2K75A

Solution nmr structure of the ob domain of ta0387 from thermoplasma acidophilum. northeast structural genomics consortium target tar80b.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
106
structure length
106
Chain Sequence
SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Ta0387
publication title Solution NMR structure of the OB domain of Ta0387 from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum
molecule tags Dna binding protein
total genus 12
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k75A01
3RZDH 4B3TL 4JBMA 1NMGA 4JI1L 3S24A 2VQEQ 2QA4A 3W1BA 4AQYQ 1HZ9A 1X65A 1XPOA 4PG3A 3IRBA 2WP8J 4QL5A 2NN6G 1N34Q 1VQBA 5M5XH 5AJ3L 3J81c 4PZ6A 4QGUA 2JA5G 3HOZG 2HIXA 1LUZA 4DV7L 1EYGA 2LSSA 3CC4A 2UXCL 3TS2A 3BZKA 2F52A 4R4IA 4P73A 2VUMG 4JYAQ 4A3JH 4DV0L 2V1CC 3KYHC 1K8GA 3TEHB 2JE6I 3AEVA 3KLWA 4NXNL 1K0RA 5IE8A 3VDYA 4DR4L 4GS3A 5C0XG 3PCOB 4JI4Q 2QEXA 4A3JG 4BBSH 3Q8DA 2BA1A 3A74A 3CCEA 1SN8A 1IL2A 3L0OA 4X66Q 1K73C 4OWWB 2I5HA 2I5MX 3PO2G 1AE3A 5JEAJ 4X64Q 1P16A 4R4TA 3NELA 3CMEA 2UUAL 4GN5A 4MZ9A 1U0LA 4B3ML 2RF4A 1N33Q 3PUYA 4UPAA 4BA2I 1JE5A 3GTJH 1BVSA 5JJLA 5M3FG 1X3GA 1IBLQ 3CW2C 3GTLH 2KHIA 3PF4A 4BXXH 4UP8A 3K81C 1W2BA 4JBJA 1OXXK 2KENA 2VW9A 2WB1E 4LF8L 4P75A 3CMAA 3F8TA 3W1GA 3OTOL 4LNQA 3PV0A 5IY0A 2L15A 4DV4Q 1FJGQ 4LW1A 3JAMi 3FKIH 5C3EG 3OYYA 4O0AA 1RL2A 4DV2Q 3HOUH 5FLMH 3A5ZB 3EBEA 4H02A 1SRUA 1XNQQ 3S1NH 5IWAL 1L0WA 4JI8Q 4JI2L 4DV1L 5IYCH 1E24A 2A8VA 4YY3Q 1NTGA 2UUBQ 5FLMG 1HNWL 4BBRH 3W5OA 1Y14B 2D62A 4A3BH 4AH6A 1TWHH 4JI6L 5IYCG 1CUKA 4YHHL 1PYBA 3I55A 4LF5Q 4IPCA 3M3YH 4HJAA 1A63A 4O2DA 3UDXA 4JI3Q 4BBRG 3K7UC 3CCVA 1PH4A 4YWLA 1IBKQ 4EQ5A 4A3BG 1VQJA 1HR0L 2CQOA 1X3EA 2NVTH 1TWGH 2C35B 2ES2A 4JI0Q 4LF6Q 4GN3B 2CWPA 2H5XA 4R4CA 3A0JA 4P72A 5GADC 3CPWA 2E5LQ 2B3GA 3I2ZA 1K9MC 1KL9A 3PIOA 4R1JA 4DK3C 4LF4Q 2WAQE 2YTYA 2R92H 2YYZA 4IFDJ 2KCTA 2ZM6L 2UUCQ 2ID0A 3KF6B 4NXMQ 3U50C 3S1QH 1BBWA 4A3CG 1A0IA 1IBMQ 1V9PA 3PO2H 3HOZH 4WJ4A 1B7YB 5IYBH 1PH7A 4JI7Q 3NENA 2VQFQ 3CCSA 4A3MG 3M7NA 2R7DA 4KI0A 3ZJYC 2R92G 1N36Q 2F4VL 5ELNA 3KJOA 1VQ5A 1S3OA 4LFCL 1XMOL 4EX5A 1CKMA 5C0XI 4HJ5A 1MIUA 3STBD 5BR8L 2AWOA 3J80i 3CF5A 5IYBG 1YJ9A 1AE2A 3BZCA 4JBKA 2AWNA 2CFMA 3L2PA 2GVBA 4DR3Q 5FLXc 1X54A 1I3QH 3U4VA 4LF7L 3H15A 3WWVA 1PH3A 4GKKQ 5M3MH 3T1YL 1XNRQ 1PH6A 4RG1A 2VL6A 1QZHA 3GDEA 2A1AA 1PH9A 4DR5L 1YHQA 2PNHA 1XMQL 1NJIC 5K36G 1I94L 4YCWA 3S14H 3T1HQ 1HZBA 1UE7A 1I5FA 4IOCA 1JJGA 2VQEL 1SE8A 2MQHA 3LGJA 2ZJQA 2YTXA 2Z6KA 3KJPA 1X55A 4AQYL 4QIWE 1VQ8A 4DNIA 2ZTDA 4X65Q 4PMWA 4LFAL 3J81i 1LYLA 2B63H 1TWFH 1PHJA 4P71A 2AHOB 2ALYB 2RHSB 1VQCA 1M90C 3PO3H 3AFQA 3ULLA 1K3RA 3F2CA 4GKJQ 4L5TA 3JC66 4JC0A 1B8AA 1Q82C 4YCUA 1G6PA 4YWMA 1IYJB 4DV3Q 1C7YA 4B3RL 2B63G 4PZ7A 4JI1Q 1VQMA 1CSPA 2JK8A 3CQZH 1JJ2A 3ER0A 1N32Q 4X6AH 4A4IA 3TREA 5AJ3Q 1HNZL 1YJWA 2Z0SA 4R4OA 5LMNQ 4DV3L 3K0XA 4DV7Q 1HJPA 2UU9L 1ASYA 3ICEA 4QJFA 1HZAA 5IP9H 2OCEA 1YVCA 2JA7H 1KAWA 3MXNB 2HQLA 3I56A 4GLXA 2XTIA 4BBSG 1KC8C 5M5YH 3CCLA 1KRTA 1SFOH 4DUYQ 2B29A 3EN2A 1D7QA 2A19A 4AYBG 5IP9G 3J7A5 1WI5A 2K75A 4KHZA 5FJ8H 4JI5L 4HIMA 3D31A 3FP9A 4NXNQ 1QVCA 2JA7G 1PH2A 1VQLA 4DR4Q 1BKBA 5GAGC 1X3FA 1PVOA 1E22A 3ULPA 3GTQH 3K8AA 1BBUA 1Y1VH 4DV6L 2PMZE 2HHHL 4DUZL 4GLAC 3GTMH 3F1ZA 3L7ZC 4GOPA 1E1OA 1RIPA 3S15H 4BXXG 2UUAQ 1XPRA 1EOVA 2BH2A 1WOCA 1VQ4A 4HJ9A 4Y7NH 4KHPL 4B3MQ 4K0KL 4HIOA 1VQOA 4TVAB 1X56A 2EXDA 4C2MH 5LMUL 4DR6L 4QY7A 1TWAH 1TWCH 2JEBI 3M9BA 5LMNW 1C0AA 1SLJA 2YV5A 4X62L 3FKIG 1UE5A 1OXSC 4ALPA 2JA8H 2NVQH 4WJ3M 2DGYA 1YBYA 1FL0A 5E7NA 4AIMA 5C4JH 1Q46A 4DR1L 4GOPB 4LF8Q 3F2DA 4A93H 1O7IA 5C4XH 1T9HA 3OTOQ 2Z6KC 1J5EL 1KHIA 1C9OA 1VQ7A 3S2HH 2QGQA 2WFWA 4UP9A 4LF5L 4LUZA 3OW2A 1M1KC 2JA8G 4Y52H 4DR7L 3HKSA 4TQUS 3JAMc 3G48A 3KF6A 4DV5L 4A3IH 2JJQA 3FHWA 5IWAQ 2VNUD 4XIGS 4DV1Q 1YI2A 4B3SL 5C4XG 1JB7A 4OX9L 4DR2L 5J3BA 1TXYA 1VCIA 1WCMH 3K7AH 3PUXA 4IPDA 4DAYB 4A3KH 4BA1I 1Q81C 2I0QA 4JI0L 3GTOH 1KIXA 1HNWQ 2UXBL 4A3IG 2VS1A 2ZJPA 2IHEA 1HNXL 3S16H 1YHBA 5GAEC 3CC2A 1LM0A 2E5LL 3GTGH 4A3GH 1Q1BA 2PI2E 1YIJA 4JI6Q 4LF9L 4YHHQ 1FGUA 2I5LX 4A3KG 1WCMG 2R7ZG 1JJCB 2UXDL 5HGQA 1XPUA 4LUOA 1NY4A 5EAYA 5JEAG 4J15A 4A3GG 1B70B 1NMFA 4IJHA 1SR3A 3KOJA 3GD7A 1HR0Q 2JQOA 4DK6C 3CCJA 2HIVA 3EIVA 1VQKA 1QVGA 5JJIA 1EIFA 3A5UA 2E2HH 1EFWA 2ATWA 4OWTB 4RMFA 1UEBA 1PFSA 2R93H 1OXVA 1VQNA 1JT8A 3U4ZA 2ZTCA 1Q8KA 2KCMA 4BY1H 2ZM6Q 1J6QA 3ERSX 2EIFA 5C44H 2LXJA 2PQAA 1OTCA 4C3IH 1VQFA 3HOXH 5M5WH 1IXRA 1X9NA 1G51A 4A3EH 2Y0SE 2JA6G 3HOYH 3NEMA 1NE3A 2NZHA 2N78A 1K8AC 1Q7YC 3RLOA 4GOPC 3I7FA 3RNUA 1A62A 1QUQA 2F4VQ 1A8VA 4BY1G 1VQPA 1VQ9A 5M3MG 3KDFA 3HKZG 1N9WA 5C44G 1XMOQ 4LFCQ 3GTPH 4OXPA 2K5VA 3PUWA 4LFBQ 3HOXG 4IOAA 1Q1EA 3M4QA 3H0GH 4A3EG 1DGSA 3HOYG 3BU2A 3M85A 3G6EA 3HOWH 4HIKA 2E2JH 4OO1I 1VS0A 1KRSA 1N34L 4MTNA 2PQAB 3T1YQ 1VQGA 1S40A 2IX1A 2D0PA 1XJVA 2JA6H 4DPGA 1PA6A 3F2BA 4P74A 4GNXA 3H0GG 4A3FH 3TRZA 3G4SA 3HOVH 3U58A 4A75A 3HOWG 4DR5Q 1VQ6A 1QUQB 2Q2IA 1I94Q 2MFIA 3KDFB 2K5HA 3PF5A 4B3TQ 4JYAL 2VZAA 2JA5H 3TQYA 4XTCS 4BY7H 2K5NA 2OTJA 2ZTEA 2K4KA 3D0FA 4A3FG 3HOVG 3J7ZC 4LFAQ 1N32L 3B6YA 1S72A 2EQSA 4MNOA 1E7ZA 3CP0A 2PI2A 1L1OB 2MNAA 4JI4L 2VY3A 2VUMH 5LMNL 1FVIA 1VQEA 1MJEA 4GNXB 4BY7G 2NVXH 2UXCQ 2HT1A 2LXKA 4X66L 2AKWB 1EQRA 4IFDG 3UDIA 1K83H 3CCQA 3RN5A 4B3RQ 4X64L 3CCMA 1Z9FA 4IO9A 1SROA 1NBWA 4DV0Q 1N33L 4AYBE 4JOIC 4DUYL 2OTLA 2R7FA 3AFPA 2IY5B 1QZGA 1IBLL 2XGTA 3AYHB 4HIDA 4UY8C 4KLKA 4A76A 3RN2A 1HNZQ 3I4MH 2CKZB 1UWVA 1Q86C 2BA0A 4LWCA 2UU9Q 3UE0A 3GTKH 3H3VH 4OO1G 1PYSB 3S1RH 1YHAA 5FJ8G 2YU9H 4UP7A 5M3FH 1PV4A 1OXUA 2K14A 3E9IA 1VQAA 1FJGL 4L5SA 4DV4L 3I4MG 3PIPA 4L5QA 4POGA 3SGIA 4APVA 4DV2L 1Y1VG 2JA9A 1WYDA 1Y1WH 3STBC 4DKAC 1XNQL 3NBHB 1CKNA 4C3HH 2K52A 4IJLA 4IPHA 5H1SE 1PH5A 4JI5Q 2FXQA 4JI8L 2K50A 1CKOA 1X6OA 3MEFA 2Q2HA 4HJ7A 4YY3L 5C3EH 3TS0A 1E1TA 4DV6Q 2UUBL 1CSQA 1V1QA 5DLQE 1Y1WG 4DUZQ 3E9HA 2HHHQ 2MO0A 3AQQA 1EWIA 2E2IH 2WB1G 3BJUA 1MKHA 3CPFA 2RCNA 1YITA 4LF6L 3CXCA 2DUDA 1PH8A 4KHPQ 3I4NH 4K0KQ 2IT1A 1D8LA 5IYDH 5HY6A 4JI3L 4C3JH 2RHQB 1CKNB 4ME3A 1IBKL 5JJKA 1GM5A 2OQ0A 1L1OC 5LMUQ 4DR6Q 3CCUA 3PSIA 4JI2Q 4A93G 4GN4B 4GNXC 2IX0A 4JV5L 3M4PA 4X62Q 4R4QA 2R7ZH 5IT9c 3M4OH 4YWKA 3I4NG 3HFZB 5IYDG 1YJNA 2IHFA 1GO3E 4DR1Q 1H95A 1L2FA 1Z47A 2D0OA 4NPSA 1PH1A 1VQDA 1R9TH 1KXLA 4LUVA 1J5EQ 3RZOH 3PGZA 5GQOA 4LF4L 4JBWA 4JOIA 2NVYH 2OQKA 1UE6A 2CWAA 2N8NA 4OONA 3CCRA 4DV5Q 2UUCL 2KBNA 1MJCA 4NXML 4PZ8A 5IP7H 1IBML 4POFA 1KD1C 1SMXA 1G291 2AMCB 3KF8B 1E3PA 4B3SQ 2GN5A 1YEZA 4JI7L 2VQFL 2BH8A 4OX9Q 3I4OA 4DR2Q 2N3SA 1N36L 1UE1A 3GO5A 4JV5Q 3RLNA 3UE1A 4JG2A 1ASZA 2MO1A 3HOUG 5C0XJ 1GD7A 1Q12A 4JCVE 3G71A 4A3CH 2UXBQ 1HNXQ 5IP7G 4IPGA 1V43A 3DM3A 3RLFA 4HJ8A 2NN6I 3J81j 3CD6A 4FDBA 4LF9Q 1LTLA 4DR3L 4A3MH 1VQHA 2Q2UA 1P8LA 2JEAI 1AH9A 1YNXA 2UXDQ 1WJJA 2WAQG 2Q2TA 4DR7Q 1GVPA 4GKKL 5GAHC 4IFDI 1XNRL 1IZ6A 1I50H 3S2DH 2ZJRA 1KQSA 4OWXB 2R93G 4A3DH 4NB3A 4L5RC 1GKHA 1EUJA 1HZCA 3PUZA 3HKZE 3RR5A 1U5KA 2NZOA 4QQBX 4A3LH 2E8GA 2OWOA 2R6GA 3T1HL 1VQIA 3KFUA 3S17H 2GVAA 3DLLA 3UDGA 1XTDA 2KHJA 5BR8Q 3CC7A 4LFBL 3E0EA 3ULJA 3UDFA 4A3DG 1OXTA 3J80c 4X65L 4LF7Q 3CAMA 5ELOA 1W3SA 3PO3G 2N49A 1EQQA 2CCZA 3K80C 1EIYB 3S1MH 4A3LG 1L1OA 3PUVA 1HH2P 5GROA 1HR0W 4DAMA 2F3IA 1QVFA 4GKJL 2ASBA 4YCVA 4GLVB 1XMQQ 2YTVA 1YZ6A 1N8RC 3H3VI 2Y0SG 1I6HH 1WFQA 1JMCA
chains in the Genus database with same CATH superfamily
4JBMA 4DAPA 2VQEQ 2EVBA 1QCBD 4C1NK 5M5XH 1PLFA 1KNEA 1LUZA 1VF5C 2UXCL 1DJRD 4CDFC 2BDOA 5KYLA 5DM63 5C0XH 4P73A 2VUMG 5F2DA 2K03A 1RHPA 4J8QA 3QIAA 4NXNL 1K0RA 3L9AX 4DR4L 4GS3A 2B2WA 3PCOB 2SDFA 1C48A 1H9RA 1K73C 2Z1CA 3TBIB 2KVMA 4X64Q 3AB9A 3S1QB 3FRPB 3PUYA 5CORA 3HOZB 1B9NA 5M3FG 1X3GA 1IBLQ 1L0XB 3CW2C 3Q6SA 2KHIA 2A6EC 2QF7A 1XXGA 4FYDA 4LF8L 3CMAA 1WTRA 5DM73 1NNXA 4K5XA 1AW7A 4DV4Q 4RGTA 2L1BA 4LW1A 5T1IA 1F9PA 3NTHA 3OWFA 5C4HA 4H02A 1SRUA 4JI2L 4DV1L 3FPPA 1HQRD 2B2UC 4YY3Q 3SVMA 5EBDA 5FLMG 1HNWL 4BBRH 1EYDA 4A3BH 4JI6L 2B63B 1TWFB 3I55A 1WTVA 4HJAA 2EYPA 1MBYA 5FO7B 2EXZA 2OEOA 4QCLA 4YWLA 3T56B 1IBKQ 5IT9E 2LKVA 4EQ5A 4LJZC 1SNMA 4LF6Q 2C35B 4GN3B 1KABA 2CWPA 4R4CA 4U68A 1G2TA 1PTOF 5GADC 3VR4A 5JEAH 2PNRC 3R2IA 3J7YW 4LF4Q 1X32A 4KD3A 2YTYA 1LTGD 5CMDA 3E3XA 3I3CA 2K5QA 5A35A 2ZM6L 2ID0A 4ODGA 1JQYD 2B2WC 1BBWA 1IBMQ 1TU2B 2CW0D 3PO2H 4WJ4A 3QWNA 2JA7B 2R7DA 3ZJYC 1NR2A 4FNFA 3HOZG 3J80i 5IYBG 2JA6H 4OEMB 1HUNA 1X54A 5M3MH 3T1YL 1XNRQ 3QJYA 1PTOB 2A5HA 1GXDC 1SDFA 2NTTA 3I4LA 1EWHA 4YCWA 1HZBA 1SNOA 2EY2A 1L0YB 5IODA 2VQEL 4KY5A 2F3VA 1PZKD 4QIWE 4DNIA 2ZTDA 4PMWA 3SXHA 1IHZA 3AFQA 1A2TA 4F8MA 4JC0A 3MHBA 2ZXOA 3BVGA 1XTCD 4EQNA 4GZYC 1IYJB 3S2HB 3MXNA 2B63G 3D6CA 5KEEA 1A3TA 4EQOA 1PRTB 4EGVA 5ELBA 1VMCA 1Q90A 4BS9A 3WOEA 1STNA 5AJ3Q 1YJWA 2Z0SA 1O78A 3K0XA 3DHQA 3UI2A 1HZAA 3MXNB 2KOLA 3I56A 1I4PA 4BBSG 1KC8C 4IQZA 3Q22A 1SFOH 4QMGA 2B29A 1D7QA 2A19A 3J7A5 5HURA 3D4DA 4KHZA 1DD2A 2JA7G 1JOQA 5JPMC 1VQLA 4FF4A 1PTOC 4V0BA 2E2HB 3K8AA 2D9UA 5LL6S 1Y1VH 2PMZE 2L4NA 2HHHL 2MPMA 2LMCB 2R93B 1XYIA 4CBVA 1SYEA 1ENAA 3NP8A 4BXXG 1XPRA 3A8IE 1VQ4A 5C44B 4HJ9A 4K0KL 4HIOA 3K0YA 1VQOA 2XWBB 2R61A 4A3EB 3N52A 3PO3B 4QY7A 1LABA 4X62L 5J39A 4HAEA 3GTPB 1OXSC 2JA8H 2NVQH 2RSOA 2DGYA 4AIMA 5C4JH 1S5DD 4PV1C 3HOWB 4A93H 1KTKA 1O7IA 1EY0A 1I4XA 2QGQA 