2K75A

Solution nmr structure of the ob domain of ta0387 from thermoplasma acidophilum. northeast structural genomics consortium target tar80b.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
106
structure length
106
Chain Sequence
SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Ta0387
publication title Solution NMR structure of the OB domain of Ta0387 from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum
molecule tags Dna binding protein
total genus 12
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k75A01
2B63G 1G51A 2V1CC 1XPOA 2E8GA 3GTGH 4GOPC 5C44G 5JJIA 1YNXA 2UUBL 1V43A 3EBEA 4J15A 2MNAA 5LMNQ 2E5LQ 1N34L 1YEZA 3WWVA 1QVFA 1FGUA 3CCMA 3HOUH 4JOIC 1S3OA 2VUMH 1J5EL 3PO2G 4DK6C 2D62A 3J81j 3IRBA 4DV6Q 3B6YA 1HNWQ 2AMCB 4DK3C 3RLOA 1VQNA 3KFUA 2QGQA 3CCUA 2LXJA 1I94L 1VQLA 4DR4L 1SN8A 1P8LA 2HIXA 2JEBI 2RHQB 5IP9H 1XMOL 3CQZH 2KENA 4LF9L 4JI0L 4JV5Q 4GNXA 1FL0A 3PIPA 1Q1EA 2MFIA 4LF5L 1UWVA 4DV1L 2JA7G 4HIDA 3FHWA 2EQSA 3CPFA 2IHFA 1XMQL 1VQJA 1I6HH 4JI2L 2F4VL 2VW9A 1X3FA 2Z6KA 3BZKA 1G291 4YCUA 2KHJA 3D0FA 5EAYA 1EYGA 4JOIA 1RL2A 3GD7A 1X55A 3S14H 4OO1G 5IWAL 1HH2P 4L5SA 5GAHC 1TWGH 4MNOA 4EX5A 4HJAA 5E7NA 1X9NA 4A3DG 2VQEQ 4A3CG 1PH2A 1N33Q 2IHEA 2UUAL 3KDFB 4GN5A 1VQ8A 2GVAA 4DV4L 2CWPA 4GLVB 1Q7YC 5C44H 4LF6Q 3PGZA 5IE8A 2A1AA 2NZOA 4YWLA 3MXNB 4BA1I 5JEAJ 2ES2A 1Q46A 4JI1Q 4AH6A 4LF7Q 4NXNQ 1LM0A 2B3GA 2Q2UA 3JAMc 1VQAA 3I4MG 2CQOA 1J6QA 3PUZA 4X6AH 2VZAA 4R4QA 1OXVA 3M9BA 4LNQA 1PFSA 4PZ8A 2L15A 4B3MQ 4PZ7A 1RIPA 5LMUQ 2E2JH 4IOAA 4X65L 2ASBA 1M90C 1MKHA 3KJPA 3FKIG 3CD6A 3S15H 1KL9A 4UY8C 4JI3Q 1FJGQ 2RCNA 4NB3A 2I5MX 4JG2A 1S72A 5IYBH 2NVYH 1Q12A 2VY3A 3ER0A 1ASYA 2JA7H 1HJPA 4DV5Q 1XNRL 4JI4Q 4AIMA 1YJ9A 1EOVA 5IYDG 4X64L 3G48A 2ZM6L 4DV7L 4A3LG 3AFQA 3KOJA 1UE1A 2JA5G 4B3RQ 1QZGA 4GLAC 3UDFA 3CCRA 3CCEA 4GN4B 1KD1C 4DR5Q 3DM3A 1IBKQ 1PA6A 1VQCA 3K81C 2JA6H 4PMWA 3GTLH 3PV0A 1KQSA 