N00 A;  2ZOC A;  2HSN A;  1ANN A;  1C1K A;  1N44 A;  1N41 A;  4JK1 X;  1AXN A;  1BCY A;  2QEZ A;  3ANY A;  1BC3 A;  1RE0 B;  2RAN A;  1YII A;  1HM6 A;  2XO3 A;  3SWV A;  2H0L A;  1XT0 B;  1ANX A;  1BCZ A;  3USY A;  2ZHI A;  2VXG A;  2HYV A;  1R8Q E;  4A4P A;  4MDV A;  2K6X A;  1LKV X;  2H0M A;  3AJC A;  1AVR A;  1AVH A;  1XJL A;  2IE7 A;  1YGM A;  3ABQ A;  1HAK A;  3HJL A;  1ANW A;  3AO0 A;  3LTL A;  1AVC A;  2II2 A;  4EVF A;  1DK5 A;  4D7Q A;  3ABO A;  1HVE A;  4C7P A;  1S9D E;  2IIC A;  1ALA A;  2XO2 A;  1W45 A;  2ZHJ A;  4L5M A;  4Z21 A;  2H0K A;  2IE6 A;  1M9I A;  4C0A A;  1BC9 A;  1HVG A;  4JWL A;  4D7R A;  4KN4 X;  1AOW A;  2HYW A;  2HYU A;  3SOH B;  1A8B A;  4KMU X;  4FQ0 C;  1BCW A;  1BC1 A;  1DM5 A;  3ABR A;  1W7B A;  1AEI A;  1I4A A;  1XSZ A;  1PBV A;  1AII A;  1BC0 A;  1QC7 A;  1UPT B;  4JMI A;  4HRE A;  1R8M E;  2OY9 A;  1A8A A;  1YJ0 A;  4EVH A;  1Q8D A;  1BO9 A;  4OIY A;  1R8S E;  4X9P A;  2R0D A;  1N42 A;  1G5N A;  4MDU A; 
#chains in the Genus database with same CATH homology
 3HJL A;  1XT0 B;  3L8N A;  3LTL A;  4KMU X;  4FQ0 C;  4D7Q A;  3USW A;  3USY A;  4C7P A;  4KN7 X;  1S9D E;  3TW5 A;  1R8Q E;  4JXH A;  4A4P A;  2K6X A;  4JMO A;  1LKV X;  1XSZ A;  4FHR B;  1PBV A;  4L5M A;  4Z21 A;  2R09 A;  1KU1 A;  3AJC A;  1QC7 A;  4C0A A;  2HSN A;  4JMI A;  1BC9 A;  1R8M E;  4JWL A;  4D7R A;  4KN4 X;  4JK1 X;  1Q8D A;  4OIY A;  1R8S E;  2R0D A;  1RE0 B;  3SOH B;  3SWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...