4LUZA 4I65A 5KIXA 3JAMc 3KF6A 4F87A 4KKUA 3FHWA 5IWAQ 1HCZA 1SXTA 4RGNA 5CV7A 1DM0B 4WFN3 4XDXA 3Q0AA 3K7AH 4LF6L 3HZXA 3GTOH 2XRSD 2ZJPA 1HNXL 3M7GA 1YNJD 3GTGH 2ZXRA 5CV6A 2PI2E 1JB3A 5COYA 3DWQA 1FGUA 2F0EA 1MGSA 5E3FA 1XPUA 2J0TD 3EA6A 5EAYA 3LX0A 1SR3A 3KOJA 2F0DA 3KLRA 3EIVA 3MZ5A 1VQKA 5JJIA 1EFWA 5KNDA 3NE5B 2A6HC 1PFSA 1OXVA 1JT8A 1B53A 3BVZA 1J6QA 4ILWA 3ERSX 1SE2A 1VQFA 2SEBD 2RBMA 3R3OA 3TZDA 3RNUA 1A62A 1QUQA 3S9WA 1A8VA 1QWYA 2MJ8A 5C44G 4LFCQ 3PUWA 2PMZB 4A3EG 1DGSA 1UNSA 4IUPA 3G6EA 1STBA 2E2JH 4OO1I 1VS0A 1N34L 4RA8A 3MTSA 4OGQC 2D0PA 2E2IB 3VR3A 3HOWG 1VQ6A 1QUQB 1I4QA 2B2YA 5EQ0A 5IGFA 1PRTD 4JYAL 2VZAA 1BCPB 1X3QA 2K5NA 1RKNA 4IFDH 2B39A 1S72A 2PI2A 2VUMH 2VY3A 4MHEA 1LTRD 4JVZA 2NVXH 1R9TB 1ENFA 3RN5A 2M2LA 4B3RQ 1GUNA 2NVYB 2NZ1D 1F2ZA 5EPLA 4IO9A 1NBWA 1N33L 2HQEA 2BCOA 2R7FA 3H3VC 2IY5B 1QZGA 1DZ1A 4UY8C 3CRLC 3RN2A 5E4WC 1LTID 3NWSA 1Q86C 1WD0A 3SK8A 5FJ8G 2YU9H 5EKLA 5M3FH 1OXUA 1EEID 1FJGL 3SE0A 4DK1A 3CU7A 3SGIA 4APVA 1I50B 2JA9A 1WYDA 1Y1WH 2JYOA 4KN7C 1FNVA 4DKAC 1QE6A 3I8ZA 2SOBA 4C3HH 5H1SE 2FXQA 2K50A 4HJ7A 3S17B 5DLQE 3E9HA 1DONA 2FFKB 2WB1G 2XNAC 1S5BD 2RCNA 1BCPC 3CXCA 2DUDA 1KLGD 2IT1A 4JI3L 3IFDA 2XRQD 4ME3A 5CBEE 1H9SB 4DR6Q 2JXMB 1I6HB 5CV4A 4J6HA 4G57A 3TP7A 1D5MC 2B2YC 3HFZB 2IHFA 2OXPA 1Z6HA 1WTHA 1KXLA 2WKDA 1ET6A 1PH1A 1VQDA 3JAME 5GQOA 2ZXPA 1HFGA 3GP7A 4DXFA 4JOIA 2OQKA 4DR7Q 4NXML 1MJCA 2AUJD 2EPBA 3C46A 3RD4A 1SMXA 1G291 2AMCB 2GN5A 2PW7A 4OX9Q 4DR2Q 1LT6D 2F0SA 3UE1A 1Q12A 2VB2X 5IGBA 4ME5A 4IPGA 1V43A 5I9PA 3RLFA 1WD1A 2NN6I 2A74C 1LTLA 2JN4A 2E75C 4OL7A 2Q2TA 1SYBA 5GAHC 1IZ6A 3S2DH 2ZJRA 3A55A 1JE4A 4A3DH 3NTKA 3K5MA 4KK7A 4K2LA 1EEFD 3RR5A 4MIUA 2BE5C 2E8GA 3T16A 3T1HL 2PW5A 2K5DA 2F0UA 2WV6D 3DLLA 3GTJB 3HG9A 2EYMA 2KHJA 3CC7A 3UDFA 3GTLB 3ITPA 5ELOA 1W3SA 4XQQA 3MC0B 1ESFA 3D8GA 5IIFA 4DNTB 4IURA 1RJTA 2F3IA 4GKJL 4DV3L 2F0KA 2Q8IB 3S24A 1IKMA 2NBFA 3S1NB 3W1BA 3OMCA 5C3WA 1HZ9A 2CH4W 4AQYQ 4C1NI 2WP8J 4QL5A 4PZ6A 2HIXA 1JWSD 2NB0A 1EYGA 3SHLA 4NP5A 1DCZA 4MTKA 1GHKA 1UUPA 3BZKA 4R4IA 2A69D 4A3JH 4B08A 3CKIB 3KBGA 5ELEA 1BQQT 3KYHC 1K8GA 3TEHB 3KLWA 2FHTA 3VDYA 2NVTB 2O5IC 4BBSH 4PQXA 2BA1A 2B2VC 1TVXA 3CCEA 1ML0D 1IL2A 3L0OA 4X66Q 2L5TA 1JCKB 1P16A 2UUAL 1STHA 3FDTA 5D3DA 1U0LA 4B3ML 4RGOS 4BA2I 1GUOA 3PF4A 4BXXH 4PNYA 3KK7A 1OXXK 2KENA 1K28A 2EJFC 3F8TA 1K8MA 5JOBA 1GUWA 3PMFA 3D4WA 5C3EG 3OYYA 2KHSA 4DV2Q 1XNQQ 1ILQA 4NKLA 4ZLTF 5IYCH 1HUMA 4RGMA 2A8VA 4C3JG 4XT3B 1Y14B 2D62A 3CRKC 4KKSA 1TWHH 4RFBA 4RKBA 3M3YH 4O1NA 3DEOA 2D2CC 1PH4A 4G7HC 1ZYRD 4HCEA 1D5XC 2IWHA 4CJ2C 3HRZC 2CQOA 1TWGH 4JI0Q 1SMYC 1CHQD 3CQZB 3A0JA 3HEJA 2E5LQ 1KL9A 3PIOA 4FXKC 4R1JA 2WAQE 2R92H 1I4RA 1HTPA 2F03A 2UUCQ 3U50C 1A0IA 4HMIA 4I7ZC 1B7YB 1LTBD 1RD9D 1PH7A 4JI7Q 1W6JA 4RKLA 5J22A 1EIGA 5ELNA 3KJOA 3SEBA 1FGBD 2WKCA 4IUNA 5C0XI 1MIUA 3STBD 2AWOA 4L8JA 3CF5A 4JBKA 1AE2A 3BZCA 5CBAE 3VYSA 3L2PA 1RCVD 3U4VA 3GTQB 1A6XA 2HCCA 3WWVA 4GKKQ 2IW3A 3GTMB 2F4IA 1PH6A 4RG1A 1SJED 5FOBB 3S15B 2B2UA 2A1AA 3LNNA 3VR6A 1I94L 2O5JC 1B1ZA 4V190 1I5FA 2MQHA 3NQIA 1GJXA 4C2MB 2Z6KA 3KJPA 1WTOA 4AQYL 1TWAB 1VQ8A 2OT2A 5DEHA 3TP8A 4LFAL 1LYLA 2IX3A 4ULLA 5E4XA 2RHSB 4DAVA 3GV6A 1M90C 1Q82C 3JC66 2F0OA 1B8AA 5C4XB 2LS01 1BDOA 1STEA 4JI1Q 5K5PA 3HS0C 1HFNA 4EVOA 2F0NA 1JJ2A 4FVMA 4A3KB 4DV7Q 2UU9L 1WTWA 4CJ1B 4BWGB 1U9RA 4A3GB 1BNZA 2OCEA 1AZPA 3QOJA 3F2UA 3J80L 1KAWA 1MSGA 5LHY1 1QNUA 5M5YH 3LWEA 1KRTA 1Y8NB 2Z8LA 5IP9G 5FJ8H 3FP9A 3SK6A 1X3FA 1PVOA 3ULPA 3OHXC 1BBUA 4DV6L 3A7LA 4UDUC 4GLAC 4GOPA 5I2YA 1I3QB 1RIPA 3I91A 3ND9A 1JORA 4IUTA 4BY1B 1WOCA 4Y7NH 4C3IB 3HOXB 2F0JA 3BVMA 4TVAB 5M5WB 1X56A 1CK1A 1STAA 3S14B 1TWCH 5LMNW 4KJOA 4XXEA 2YV5A 3FVQA 4CKBA 4ALPA 4DAYA 4J1MA 1YBYA 1SNPA 3H0GB 3DWAA 4GOPB 1Q46A 1LV9A 2ENBA 2XWJB 1J5EL 3OTOQ 2Z6KC 1VQ7A 4HEDA 4YIJA 3OW2A 5KYIA 4TQUS 3G48A 4DV5L 4N9PA 4A3IH 1LLRD 4A3FB 3HOVB 2EY6A 1FNUA 3MA2B 2VNUD 5JVH3 5C4XG 4KMUC 2ATWA 4R8NA 1WCMH 5D3IB 1Q81C 2I0QA 4DAYB 4JI0L 2R7ZH 4JV5L 2JA5B 3DEPA 3D4RA 1KIXA 2UXBL 2IHEA 3S16H 2E5LL 2EY5A 5DNFA 4YHHQ 3QG1A 2I5LX 4A3KG 2UXDL 5HGQA 1NY4A 1NUCA 4A3GG 2KUMA 2A68C 1HR0Q 3QO2A 4RWSC 4KKTA 4DK6C 3H09A 1EIFA 3A5UA 1IYUA 4L6TB 5CV5A 4OWTB 4JK1C 1VQNA 1LT4D 2ZTCA 3BG3A 1ESRA 1Q8KA 2KCMA 2A6ED 2EIFA 5ELFA 1OTCA 5EKIA 2CH4A 2Y0SE 3HOYH 3NEMA 2F0FA 1SYCA 2N78A 1Q7YC 3RLOA 4DXGA 3I7FA 4GOPC 4CDCC 2F4VQ 3J7AV 4BY1G 1VQPA 1N9WA 1XMOQ 3R93A 3HOXG 3NHHA 1I6VC 1Z7TA 2KA7A 3M85A 2L11A 2MP1A 1QNKA 5FK9C 1DOMA 1EY5A 3VYRA 1KRSA 3R8BA 2XN9C 4O42A 4P74A 1G8ZD 3H0GG 4GNXA 1LT5D 1H9MA 4ZQ3A 4DR5Q 1EYCA 2Q2IA 2MFIA 1HQMC 2K5HA 3E5SA 4DNRB 1T5XD 4BY7H 4A3FG 3D0FA 2K4KA 3HOVG 1D1IA 1EZ6A 2RDHA 1U4RA 3L3OC 2EQSA 2R3ZA 1E7ZA 1L1OB 2OF1A 4GNXB 1SNQA 2N55A 2HT1A 2LXKA 1K83H 5FLXL 4X64L 2K04A 3HOUB 1Z9FA 2J4XA 1S5ED 1EU3A 4AYBE 5IGEA 3D6WA 3D3RA 1GUGA 2RKSA 3NBHA 1IBLL 2XGTA 3AYHB 3I4MH 1HNZQ 4R9WA 2VXWA 1K8OA 3GTKH 5EBCA 1PYSB 5C5LA 3S1RH 1YHAA 1CZWA 4N8X1 2TMPA 2XIWA 4A3MB 2K14A 3I73A 4L5SA 2RQXA 4DV4L 1H9JA 4POGA 4K8JA 4WRDA 5CV8A 1CTMA 5IGCA 1FD7D 3NBHB 1MHWC 2DNEA 2EY1A 4JI5Q 1V1OA 1X3PA 3P75A 1X6OA 4JW0A 1D1KA 4YY3L 5C3EH 3KUPA 1CSQA 1V1QA 1B9MA 3NXWA 4DUZQ 1A3VA 2AUKA 2MO0A 4IALA 4E6IA 3BJUA 2Y0SB 3CPFA 3S1MB 2EYHA 4KHPQ 3I4NH 4LK1C 1J9OA 5A2QE 1D8LA 2K7VA 1PYWD 4C3JH 1IBKL 3I90A 1GM5A 1L1OC 5LMUQ 4G7OC 4QIWB 3K5NA 4GNXC 1II3A 2DJFC 3M4OH 1EY6A 5CR3A 1JICA 5IYDG 1GO3E 4DR1Q 1L2FA 4X3KA 3QOLA 4LF4L 1NR4A 1SNCA 3OPOA 4JBWA 5M5XB 1SE4A 1QG7A 1UE6A 2CWAA 3VYUA 4ZKCB 3CCRA 1DYQA 5IP7H 1IBML 4HSVA 4B3SQ 2BH8A 2ICIA 4DU9A 3HOUG 1ASZA 2MO1A 3G71A 3P20A 4DK0A 3BS1A 4FDBA 4LF9Q 3CD6A 4HCSA 2Q2UA 1AH9A 1YNXA 5D65A 1WJJA 1PTOD 1KNAA 3BDOA 4IFDI 1LTAD 2DY7A 5BN3A 1XNRL 4AYBB 2R93G 4NB3A 1GKHA 3HKZE 1U5KA 2PZWA 4QQBX 1D5ZC 1O7LA 3KFUA 2GVAA 2IPKD 4ZUJA 1OXTA 3PO3G 3CAMA 2CCZA 1EIYB 4A3LG 3K80C 3PUVA 1HR0W 4G7ZC 2ASBA 4GLVB 1XMQQ 1BBXC 2Y0SG 1SYGA 3ND8A 3RZDH 1NMGA 2C9OA 4NDXA 3BYTB 1JWUD 2IL8A 1X65A 1XPOA 2EJMA 3IRBA 5FO8B 1VQBA 5AJ3L 3J81c 4BBRB 3NK9A 1PDQA 2TSSA 1IKLA 4A3BB 2LSSA 1F9SA 4RCNA 1XWEA 1DXMA 4TRDA 2V1CC 2F3WA 3V96A 3HGBA 1CQVA 1STGA 2Q8TA 1U4PA 4CJ0B 5IE8A 5C0XG 3Q24A 4JI4Q 3Q8DA 1MSHA 2A6HD 4OWWB 2I5HA 1PXUA 4R4TA 5TSSA 5HGTA 4GN5A 4MZ9A 3PO2B 2HD3A 2C5CA 3MFGA 1H9SA 1WVLA 5JJLA 1I4GA 3A8JE 4FO2A 4UP8A 5I6WA 3K81C 1W2BA 4JBJA 2JA6B 4NW2A 4UAIA 2EYLA 4IUVA 2O4XA 3P1HA 4OELB 3W1GA 4F88A 3PV0A 2L15A 5M3MB 3MXPA 5FKAC 2NYZD 4K14A 5FLMH 1BOSA 2XVSA 1A2UA 5IWAL 4JI8Q 5CGKA 1PFBA 1SBBB 2UUBQ 4K5WA 1E2VA 4U673 2NTSA 2ICEC 4AH6A 4XQJA 4LF5Q 1ONLA 3EROA 4DGZA 4FF1A 2KJXA 3UDXA 4BBRG 2FMMA 4ZKBB 3CCVA 1TIID 1SYFA 5M9OA 4A3BG 2HDLA 4RHRA 2K01A 3VR2A 3PIO3 2I46A 1SAPA 1X3EA 2B2VA 2FJ2A 3OW7A 3A8KE 1J8IA 2H5XA 4P72A 1O80A 3CPWA 5KGUA 2B3GA 1K9MC 4IFDJ 2KCTA 1DOLA 2L0CA 3LWUA 3S1QH 4CHTB 2K28A 3HOZH 1SJHD 5IYBH 4H0LC 3H94A 3NENA 2VQFQ 3M7NA 3T4AC 5EPJA 1N36Q 1VQ5A 5G3LF 1IW7C 4LFCL 1CKMA 1S5FD 3PO2G 1Q8IA 4DR3Q 2GVBA 1I3QH 1RF2D 1JWMD 3MWYW 3U9OA 3H15A 5IT9L 1Y1VB 2K05A 4IUQA 2GA4B 1QZHA 4LAAA 3NBIA 1UAPA 3MVVA 1PH9A 2E76C 2RDFA 1F2MA 1NJIC 1ENCA 1PZID 3FKIB 1XMQL 2HCIA 3S14H 4I7AA 1BCPD 5C4ZA 4IOCA 1ZEQX 1KAAA 3LGJA 2YTXA 1SNDA 1WTPA 5CYUA 4X65Q 3GV3A 2JA8B 2B63H 2NVQB 1TWFH 1VDZA 4P71A 2ALYB 4XQNA 5C4JB 1VQCA 3F2CA 4A93B 1K3RA 2MGSA 4M1UB 4L5TA 5IGGA 5L37A 4YCUA 1EY7A 1VMPA 3GQBA 4B3RL 4H44C 1ZXTA 4PZ7A 1VQMA 1CSPA 1LTSD 3J81E 3VR5A 1NCVA 1N32Q 1I4HA 3WOFA 3K7AB 5JPNC 3TREA 3GTOB 4NMZA 4R4OA 5LMNQ 2PPBC 3ICEA 3GTGB 1YVCA 2QCPX 2JA7H 2HQLA 4GLXA 2XTIA 3CCLA 4RH6A 5FO9B 4DUYQ 3EN2A 1AZQA 3M4YA 4B9WA 2K75A 4NXNQ 2Z6BA 4DR4Q 3D31A 3K6OA 1BKBA 5GAGC 2MUYA 5BN4A 1YNNC 2CVRA 2BE5D 2F0QA 3FPUB 4CDDC 3L7ZC 2EYFA 1PTOH 1E1OA 5EJWA 2P5ZX 2BH2A 4CDEC 1O7ZA 2QW7A 1TS3A 2G5DA 1AP0A 4DR6L 2JEBI 2KQ3A 1SLJA 3FKIG 1UE5A 1CA5A 5E1FA 4WJ3M 1CM9A 1FL0A 4X3TA 4LF8Q 1G2SA 3F2DA 2E2JB 4FXDA 3TP6A 3S2HH 1C9OA 2WFWA 4UP9A 4LF5L 4Y52H 1M1KC 2JA8G 4DR7L 4OIKA 4XIGS 4DV1Q 1YI2A 1HXYD 4OX9L 4DR2L 1TXYA 1TS2A 4BA1I 1HNWQ 3W2DA 2ZT9C 2K1BA 3SK5A 5GAEC 3CC2A 3V2TA 2JSOA 4JI6Q 2VUMB 1JJCB 2F1MA 2NVXB 4LUOA 1NMFA 4ZK9B 3GD7A 2I07B 3X3MA 2JQOA 3DWPA 3CCJA 2HIVA 2E2HH 3NWTA 2WINB 4RMFA 2R93H 5A2QL 3TDQA 1R4QB 1A3UA 2ZM6Q 1BF4A 5C44H 2YU9B 4UHVA 5M3FB 4A3EH 1STYA 2X6LA 1K8AC 3PO3H 3RMHA 4HTHA 1B50A 1VQ9A 1Y1WB 3KDFA 3GTPH 4OXPA 1LT3D 3E6ZX 2K5VA 3C1FA 4C3HB 2CQAA 4IOAA 4CGYB 3BU2A 3IL8A 3HOWH 5EGTA 1HA5A 4MTNA 3DMUA 3T1YQ 1VQGA 1PA6A 3F2BA 3TRZA 1Y8PB 1XX8A 3U58A 1QOHA 4A75A 4P2CB 3KDFB 4B3TQ 3KBXA 3KLSA 4XTCS 1D6EC 1JOKA 1TR5A 3J7ZC 1B3QA 1N32L 3B6YA 1GUTA 4K2KA 5JAVA 3CP0A 3I70A 1SMYD 5LMNL 1VQEA 4G4KA 3TMEA 1MJEA 1CA6A 4X66L 2AKWB 1EQRA 4IFDG 2EE1A 1BXTA 3UDIA 3CCQA 1ICWA 4TSSA 3CCMA 1S4ZA 4DV0Q 3AMUA 4FXGC 1JC7A 4ZAIA 4DUYL 1F2YA 3AFPA 5IGDA 1RTNA 2K32A 2WAQB 4A76A 3A56A 2M9VA 2CKZB 2AQ1B 2PZTA 2BA0A 4LWCA 3H3VH 3UE0A 4OO1G 2CW0C 4HMJA 3SDZA 2EZVA 2B2TC 2K6AA 4OIJA 3PIPA 5T1GA 4DV2L 3S2DB 1K3BC 1XNQL 4A3DB 1CKNA 1PH5A 2K52A 4IJLA 4DFAA 1CKOA 2Q2HA 2G9HD 1Y1WG 2HHHQ 5KRUA 4H7BA 2E2IH 2B8FA 4C3HG 3CHBD 4KJNA 5CV9A 1PH8A 4K0KQ 5HY6A 2J7ZA 2RHQB 1CKNB 5JJKA 2OQ0A 3CCUA 3PSIA 1TY0A 2A73B 4GN4B 2IX0A 2RCFA 4X62Q 4R4QA 3OOCA 4YWKA 5JJZA 1PFNA 3AU7A 4ZCKA 1H95A 1R9TH 1MD2D 1AN8A 3PGZA 1CHPD 1GOZA 1K0SA 1UEAB 5DAUA 2F0GA 2NVYH 2MHVA 2UUCL 1EZ8A 2N8NA 