4R1JA 1HR0W 4K0KL 4A3CH 5C4XG 3BU2A 4IFDI 4DR2L 3CC7A 3EIVA 3UDIA 3F8TA 4GKKL 3M85A 3CCVA 2UUBQ 1Q1BA 4TVAB 2CCZA 2JQOA 1VQEA 2HIVA 3CMEA 1H95A 4WJ3M 1PH5A 1TWFH 3RN5A 3I4MH 4GN3B 1PH1A 2KHIA 3J80i 2BH2A 3S2HH 2ZTEA 1WFQA 4DV0L 1VQ5A 1CKOA 3KYHC 1HZAA 1O7IA 1P16A 1X65A 1YHBA 2N49A 4JBWA 2HT1A 4A4IA 3TEHB 4C3JH 3OW2A 1VQDA 5ELNA 4HJ5A 1YJWA 1OXTA 1QUQB 1MJEA 3S1MH 3FKIH 4A93G 1I94Q 2D0OA 1E1TA 1PH4A 4B3SQ 4BY7G 3L2PA 3A5UA 4A3KG 4A76A 1XMOQ 1VQKA 4A3FG 4A3BG 4KHPQ 5JJKA 4DR6Q 4JI0Q 1HR0L 1VQFA 2K5HA 2OCEA 3BZCA 2Y0SG 4MTNA 4A3MG 3G71A 1KIXA 2BH8A 1DGSA 3K80C 4JI8L 2UUCQ 3HOVH 3RZOH 3T1YQ 3ERSX 2UXBQ 5IYDH 4A3LH 3ICEA 2YTXA 3NENA 3OYYA 4PZ6A 2VL6A 4HIKA 1SROA 2CKZB 3K7AH 3PO3G 4JC0A 1NMFA 5C4XH 3RR5A 3I4NG 5M3FH 1Q82C 1JE5A 3OTOL 2IX1A 1L2FA 3KF6A 1I50H 3HOWG 1B7YB 4OWTB 5IT9c 4C3HH 1UEBA 3CMAA 2OQKA 2NN6I 1WCMG 1BVSA 4IJLA 4DR7L 4NXML 1CKNA 2ZTCA 2HHHL 3S24A 1GKHA 2I5LX 4LFBL 4ME3A 2QEXA 4P73A 4AQYL 1SRUA 2UU9L 4X65Q 4FDBA 3SGIA 4R4OA 4ALPA 4A93H 4BY1G 4LF8Q 4LUOA 3S2DH 1VQPA 4LW1A 4GKJL 4A3GG 4YY3L 1GD7A 4BY7H 4DV2L 1L1OC 4A3FH 1IBMQ 2Y0SE 4A3BH 4HJ9A 2YU9H 4DAMA 4DR3Q 3GTQH 1NMGA 4A3MH 1K73C 4X66L 4XTCS 3F2DA 1N32L 3BJUA 4LUVA 4DV7Q 3M3YH 5AJ3L 5BR8L 1JJ2A 1E24A 1D8LA 4POFA 4GOPA 4A3IH 1NBWA 1Y1VG 3I4NH 4K0KQ 2A19A 1K3RA 4DR2Q 1HNZQ 3U58A 1TXYA 3W1GA 2AWOA 4BBSH 3HOWH 4JYAL 4GKKQ 1BBWA 3LGJA 1X56A 1L1OA 2K75A 1A8VA 5GQOA 4DV3Q 4LF4L 1KHIA 4C2MH 2I0QA 1KXLA 2QA4A 1HNXL 5M3MG 2JA9A 2YYZA 1Q86C 4OX9L 4HIOA 2B63H 1WYDA 4JI5Q 3G6EA 4DV0Q 5C0XI 1D7QA 1VQ4A 2ZJRA 3E0EA 2NVQH 4GLXA 1XNQL 1EUJA 4IPDA 1KRSA 5DLQE 3TREA 3PUVA 3RZDH 3AFPA 2ZJQA 5LMNW 4LWCA 3PO2H 1X6OA 2R6GA 3CAMA 1K8AC 1K83H 2N78A 4IJHA 2ZJPA 1BBUA 3TS0A 2IT1A 1HR0Q 1EWIA 4IPCA 4LUZA 5FJ8G 4JI8Q 4DUYL 2WAQG 4A75A 3HFZB 4DR1L 4P74A 4KHZA 1CKNB 3NEMA 3K8AA 3GO5A 1EIFA 4DUZQ 1IYJB 4UP9A 4UPAA 3CCSA 3S17H 3JC66 3HOXG 5J3BA 4YCVA 3H15A 3FP9A 2VQFL 1JJGA 1XTDA 1Y1VH 