4OONA 1Q3LA 2KBNA 2PCFB 4JI7L 1JR0D 2JP1A 1YEZA 3MXUA 3K5LA 4IN3A 2NUCA 3Q23A 4A3JB 2LY7A 4QB4A 4KN4C 5C0XJ 1BUVT 4JCVE 4K5VA 1HNXQ 3DM3A 3J81j 5J1ZA 1VQHA 2JEAI 1R4PB 2F0PA 4BBSB 3K59A 2WAQG 1GVPA 1LO5D 4GKKL 5C6AA 1I50H 4S3SA 1KQSA 1ILPA 1AFPA 1EQVA 1HZCA 4K6LA 3T51B 2SNMA 4ZUIA 3S17H 3JAML 3UDGA 1KDAA 3BZDB 4C3IG 5BR8Q 3E0EA 3ULJA 1C4QA 1Y69U 4A3DG 3J80c 3T13A 5CC4A 4LF7Q 3ERQA 2NWGA 3URYA 3TN2A 2N49A 1F9QA 1EQQA 3MFYA 2PZUA 3IAYA 1L1OA 1HH2P 5GROA 1LACA 1PRTF 4KV6A 5EPKA 4KTAA 2O2LD 4XYOA 2YTVA 1YZ6A 3VA7A 1N8RC 2NZOA 1I6HH 1WFQA 1FNWA 4B3TL 4JI1L 2QA4A 3X3NA 5JVG3 4X3UA 3OSOA 4PG3A 3BDCA 2NN6G 2KCCA 1N34Q 4QGUA 2JA5G 4EQPA 4DV7L 1QILA 3RZOB 3CC4A 1TWHB 3DUZA 3MEHA 3M3YB 3TS2A 2V4DA 4QUFA 4K6DA 2F52A 2PQEA 4JYAQ 4DV0L 1YNJC 2D5DA 2JE6I 3AEVA 1TWGB 3DXJC 5ELCA 2A68D 2QEXA 4A3JG 3A74A 1A15A 3FMCA 3EJIA 1SN8A 2R92B 2I5MX 1SYDA 1AE3A 2F0HA 5JEAJ 3NELA 3CMEA 1HTLD 2RF4A 1N33Q 4UPAA 1JE5A 3GTJH 1BVSA 5D14A 2QEJC 1HHVA 1RDPD 2F0VA 2B8GA 2RSNA 4F7XA 3GTLH 2X69A 2DN8A 4K8IA 2VW9A 2WB1E 4P75A 3OTOL 4LNQA 5IY0A 1FJGQ 3JAMi 3FKIH 3BYYB 4O0AA 1RL2A 3J81L 4N9TA 3A5ZB 1KDBA 3EBEA 3S1NH 1E0BA 1CT1D 1L0WA 5IOCA 4HR7B 4HSPA 1E24A 1EIHA 1NTGA 3W5OA 4KHVA 2BDNA 2QKIC 5IYCG 1CUKA 4YHHL 1PYBA 1PRTC 4IPCA 1CFMA 1NSNS 1A63A 4O2DA 4JI3Q 3K7UC 1C8CA 1KDCA 5C3XA 1U4LA 1VQJA 1HR0L 2NVTH 2ES2A 3MXGA 2RVLA 3OIQA 2K33A 4RHSA 3I2ZA 4DK3C 2Z4HA 4RCOA 4FP5D 4RAUC 2YYZA 4NXMQ 3KF6B 4A3CG 1V9PA 1QB5D 3E0JA 3CCSA 4A3MG 4KI0A 2R92G 1TS5A 3SK4A 2F4VL 5M5YB 3KLSX 3QR8A 1S3OA 2Z4IA 2KECA 1XMOL 4EX5A 5I6YA 4HJ5A 5BR8L 4IZ8A 1YJ9A 2AWNA 2CFMA 5FLXc 4LF7L 2WIIB 3A54A 1PH3A 1ICFB 1BCPF 4CKEA 2VL6A 3GDEA 4DR5L 1YHQA 2PNHA 5K36G 2IJ0A 4Y7NB 5ISRA 3T1HQ 1UE7A 3J80E 1M4VA 1JJGA 2ZJQA 1SE8A 1EU4A 2WB1B 1EY9A 1X55A 1TWCB 1GHJA 4PMBA 3J81i 1PHJA 3EQLC 1PZJD 2AHOB 1B3AA 4FF3A 3ULLA 1G6PA 2L55A 4GKJQ 1TKWB 2X6GA 3NQTA 2FMCA 4YWMA 2H1EA 4DV3Q 1C7YA 3MAQA 4MN3A 5I9OA 2JK8A 4A3IB 2KEEA 3CQZH 4H13C 3ER0A 1SEBD 4X6AH 3NPPA 4A4IA 1WCMB 2R7ZB 3G7LA 1HNZL 2HUGA 2RDGA 4C56C 1EQTA 1CQFA 1HJPA 1ASYA 3S16B 4QJFA 1B4OA 2DJGC 5IP9H 1RTOA 2DY8A 4DF7A 4FF2A 3RUZA 4OHJA 3R2TA 4OO1H 2EJGC 4AYBG 3EVQA 1WI5A 3ONAB 5NUCA 4JI5L 5BN5A 4HIMA 1QVCA 1TQOA 1PH2A 1E22A 3GTQH 1FYCA 2AQ3B 4R8IA 4DUZL 4PMCA 3VA5A 3GTMH 3F1ZA 4Q5VA 3S15H 1HPCA 2BOSA 2UUAQ 1EOVA 4HN7A 3HKZB 4KHPL 4B3MQ 3U9SA 3HOYB 1TT2A 2EXDA 4C2MH 5LMUL 2CHBD 1TWAH 3M9BA 3C2PA 1C0AA 1EOTA 2VB3X 1BR9A 1SSOA 4Q0FA 1V8QA 5E7NA 4IUUA 4DR1L 2DNCA 4L63B 2WACA 5C4XH 1T9HA 1KHIA 1EYAA 1S5CD 2EDGA 3IKJA 4DA2A 1G91A 2EOTA 1HA6A 3HKSA 1TY2A 2JJQA 2N88A 1B2TA 5I2XA 4B3SL 1JB7A 5J3BA 3PUXA 1VCIA 1ZKOA 4IPDA 4A3KH 2Z9HA 3A7AB 2L12A 4BY7B 5KNBA 3K5OA 3HP3A 2VS1A 3VYTA 4A3IG 1YHBA 4A3GH 1LM0A 3G6JB 2M00A 1Q1BA 1YIJA 4LF9L 2A69C 1E2WA 1CI3M 1WCMG 2R7ZG 1NAPA 2SNSA 1SE3A 5JEAG 4J15A 1K83B 1B70B 4IJHA 2QDBA 5EKKA 1Y8OB 1SFOB 1PFMA 1QVGA 3NTIA 3DM1A 2QILA 1UEBA 3H91A 1T5EA 4ZRZA 4ABNA 3I4MB 3U4ZA 4Z9CB 4BY1H 3GTKB 2LXJA 1FR3A 2PQAA 3K57A 3S1RB 4C3IH 3HOXH 5M5WH 1IXRA 1X9NA 1F2LA 1G51A 2JA6G 1NE3A 2NZHA 1E2ZA 1EY8A 5LL6X 5M3MG 3HKZG 5FLXE 4LFBQ 1Q1EA 3M4QA 3H0GH 3HOYG 4HIKA 3ZYYX 5C3EB 1G6ZA 2PQAB 4B9XA 1S40A 1IYVA 2IX1A 2F0MA 3FEWX 1XJVA 4DPGA 4A3FH 3G4SA 3HOVH 3P7JA 1EY4A 1I94Q 4ID6A 4KD4A 3I4NB 2NN6H 3PF5A 3WDNA 2JA5H 4C3JB 1H9KA 3TQYA 3TZUA 2OTJA 2L9HA 2F0TA 3T53B 3OMGA 2ZTEA 4LFAQ 1ET9A 2AQ2B 3M4OB 1TS4A 4MNOA 2MNAA 4JI4L 4QUCA 1WTQA 1VF7A 1F9RA 1FVIA 1ZYRC 4BY7G 2UXCQ 4WORA 1JOOA 3IFTA 1SROA 4X3SA 2K5WA 5C5MA 4JOIC 2OTLA 5KNCA 4HIDA 4KLKA 3NUCA 1UWVA 3PIP3 2UU9Q 1IW7D 3O13A 4UP7A 1PV4A 3E9IA 2PO4A 1EWCA 1VQAA 3I4MG 1B44D 2FINB 4L5QA 1Y1VG 1HRJA 3OWEB 3W3AA 4DN4M 3C1EA 3STBC 4KY7A 1CZGA 4IPHA 4JI8L 1DOKA 3MEFA 2KEDA 2G9DA 2LFNA 4M8AA 3TS0A 1E1TA 4DV6Q 2UUBL 2KCNA 3J7AF 1BO0A 2Q8RE 3SR1A 3AQQA 1EWIA 4TKOB 1MKHA 1YITA 2F0WA 3BDLA 3H6MA 5IYDH 1QJOA 1LTTD 4A93G 4JI2Q 3KF8A 1EL0A 3M4PA 3RZDB 1W6KA 1GUSA 5IT9c 1F77A 3I4NG 1YJNA 3V05A 1Z47A 2D0OA 4NPSA 4LUVA 1M8AA 1J5EQ 3RZOH 1PMRA 2F0LA 1RODA 3C3LA 5ELDA 3HOUH 4XT1B 3OIPA 4DV5Q 4PZ8A 4POFA 1KD1C 3EFXD 2EYJA 2QDLA 3KF8B 1IL8A 1AEXA 1E3PA 2PYKA 2VQFL 3I4OA 2N3SA 1N36L 1UE1A 2E2DC 3GO5A 4JV5Q 3RLNA 4JG2A 3NSWA 1GD7A 2UXBQ 2B2TA 4A3CH 5IP7G 4HJ8A 2E74C 1V1PA 4DR3L 4A3MH 1P8LA 2UXDQ 1U4MA 4N8FA 3QB3A 1KLUD 1YNND 1O7YA 3K58A 1EFID 4OWXB 4WJWA 4L5RC 2XSCA 3PUZA 1EUJA 2RA4A 2EYOA 3TP5A 1OO9B 3N6RA 4A3LH 3TSSA 2OWOA 2HDMA 2R6GA 1VQIA 2F0IA 4CKCA 2H4OA 1WTXA 1XTDA 3I72A 4LFBL 1V1PB 4XYQA 4KY6A 4X65L 4JPBW 5K36H 5G3LD 3S1MH 5I4DA 4ZYSA 1MI2A 4QF4A 5AFWA 4LMQD 4DAMA 1QVFA 3PQIA 4YCVA 3H3VI 1D2BA 1JMCA
chains in the Genus database with same CATH topology
3RZDH 4B3TL 4JBMA 1NMGA 4JI1L 3S24A 2VQEQ 2QA4A 3W1BA 4AQYQ 1HZ9A 1X65A 1XPOA 4PG3A 3IRBA 2WP8J 4QL5A 2NN6G 1N34Q 1VQBA 5M5XH 5AJ3L 3J81c 4PZ6A 4QGUA 2JA5G 3HOZG 2HIXA 1LUZA 4DV7L 1EYGA 2LSSA 3CC4A 2UXCL 3TS2A 3BZKA 2F52A 4R4IA 4P73A 2VUMG 4JYAQ 4A3JH 4DV0L 2V1CC 3KYHC 1K8GA 3TEHB 2JE6I 3AEVA 3KLWA 4NXNL 1K0RA 5IE8A 3VDYA 4DR4L 4GS3A 5C0XG 3PCOB 4JI4Q 2QEXA 4A3JG 4BBSH 3Q8DA 2BA1A 3A74A 3CCEA 1SN8A 1IL2A 3L0OA 4X66Q 1K73C 4OWWB 2I5HA 2I5MX 3PO2G 1AE3A 5JEAJ 4X64Q 1P16A 4R4TA 3NELA 3CMEA 2UUAL 4GN5A 4MZ9A 1U0LA 4B3ML 2RF4A 1N33Q 3PUYA 4UPAA 4BA2I 1JE5A 3GTJH 1BVSA 5JJLA 5M3FG 1X3GA 1IBLQ 3CW2C 3GTLH 2KHIA 3PF4A 4BXXH 4UP8A 3K81C 1W2BA 4JBJA 1OXXK 2KENA 2VW9A 2WB1E 4LF8L 4P75A 3CMAA 3F8TA 3W1GA 3OTOL 4LNQA 3PV0A 5IY0A 2L15A 4DV4Q 1FJGQ 4LW1A 3JAMi 3FKIH 5C3EG 3OYYA 4O0AA 1RL2A 4DV2Q 3HOUH 5FLMH 3A5ZB 3EBEA 4H02A 1SRUA 1XNQQ 3S1NH 5IWAL 1L0WA 4JI8Q 4JI2L 4DV1L 5IYCH 1E24A 2A8VA 4YY3Q 1NTGA 2UUBQ 5FLMG 1HNWL 4BBRH 3W5OA 1Y14B 2D62A 4A3BH 4AH6A 1TWHH 4JI6L 5IYCG 1CUKA 4YHHL 1PYBA 3I55A 4LF5Q 4IPCA 3M3YH 4HJAA 1A63A 4O2DA 3UDXA 4JI3Q 4BBRG 3K7UC 3CCVA 1PH4A 4YWLA 1IBKQ 4EQ5A 4A3BG 1VQJA 1HR0L 2CQOA 1X3EA 2NVTH 1TWGH 2C35B 2ES2A 4JI0Q 4LF6Q 4GN3B 2CWPA 2H5XA 4R4CA 3A0JA 4P72A 5GADC 3CPWA 2E5LQ 2B3GA 3I2ZA 1K9MC 1KL9A 3PIOA 4R1JA 4DK3C 4LF4Q 2WAQE 2YTYA 2R92H 2YYZA 4IFDJ 2KCTA 2ZM6L 2UUCQ 2ID0A 3KF6B 4NXMQ 3U50C 3S1QH 1BBWA 4A3CG 1A0IA 1IBMQ 1V9PA 3PO2H 3HOZH 4WJ4A 1B7YB 5IYBH 1PH7A 4JI7Q 3NENA 2VQFQ 3CCSA 4A3MG 3M7NA 2R7DA 4KI0A 3ZJYC 2R92G 1N36Q 2F4VL 5ELNA 3KJOA 1VQ5A 1S3OA 4LFCL 1XMOL 4EX5A 1CKMA 5C0XI 4HJ5A 1MIUA 3STBD 5BR8L 2AWOA 3J80i 3CF5A 5IYBG 1YJ9A 1AE2A 3BZCA 4JBKA 2AWNA 2CFMA 3L2PA 2GVBA 4DR3Q 5FLXc 1X54A 1I3QH 3U4VA 4LF7L 3H15A 3WWVA 1PH3A 4GKKQ 5M3MH 3T1YL 1XNRQ 1PH6A 4RG1A 2VL6A 1QZHA 3GDEA 2A1AA 1PH9A 4DR5L 1YHQA 2PNHA 1XMQL 1NJIC 5K36G 1I94L 4YCWA 3S14H 3T1HQ 1HZBA 1UE7A 1I5FA 4IOCA 1JJGA 2VQEL 1SE8A 2MQHA 3LGJA 2ZJQA 2YTXA 2Z6KA 3KJPA 1X55A 4AQYL 4QIWE 1VQ8A 4DNIA 2ZTDA 4X65Q 4PMWA 4LFAL 3J81i 1LYLA 2B63H 1TWFH 1PHJA 4P71A 2AHOB 2ALYB 2RHSB 1VQCA 1M90C 3PO3H 3AFQA 3ULLA 1K3RA 3F2CA 4GKJQ 4L5TA 3JC66 4JC0A 1B8AA 1Q82C 4YCUA 1G6PA 4YWMA 1IYJB 4DV3Q 1C7YA 4B3RL 2B63G 4PZ7A 4JI1Q 1VQMA 1CSPA 2JK8A 3CQZH 1JJ2A 3ER0A 1N32Q 4X6AH 4A4IA 3TREA 5AJ3Q 1HNZL 1YJWA 2Z0SA 4R4OA 5LMNQ 4DV3L 3K0XA 4DV7Q 1HJPA 2UU9L 1ASYA 3ICEA 4QJFA 1HZAA 5IP9H 2OCEA 1YVCA 2JA7H 1KAWA 3MXNB 2HQLA 3I56A 4GLXA 2XTIA 4BBSG 1KC8C 5M5YH 3CCLA 1KRTA 1SFOH 4DUYQ 2B29A 3EN2A 1D7QA 2A19A 4AYBG 5IP9G 3J7A5 1WI5A 2K75A 4KHZA 5FJ8H 4JI5L 4HIMA 3D31A 3FP9A 4NXNQ 1QVCA 2JA7G 1PH2A 1VQLA 4DR4Q 1BKBA 5GAGC 1X3FA 1PVOA 1E22A 3ULPA 3GTQH 3K8AA 1BBUA 1Y1VH 4DV6L 2PMZE 2HHHL 4DUZL 4GLAC 3GTMH 3F1ZA 3L7ZC 4GOPA 1E1OA 1RIPA 3S15H 4BXXG 2UUAQ 1XPRA 1EOVA 2BH2A 1WOCA 1VQ4A 4HJ9A 4Y7NH 4KHPL 4B3MQ 4K0KL 4HIOA 1VQOA 4TVAB 1X56A 2EXDA 4C2MH 5LMUL 4DR6L 4QY7A 1TWAH 1TWCH 2JEBI 3M9BA 5LMNW 1C0AA 1SLJA 2YV5A 4X62L 3FKIG 1UE5A 1OXSC 4ALPA 2JA8H 2NVQH 4WJ3M 2DGYA 1YBYA 1FL0A 5E7NA 4AIMA 5C4JH 1Q46A 4DR1L 4GOPB 4LF8Q 3F2DA 4A93H 1O7IA 5C4XH 1T9HA 3OTOQ 2Z6KC 1J5EL 1KHIA 1C9OA 1VQ7A 3S2HH 2QGQA 2WFWA 4UP9A 4LF5L 4LUZA 3OW2A 1M1KC 2JA8G 4Y52H 4DR7L 3HKSA 4TQUS 3JAMc 3G48A 3KF6A 4DV5L 4A3IH 2JJQA 3FHWA 5IWAQ 2VNUD 4XIGS 4DV1Q 1YI2A 4B3SL 5C4XG 1JB7A 4OX9L 4DR2L 5J3BA 1TXYA 1VCIA 1WCMH 3K7AH 3PUXA 4IPDA 4DAYB 4A3KH 4BA1I 1Q81C 2I0QA 4JI0L 3GTOH 1KIXA 1HNWQ 2UXBL 4A3IG 2VS1A 2ZJPA 2IHEA 1HNXL 3S16H 1YHBA 5GAEC 3CC2A 1LM0A 2E5LL 3GTGH 4A3GH 1Q1BA 2PI2E 1YIJA 4JI6Q 4LF9L 4YHHQ 1FGUA 2I5LX 4A3KG 1WCMG 2R7ZG 1JJCB 2UXDL 5HGQA 1XPUA 4LUOA 1NY4A 5EAYA 5JEAG 4J15A 4A3GG 1B70B 1NMFA 4IJHA 1SR3A 3KOJA 3GD7A 1HR0Q 2JQOA 4DK6C 3CCJA 2HIVA 3EIVA 1VQKA 1QVGA 5JJIA 1EIFA 3A5UA 2E2HH 1EFWA 2ATWA 4OWTB 4RMFA 1UEBA 1PFSA 2R93H 1OXVA 1VQNA 1JT8A 3U4ZA 2ZTCA 1Q8KA 2KCMA 4BY1H 2ZM6Q 1J6QA 3ERSX 2EIFA 5C44H 2LXJA 2PQAA 1OTCA 4C3IH 1VQFA 3HOXH 5M5WH 1IXRA 1X9NA 1G51A 4A3EH 2Y0SE 2JA6G 3HOYH 3NEMA 1NE3A 2NZHA 2N78A 1K8AC 1Q7YC 3RLOA 4GOPC 3I7FA 3RNUA 1A62A 1QUQA 2F4VQ 1A8VA 4BY1G 1VQPA 1VQ9A 5M3MG 3KDFA 3HKZG 1N9WA 5C44G 1XMOQ 4LFCQ 3GTPH 4OXPA 2K5VA 3PUWA 4LFBQ 3HOXG 4IOAA 1Q1EA 3M4QA 3H0GH 4A3EG 1DGSA 3HOYG 3BU2A 3M85A 3G6EA 3HOWH 4HIKA 2E2JH 4OO1I 1VS0A 1KRSA 1N34L 4MTNA 2PQAB 3T1YQ 1VQGA 1S40A 2IX1A 2D0PA 1XJVA 2JA6H 4DPGA 1PA6A 3F2BA 4P74A 4GNXA 3H0GG 4A3FH 3TRZA 3G4SA 3HOVH 3U58A 4A75A 3HOWG 4DR5Q 1VQ6A 1QUQB 2Q2IA 1I94Q 2MFIA 3KDFB 2K5HA 3PF5A 4B3TQ 4JYAL 2VZAA 2JA5H 3TQYA 4XTCS 4BY7H 2K5NA 2OTJA 2ZTEA 2K4KA 3D0FA 4A3FG 3HOVG 3J7ZC 4LFAQ 1N32L 3B6YA 1S72A 2EQSA 4MNOA 1E7ZA 3CP0A 2PI2A 1L1OB 2MNAA 4JI4L 2VY3A 2VUMH 5LMNL 1FVIA 1VQEA 1MJEA 4GNXB 4BY7G 2NVXH 2UXCQ 2HT1A 2LXKA 4X66L 2AKWB 1EQRA 4IFDG 3UDIA 1K83H 3CCQA 3RN5A 4B3RQ 4X64L 3CCMA 1Z9FA 4IO9A 1SROA 1NBWA 4DV0Q 1N33L 4AYBE 4JOIC 4DUYL 2OTLA 2R7FA 3AFPA 2IY5B 1QZGA 1IBLL 2XGTA 3AYHB 4HIDA 4UY8C 4KLKA 4A76A 3RN2A 1HNZQ 3I4MH 2CKZB 1UWVA 1Q86C 2BA0A 4LWCA 2UU9Q 3UE0A 3GTKH 3H3VH 4OO1G 1PYSB 3S1RH 1YHAA 5FJ8G 2YU9H 4UP7A 5M3FH 1PV4A 1OXUA 2K14A 3E9IA 1VQAA 1FJGL 4L5SA 4DV4L 3I4MG 3PIPA 4L5QA 4POGA 3SGIA 4APVA 4DV2L 1Y1VG 2JA9A 1WYDA 1Y1WH 3STBC 4DKAC 1XNQL 3NBHB 1CKNA 4C3HH 2K52A 4IJLA 4IPHA 5H1SE 1PH5A 4JI5Q 2FXQA 4JI8L 2K50A 1CKOA 1X6OA 3MEFA 2Q2HA 4HJ7A 4YY3L 5C3EH 3TS0A 1E1TA 4DV6Q 2UUBL 1CSQA 1V1QA 5DLQE 1Y1WG 4DUZQ 3E9HA 2HHHQ 2MO0A 3AQQA 1EWIA 2E2IH 2WB1G 3BJUA 1MKHA 3CPFA 2RCNA 1YITA 4LF6L 3CXCA 2DUDA 1PH8A 4KHPQ 3I4NH 4K0KQ 2IT1A 1D8LA 5IYDH 5HY6A 4JI3L 4C3JH 2RHQB 1CKNB 4ME3A 1IBKL 5JJKA 1GM5A 2OQ0A 1L1OC 5LMUQ 4DR6Q 3CCUA 3PSIA 4JI2Q 4A93G 4GN4B 4GNXC 2IX0A 4JV5L 3M4PA 4X62Q 4R4QA 2R7ZH 5IT9c 3M4OH 4YWKA 3I4NG 3HFZB 5IYDG 1YJNA 2IHFA 1GO3E 4DR1Q 1H95A 1L2FA 1Z47A 2D0OA 4NPSA 1PH1A 1VQDA 1R9TH 1KXLA 4LUVA 1J5EQ 3RZOH 3PGZA 5GQOA 4LF4L 4JBWA 4JOIA 2NVYH 2OQKA 1UE6A 2CWAA 2N8NA 4OONA 3CCRA 4DV5Q 2UUCL 2KBNA 1MJCA 4NXML 4PZ8A 5IP7H 1IBML 4POFA 1KD1C 1SMXA 1G291 2AMCB 3KF8B 1E3PA 4B3SQ 2GN5A 1YEZA 4JI7L 2VQFL 2BH8A 4OX9Q 3I4OA 4DR2Q 2N3SA 1N36L 1UE1A 3GO5A 4JV5Q 3RLNA 3UE1A 4JG2A 1ASZA 2MO1A 3HOUG 5C0XJ 1GD7A 1Q12A 4JCVE 3G71A 4A3CH 2UXBQ 1HNXQ 5IP7G 4IPGA 1V43A 3DM3A 3RLFA 4HJ8A 2NN6I 3J81j 3CD6A 4FDBA 4LF9Q 1LTLA 4DR3L 4A3MH 1VQHA 2Q2UA 1P8LA 2JEAI 1AH9A 1YNXA 2UXDQ 1WJJA 2WAQG 2Q2TA 4DR7Q 1GVPA 4GKKL 5GAHC 4IFDI 1XNRL 1IZ6A 1I50H 3S2DH 2ZJRA 1KQSA 4OWXB 2R93G 4A3DH 4NB3A 4L5RC 1GKHA 1EUJA 1HZCA 3PUZA 3HKZE 3RR5A 1U5KA 2NZOA 4QQBX 4A3LH 2E8GA 2OWOA 2R6GA 3T1HL 1VQIA 3KFUA 3S17H 2GVAA 3DLLA 3UDGA 1XTDA 2KHJA 5BR8Q 3CC7A 4LFBL 3E0EA 3ULJA 3UDFA 4A3DG 1OXTA 3J80c 4X65L 4LF7Q 3CAMA 5ELOA 1W3SA 3PO3G 2N49A 1EQQA 2CCZA 3K80C 1EIYB 3S1MH 4A3LG 1L1OA 3PUVA 1HH2P 5GROA 1HR0W 4DAMA 2F3IA 1QVFA 4GKJL 2ASBA 4YCVA 4GLVB 1XMQQ 2YTVA 1YZ6A 1N8RC 3H3VI 2Y0SG 1I6HH 1WFQA 1JMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD H;  4B3T L;  4JBM A;  1NMG A;  4JI1 L;  3S24 A;  2VQE Q;  2QA4 A;  3W1B A;  4AQY Q;  1HZ9 A;  1X65 A;  1XPO A;  4PG3 A;  3IRB A;  2WP8 J;  4QL5 A;  2NN6 G;  1N34 Q;  1VQB A;  5M5X H;  5AJ3 L;  3J81 c;  4PZ6 A;  4QGU A;  2JA5 G;  3HOZ G;  2HIX A;  1LUZ A;  4DV7 L;  1EYG A;  2LSS A;  3CC4 A;  2UXC L;  3TS2 A;  3BZK A;  2F52 A;  4R4I A;  4P73 A;  2VUM G;  4JYA Q;  4A3J H;  4DV0 L;  2V1C C;  3KYH C;  1K8G A;  3TEH B;  2JE6 I;  3AEV A;  3KLW A;  4NXN L;  1K0R A;  5IE8 A;  3VDY A;  4DR4 L;  4GS3 A;  5C0X G;  3PCO B;  4JI4 Q;  2QEX A;  4A3J G;  4BBS H;  3Q8D A;  2BA1 A;  3A74 A;  3CCE A;  1SN8 A;  1IL2 A;  3L0O A;  4X66 Q;  1K73 C;  4OWW B;  2I5H A;  2I5M X;  3PO2 G;  1AE3 A;  5JEA J;  4X64 Q;  1P16 A;  4R4T A;  3NEL A;  3CME A;  2UUA L;  4GN5 A;  4MZ9 A;  1U0L A;  4B3M L;  2RF4 A;  1N33 Q;  3PUY A;  4UPA A;  4BA2 I;  1JE5 A;  3GTJ H;  1BVS A;  5JJL A;  5M3F G;  1X3G A;  1IBL Q;  3CW2 C;  3GTL H;  2KHI A;  3PF4 A;  4BXX H;  4UP8 A;  3K81 C;  1W2B A;  4JBJ A;  1OXX K;  2KEN A;  2VW9 A;  2WB1 E;  4LF8 L;  4P75 A;  3CMA A;  3F8T A;  3W1G A;  3OTO L;  4LNQ A;  3PV0 A;  5IY0 A;  2L15 A;  4DV4 Q;  1FJG Q;  4LW1 A;  3JAM i;  3FKI H;  5C3E G;  3OYY A;  4O0A A;  1RL2 A;  4DV2 Q;  3HOU H;  5FLM H;  3A5Z B;  3EBE A;  4H02 A;  1SRU A;  1XNQ Q;  3S1N H;  5IWA L;  1L0W A;  4JI8 Q;  4JI2 L;  4DV1 L;  5IYC H;  1E24 A;  2A8V A;  4YY3 Q;  1NTG A;  2UUB Q;  5FLM G;  1HNW L;  4BBR H;  3W5O A;  1Y14 B;  2D62 A;  4A3B H;  4AH6 A;  1TWH H;  4JI6 L;  5IYC G;  1CUK A;  4YHH L;  1PYB A;  3I55 A;  4LF5 Q;  4IPC A;  3M3Y H;  4HJA A;  1A63 A;  4O2D A;  3UDX A;  4JI3 Q;  4BBR G;  3K7U C;  3CCV A;  1PH4 A;  4YWL A;  1IBK Q;  4EQ5 A;  4A3B G;  1VQJ A;  1HR0 L;  2CQO A;  1X3E A;  2NVT H;  1TWG H;  2C35 B;  2ES2 A;  4JI0 Q;  4LF6 Q;  4GN3 B;  2CWP A;  2H5X A;  4R4C A;  3A0J A;  4P72 A;  5GAD C;  3CPW A;  2E5L Q;  2B3G A;  3I2Z A;  1K9M C;  1KL9 A;  3PIO A;  4R1J A;  4DK3 C;  4LF4 Q;  2WAQ E;  2YTY A;  2R92 H;  2YYZ A;  4IFD J;  2KCT A;  2ZM6 L;  2UUC Q;  2ID0 A;  3KF6 B;  4NXM Q;  3U50 C;  3S1Q H;  1BBW A;  4A3C G;  1A0I A;  1IBM Q;  1V9P A;  3PO2 H;  3HOZ H;  4WJ4 A;  1B7Y B;  5IYB H;  1PH7 A;  4JI7 Q;  3NEN A;  2VQF Q;  3CCS A;  4A3M G;  3M7N A;  2R7D A;  4KI0 A;  3ZJY C;  2R92 G;  1N36 Q;  2F4V L;  5ELN A;  3KJO A;  1VQ5 A;  1S3O A;  4LFC L;  1XMO L;  4EX5 A;  1CKM A;  5C0X I;  4HJ5 A;  1MIU A;  3STB D;  5BR8 L;  2AWO A;  3J80 i;  3CF5 A;  5IYB G;  1YJ9 A;  1AE2 A;  3BZC A;  4JBK A;  2AWN A;  2CFM A;  3L2P A;  2GVB A;  4DR3 Q;  5FLX c;  1X54 A;  1I3Q H;  3U4V A;  4LF7 L;  3H15 A;  3WWV A;  1PH3 A;  4GKK Q;  5M3M H;  3T1Y L;  1XNR Q;  1PH6 A;  4RG1 A;  2VL6 A;  1QZH A;  3GDE A;  2A1A A;  1PH9 A;  4DR5 L;  1YHQ A;  2PNH A;  1XMQ L;  1NJI C;  5K36 G;  1I94 L;  4YCW A;  3S14 H;  3T1H Q;  1HZB A;  1UE7 A;  1I5F A;  4IOC A;  1JJG A;  2VQE L;  1SE8 A;  2MQH A;  3LGJ A;  2ZJQ A;  2YTX A;  2Z6K A;  3KJP A;  1X55 A;  4AQY L;  4QIW E;  1VQ8 A;  4DNI A;  2ZTD A;  4X65 Q;  4PMW A;  4LFA L;  3J81 i;  1LYL A;  2B63 H;  1TWF H;  1PHJ A;  4P71 A;  2AHO B;  2ALY B;  2RHS B;  1VQC A;  1M90 C;  3PO3 H;  3AFQ A;  3ULL A;  1K3R A;  3F2C A;  4GKJ Q;  4L5T A;  3JC6 6;  4JC0 A;  1B8A A;  1Q82 C;  4YCU A;  1G6P A;  4YWM A;  1IYJ B;  4DV3 Q;  1C7Y A;  4B3R L;  2B63 G;  4PZ7 A;  4JI1 Q;  1VQM A;  1CSP A;  2JK8 A;  3CQZ H;  1JJ2 A;  3ER0 A;  1N32 Q;  4X6A H;  4A4I A;  3TRE A;  5AJ3 Q;  1HNZ L;  1YJW A;  2Z0S A;  4R4O A;  5LMN Q;  4DV3 L;  3K0X A;  4DV7 Q;  1HJP A;  2UU9 L;  1ASY A;  3ICE A;  4QJF A;  1HZA A;  5IP9 H;  2OCE A;  1YVC A;  2JA7 H;  1KAW A;  3MXN B;  2HQL A;  3I56 A;  4GLX A;  2XTI A;  4BBS G;  1KC8 C;  5M5Y H;  3CCL A;  1KRT A;  1SFO H;  4DUY Q;  2B29 A;  3EN2 A;  1D7Q A;  2A19 A;  4AYB G;  5IP9 G;  3J7A 5;  1WI5 A;  2K75 A;  4KHZ A;  5FJ8 H;  4JI5 L;  4HIM A;  3D31 A;  3FP9 A;  4NXN Q;  1QVC A;  2JA7 G;  1PH2 A;  1VQL A;  4DR4 Q;  1BKB A;  5GAG C;  1X3F A;  1PVO A;  1E22 A;  3ULP A;  3GTQ H;  3K8A A;  1BBU A;  1Y1V H;  4DV6 L;  2PMZ E;  2HHH L;  4DUZ L;  4GLA C;  3GTM H;  3F1Z A;  3L7Z C;  4GOP A;  1E1O A;  1RIP A;  3S15 H;  4BXX G;  2UUA Q;  1XPR A;  1EOV A;  2BH2 A;  1WOC A;  1VQ4 A;  4HJ9 A;  4Y7N H;  4KHP L;  4B3M Q;  4K0K L;  4HIO A;  1VQO A;  4TVA B;  1X56 A;  2EXD A;  4C2M H;  5LMU L;  4DR6 L;  4QY7 A;  1TWA H;  1TWC H;  2JEB I;  3M9B A;  5LMN W;  1C0A A;  1SLJ A;  2YV5 A;  4X62 L;  3FKI G;  1UE5 A;  1OXS C;  4ALP A;  2JA8 H;  2NVQ H;  4WJ3 M;  2DGY A;  1YBY A;  1FL0 A;  5E7N A;  4AIM A;  5C4J H;  1Q46 A;  4DR1 L;  4GOP B;  4LF8 Q;  3F2D A;  4A93 H;  1O7I A;  5C4X H;  1T9H A;  3OTO Q;  2Z6K C;  1J5E L;  1KHI A;  1C9O A;  1VQ7 A;  3S2H H;  2QGQ A;  2WFW A;  4UP9 A;  4LF5 L;  4LUZ A;  3OW2 A;  1M1K C;  2JA8 G;  4Y52 H;  4DR7 L;  3HKS A;  4TQU S;  3JAM c;  3G48 A;  3KF6 A;  4DV5 L;  4A3I H;  2JJQ A;  3FHW A;  5IWA Q;  2VNU D;  4XIG S;  4DV1 Q;  1YI2 A;  4B3S L;  5C4X G;  1JB7 A;  4OX9 L;  4DR2 L;  5J3B A;  1TXY A;  1VCI A;  1WCM H;  3K7A H;  3PUX A;  4IPD A;  4DAY B;  4A3K H;  4BA1 I;  1Q81 C;  2I0Q A;  4JI0 L;  3GTO H;  1KIX A;  1HNW Q;  2UXB L;  4A3I G;  2VS1 A;  2ZJP A;  2IHE A;  1HNX L;  3S16 H;  1YHB A;  5GAE C;  3CC2 A;  1LM0 A;  2E5L L;  3GTG H;  4A3G H;  1Q1B A;  2PI2 E;  1YIJ A;  4JI6 Q;  4LF9 L;  4YHH Q;  1FGU A;  2I5L X;  4A3K G;  1WCM G;  2R7Z G;  1JJC B;  2UXD L;  5HGQ A;  1XPU A;  4LUO A;  1NY4 A;  5EAY A;  5JEA G;  4J15 A;  4A3G G;  1B70 B;  1NMF A;  4IJH A;  1SR3 A;  3KOJ A;  3GD7 A;  1HR0 Q;  2JQO A;  4DK6 C;  3CCJ A;  2HIV A;  3EIV A;  1VQK A;  1QVG A;  5JJI A;  1EIF A;  3A5U A;  2E2H H;  1EFW A;  2ATW A;  4OWT B;  4RMF A;  1UEB A;  1PFS A;  2R93 H;  1OXV A;  1VQN A;  1JT8 A;  3U4Z A;  2ZTC A;  1Q8K A;  2KCM A;  4BY1 H;  2ZM6 Q;  1J6Q A;  3ERS X;  2EIF A;  5C44 H;  2LXJ A;  2PQA A;  1OTC A;  4C3I H;  1VQF A;  3HOX H;  5M5W H;  1IXR A;  1X9N A;  1G51 A;  4A3E H;  2Y0S E;  2JA6 G;  3HOY H;  3NEM A;  1NE3 A;  2NZH A;  2N78 A;  1K8A C;  1Q7Y C;  3RLO A;  4GOP C;  3I7F A;  3RNU A;  1A62 A;  1QUQ A;  2F4V Q;  1A8V A;  4BY1 G;  1VQP A;  1VQ9 A;  5M3M G;  3KDF A;  3HKZ G;  1N9W A;  5C44 G;  1XMO Q;  4LFC Q;  3GTP H;  4OXP A;  2K5V A;  3PUW A;  4LFB Q;  3HOX G;  4IOA A;  1Q1E A;  3M4Q A;  3H0G H;  4A3E G;  1DGS A;  3HOY G;  3BU2 A;  3M85 A;  3G6E A;  3HOW H;  4HIK A;  2E2J H;  4OO1 I;  1VS0 A;  1KRS A;  1N34 L;  4MTN A;  2PQA B;  3T1Y Q;  1VQG A;  1S40 A;  2IX1 A;  2D0P A;  1XJV A;  2JA6 H;  4DPG A;  1PA6 A;  3F2B A;  4P74 A;  4GNX A;  3H0G G;  4A3F H;  3TRZ A;  3G4S A;  3HOV H;  3U58 A;  4A75 A;  3HOW G;  4DR5 Q;  1VQ6 A;  1QUQ B;  2Q2I A;  1I94 Q;  2MFI A;  3KDF B;  2K5H A;  3PF5 A;  4B3T Q;  4JYA L;  2VZA A;  2JA5 H;  3TQY A;  4XTC S;  4BY7 H;  2K5N A;  2OTJ A;  2ZTE A;  2K4K A;  3D0F A;  4A3F G;  3HOV G;  3J7Z C;  4LFA Q;  1N32 L;  3B6Y A;  1S72 A;  2EQS A;  4MNO A;  1E7Z A;  3CP0 A;  2PI2 A;  1L1O B;  2MNA A;  4JI4 L;  2VY3 A;  2VUM H;  5LMN L;  1FVI A;  1VQE A;  1MJE A;  4GNX B;  4BY7 G;  2NVX H;  2UXC Q;  2HT1 A;  2LXK