4YHHL 1I5FA 1N9WA 1X54A 4RG1A 3PIOA 1A63A 1NJIC 4TQUS 2PQAA 1SFOH 1W3SA 2N3SA 2E5LL 5LMNL 1YITA 2KCTA 1PV4A 1C0AA 2NVXH 2JA8G 4A3DH 2UXDL 5HGQA 4DR7Q 4NXMQ 1X3EA 5M3MH 5H1SE 2F3IA 4UP8A 2HHHQ 4POGA 1B8AA 4IFDG 1SLJA 1K9MC 3CC2A 4DV6L 3H3VH 4LFBQ 3HKZG 4AQYQ 3E9IA 3PSIA 1WI5A 2WB1G 5IYCG 4GNXB 2AHOB 2E2HH 1JB7A 2R92G 2R93G 1N34Q 4QJFA 3CXCA 3I56A 4GOPB 4P75A 3CPWA 3E9HA 4OONA 2CWAA 1J5EQ 1I3QH 4YY3Q 4R4TA 2F52A 1PH3A 2R7FA 4JBJA 5M5XH 4X66Q 3W5OA 3PUYA 5M5YH 4WJ4A 4DR4Q 1YHAA 2FXQA 4YWMA 2E2IH 2WP8J 3J7ZC 4LF9Q 1IBLL 1QZHA 4L5RC 1OTCA 3VDYA 4LF5Q 4JI7L 5ELOA 3HOXH 2KBNA 3UE1A 1JJCB 4NPSA 3J80c 1AE2A 1LUZA 4DV1Q 4H02A 1M1KC 1HZBA 1XMQQ 4JI2Q 1N33L 2F4VQ 5GAGC 1VCIA 3CW2C 5C0XJ 3I4OA 1JMCA 2JA5H 3TRZA 4LF6L 5IWAQ 2K52A 4DR6L 3T1HL 4JI1L 4LF4Q 2JA8H 3CP0A 5GADC 1YJNA 5GAEC 3A74A 2PI2A 3NELA 3HKZE 5C4JH 2UUAQ 4BA2I 2WB1E 4B3ML 4QL5A 1Z9FA 5IP7G 5LMUL 4DV4Q 3ULPA 4DKAC 3F1ZA 4Y7NH 2C35B 2DUDA 3HOZG 3KJOA 1YHQA 2R93H 3PUWA 1XNQQ 3W1BA 2PMZE 2NN6G 2YV5A 4OXPA 3U4ZA 3KDFA 3GDEA 1VQ9A 4JI3L 4RMFA 3RNUA 1OXUA 2MO0A 1FJGL 2OWOA 2I5HA 1YI2A 5IY0A 4EQ5A 1TWHH 4R4IA 1Y1WG 5FLXc 4DUYQ 1SE8A 4JI4L 3U50C 1PVOA 4C3IH 1G6PA 4A3KH 1E3PA 3GTPH 4LFCL 2AWNA 3PUXA 4O2DA 4A3JG 4B3RL 2ALYB 2A8VA 4L5QA 1V1QA 1E22A 1IBKL 4A3GH 3HKSA 4IPHA 4UP7A 5C3EG 2MQHA 1XNRQ 4HIMA 1NE3A 3L7ZC 1LYLA 4PG3A 1N36L 1IL2A 4X64Q 3K0XA 2ZM6Q 4L5TA 5K36G 3RLNA 3S1RH 1CKMA 2IY5B 1MJCA 3GTMH 1EQRA 3NBHB 3HOYG 3PO3H 4KLKA 2UXDQ 2Z6KC 3RN2A 3M7NA 4BXXG 3CF5A 1YIJA 4JBKA 4YCWA 1R9TH 5IP7H 4AYBG 1K8GA 2R7ZH 2JJQA 1VS0A 1UE5A 4P72A 2UXCL 3UDGA 4B3TL 2YTYA 1Q8KA 4JI6L 1WCMH 2Q2IA 3HOZH 3K7UC 2D0PA 2DGYA 2OQ0A 2UXBL 1S40A 3CCQA 1X3GA 1YZ6A 3J81i 4B3SL 4KHPL 4OWWB 1TWAH 3A0JA 4KI0A 1GVPA 1E1OA 3H0GG 1KRTA 3UDXA 5C0XG 5IYBG 2ZTDA 2JK8A 4X62L 1Y1WH 2UUCL 3PF5A 4BY1H 1FVIA 3T1YL 2GVBA 1U5KA 1Y14B 3KF8B 3STBD 4OO1I 3JAMi 3CC4A 3KF6B 1AE3A 3GTOH 1VQOA 2K4KA 4A3JH 3A5ZB 1IZ6A 2ID0A 1IBLQ 2Q2TA 2JE6I 1AH9A 1QUQA 4JI7Q 4QQBX 3PCOB 5C3EH 4IFDJ 3J81c 2JA6G 2ATWA 1PH9A 1SR3A 1VQMA 3H3VI 3STBC 5HY6A 3ULJA 2K14A 3EN2A 3HOYH 3T1HQ 1PH6A 1NTGA 1YBYA 1L0WA 4BBRG 1K0RA 1UE7A 1JT8A 3UE0A 1PYSB 4BXXH 1EIYB 3S16H 1HZCA 4LFAL 3OTOQ 2OTJA 4AYBE 4HJ7A 4OWXB 1VQGA 2MO1A 2LSSA 3RLFA 3S1QH 2KCMA 3M4PA 1CSPA 1PHJA 2CFMA 2XGTA 2IX0A 1EQQA 4LF8L 2GN5A 3AEVA 3I2ZA 2H5XA 2EXDA 2XTIA 1VQ7A 2JEAI 1IBML 3H0GH 3G4SA 2UU9Q 4DR3L 3GTKH 1SMXA 3TS2A 5M5WH 1KAWA 4IOCA 3HOVG 2RF4A 5JEAG 4IO9A 1GO3E 2R7DA 4GKJQ 4QIWE 1PYBA 4DAYB 3S1NH 4DV2Q 1U0LA 4LFCQ 4JV5L 4Y52H 3Q8DA 3CCLA 2HQLA 2WAQE 5FJ8H 1V9PA 1L1OB 4IPGA 3I7FA 2LXKA 1XJVA 1XPRA 1C7YA 2K50A 5M3FG 1OXSC 2K5VA 3D31A 1N36Q 1HNZL 1KC8C 1N32Q 2WFWA 1C9OA 4A3EG 1Z47A 5AJ3Q 5BR8Q 1OXXK 4HJ8A 4DV3L 2OTLA 3F2BA 3PF4A 4BBRH 3U4VA 2VQEL 1WJJA 5FLMG 1EFWA 3ULLA 2VNUD 4QY7A 1CSQA 3M4OH 1HZ9A 4JYAQ 1E7ZA 4JI5L 2R7ZG 3J7A5 5GROA 3F2CA 1PH7A 2NVTH 4DPGA 3DLLA 4NXNL 3TQYA 4LF7L 1HNWL 4O0AA 2UXCQ 3KLWA 4B3TQ 4JI6Q 4LFAQ 1QVCA 3HOUG 3AQQA 2N8NA 1HNXQ 1PH8A 4R4CA 1QVGA 4OX9Q 4JBMA 2VUMG 4APVA 2BA0A 3L0OA 2B29A 4MZ9A 1WOCA 1A0IA 3CCJA 1IXRA 2RHSB 4P71A 1N8RC 1B70B 5IYCH 3MEFA 2R92H 1XPUA 4X62Q 3M4QA 4JCVE 1GM5A 1VQBA 1VQHA 5IP9G 2YTVA 5JJLA 1NY4A 2PQAB 4DUZL 1ASZA 1VQ6A 3I55A 1BKBA 1CUKA 3GTJH 3ZJYC 1VQIA 2VS1A 2BA1A 2NZHA 4DNIA 4DV5L 4A3IG 1T9HA 1TWCH 4XIGS 4DR1Q 2K5NA 1MIUA 4GS3A 4A3EH 1W2BA 4BBSG 2Q2HA 4DR5L 2EIFA 2PI2E 4QGUA 2AKWB 2VQFQ 5FLMH 4YHHQ 1Q81C 2Z0SA 1A62A 3AYHB 1LTLA 1UE6A 4GNXC 4YWKA 2PNHA 1YVCA
chains in the Genus database with same CATH superfamily
1XPOA 1VF5C 5C44G 1SNQA 2UUBL 4J15A 1PRTD 2QW7A 1YEZA 2K05A 4I7AA 1GUGA 2WB1B 4JOIC 4Y7NB 3KK7A 2VUMH 1EY5A 3PO2G 3P20A 3J81j 5CV5A 3B6YA 1JOKA 1SYCA 2PMZB 2F1MA 3OIPA 3CCUA 3QB3A 1BO0A 1Z7TA 1SN8A 2RHQB 2KENA 1SMYC 4GNXA 1B50A 1V1PB 2JA7G 2K33A 4I7ZC 2O5IC 4JI2L 2VW9A 1PMRA 4YCUA 4OO1G 3GD7A 5IWAL 4CBVA 1HH2P 4MNOA 4HJAA 1UAPA 