A;  4X66 L;  2AKW B;  1EQR A;  4IFD G;  3UDI A;  1K83 H;  3CCQ A;  3RN5 A;  4B3R Q;  4X64 L;  3CCM A;  1Z9F A;  4IO9 A;  1SRO A;  1NBW A;  4DV0 Q;  1N33 L;  4AYB E;  4JOI C;  4DUY L;  2OTL A;  2R7F A;  3AFP A;  2IY5 B;  1QZG A;  1IBL L;  2XGT A;  3AYH B;  4HID A;  4UY8 C;  4KLK A;  4A76 A;  3RN2 A;  1HNZ Q;  3I4M H;  2CKZ B;  1UWV A;  1Q86 C;  2BA0 A;  4LWC A;  2UU9 Q;  3UE0 A;  3GTK H;  3H3V H;  4OO1 G;  1PYS B;  3S1R H;  1YHA A;  5FJ8 G;  2YU9 H;  4UP7 A;  5M3F H;  1PV4 A;  1OXU A;  2K14 A;  3E9I A;  1VQA A;  1FJG L;  4L5S A;  4DV4 L;  3I4M G;  3PIP A;  4L5Q A;  4POG A;  3SGI A;  4APV A;  4DV2 L;  1Y1V G;  2JA9 A;  1WYD A;  1Y1W H;  3STB C;  4DKA C;  1XNQ L;  3NBH B;  1CKN A;  4C3H H;  2K52 A;  4IJL A;  4IPH A;  5H1S E;  1PH5 A;  4JI5 Q;  2FXQ A;  4JI8 L;  2K50 A;  1CKO A;  1X6O A;  3MEF A;  2Q2H A;  4HJ7 A;  4YY3 L;  5C3E H;  3TS0 A;  1E1T A;  4DV6 Q;  2UUB L;  1CSQ A;  1V1Q A;  5DLQ E;  1Y1W G;  4DUZ Q;  3E9H A;  2HHH Q;  2MO0 A;  3AQQ A;  1EWI A;  2E2I H;  2WB1 G;  3BJU A;  1MKH A;  3CPF A;  2RCN A;  1YIT A;  4LF6 L;  3CXC A;  2DUD A;  1PH8 A;  4KHP Q;  3I4N H;  4K0K Q;  2IT1 A;  1D8L A;  5IYD H;  5HY6 A;  4JI3 L;  4C3J H;  2RHQ B;  1CKN B;  4ME3 A;  1IBK L;  5JJK A;  1GM5 A;  2OQ0 A;  1L1O C;  5LMU Q;  4DR6 Q;  3CCU A;  3PSI A;  4JI2 Q;  4A93 G;  4GN4 B;  4GNX C;  2IX0 A;  4JV5 L;  3M4P A;  4X62 Q;  4R4Q A;  2R7Z H;  5IT9 c;  3M4O H;  4YWK A;  3I4N G;  3HFZ B;  5IYD G;  1YJN A;  2IHF A;  1GO3 E;  4DR1 Q;  1H95 A;  1L2F A;  1Z47 A;  2D0O A;  4NPS A;  1PH1 A;  1VQD A;  1R9T H;  1KXL A;  4LUV A;  1J5E Q;  3RZO H;  3PGZ A;  5GQO A;  4LF4 L;  4JBW A;  4JOI A;  2NVY H;  2OQK A;  1UE6 A;  2CWA A;  2N8N A;  4OON A;  3CCR A;  4DV5 Q;  2UUC L;  2KBN A;  1MJC A;  4NXM L;  4PZ8 A;  5IP7 H;  1IBM L;  4POF A;  1KD1 C;  1SMX A;  1G29 1;  2AMC B;  3KF8 B;  1E3P A;  4B3S Q;  2GN5 A;  1YEZ A;  4JI7 L;  2VQF L;  2BH8 A;  4OX9 Q;  3I4O A;  4DR2 Q;  2N3S A;  1N36 L;  1UE1 A;  3GO5 A;  4JV5 Q;  3RLN A;  3UE1 A;  4JG2 A;  1ASZ A;  2MO1 A;  3HOU G;  5C0X J;  1GD7 A;  1Q12 A;  4JCV E;  3G71 A;  4A3C H;  2UXB Q;  1HNX Q;  5IP7 G;  4IPG A;  1V43 A;  3DM3 A;  3RLF A;  4HJ8 A;  2NN6 I;  3J81 j;  3CD6 A;  4FDB A;  4LF9 Q;  1LTL A;  4DR3 L;  4A3M H;  1VQH A;  2Q2U A;  1P8L A;  2JEA I;  1AH9 A;  1YNX A;  2UXD Q;  1WJJ A;  2WAQ G;  2Q2T A;  4DR7 Q;  1GVP A;  4GKK L;  5GAH C;  4IFD I;  1XNR L;  1IZ6 A;  1I50 H;  3S2D H;  2ZJR A;  1KQS A;  4OWX B;  2R93 G;  4A3D H;  4NB3 A;  4L5R C;  1GKH A;  1EUJ A;  1HZC A;  3PUZ A;  3HKZ E;  3RR5 A;  1U5K A;  2NZO A;  4QQB X;  4A3L H;  2E8G A;  2OWO A;  2R6G A;  3T1H L;  1VQI A;  3KFU A;  3S17 H;  2GVA A;  3DLL A;  3UDG A;  1XTD A;  2KHJ A;  5BR8 Q;  3CC7 A;  4LFB L;  3E0E A;  3ULJ A;  3UDF A;  4A3D G;  1OXT A;  3J80 c;  4X65 L;  4LF7 Q;  3CAM A;  5ELO A;  1W3S A;  3PO3 G;  2N49 A;  1EQQ A;  2CCZ A;  3K80 C;  1EIY B;  3S1M H;  4A3L G;  1L1O A;  3PUV A;  1HH2 P;  5GRO A;  1HR0 W;  4DAM A;  2F3I A;  1QVF A;  4GKJ L;  2ASB A;  4YCV A;  4GLV B;  1XMQ Q;  2YTV A;  1YZ6 A;  1N8R C;  3H3V I;  2Y0S G;  1I6H H;  1WFQ A;  1JMC A; 
#chains in the Genus database with same CATH topology
 4JBM A;  4DAP A;  2VQE Q;  2EVB A;  1QCB D;  4C1N K;  5M5X H;  1PLF A;  1KNE A;  1LUZ A;  1VF5 C;  2UXC L;  1DJR D;  4CDF C;  2BDO A;  5KYL A;  5DM6 3;  5C0X H;  4P73 A;  2VUM G;  5F2D A;  2K03 A;  1RHP A;  4J8Q A;  3QIA A;  4NXN L;  1K0R A;  3L9A X;  4DR4 L;  4GS3 A;  2B2W A;  3PCO B;  2SDF A;  1C48 A;  1H9R A;  1K73 C;  2Z1C A;  3TBI B;  2KVM A;  4X64 Q;  3AB9 A;  3S1Q B;  3FRP B;  3PUY A;  5COR A;  3HOZ B;  1B9N A;  5M3F G;  1X3G A;  1IBL Q;  1L0X B;  3CW2 C;  3Q6S A;  2KHI A;  2A6E C;  2QF7 A;  1XXG A;  4FYD A;  4LF8 L;  3CMA A;  1WTR A;  5DM7 3;  1NNX A;  4K5X A;  1AW7 A;  4DV4 Q;  4RGT A;  2L1B A;  4LW1 A;  5T1I A;  1F9P A;  3NTH A;  3OWF A;  5C4H A;  4H02 A;  1SRU A;  4JI2 L;  4DV1 L;  3FPP A;  1HQR D;  2B2U C;  4YY3 Q;  3SVM A;  5EBD A;  5FLM G;  1HNW L;  4BBR H;  1EYD A;  4A3B H;  4JI6 L;  2B63 B;  1TWF B;  3I55 A;  1WTV A;  4HJA A;  2EYP A;  1MBY A;  5FO7 B;  2EXZ A;  2OEO A;  4QCL A;  4YWL A;  3T56 B;  1IBK Q;  5IT9 E;  2LKV A;  4EQ5 A;  4LJZ C;  1SNM A;  4LF6 Q;  2C35 B;  4GN3 B;  1KAB A;  2CWP A;  4R4C A;  4U68 A;  1G2T A;  1PTO F;  5GAD C;  3VR4 A;  5JEA H;  2PNR C;  3R2I A;  3J7Y W;  4LF4 Q;  1X32 A;  4KD3 A;  2YTY A;  1LTG D;  5CMD A;  3E3X A;  3I3C A;  2K5Q A;  5A35 A;  2ZM6 L;  2ID0 A;  4ODG A;  1JQY D;  2B2W C;  1BBW A;  1IBM Q;  1TU2 B;  2CW0 D;  3PO2 H;  4WJ4 A;  3QWN A;  2JA7 B;  2R7D A;  3ZJY C;  1NR2 A;  4FNF A;  3HOZ G;  3J80 i;  5IYB G;  2JA6 H;  4OEM B;  1HUN A;  1X54 A;  5M3M H;  3T1Y L;  1XNR Q;  3QJY A;  1PTO B;  2A5H A;  1GXD C;  1SDF A;  2NTT A;  3I4L A;  1EWH A;  4YCW A;  1HZB A;  1SNO A;  2EY2 A;  1L0Y B;  5IOD A;  2VQE L;  4KY5 A;  2F3V A;  1PZK D;  4QIW E;  4DNI A;  2ZTD A;  4PMW A;  3SXH A;  1IHZ A;  3AFQ A;  1A2T A;  4F8M A;  4JC0 A;  3MHB A;  2ZXO A;  3BVG A;  1XTC D;  4EQN A;  4GZY C;  1IYJ B;  3S2H B;  3MXN A;  2B63 G;  3D6C A;  5KEE A;  1A3T A;  4EQO A;  1PRT B;  4EGV A;  5ELB A;  1VMC A;  1Q90 A;  4BS9 A;  3WOE A;  1STN A;  5AJ3 Q;  1YJW A;  2Z0S A;  1O78 A;  3K0X A;  3DHQ A;  3UI2 A;  1HZA A;  3MXN B;  2KOL A;  3I56 A;  1I4P A;  4BBS G;  1KC8 C;  4IQZ A;  3Q22 A;  1SFO H;  4QMG A;  2B29 A;  1D7Q A;  2A19 A;  3J7A 5;  5HUR A;  3D4D A;  4KHZ A;  1DD2 A;  2JA7 G;  1JOQ A;  5JPM C;  1VQL A;  4FF4 A;  1PTO C;  4V0B A;  2E2H B;  3K8A A;  2D9U A;  5LL6 S;  1Y1V H;  2PMZ E;  2L4N A;  2HHH L;  2MPM A;  2LMC B;  2R93 B;  1XYI A;  4CBV A;  1SYE A;  1ENA A;  3NP8 A;  4BXX G;  1XPR A;  3A8I E;  1VQ4 A;  5C44 B;  4HJ9 A;  4K0K L;  4HIO A;  3K0Y A;  1VQO A;  2XWB B;  2R61 A;  4A3E B;  3N52 A;  3PO3 B;  4QY7 A;  1LAB A;  4X62 L;  5J39 A;  4HAE A;  3GTP B;  1OXS C;  2JA8 H;  2NVQ H;  2RSO A;  2DGY A;  4AIM A;  5C4J H;  1S5D D;  4PV1 C;  3HOW B;  4A93 H;  1KTK A;  1O7I A;  1EY0 A;  1I4X A;  2QGQ A;  4LUZ A;  4I65 A;  5KIX A;  3JAM c;  3KF6 A;  4F87 A;  4KKU A;  3FHW A;  5IWA Q;  1HCZ A;  1SXT A;  4RGN A;  5CV7 A;  1DM0 B;  4WFN 3;  4XDX A;  3Q0A A;  3K7A H;  4LF6 L;  3HZX A;  3GTO H;  2XRS D;  2ZJP A;  1HNX L;  3M7G A;  1YNJ D;  3GTG H;  2ZXR A;  5CV6 A;  2PI2 E;  1JB3 A;  5COY A;  3DWQ A;  1FGU A;  2F0E A;  1MGS A;  5E3F A;  1XPU A;  2J0T D;  3EA6 A;  5EAY A;  3LX0 A;  1SR3 A;  3KOJ A;  2F0D A;  3KLR A;  3EIV A;  3MZ5 A;  1VQK A;  5JJI A;  1EFW A;  5KND A;  3NE5 B;  2A6H C;  1PFS A;  1OXV A;  1JT8 A;  1B53 A;  3BVZ A;  1J6Q A;  4ILW A;  3ERS X;  1SE2 A;  1VQF A;  2SEB D;  2RBM A;  3R3O A;  3TZD A;  3RNU A;  1A62 A;  1QUQ A;  3S9W A;  1A8V A;  1QWY A;  2MJ8 A;  5C44 G;  4LFC Q;  3PUW A;  2PMZ B;  4A3E G;  1DGS A;  1UNS A;  4IUP A;  3G6E A;  1STB A;  2E2J H;  4OO1 I;  1VS0 A;  1N34 L;  4RA8 A;  3MTS A;  4OGQ C;  2D0P A;  2E2I B;  3VR3 A;  3HOW G;  1VQ6 A;  1QUQ B;  1I4Q A;  2B2Y A;  5EQ0 A;  5IGF A;  1PRT D;  4JYA L;  2VZA A;  1BCP B;  1X3Q A;  2K5N A;  1RKN A;  4IFD H;  2B39 A;  1S72 A;  2PI2 A;  2VUM H;  2VY3 A;  4MHE A;  1LTR D;  4JVZ A;  2NVX H;  1R9T B;  1ENF A;  3RN5 A;  2M2L A;  4B3R Q;  1GUN A;  2NVY B;  2NZ1 D;  1F2Z A;  5EPL A;  4IO9 A;  1NBW A;  1N33 L;  2HQE A;  2BCO A;  2R7F A;  3H3V C;  2IY5 B;  1QZG A;  1DZ1 A;  4UY8 C;  3CRL C;  3RN2 A;  5E4W C;  1LTI D;  3NWS A;  1Q86 C;  1WD0 A;  3SK8 A;  5FJ8 G;  2YU9 H;  5EKL A;  5M3F H;  1OXU A;  1EEI D;  1FJG L;  3SE0 A;  4DK1 A;  3CU7 A;  3SGI A;  4APV A;  1I50 B;  2JA9 A;  1WYD A;  1Y1W H;  2JYO A;  4KN7 C;  1FNV A;  4DKA C;  1QE6 A;  3I8Z A;  2SOB A;  4C3H H;  5H1S E;  2FXQ A;  2K50 A;  4HJ7 A;  3S17 B;  5DLQ E;  3E9H A;  1DON A;  2FFK B;  2WB1 G;  2XNA C;  1S5B D;  2RCN A;  1BCP C;  3CXC A;  2DUD A;  1KLG D;  2IT1 A;  4JI3 L;  3IFD A;  2XRQ D;  4ME3 A;  5CBE E;  1H9S B;  4DR6 Q;  2JXM B;  1I6H B;  5CV4 A;  4J6H A;  4G57 A;  3TP7 A;  1D5M C;  2B2Y C;  3HFZ B;  2IHF A;  2OXP A;  1Z6H A;  1WTH A;  1KXL A;  2WKD A;  1ET6 A;  1PH1 A;  1VQD A;  3JAM E;  5GQO A;  2ZXP A;  1HFG A;  3GP7 A;  4DXF A;  4JOI A;  2OQK A;  4DR7 Q;  4NXM L;  1MJC A;  2AUJ D;  2EPB A;  3C46 A;  3RD4 A;  1SMX A;  1G29 1;  2AMC B;  2GN5 A;  2PW7 A;  4OX9 Q;  4DR2 Q;  1LT6 D;  2F0S A;  3UE1 A;  1Q12 A;  2VB2 X;  5IGB A;  4ME5 A;  4IPG A;  1V43 A;  5I9P A;  3RLF A;  1WD1 A;  2NN6 I;  2A74 C;  1LTL A;  2JN4 A;  2E75 C;  4OL7 A;  2Q2T A;  1SYB A;  5GAH C;  1IZ6 A;  3S2D H;  2ZJR A;  3A55 A;  1JE4 A;  4A3D H;  3NTK A;  3K5M A;  4KK7 A;  4K2L A;  1EEF D;  3RR5 A;  4MIU A;  2BE5 C;  2E8G A;  3T16 A;  3T1H L;  2PW5 A;  2K5D A;  2F0U A;  2WV6 D;  3DLL A;  3GTJ B;  3HG9 A;  2EYM A;  2KHJ A;  3CC7 A;  3UDF A;  3GTL B;  3ITP A;  5ELO A;  1W3S A;  4XQQ A;  3MC0 B;  1ESF A;  3D8G A;  5IIF A;  4DNT B;  4IUR A;  1RJT A;  2F3I A;  4GKJ L;  4DV3 L;  2F0K A;  2Q8I B;  3S24 A;  1IKM A;  2NBF A;  3S1N B;  3W1B A;  3OMC A;  5C3W A;  1HZ9 A;  2CH4 W;  4AQY Q;  4C1N I;  2WP8 J;  4QL5 A;  4PZ6 A;  2HIX A;  1JWS D;  2NB0 A;  1EYG A;  3SHL A;  4NP5 A;  1DCZ A;  4MTK A;  1GHK A;  1UUP A;  3BZK A;  4R4I A;  2A69 D;  4A3J H;  4B08 A;  3CKI B;  3KBG A;  5ELE A;  1BQQ T;  3KYH C;  1K8G A;  3TEH B;  3KLW A;  2FHT A;  3VDY A;  2NVT B;  2O5I C;  4BBS H;  4PQX A;  2BA1 A;  2B2V C;  1TVX A;  3CCE A;  1ML0 D;  1IL2 A;  3L0O A;  4X66 Q;  2L5T A;  1JCK B;  1P16 A;  2UUA L;  1STH A;  3FDT A;  5D3D A;  1U0L A;  4B3M L;  4RGO S;  4BA2 I;  1GUO A;  3PF4 A;  4BXX H;  4PNY A;  3KK7 A;  1OXX K;  2KEN A;  1K28 A;  2EJF C;  3F8T A;  1K8M A;  5JOB A;  1GUW A;  3PMF A;  3D4W A;  5C3E G;  3OYY A;  2KHS A;  4DV2 Q;  1XNQ Q;  1ILQ A;  4NKL A;  4ZLT F;  5IYC H;  1HUM A;  4RGM A;  2A8V A;  4C3J G;  4XT3 B;  1Y14 B;  2D62 A;  3CRK C;  4KKS A;  1TWH H;  4RFB A;  4RKB A;  3M3Y H;  4O1N A;  3DEO A;  2D2C C;  1PH4 A;  4G7H C;  1ZYR D;  4HCE A;  1D5X C;  2IWH A;  4CJ2 C;  3HRZ C;  2CQO A;  1TWG H;  4JI0 Q;  1SMY C;  1CHQ D;  3CQZ B;  3A0J A;  3HEJ A;  2E5L Q;  1KL9 A;  3PIO A;  4FXK C;  4R1J A;  2WAQ E;  2R92 H;  1I4R A;  1HTP A;  2F03 A;  2UUC Q;  3U50 C;  1A0I A;  4HMI A;  4I7Z C;  1B7Y B;  1LTB D;  1RD9 D;  1PH7 A;  4JI7 Q;  1W6J A;  4RKL A;  5J22 A;  1EIG A;  5ELN A;  3KJO A;  3SEB A;  1FGB D;  2WKC A;  4IUN A;  5C0X I;  1MIU A;  3STB D;  2AWO A;  4L8J A;  3CF5 A;  4JBK A;  1AE2 A;  3BZC A;  5CBA E;  3VYS A;  3L2P A;  1RCV D;  3U4V A;  3GTQ B;  1A6X A;  2HCC A;  3WWV A;  4GKK Q;  2IW3 A;  3GTM B;  2F4I A;  1PH6 A;  4RG1 A;  1SJE D;  5FOB B;  3S15 B;  2B2U A;  2A1A A;  3LNN A;  3VR6 A;  1I94 L;  2O5J C;  1B1Z A;  4V19 0;  1I5F A;  2MQH A;  3NQI A;  1GJX A;  4C2M B;  2Z6K A;  3KJP A;  1WTO A;  4AQY L;  1TWA B;  1VQ8 A;  2OT2 A;  5DEH A;  3TP8 A;  4LFA L;  1LYL A;  2IX3 A;  4ULL A;  5E4X A;  2RHS B;  4DAV A;  3GV6 A;  1M90 C;  1Q82 C;  3JC6 6;  2F0O A;  1B8A A;  5C4X B;  2LS0 1;  1BDO A;  1STE A;  4JI1 Q;  5K5P A;  3HS0 C;  1HFN A;  4EVO A;  2F0N A;  1JJ2 A;  4FVM A;  4A3K B;  4DV7 Q;  2UU9 L;  1WTW A;  4CJ1 B;  4BWG B;  1U9R A;  4A3G B;  1BNZ A;  2OCE A;  1AZP A;  3QOJ A;  3F2U A;  3J80 L;  1KAW A;  1MSG A;  5LHY 1;  1QNU A;  5M5Y H;  3LWE A;  1KRT A;  1Y8N B;  2Z8L A;  5IP9 G;  5FJ8 H;  3FP9 A;  3SK6 A;  1X3F A;  1PVO A;  3ULP A;  3OHX C;  1BBU A;  4DV6 L;  3A7L A;  4UDU C;  4GLA C;  4GOP A;  5I2Y A;  1I3Q B;  1RIP A;  3I91 A;  3ND9 A;  1JOR A;  4IUT A;  4BY1 B;  1WOC A;  4Y7N H;  4C3I B;  3HOX B;  2F0J A;  3BVM A;  4TVA B;  5M5W B;  1X56 A;  1CK1 A;  1STA A;  3S14 B;  1TWC H;  5LMN W;  4KJO A;  4XXE A;  2YV5 A;  3FVQ A;  4CKB A;  4ALP A;  4DAY A;  4J1M A;  1YBY A;  1SNP A;  3H0G B;  3DWA A;  4GOP B;  1Q46 A;  1LV9 A;  2ENB A;  2XWJ B;  1J5E L;  3OTO Q;  2Z6K C;  1VQ7 A;  4HED A;  4YIJ A;  3OW2 A;  5KYI A;  4TQU S;  3G48 A;  4DV5 L;  4N9P A;  4A3I H;  1LLR D;  4A3F B;  3HOV B;  2EY6 A;  1FNU A;  3MA2 B;  2VNU D;  5JVH 3;  5C4X G;  4KMU C;  2ATW A;  4R8N A;  1WCM H;  5D3I B;  1Q81 C;  2I0Q A;  4DAY B;  4JI0 L;  2R7Z H;  4JV5 L;  2JA5 B;  3DEP A;  3D4R A;  1KIX A;  2UXB L;  2IHE A;  3S16 H;  2E5L L;  2EY5 A;  5DNF A;  4YHH Q;  3QG1 A;  2I5L X;  4A3K G;  2UXD L;  5HGQ A;  1NY4 A;  1NUC A;  4A3G G;  2KUM A;  2A68 C;  1HR0 Q;  3QO2 A;  4RWS C;  4KKT A;  4DK6 C;  3H09 A;  1EIF A;  3A5U A;  1IYU A;  4L6T B;  5CV5 A;  4OWT B;  4JK1 C;  1VQN A;  1LT4 D;  2ZTC A;  3BG3 A;  1ESR A;  1Q8K A;  2KCM A;  2A6E D;  2EIF A;  5ELF A;  1OTC A;  5EKI A;  2CH4 A;  2Y0S E;  3HOY H;  3NEM A;  2F0F A;  1SYC A;  2N78 A;  1Q7Y C;  3RLO A;  4DXG A;  3I7F A;  4GOP C;  4CDC C;  2F4V Q;  3J7A V;  4BY1 G;  1VQP A;  1N9W A;  1XMO Q;  3R93 A;  3HOX G;  3NHH A;  1I6V C;  1Z7T A;  2KA7 A;  3M85 A;  2L11 A;  2MP1 A;  1QNK A;  5FK9 C;  1DOM A;  1EY5 A;  3VYR A;  1KRS A;  3R8B A;  2XN9 C;  4O42 A;  4P74 A;  1G8Z D;  3H0G G;  4GNX A;  1LT5 D;  1H9M A;  4ZQ3 A;  4DR5 Q;  1EYC A;  2Q2I A;  2MFI A;  1HQM C;  2K5H A;  3E5S A;  4DNR B;  1T5X D;  4BY7 H;  4A3F G;  3D0F A;  2K4K A;  3HOV G;  1D1I A;  1EZ6 A;  2RDH A;  1U4R A;  3L3O C;  2EQS A;  2R3Z A;  1E7Z A;  1L1O B;  2OF1 A;  4GNX B;  1SNQ A;  2N55 A;  2HT1 A;  2LXK A;  1K83 H;  5FLX L;  4X64 L;  2K04 A;  3HOU B;  1Z9F A;  2J4X A;  1S5E D;  1EU3 A;  4AYB E;  5IGE A;  3D6W A;  3D3R A;  1GUG A;  2RKS A;  3NBH A;  1IBL L;  2XGT A;  3AYH B;  3I4M H;  1HNZ Q;  4R9W A;  2VXW A;  1K8O A;  3GTK H;  5EBC A;  1PYS B;  5C5L A;  3S1R H;  1YHA A;  1CZW A;  4N8X 1;  2TMP A;  2XIW A;  4A3M B;  2K14 A;  3I73 A;  4L5S A;  2RQX A;  4DV4 L;  1H9J A;  4POG A;  4K8J A;  4WRD A;  5CV8 A;  1CTM A;  5IGC A;  1FD7 D;  3NBH B;  1MHW C;  2DNE A;  2EY1 A;  4JI5 Q;  1V1O A;  1X3P A;  3P75 A;  1X6O A;  4JW0 A;  1D1K A;  4YY3 L;  5C3E H;  3KUP A;  1CSQ A;  1V1Q A;  1B9M A;  3NXW A;  4DUZ Q;  1A3V A;  2AUK A;  2MO0 A;  4IAL A;  4E6I A;  3BJU A;  2Y0S B;  3CPF A;  3S1M B;  2EYH A;  4KHP Q;  3I4N H;  4LK1 C;  1J9O A;  5A2Q E;  1D8L A;  2K7V A;  1PYW D;  4C3J H;  1IBK L;  3I90 A;  1GM5 A;  1L1O C;  5LMU Q;  4G7O C;  4QIW B;  3K5N A;  4GNX C;  1II3 A;  2DJF C;  3M4O H;  1EY6 A;  5CR3 A;  1JIC A;  5IYD G;  1GO3 E;  4DR1 Q;  1L2F A;  4X3K A;  3QOL A;  4LF4 L;  1NR4 A;  1SNC A;  3OPO A;  4JBW A;  5M5X B;  1SE4 A;  1QG7 A;  1UE6 A;  2CWA A;  3VYU A;  4ZKC B;  3CCR A;  1DYQ A;  5IP7 H;  1IBM L;  4HSV A;  4B3S Q;  2BH8 A;  2ICI A;  4DU9 A;  3HOU G;  1ASZ A;  2MO1 A;  3G71 A;  3P20 A;  4DK0 A;  3BS1 A;  4FDB A;  4LF9 Q;  3CD6 A;  4HCS A;  2Q2U A;  1AH9 A;  1YNX A;  5D65 A;  1WJJ A;  1PTO D;  1KNA A;  3BDO A;  4IFD I;  1LTA D;  2DY7 A;  5BN3 A;  1XNR L;  4AYB B;  2R93 G;  4NB3 A;  1GKH A;  3HKZ E;  1U5K A;  2PZW A;  4QQB X;  1D5Z C;  1O7L A;  3KFU A;  2GVA A;  2IPK D;  4ZUJ A;  1OXT A;  3PO3 G;  3CAM A;  2CCZ A;  1EIY B;  4A3L G;  3K80 C;  3PUV A;  1HR0 W;  4G7Z C;  2ASB A;  4GLV B;  1XMQ Q;  1BBX C;  2Y0S G;  1SYG A;  3ND8 A;  3RZD H;  1NMG A;  2C9O A;  4NDX A;  3BYT B;  1JWU D;  2IL8 A;  1X65 A;  1XPO A;  2EJM A;  3IRB A;  5FO8 B;  1VQB A;  5AJ3 L;  3J81 c;  4BBR B;  3NK9 A;  1PDQ A;  2TSS A;  1IKL A;  4A3B B;  2LSS A;  1F9S A;  4RCN A;  1XWE A;  1DXM A;  4TRD A;  2V1C C;  2F3W A;  3V96 A;  3HGB A;  1CQV A;  1STG A;  2Q8T A;  1U4P A;  4CJ0 B;  5IE8 A;  5C0X G;  3Q24 A;  4JI4 Q;  3Q8D A;  1MSH A;  2A6H D;  4OWW B;  2I5H A;  1PXU A;  4R4T A;  5TSS A;  5HGT A;  4GN5 A;  4MZ9 A;  3PO2 B;  2HD3 A;  2C5C A;  3MFG A;  1H9S A;  1WVL A;  5JJL A;  1I4G A;  3A8J E;  4FO2 A;  4UP8 A;  5I6W A;  3K81 C;  1W2B A;  4JBJ A;  2JA6 B;  4NW2 A;  4UAI A;  2EYL A;  4IUV A;  2O4X A;  3P1H A;  4OEL B;  3W1G A;  4F88 A;  3PV0 A;  2L15 A;  5M3M B;  3MXP A;  5FKA C;  2NYZ D;  4K14 A;  5FLM H;  1BOS A;  2XVS A;  1A2U A;  5IWA L;  4JI8 Q;  5CGK A;  1PFB A;  1SBB B;  2UUB Q;  4K5W A;  1E2V A;  4U67 3;  2NTS A;  2ICE C;  4AH6 A;  4XQJ A;  4LF5 Q;  1ONL A;  3ERO A;  4DGZ A;  4FF1 A;  2KJX A;  3UDX A;  4BBR G;  2FMM A;  4ZKB B;  3CCV A;  1TII D;  1SYF A;  5M9O A;  4A3B G;  2HDL A;  4RHR A;  2K01 A;  3VR2 A;  3PIO 3;  2I46 A;  1SAP A;  1X3E A;  2B2V A;  2FJ2 A;  3OW7 A;  3A8K E;  1J8I A;  2H5X A;  4P72 A;  1O80 A;  3CPW A;  5KGU A;  2B3G A;  1K9M C;  4IFD J;  2KCT A;  1DOL A;  2L0C A;  3LWU A;  3S1Q H;  4CHT B;  2K28 A;  3HOZ H;  1SJH D;  5IYB H;  4H0L C;  3H94 A;  3NEN A;  2VQF Q;  3M7N A;  3T4A C;  5EPJ A;  1N36 Q;  1VQ5 A;  5G3L F;  1IW7 C;  4LFC L;  1CKM A;  1S5F D;  3PO2 G;  1Q8I A;  4DR3 Q;  2GVB A;  1I3Q H;  1RF2 D;  1JWM D;  3MWY W;  3U9O A;  3H15 A;  5IT9 L;  1Y1V B;  2K05 A;  4IUQ A;  2GA4 B;  1QZH A;  4LAA A;  3NBI A;  1UAP A;  3MVV A;  1PH9 A;  2E76 C;  2RDF A;  1F2M A;  1NJI C;  1ENC A;  1PZI D;  3FKI B;  1XMQ L;  2HCI A;  3S14 H;  4I7A A;  1BCP D;  5C4Z A;  4IOC A;  1ZEQ X;  1KAA A;  3LGJ A;  2YTX A;  1SND A;  1WTP A;  5CYU A;  4X65 Q;  3GV3 A;  2JA8 B;  2B63 H;  2NVQ B;  1TWF H;  1VDZ A;  4P71 A;  2ALY B;  4XQN A;  5C4J B;  1VQC A;  3F2C A;  4A93 B;  1K3R A;  2MGS A;  4M1U B;  4L5T A;  5IGG A;  5L37 A;  4YCU A;  1EY7 A;  1VMP A;  3GQB A;  4B3R L;  4H44 C;  1ZXT A;  4PZ7 A;  1VQM A;  1CSP A;  1LTS D;  3J81 E;  3VR5 A;  1NCV A;  1N32 Q;  1I4H A;  3WOF A;  3K7A B;  5JPN C;  3TRE A;  3GTO B;  4NMZ A;  4R4O A;  5LMN Q;  2PPB C;  3ICE A;  3GTG B;  1YVC A;  2QCP X;  2JA7 H;  2HQL A;  4GLX A;  2XTI A;  3CCL A;  4RH6 A;  5FO9 B;  4DUY Q;  3EN2 A;  1AZQ A;  3M4Y A;  4B9W A;  2K75 A;  4NXN Q;  2Z6B A;  4DR4 Q;  3D31 A;  3K6O A;  1BKB A;  5GAG C;  2MUY A;  5BN4 A;  1YNN C;  2CVR A;  2BE5 D;  2F0Q A;  3FPU B;  4CDD C;  3L7Z C;  2EYF A;  1PTO H;  1E1O A;  5EJW A;  2P5Z X;  2BH2 A;  4CDE C;  1O7Z A;  2QW7 A;  1TS3 A;  2G5D A;  1AP0 A;  4DR6 L;  2JEB I;  2KQ3 A;  1SLJ A;  3FKI G;  1UE5 A;  1CA5 A;  5E1F A;  4WJ3 M;  1CM9 A;  1FL0 A;  4X3T A;  4LF8 Q;  1G2S A;  3F2D A;  2E2J B;  4FXD A;  3TP6 A;  3S2H H;  1C9O A;  2WFW A;  4UP9 A;  4LF5 L;  4Y52 H;  1M1K C;  2JA8 G;  4DR7 L;  4OIK A;  4XIG S;  4DV1 Q;  1YI2 A;  1HXY D;  4OX9 L;  4DR2 L;  1TXY A;  1TS2 A;  4BA1 I;  1HNW Q;  3W2D A;  2ZT9 C;  2K1B A;  3SK5 A;  5GAE C;  3CC2 A;  3V2T A;  2JSO A;  4JI6 Q;  2VUM B;  1JJC B;  2F1M A;  2NVX B;  4LUO A;  1NMF A;  4ZK9 B;  3GD7 A;  2I07 B;  3X3M A;  2JQO A;  3DWP A;  3CCJ A;  2HIV A;  2E2H H;  3NWT A;  2WIN B;  4RMF A;  2R93 H;  5A2Q L;  3TDQ A;  1R4Q B;  1A3U A;  2ZM6 Q;  1BF4 A;  5C44 H;  2YU9 B;  4UHV A;  5M3F B;  4A3E H;  1STY A;  2X6L A;  1K8A C;  3PO3 H;  3RMH A;  4HTH A;  1B50 A;  1VQ9 A;  1Y1W B;  3KDF A;  3GTP H;  4OXP A;  1LT3 D;  3E6Z X;  2K5V A;  3C1F A;  4C3H B;  2CQA A;  4IOA A;  4CGY B;  3BU2 A;  3IL8 A;  3HOW H;  5EGT A;  1HA5 