1X9NA 1AP0A 1I6VC 2EVBA 4GN5A 1Q3LA 1HXYD 2PNRC 2MP1A 4GLVB 3PGZA 1SDFA 4YWLA 3MXNB 4BA1I 4LF7Q 3KFUA 1HNWQ 1BBXC 3I4MG 2B2VA 5FKAC 1ZEQX 3BDOA 3TZDA 3M9BA 4LNQA 2L15A 1GUWA 4PZ7A 3H09A 1E2VA 1JOOA 3FMCA 5ELBA 4C56C 2XRSD 1MKHA 1TWAB 2F0NA 2L11A 2SEBD 2F0SA 3S15H 4UY8C 4JI3Q 1H9KA 1QOHA 1D1IA 5EPLA 5IT9E 4DXFA 2NVYH 1ET9A 3S14B 5EKIA 4DV5Q 1F9SA 2XNAC 4AIMA 1TWGB 4X64L 2ZM6L 4DV7L 2PZWA 3AFQA 3TDQA 1UE1A 1QZGA 4GN4B 1KD1C 1VQCA 5ELDA 4PMWA 1HR0W 4R1JA 3HOYB 2PZTA 4B9WA 4RGTA 5IGFA 3CC7A 2CQAA 1ENAA 4J6HA 2HIVA 1H95A 3TBIB 2BH2A 3DWPA 1B9MA 2DNEA 1P16A 4NMZA 3SEBA 1ICFB 1VQDA 5ELNA 4HJ5A 1YJWA 5I6WA 4J8QA 4KN4C 2N88A 2CVRA 5M5WB 3A5UA 3G71A 1KIXA 1TY0A 5CC4A 5IODA 3T1YQ 5I2XA 1LT5D 3X3NA 3VR5A 2B2UC 5FK9C 1LV9A 2QDLA 1YNND 1HCZA 3PO3G 3K5OA 1Q82C 4FYDA 5IT9c 4IQZA 3I4MB 1EEFD 4IJLA 1BVSA 4NXML 1CKNA 4OHJA 1MSHA 1FYCA 1PXUA 4P73A 3RMHA 1SRUA 1L0XB 1BOSA 3A54A 5J39A 1F9QA 1U4RA 4R4OA 1O7YA 4A93H 4BY1G 4LF8Q 3RUZA 4OELB 3S2DH 4GKJL 4LW1A 1LTSD 4S3SA 3RZOB 2PCFB 3ONAB 1NUCA 1NMGA 4A3MH 4KD4A 4XTCS 3K7AB 1N32L 3BJUA 1TWCB 2TMPA 5CMDA 5M3FB 5BR8L 2O2LD 1E24A 1D8LA 1I50B 4POFA 4GOPA 1NBWA 2HUGA 1Y1VG 2DN8A 3I4NH 4K0KQ 1K3RA 1HNZQ 1TXYA 3W1GA 5BN5A 3HOWH 1ESFA 1XTCD 5KRUA 1SE4A 1EIGA 1K8OA 3OMCA 4JK1C 3CRKC 4CJ2C 5DNFA 3QG1A 2B63H 5KNDA 1D7QA 4JVZA 1LT6D 2ZT9C 3DMUA 1TY2A 2NVQH 3BYTB 3J80E 3PUVA 2ZJQA 3GTQB 5LMNW 1E0BA 1K83H 2EPBA 3O13A 5A2QE 5FJ8G 2CHBD 2J7ZA 5KYLA 3I90A 2DY8A 5IT9L 5CGKA 3S17H 1E2ZA 4HAEA 4WRDA 1WTWA 1NCVA 1Y8PB 1ZKOA 1PZJD 5EPJA 4N8FA 4TQUS 4C2MB 1ZXTA 2F0PA 3D6WA 3H6MA 2E5LL 1CK1A 1C0AA 1PV4A 2NVXH 4A3DH 4IUPA 1JORA 5FO7B 1X3EA 2HHHQ 4UP8A 4OIJA 2M2LA 3SE0A 4DV6L 1R4PB 4GNXB 3CKIB 1C48A 5IYCG 1JB7A 2KQ3A 4QJFA 4ZUIA 3IKJA 4YY3Q 1RKNA 4KMUC 3PQIA 2F3WA 4X66Q 1GJXA 2L12A 3PUYA 1W6JA 4JW0A 2FXQA 3Q0AA 1PTOB 2E2IH 3J7ZC 3K5LA 1VMCA 1IBLL 4L5RC 3J80c 1SFOB 1AE2A 1LUZA 3QR8A 4H02A 2B39A 4JI2Q 2JA5H 4MHEA 5IIFA 5IWAQ 1M8AA 3T1HL 1KDAA 4EQOA 1TS2A 5GADC 1SYDA 1IYUA 3DM1A 4HTHA 5GAEC 1SJED 5HURA 2PI2A 2WB1E 1ET6A 1B2TA 3F1ZA 4Y7NH 1I3QB 1Z6HA 1XNQQ 2PMZE 2NN6G 5M5XB 1VQ9A 4RMFA 2MO0A 3W2DA 1D5XC 2D5DA 4DUYQ 2DJFC 1IKMA 2BE5C 2A6HD 3NBIA 1SAPA 2F0WA 4A3KH 4CKCA 4B3RL 4A3JG 4UDUC 4G7HC 4L5QA 1V1QA 4YIJA 1E22A 3WOEA 1N36L 4X64Q 3K0XA 3NTIA 2ZM6Q 4L5TA 3Q22A 5C4XB 3QJYA 2MGSA 1EQRA 1F2MA 4HMIA 1CT1D 4C3HB 3BVZA 3TP7A 1B44D 2HQEA 4AYBG 2RCFA 1WTQA 4B3TL 1F9RA 2Q2IA 1PTOC 1HQMC 1X3GA 4B3SL 1TWAH 4HN7A 1CTMA 4C3IB 1ONLA 5C0XG 4ODGA 3GTPB 4X62L 2B2VC 2D9UA 3J80L 2YU9B 4HMJA 1FVIA 1DZ1A 2GVBA 3I8ZA 4OO1I 1TIID 5JPMC 3A5ZB 2Q2TA 1Q90A 1STHA 5A2QL 1AH9A 4QQBX 3M3YB 5C5LA 2A69C 3C1EA 3H3VI 3IFDA 3STBC 1DOMA 2K14A 3HOYH 1PH6A 1L0WA 1R9TB 1KTKA 1JT8A 5DAUA 5CV9A 1EIYB 1HZCA 5D14A 1WCMB 2L0CA 3QOLA 3DEOA 2LSSA 4H44C 1GUTA 1CSPA 3M4PA 5C3XA 2CFMA 3NK9A 5FLXE 1U4LA 2WACA 1GUSA 2H5XA 1VQ7A 2XTIA 4KN7C 1IBML 1TS5A 1LO5D 3C3LA 5C5MA 5DEHA 5M5WH 1I4RA 4X3SA 2RF4A 3OW7A 4IO9A 2F0LA 1GO3E 4GKJQ 3QOJA 3S1NH 1U0LA 4LFCQ 3Q8DA 2HQLA 4IALA 1STGA 1XJVA 4KTAA 4XDXA 1OXSC 1PRTB 1N32Q 4A3EG 5BR8Q 4FF4A 1OXXK 5FO9B 1MSGA 4QY7A 2R7ZG 4RGNA 4PMCA 1DYQA 4J1MA 1X3PA 4DPGA 3DLLA 4LF7L 4FP5D 1HNWL 2OXPA 3L3OC 4TKOB 3U9SA 4R4CA 1XYIA 4APVA 1UUPA 2B29A 1WOCA 3MFYA 3PMFA 3MTSA 1FNWA 3MEFA 5JEAH 5IP9G 4F88A 1EY6A 1NY4A 3I4LA 4DUZL 5D65A 2RSOA 1AFPA 2G9DA 2VS1A 4DV5L 4FO2A 3JAME 1TWCH 1HUMA 3PIP3 1JB3A 4O42A 3VR2A 4QGUA 2XWJB 2JP1A 5FLMH 4NDXA 1Q81C 1UE6A 1C8CA 3NSWA 2B63G 2Z6BA 1G51A 4GOPC 3MVVA 2E5LQ 1K0SA 4L6TB 3WWVA 3HKZB 5KEEA 3HOUH 2R92B 2A5HA 1HUNA 4DV6Q 4KKSA 2AMCB 2C9OA 4RH6A 2XIWA 2QGQA 3ND8A 2LXJA 2JEBI 1P8LA 5EGTA 1LTGD 3CQZH 4LF9L 4JV5Q 3TZUA 2E76C 1AZPA 1EIHA 2MFIA 1KAAA 2K5WA 4BS9A 3CPFA 2LFNA 2F4VL 5EAYA 1EYGA 1SSOA 1RL2A 1DOKA 4XYQA 5GAHC 2R7ZB 4A3DG 1DD2A 4A3CG 4RFBA 2AQ3B 5CBAE 3KLSX 2QKIC 4DV4L 2CWPA 1Q7YC 2HDMA 4NXNQ 5JEAJ 1Q46A 1EY0A 1LM0A 2B3GA 