A;  4MTN A;  3DMU A;  3T1Y Q;  1VQG A;  1PA6 A;  3F2B A;  3TRZ A;  1Y8P B;  1XX8 A;  3U58 A;  1QOH A;  4A75 A;  4P2C B;  3KDF B;  4B3T Q;  3KBX A;  3KLS A;  4XTC S;  1D6E C;  1JOK A;  1TR5 A;  3J7Z C;  1B3Q A;  1N32 L;  3B6Y A;  1GUT A;  4K2K A;  5JAV A;  3CP0 A;  3I70 A;  1SMY D;  5LMN L;  1VQE A;  4G4K A;  3TME A;  1MJE A;  1CA6 A;  4X66 L;  2AKW B;  1EQR A;  4IFD G;  2EE1 A;  1BXT A;  3UDI A;  3CCQ A;  1ICW A;  4TSS A;  3CCM A;  1S4Z A;  4DV0 Q;  3AMU A;  4FXG C;  1JC7 A;  4ZAI A;  4DUY L;  1F2Y A;  3AFP A;  5IGD A;  1RTN A;  2K32 A;  2WAQ B;  4A76 A;  3A56 A;  2M9V A;  2CKZ B;  2AQ1 B;  2PZT A;  2BA0 A;  4LWC A;  3H3V H;  3UE0 A;  4OO1 G;  2CW0 C;  4HMJ A;  3SDZ A;  2EZV A;  2B2T C;  2K6A A;  4OIJ A;  3PIP A;  5T1G A;  4DV2 L;  3S2D B;  1K3B C;  1XNQ L;  4A3D B;  1CKN A;  1PH5 A;  2K52 A;  4IJL A;  4DFA A;  1CKO A;  2Q2H A;  2G9H D;  1Y1W G;  2HHH Q;  5KRU A;  4H7B A;  2E2I H;  2B8F A;  4C3H G;  3CHB D;  4KJN A;  5CV9 A;  1PH8 A;  4K0K Q;  5HY6 A;  2J7Z A;  2RHQ B;  1CKN B;  5JJK A;  2OQ0 A;  3CCU A;  3PSI A;  1TY0 A;  2A73 B;  4GN4 B;  2IX0 A;  2RCF A;  4X62 Q;  4R4Q A;  3OOC A;  4YWK A;  5JJZ A;  1PFN A;  3AU7 A;  4ZCK A;  1H95 A;  1R9T H;  1MD2 D;  1AN8 A;  3PGZ A;  1CHP D;  1GOZ A;  1K0S A;  1UEA B;  5DAU A;  2F0G A;  2NVY H;  2MHV A;  2UUC L;  1EZ8 A;  2N8N A;  4OON A;  1Q3L A;  2KBN A;  2PCF B;  4JI7 L;  1JR0 D;  2JP1 A;  1YEZ A;  3MXU A;  3K5L A;  4IN3 A;  2NUC A;  3Q23 A;  4A3J B;  2LY7 A;  4QB4 A;  4KN4 C;  5C0X J;  1BUV T;  4JCV E;  4K5V A;  1HNX Q;  3DM3 A;  3J81 j;  5J1Z A;  1VQH A;  2JEA I;  1R4P B;  2F0P A;  4BBS B;  3K59 A;  2WAQ G;  1GVP A;  1LO5 D;  4GKK L;  5C6A A;  1I50 H;  4S3S A;  1KQS A;  1ILP A;  1AFP A;  1EQV A;  1HZC A;  4K6L A;  3T51 B;  2SNM A;  4ZUI A;  3S17 H;  3JAM L;  3UDG A;  1KDA A;  3BZD B;  4C3I G;  5BR8 Q;  3E0E A;  3ULJ A;  1C4Q A;  1Y69 U;  4A3D G;  3J80 c;  3T13 A;  5CC4 A;  4LF7 Q;  3ERQ A;  2NWG A;  3URY A;  3TN2 A;  2N49 A;  1F9Q A;  1EQQ A;  3MFY A;  2PZU A;  3IAY A;  1L1O A;  1HH2 P;  5GRO A;  1LAC A;  1PRT F;  4KV6 A;  5EPK A;  4KTA A;  2O2L D;  4XYO A;  2YTV A;  1YZ6 A;  3VA7 A;  1N8R C;  2NZO A;  1I6H H;  1WFQ A;  1FNW A;  4B3T L;  4JI1 L;  2QA4 A;  3X3N A;  5JVG 3;  4X3U A;  3OSO A;  4PG3 A;  3BDC A;  2NN6 G;  2KCC A;  1N34 Q;  4QGU A;  2JA5 G;  4EQP A;  4DV7 L;  1QIL A;  3RZO B;  3CC4 A;  1TWH B;  3DUZ A;  3MEH A;  3M3Y B;  3TS2 A;  2V4D A;  4QUF A;  4K6D A;  2F52 A;  2PQE A;  4JYA Q;  4DV0 L;  1YNJ C;  2D5D A;  2JE6 I;  3AEV A;  1TWG B;  3DXJ C;  5ELC A;  2A68 D;  2QEX A;  4A3J G;  3A74 A;  1A15 A;  3FMC A;  3EJI A;  1SN8 A;  2R92 B;  2I5M X;  1SYD A;  1AE3 A;  2F0H A;  5JEA J;  3NEL A;  3CME A;  1HTL D;  2RF4 A;  1N33 Q;  4UPA A;  1JE5 A;  3GTJ H;  1BVS A;  5D14 A;  2QEJ C;  1HHV A;  1RDP D;  2F0V A;  2B8G A;  2RSN A;  4F7X A;  3GTL H;  2X69 A;  2DN8 A;  4K8I A;  2VW9 A;  2WB1 E;  4P75 A;  3OTO L;  4LNQ A;  5IY0 A;  1FJG Q;  3JAM i;  3FKI H;  3BYY B;  4O0A A;  1RL2 A;  3J81 L;  4N9T A;  3A5Z B;  1KDB A;  3EBE A;  3S1N H;  1E0B A;  1CT1 D;  1L0W A;  5IOC A;  4HR7 B;  4HSP A;  1E24 A;  1EIH A;  1NTG A;  3W5O A;  4KHV A;  2BDN A;  2QKI C;  5IYC G;  1CUK A;  4YHH L;  1PYB A;  1PRT C;  4IPC A;  1CFM A;  1NSN S;  1A63 A;  4O2D A;  4JI3 Q;  3K7U C;  1C8C A;  1KDC A;  5C3X A;  1U4L A;  1VQJ A;  1HR0 L;  2NVT H;  2ES2 A;  3MXG A;  2RVL A;  3OIQ A;  2K33 A;  4RHS A;  3I2Z A;  4DK3 C;  2Z4H A;  4RCO A;  4FP5 D;  4RAU C;  2YYZ A;  4NXM Q;  3KF6 B;  4A3C G;  1V9P A;  1QB5 D;  3E0J A;  3CCS A;  4A3M G;  4KI0 A;  2R92 G;  1TS5 A;  3SK4 A;  2F4V L;  5M5Y B;  3KLS X;  3QR8 A;  1S3O A;  2Z4I A;  2KEC A;  1XMO L;  4EX5 A;  5I6Y A;  4HJ5 A;  5BR8 L;  4IZ8 A;  1YJ9 A;  2AWN A;  2CFM A;  5FLX c;  4LF7 L;  2WII B;  3A54 A;  1PH3 A;  1ICF B;  1BCP F;  4CKE A;  2VL6 A;  3GDE A;  4DR5 L;  1YHQ A;  2PNH A;  5K36 G;  2IJ0 A;  4Y7N B;  5ISR A;  3T1H Q;  1UE7 A;  3J80 E;  1M4V A;  1JJG A;  2ZJQ A;  1SE8 A;  1EU4 A;  2WB1 B;  1EY9 A;  1X55 A;  1TWC B;  1GHJ A;  4PMB A;  3J81 i;  1PHJ A;  3EQL C;  1PZJ D;  2AHO B;  1B3A A;  4FF3 A;  3ULL A;  1G6P A;  2L55 A;  4GKJ Q;  1TKW B;  2X6G A;  3NQT A;  2FMC A;  4YWM A;  2H1E A;  4DV3 Q;  1C7Y A;  3MAQ A;  4MN3 A;  5I9O A;  2JK8 A;  4A3I B;  2KEE A;  3CQZ H;  4H13 C;  3ER0 A;  1SEB D;  4X6A H;  3NPP A;  4A4I A;  1WCM B;  2R7Z B;  3G7L A;  1HNZ L;  2HUG A;  2RDG A;  4C56 C;  1EQT A;  1CQF A;  1HJP A;  1ASY A;  3S16 B;  4QJF A;  1B4O A;  2DJG C;  5IP9 H;  1RTO A;  2DY8 A;  4DF7 A;  4FF2 A;  3RUZ A;  4OHJ A;  3R2T A;  4OO1 H;  2EJG C;  4AYB G;  3EVQ A;  1WI5 A;  3ONA B;  5NUC A;  4JI5 L;  5BN5 A;  4HIM A;  1QVC A;  1TQO A;  1PH2 A;  1E22 A;  3GTQ H;  1FYC A;  2AQ3 B;  4R8I A;  4DUZ L;  4PMC A;  3VA5 A;  3GTM H;  3F1Z A;  4Q5V A;  3S15 H;  1HPC A;  2BOS A;  2UUA Q;  1EOV A;  4HN7 A;  3HKZ B;  4KHP L;  4B3M Q;  3U9S A;  3HOY B;  1TT2 A;  2EXD A;  4C2M H;  5LMU L;  2CHB D;  1TWA H;  3M9B A;  3C2P A;  1C0A A;  1EOT A;  2VB3 X;  1BR9 A;  1SSO A;  4Q0F A;  1V8Q A;  5E7N A;  4IUU A;  4DR1 L;  2DNC A;  4L63 B;  2WAC A;  5C4X H;  1T9H A;  1KHI A;  1EYA A;  1S5C D;  2EDG A;  3IKJ A;  4DA2 A;  1G91 A;  2EOT A;  1HA6 A;  3HKS A;  1TY2 A;  2JJQ A;  2N88 A;  1B2T A;  5I2X A;  4B3S L;  1JB7 A;  5J3B A;  3PUX A;  1VCI A;  1ZKO A;  4IPD A;  4A3K H;  2Z9H A;  3A7A B;  2L12 A;  4BY7 B;  5KNB A;  3K5O A;  3HP3 A;  2VS1 A;  3VYT A;  4A3I G;  1YHB A;  4A3G H;  1LM0 A;  3G6J B;  2M00 A;  1Q1B A;  1YIJ A;  4LF9 L;  2A69 C;  1E2W A;  1CI3 M;  1WCM G;  2R7Z G;  1NAP A;  2SNS A;  1SE3 A;  5JEA G;  4J15 A;  1K83 B;  1B70 B;  4IJH A;  2QDB A;  5EKK A;  1Y8O B;  1SFO B;  1PFM A;  1QVG A;  3NTI A;  3DM1 A;  2QIL A;  1UEB A;  3H91 A;  1T5E A;  4ZRZ A;  4ABN A;  3I4M B;  3U4Z A;  4Z9C B;  4BY1 H;  3GTK B;  2LXJ A;  1FR3 A;  2PQA A;  3K57 A;  3S1R B;  4C3I H;  3HOX H;  5M5W H;  1IXR A;  1X9N A;  1F2L A;  1G51 A;  2JA6 G;  1NE3 A;  2NZH A;  1E2Z A;  1EY8 A;  5LL6 X;  5M3M G;  3HKZ G;  5FLX E;  4LFB Q;  1Q1E A;  3M4Q A;  3H0G H;  3HOY G;  4HIK A;  3ZYY X;  5C3E B;  1G6Z A;  2PQA B;  4B9X A;  1S40 A;  1IYV A;  2IX1 A;  2F0M A;  3FEW X;  1XJV A;  4DPG A;  4A3F H;  3G4S A;  3HOV H;  3P7J A;  1EY4 A;  1I94 Q;  4ID6 A;  4KD4 A;  3I4N B;  2NN6 H;  3PF5 A;  3WDN A;  2JA5 H;  4C3J B;  1H9K A;  3TQY A;  3TZU A;  2OTJ A;  2L9H A;  2F0T A;  3T53 B;  3OMG A;  2ZTE A;  4LFA Q;  1ET9 A;  2AQ2 B;  3M4O B;  1TS4 A;  4MNO A;  2MNA A;  4JI4 L;  4QUC A;  1WTQ A;  1VF7 A;  1F9R A;  1FVI A;  1ZYR C;  4BY7 G;  2UXC Q;  4WOR A;  1JOO A;  3IFT A;  1SRO A;  4X3S A;  2K5W A;  5C5M A;  4JOI C;  2OTL A;  5KNC A;  4HID A;  4KLK A;  3NUC A;  1UWV A;  3PIP 3;  2UU9 Q;  1IW7 D;  3O13 A;  4UP7 A;  1PV4 A;  3E9I A;  2PO4 A;  1EWC A;  1VQA A;  3I4M G;  1B44 D;  2FIN B;  4L5Q A;  1Y1V G;  1HRJ A;  3OWE B;  3W3A A;  4DN4 M;  3C1E A;  3STB C;  4KY7 A;  1CZG A;  4IPH A;  4JI8 L;  1DOK A;  3MEF A;  2KED A;  2G9D A;  2LFN A;  4M8A A;  3TS0 A;  1E1T A;  4DV6 Q;  2UUB L;  2KCN A;  3J7A F;  1BO0 A;  2Q8R E;  3SR1 A;  3AQQ A;  1EWI A;  4TKO B;  1MKH A;  1YIT A;  2F0W A;  3BDL A;  3H6M A;  5IYD H;  1QJO A;  1LTT D;  4A93 G;  4JI2 Q;  3KF8 A;  1EL0 A;  3M4P A;  3RZD B;  1W6K A;  1GUS A;  5IT9 c;  1F77 A;  3I4N G;  1YJN A;  3V05 A;  1Z47 A;  2D0O A;  4NPS A;  4LUV A;  1M8A A;  1J5E Q;  3RZO H;  1PMR A;  2F0L A;  1ROD A;  3C3L A;  5ELD A;  3HOU H;  4XT1 B;  3OIP A;  4DV5 Q;  4PZ8 A;  4POF A;  1KD1 C;  3EFX D;  2EYJ A;  2QDL A;  3KF8 B;  1IL8 A;  1AEX A;  1E3P A;  2PYK A;  2VQF L;  3I4O A;  2N3S A;  1N36 L;  1UE1 A;  2E2D C;  3GO5 A;  4JV5 Q;  3RLN A;  4JG2 A;  3NSW A;  1GD7 A;  2UXB Q;  2B2T A;  4A3C H;  5IP7 G;  4HJ8 A;  2E74 C;  1V1P A;  4DR3 L;  4A3M H;  1P8L A;  2UXD Q;  1U4M A;  4N8F A;  3QB3 A;  1KLU D;  1YNN D;  1O7Y A;  3K58 A;  1EFI D;  4OWX B;  4WJW A;  4L5R C;  2XSC A;  3PUZ A;  1EUJ A;  2RA4 A;  2EYO A;  3TP5 A;  1OO9 B;  3N6R A;  4A3L H;  3TSS A;  2OWO A;  2HDM A;  2R6G A;  1VQI A;  2F0I A;  4CKC A;  2H4O A;  1WTX A;  1XTD A;  3I72 A;  4LFB L;  1V1P B;  4XYQ A;  4KY6 A;  4X65 L;  4JPB W;  5K36 H;  5G3L D;  3S1M H;  5I4D A;  4ZYS A;  1MI2 A;  4QF4 A;  5AFW A;  4LMQ D;  4DAM A;  1QVF A;  3PQI A;  4YCV A;  3H3V I;  1D2B A;  1JMC A; 
#chains in the Genus database with same CATH homology
 3RZD H;  4B3T L;  4JBM A;  1NMG A;  4JI1 L;  3S24 A;  2VQE Q;  2QA4 A;  3W1B A;  4AQY Q;  1HZ9 A;  1X65 A;  1XPO A;  4PG3 A;  3IRB A;  2WP8 J;  4QL5 A;  2NN6 G;  1N34 Q;  1VQB A;  5M5X H;  5AJ3 L;  3J81 c;  4PZ6 A;  4QGU A;  2JA5 G;  3HOZ G;  2HIX A;  1LUZ A;  4DV7 L;  1EYG A;  2LSS A;  3CC4 A;  2UXC L;  3TS2 A;  3BZK A;  2F52 A;  4R4I A;  4P73 A;  2VUM G;  4JYA Q;  4A3J H;  4DV0 L;  2V1C C;  3KYH C;  1K8G A;  3TEH B;  2JE6 I;  3AEV A;  3KLW A;  4NXN L;  1K0R A;  5IE8 A;  3VDY A;  4DR4 L;  4GS3 A;  5C0X G;  3PCO B;  4JI4 Q;  2QEX A;  4A3J G;  4BBS H;  3Q8D A;  2BA1 A;  3A74 A;  3CCE A;  1SN8 A;  1IL2 A;  3L0O A;  4X66 Q;  1K73 C;  4OWW B;  2I5H A;  2I5M X;  3PO2 G;  1AE3 A;  5JEA J;  4X64 Q;  1P16 A;  4R4T A;  3NEL A;  3CME A;  2UUA L;  4GN5 A;  4MZ9 A;  1U0L A;  4B3M L;  2RF4 A;  1N33 Q;  3PUY A;  4UPA A;  4BA2 I;  1JE5 A;  3GTJ H;  1BVS A;  5JJL A;  5M3F G;  1X3G A;  1IBL Q;  3CW2 C;  3GTL H;  2KHI A;  3PF4 A;  4BXX H;  4UP8 A;  3K81 C;  1W2B A;  4JBJ A;  1OXX K;  2KEN A;  2VW9 A;  2WB1 E;  4LF8 L;  4P75 A;  3CMA A;  3F8T A;  3W1G A;  3OTO L;  4LNQ A;  3PV0 A;  5IY0 A;  2L15 A;  4DV4 Q;  1FJG Q;  4LW1 A;  3JAM i;  3FKI H;  5C3E G;  3OYY A;  4O0A A;  1RL2 A;  4DV2 Q;  3HOU H;  5FLM H;  3A5Z B;  3EBE A;  4H02 A;  1SRU A;  1XNQ Q;  3S1N H;  5IWA L;  1L0W A;  4JI8 Q;  4JI2 L;  4DV1 L;  5IYC H;  1E24 A;  2A8V A;  4YY3 Q;  1NTG A;  2UUB Q;  5FLM G;  1HNW L;  4BBR H;  3W5O A;  1Y14 B;  2D62 A;  4A3B H;  4AH6 A;  1TWH H;  4JI6 L;  5IYC G;  1CUK A;  4YHH L;  1PYB A;  3I55 A;  4LF5 Q;  4IPC A;  3M3Y H;  4HJA A;  1A63 A;  4O2D A;  3UDX A;  4JI3 Q;  4BBR G;  3K7U C;  3CCV A;  1PH4 A;  4YWL A;  1IBK Q;  4EQ5 A;  4A3B G;  1VQJ A;  1HR0 L;  2CQO A;  1X3E A;  2NVT H;  1TWG H;  2C35 B;  2ES2 A;  4JI0 Q;  4LF6 Q;  4GN3 B;  2CWP A;  2H5X A;  4R4C A;  3A0J A;  4P72 A;  5GAD C;  3CPW A;  2E5L Q;  2B3G A;  3I2Z A;  1K9M C;  1KL9 A;  3PIO A;  4R1J A;  4DK3 C;  4LF4 Q;  2WAQ E;  2YTY A;  2R92 H;  2YYZ A;  4IFD J;  2KCT A;  2ZM6 L;  2UUC Q;  2ID0 A;  3KF6 B;  4NXM Q;  3U50 C;  3S1Q H;  1BBW A;  4A3C G;  1A0I A;  1IBM Q;  1V9P A;  3PO2 H;  3HOZ H;  4WJ4 A;  1B7Y B;  5IYB H;  1PH7 A;  4JI7 Q;  3NEN A;  2VQF Q;  3CCS A;  4A3M G;  3M7N A;  2R7D A;  4KI0 A;  3ZJY C;  2R92 G;  1N36 Q;  2F4V L;  5ELN A;  3KJO A;  1VQ5 A;  1S3O A;  4LFC L;  1XMO L;  4EX5 A;  1CKM A;  5C0X I;  4HJ5 A;  1MIU A;  3STB D;  5BR8 L;  2AWO A;  3J80 i;  3CF5 A;  5IYB G;  1YJ9 A;  1AE2 A;  3BZC A;  4JBK A;  2AWN A;  2CFM A;  3L2P A;  2GVB A;  4DR3 Q;  5FLX c;  1X54 A;  1I3Q H;  3U4V A;  4LF7 L;  3H15 A;  3WWV A;  1PH3 A;  4GKK Q;  5M3M H;  3T1Y L;  1XNR Q;  1PH6 A;  4RG1 A;  2VL6 A;  1QZH A;  3GDE A;  2A1A A;  1PH9 A;  4DR5 L;  1YHQ A;  2PNH A;  1XMQ L;  1NJI C;  5K36 G;  1I94 L;  4YCW A;  3S14 H;  3T1H Q;  1HZB A;  1UE7 A;  1I5F A;  4IOC A;  1JJG A;  2VQE L;  1SE8 A;  2MQH A;  3LGJ A;  2ZJQ A;  2YTX A;  2Z6K A;  3KJP A;  1X55 A;  4AQY L;  4QIW E;  1VQ8 A;  4DNI A;  2ZTD A;  4X65 Q;  4PMW A;  4LFA L;  3J81 i;  1LYL A;  2B63 H;  1TWF H;  1PHJ A;  4P71 A;  2AHO B;  2ALY B;  2RHS B;  1VQC A;  1M90 C;  3PO3 H;  3AFQ A;  3ULL A;  1K3R A;  3F2C A;  4GKJ Q;  4L5T A;  3JC6 6;  4JC0 A;  1B8A A;  1Q82 C;  4YCU A;  1G6P A;  4YWM A;  1IYJ B;  4DV3 Q;  1C7Y A;  4B3R L;  2B63 G;  4PZ7 A;  4JI1 Q;  1VQM A;  1CSP A;  2JK8 A;  3CQZ H;  1JJ2 A;  3ER0 A;  1N32 Q;  4X6A H;  4A4I A;  3TRE A;  5AJ3 Q;  1HNZ L;  1YJW A;  2Z0S A;  4R4O A;  5LMN Q;  4DV3 L;  3K0X A;  4DV7 Q;  1HJP A;  2UU9 L;  1ASY A;  3ICE A;  4QJF A;  1HZA A;  5IP9 H;  2OCE A;  1YVC A;  2JA7 H;  1KAW A;  3MXN B;  2HQL A;  3I56 A;  4GLX A;  2XTI A;  4BBS G;  1KC8 C;  5M5Y H;  3CCL A;  1KRT A;  1SFO H;  4DUY Q;  2B29 A;  3EN2 A;  1D7Q A;  2A19 A;  4AYB G;  5IP9 G;  3J7A 5;  1WI5 A;  2K75 A;  4KHZ A;  5FJ8 H;  4JI5 L;  4HIM A;  3D31 A;  3FP9 A;  4NXN Q;  1QVC A;  2JA7 G;  1PH2 A;  1VQL A;  4DR4 Q;  1BKB A;  5GAG C;  1X3F A;  1PVO A;  1E22 A;  3ULP A;  3GTQ H;  3K8A A;  1BBU A;  1Y1V H;  4DV6 L;  2PMZ E;  2HHH L;  4DUZ L;  4GLA C;  3GTM H;  3F1Z A;  3L7Z C;  4GOP A;  1E1O A;  1RIP A;  3S15 H;  4BXX G;  2UUA Q;  1XPR A;  1EOV A;  2BH2 A;  1WOC A;  1VQ4 A;  4HJ9 A;  4Y7N H;  4KHP L;  4B3M Q;  4K0K L;  4HIO A;  1VQO A;  4TVA B;  1X56 A;  2EXD A;  4C2M H;  5LMU L;  4DR6 L;  4QY7 A;  1TWA H;  1TWC H;  2JEB I;  3M9B A;  5LMN W;  1C0A A;  1SLJ A;  2YV5 A;  4X62 L;  3FKI G;  1UE5 A;  1OXS C;  4ALP A;  2JA8 H;  2NVQ H;  4WJ3 M;  2DGY A;  1YBY A;  1FL0 A;  5E7N A;  4AIM A;  5C4J H;  1Q46 A;  4DR1 L;  4GOP B;  4LF8 Q;  3F2D A;  4A93 H;  1O7I A;  5C4X H;  1T9H A;  3OTO Q;  2Z6K C;  1J5E L;  1KHI A;  1C9O A;  1VQ7 A;  3S2H H;  2QGQ A;  2WFW A;  4UP9 A;  4LF5 L;  4LUZ A;  3OW2 A;  1M1K C;  2JA8 G;  4Y52 H;  4DR7 L;  3HKS A;  4TQU S;  3JAM c;  3G48 A;  3KF6 A;  4DV5 L;  4A3I H;  2JJQ A;  3FHW A;  5IWA Q;  2VNU D;  4XIG S;  4DV1 Q;  1YI2 A;  4B3S L;  5C4X G;  1JB7 A;  4OX9 L;  4DR2 L;  5J3B A;  1TXY A;  1VCI A;  1WCM H;  3K7A H;  3PUX A;  4IPD A;  4DAY B;  4A3K H;  4BA1 I;  1Q81 C;  2I0Q A;  4JI0 L;  3GTO H;  1KIX A;  1HNW Q;  2UXB L;  4A3I G;  2VS1 A;  2ZJP A;  2IHE A;  1HNX L;  3S16 H;  1YHB A;  5GAE C;  3CC2 A;  1LM0 A;  2E5L L;  3GTG H;  4A3G H;  1Q1B A;  2PI2 E;  1YIJ A;  4JI6 Q;  4LF9 L;  4YHH Q;  1FGU A;  2I5L X;  4A3K G;  1WCM G;  2R7Z G;  1JJC B;  2UXD L;  5HGQ A;  1XPU A;  4LUO A;  1NY4 A;  5EAY A;  5JEA G;  4J15 A;  4A3G G;  1B70 B;  1NMF A;  4IJH A;  1SR3 A;  3KOJ A;  3GD7 A;  1HR0 Q;  2JQO A;  4DK6 C;  3CCJ A;  2HIV A;  3EIV A;  1VQK A;  1QVG A;  5JJI A;  1EIF A;  3A5U A;  2E2H H;  1EFW A;  2ATW A;  4OWT B;  4RMF A;  1UEB A;  1PFS A;  2R93 H;  1OXV A;  1VQN A;  1JT8 A;  3U4Z A;  2ZTC A;  1Q8K A;  2KCM A;  4BY1 H;  2ZM6 Q;  1J6Q A;  3ERS X;  2EIF A;  5C44 H;  2LXJ A;  2PQA A;  1OTC A;  4C3I H;  1VQF A;  3HOX H;  5M5W H;  1IXR A;  1X9N A;  1G51 A;  4A3E H;  2Y0S E;  2JA6 G;  3HOY H;  3NEM A;  1NE3 A;  2NZH A;  2N78 A;  1K8A C;  1Q7Y C;  3RLO A;  4GOP C;  3I7F A;  3RNU A;  1A62 A;  1QUQ A;  2F4V Q;  1A8V A;  4BY1 G;  1VQP A;  1VQ9 A;  5M3M G;  3KDF A;  3HKZ G;  1N9W A;  5C44 G;  1XMO Q;  4LFC Q;  3GTP H;  4OXP A;  2K5V A;  3PUW A;  4LFB Q;  3HOX G;  4IOA A;  1Q1E A;  3M4Q A;  3H0G H;  4A3E G;  1DGS A;  3HOY G;  3BU2 A;  3M85 A;  3G6E A;  3HOW H;  4HIK A;  2E2J H;  4OO1 I;  1VS0 A;  1KRS A;  1N34 L;  4MTN A;  2PQA B;  3T1Y Q;  1VQG A;  1S40 A;  2IX1 A;  2D0P A;  1XJV A;  2JA6 H;  4DPG A;  1PA6 A;  3F2B A;  4P74 A;  4GNX A;  3H0G G;  4A3F H;  3TRZ A;  3G4S A;  3HOV H;  3U58 A;  4A75 A;  3HOW G;  4DR5 Q;  1VQ6 A;  1QUQ B;  2Q2I A;  1I94 Q;  2MFI A;  3KDF B;  2K5H A;  3PF5 A;  4B3T Q;  4JYA L;  2VZA A;  2JA5 H;  3TQY A;  4XTC S;  4BY7 H;  2K5N A;  2OTJ A;  2ZTE A;  2K4K A;  3D0F A;  4A3F G;  3HOV G;  3J7Z C;  4LFA Q;  1N32 L;  3B6Y A;  1S72 A;  2EQS A;  4MNO A;  1E7Z A;  3CP0 A;  2PI2 A;  1L1O B;  2MNA A;  4JI4 L;  2VY3 A;  2VUM H;  5LMN L;  1FVI A;  1VQE A;  1MJE A;  4GNX B;  4BY7 G;  2NVX H;  2UXC Q;  2HT1 A;  2LXK A;  4X66 L;  2AKW B;  1EQR A;  4IFD G;  3UDI A;  1K83 H;  3CCQ A;  3RN5 A;  4B3R Q;  4X64 L;  3CCM A;  1Z9F A;  4IO9 A;  1SRO A;  1NBW A;  4DV0 Q;  1N33 L;  4AYB E;  4JOI C;  4DUY L;  2OTL A;  2R7F A;  3AFP A;  2IY5 B;  1QZG A;  1IBL L;  2XGT A;  3AYH B;  4HID A;  4UY8 C;  4KLK A;  4A76 A;  3RN2 A;  1HNZ Q;  3I4M H;  2CKZ B;  1UWV A;  1Q86 C;  2BA0 A;  4LWC A;  2UU9 Q;  3UE0 A;  3GTK H;  3H3V H;  4OO1 G;  1PYS B;  3S1R H;  1YHA A;  5FJ8 G;  2YU9 H;  4UP7 A;  5M3F H;  1PV4 A;  1OXU A;  2K14 A;  3E9I A;  1VQA A;  1FJG L;  4L5S A;  4DV4 L;  3I4M G;  3PIP A;  4L5Q A;  4POG A;  3SGI A;  4APV A;  4DV2 L;  1Y1V G;  2JA9 A;  1WYD A;  1Y1W H;  3STB C;  4DKA C;  1XNQ L;  3NBH B;  1CKN A;  4C3H H;  2K52 A;  4IJL A;  4IPH A;  5H1S E;  1PH5 A;  4JI5 Q;  2FXQ A;  4JI8 L;  2K50 A;  1CKO A;  1X6O A;  3MEF A;  2Q2H A;  4HJ7 A;  4YY3 L;  5C3E H;  3TS0 A;  1E1T A;  4DV6 Q;  2UUB L;  1CSQ A;  1V1Q A;  5DLQ E;  1Y1W G;  4DUZ Q;  3E9H A;  2HHH Q;  2MO0 A;  3AQQ A;  1EWI A;  2E2I H;  2WB1 G;  3BJU A;  1MKH A;  3CPF A;  2RCN A;  1YIT A;  4LF6 L;  3CXC A;  2DUD A;  1PH8 A;  4KHP Q;  3I4N H;  4K0K Q;  2IT1 A;  1D8L A;  5IYD H;  5HY6 A;  4JI3 L;  4C3J H;  2RHQ B;  1CKN B;  4ME3 A;  1IBK L;  5JJK A;  1GM5 A;  2OQ0 A;  1L1O C;  5LMU Q;  4DR6 Q;  3CCU A;  3PSI A;  4JI2 Q;  4A93 G;  4GN4 B;  4GNX C;  2IX0 A;  4JV5 L;  3M4P A;  4X62 Q;  4R4Q A;  2R7Z H;  5IT9 c;  3M4O H;  4YWK A;  3I4N G;  3HFZ B;  5IYD G;  1YJN A;  2IHF A;  1GO3 E;  4DR1 Q;  1H95 A;  1L2F A;  1Z47 A;  2D0O A;  4NPS A;  1PH1 A;  1VQD A;  1R9T H;  1KXL A;  4LUV A;  1J5E Q;  3RZO H;  3PGZ A;  5GQO A;  4LF4 L;  4JBW A;  4JOI A;  2NVY H;  2OQK A;  1UE6 A;  2CWA A;  2N8N A;  4OON A;  3CCR A;  4DV5 Q;  2UUC L;  2KBN A;  1MJC A;  4NXM L;  4PZ8 A;  5IP7 H;  1IBM L;  4POF A;  1KD1 C;  1SMX A;  1G29 1;  2AMC B;  3KF8 B;  1E3P A;  4B3S Q;  2GN5 A;  1YEZ A;  4JI7 L;  2VQF L;  2BH8 A;  4OX9 Q;  3I4O A;  4DR2 Q;  2N3S A;  1N36 L;  1UE1 A;  3GO5 A;  4JV5 Q;  3RLN A;  3UE1 A;  4JG2 A;  1ASZ A;  2MO1 A;  3HOU G;  5C0X J;  1GD7 A;  1Q12 A;  4JCV E;  3G71 A;  4A3C H;  2UXB Q;  1HNX Q;  5IP7 G;  4IPG A;  1V43 A;  3DM3 A;  3RLF A;  4HJ8 A;  2NN6 I;  3J81 j;  3CD6 A;  4FDB A;  4LF9 Q;  1LTL A;  4DR3 L;  4A3M H;  1VQH A;  2Q2U A;  1P8L A;  2JEA I;  1AH9 A;  1YNX A;  2UXD Q;  1WJJ A;  2WAQ G;  2Q2T A;  4DR7 Q;  1GVP A;  4GKK L;  5GAH C;  4IFD I;  1XNR L;  1IZ6 A;  1I50 H;  3S2D H;  2ZJR A;  1KQS A;  4OWX B;  2R93 G;  4A3D H;  4NB3 A;  4L5R C;  1GKH A;  1EUJ A;  1HZC A;  3PUZ A;  3HKZ E;  3RR5 A;  1U5K A;  2NZO A;  4QQB X;  4A3L H;  2E8G A;  2OWO A;  2R6G A;  3T1H L;  1VQI A;  3KFU A;  3S17 H;  2GVA A;  3DLL A;  3UDG A;  1XTD A;  2KHJ A;  5BR8 Q;  3CC7 A;  4LFB L;  3E0E A;  3ULJ A;  3UDF A;  4A3D G;  1OXT A;  3J80 c;  4X65 L;  4LF7 Q;  3CAM A;  5ELO A;  1W3S A;  3PO3 G;  2N49 A;  1EQQ A;  2CCZ A;  3K80 C;  1EIY B;  3S1M H;  4A3L G;  1L1O A;  3PUV A;  1HH2 P;  5GRO A;  1HR0 W;  4DAM A;  2F3I A;  1QVF A;  4GKJ L;  2ASB A;  4YCV A;  4GLV B;  1XMQ Q;  2YTV A;  1YZ6 A;  1N8R C;  3H3V I;  2Y0S G;  1I6H H;  1WFQ A;  1JMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...