2A73B 3JAMc 1HTLD 1VQAA 2CQOA 1J6QA 3HOZB 4X6AH 1X32A 1A3TA 1OXVA 1PFSA 1PLFA 4OIKA 2Z1CA 2J0TD 4KHVA 4C3JG 4RA8A 1B9NA 3FKIG 1Y1WB 3K59A 2I5MX 3GTOB 4Z9CB 4CHTB 4ME5A 1PTOH 5G3LD 4CDFC 1FD7D 2RBMA 1YJ9A 1EOVA 5IYDG 1PYWD 5C3EB 4A3LG 1U4MA 2JA5G 4B3RQ 2K5DA 4GLAC 4FNFA 1A3UA 1PA6A 3K81C 3GTLH 1EOTA 4K0KL 3BU2A 1XX8A 3UDIA 3BZDB 3NTKA 3CCVA 1XXGA 2CCZA 2RKSA 2JQOA 3P75A 3OPOA 3RN5A 2E2JB 4GN3B 2KHIA 3J80i 2F0OA 1CKOA 1AEXA 4QCLA 3OW2A 3TEHB 1CQVA 1OXTA 3FEWX 1E1TA 4B3SQ 4BY7G 5CV6A 3L2PA 4A3KG 1VQKA 4A3BG 4A3FG 2Y0SG 1GHJA 1QG7A 1DGSA 3HOVH 2F0IA 3KLSA 5IGCA 1ZYRC 2F0QA 2JA6B 2XN9C 1G91A 1NR2A 4DK0A 1SROA 2CKZB 3VYTA 5C4XH 3JAML 3OTOL 4ZCKA 4LK1C 4BBRB 4K14A 3R8BA 1B7YB 3AMUA 1TWFB 4OWTB 4C3HH 4X3TA 1C4QA 3CMAA 2NN6I 2M9VA 1WTRA 2ZTCA 2HHHL 5FOBB 1GKHA 3S1MB 5EBCA 2KECA 4K8JA 4KK7A 4X65Q 3VYUA 2EJFC 1QJOA 2EYLA 3TSSA 3NWTA 1VQPA 3NQTA 4H0LC 4YY3L 2F0GA 1IBMQ 2L55A 3DWAA 3KUPA 5E3FA 2YU9H 2FMCA 4IUNA 5EPKA 4IUQA 1SNMA 3K58A 4X66L 1RHPA 1EWCA 4QB4A 2XWBB 3D8GA 3M3YH 1OO9B 1S5CD 4KY5A 1BQQT 2K32A 4CJ1B 4G57A 1J8IA 5E1FA 4BWGB 4DR2Q 1AN8A 1IHZA 2MJ8A 4GKKQ 2ZXPA 4FF3A 1L1OA 1A8VA 1STEA 3EFXD 5CBEE 3GTGB 4RHSA 2I0QA 1D6EC 1PRTF 2JA9A 3OOCA 3T56B 1PZID 1UEAB 4DV0Q 5C0XI 4GLXA 4RKBA 1EUJA 5DLQE 1KRSA 3TREA 3K57A 4A3FB 1XNQL 4UHVA 4A3BB 1HFNA 2Y0SB 2RSNA 1F77A 1WD1A 2R6GA 1SNOA 2N78A 2ZJPA 1BBUA 2IT1A 1HR0Q 4IZ8A 2XSCA 4LUZA 2AQ1B 4DUYL 2CW0C 1DM0B 3ITPA 4A3IB 1SYGA 4DUZQ 1CA6A 1CZWA 4UPAA 5LL6S 2RDGA 3J7YW 3HOXG 3IL8A 5J3BA 3H15A 4BBSB 2HCCA 4KY7A 1XTDA 4YHHL 1N9WA 4RG1A 3NUCA 3TP5A 3PIOA 2PQAA 1DCZA 2JA8G 5HGQA 5C44B 5FO8B 4E6IA 4DR7Q 1T5EA 3T16A 2F3IA 4QF4A 5M3MH 5H1SE 3MA2B 4IFDG 4LFBQ 1EY7A 5C4HA 1JOQA 4AQYQ 3E9IA 2VB3X 2E2HH 2AHOB 4MTKA 5EKLA 3PO2B 3T51B 1G6ZA 2R93G 3I56A 2KUMA 4P75A 3LX0A 4PNYA 5C3WA 2R7FA 4JBJA 1EEID 3HZXA 1TU2B 1YHAA 2FJ2A 2JA7B 3N52A 2WP8J 4LF9Q 2A68C 3VDYA 2L1BA 1JJCB 4NPSA 1M1KC 1HZBA 3HS0C 1F2LA 2F4VQ 5GAGC 3I4OA 2LS01 3EROA 5IGDA 3TRZA 1I4PA 1SNDA 4LF6L 2X69A 3DHQA 4K8IA 1BXTA 4JI1L 4LF4Q 4IUVA 3KLRA 2FINB 1VF7A 3A74A 4UAIA 3HKZE 1SE3A 4O1NA 3ULPA 1Z9FA 5LMUL 4DV4Q 4DKAC 3S2HB 1YHQA 2LMCB 3PUWA 4C1NK 1BF4A 4DAVA 1G2TA 3RNUA 1FJGL 2OWOA 2N55A 2WV6D 1MBYA 4TSSA 2I5HA 5IY0A 4RHRA 4JI4L 4HSVA 5I6YA 1PVOA 2RQXA 1E3PA 1K3BC 4LFCL 2AWNA 3Q23A 1BR9A 2ALYB 1IBKL 4A3GH 3HKSA 4UP7A 4HIMA 1H9RA 2ICIA 1RJTA 3L7ZC 1IL2A 1HPCA 4K6LA 5K36G 2A6HC 3RLNA 4KKUA 2UXDQ 3M7NA 4BXXG 3CF5A 2PPBC 1YIJA 4JBKA 3MC0B 2R93B 2R61A 1QB5D 1UNSA 1V1OA 4OEMB 5IP7H 4P72A 3UDGA 3HOZH 1V8QA 3K7UC 2D0PA 1S40A 2BOSA 4OWWB 1CZGA 4KI0A 1KRTA 1E1OA 3H0GG 3OSOA 1Y1WH 2UUCL 1CHQD 5CORA 3JAMi 3CC4A 3GTOH 1AE3A 4KV6A 5K5PA 1X3QA 3GV6A 1B4OA 1QUQA 1JICA 4JI7Q 3PCOB 5C3EH 2SNMA 3J81c 1QILA 2ATWA 4OGQC 1SR3A 2B8FA 1VQMA 3PO3B 2F0MA 2B2TA 4LMQD 3C46A 3UE0A 1PYSB 2AUKA 3SK8A 3OTOQ 2F0UA 2OTJA 3A8IE 4HJ7A 4OWXB 2K6AA 2BDOA 4FXDA 1PHJA 3IFTA 1O7ZA 3AEVA 3TN2A 2EXDA 1BUVT 4PMBA 4BY1B 1FR3A 3BDLA 3J7AV 1QCBD 4DR3L 3BG3A 3HRZC 3TS2A 2NWGA 1B1ZA 1KAWA 4KD3A 1G2SA 1TR5A 3EVQA 3HOVG 2G9HD 1JR0D 2Z9HA 1PYBA 4DFAA 4JV5L 3CCLA 1EU4A 1I4XA 3K5MA 2WAQE 1L1OB 1XPRA 2LXKA 1KLUD 1LT4D 2K50A 2NYZD 2NTSA 1QNUA 4PV1C 1KC8C 1Y1VB 1RDPD 5I9PA 4FF1A 4HJ8A 3PF4A 4BBRH 2MHVA 1WJJA 1EY4A 3S1QB 2VNUD 2OEOA 2EXZA 3NXWA 5GROA 3F2CA 1PH7A 3SHLA 4NXNL 3TQYA 3WDNA 2ENBA 1CFMA 4NW2A 1QVCA 2JYOA 2RA4A 3H0GB 2Z8LA 1PH8A 1O7LA 4XT1B 3SK6A 1QVGA 3GTKB 2VUMG 3L0OA 4ZLTF 4MZ9A 3CCJA 4PQXA 1IXRA 1N8RC 1B70B 2EYJA 5IOCA 1XPUA 4WJWA 1D5MC 1PFNA 3M4QA 4QIWB 5ELEA 5M9OA 3V05A 4L63B 2YTVA 5IGGA 4WFN3 1ASZA 2PQAB 5M5YB 3NTHA 1BKBA 1CUKA 1PFBA 4DNIA 4XIGS 3J7AF 1MIUA 4GS3A 4CDCC 4IUUA 2NTTA 4U673 4YHHQ 2E75C 4GNXC 4LFAQ 3FDTA 3GTGH 1Y69U 5JJIA 5C4JB 1V43A 2Z4IA 3OWEB 5J22A 3CCMA 4DK6C 2D62A 3IRBA 4EQPA 4ZRZA 1TS3A 4C1NI 1TKWB 4DK3C 3RLOA 1VQNA 4Q0FA 1VQLA 1MD2D 4DA2A 4CKBA 2CH4W 1A3VA 2HIXA 1AW7A 1HA6A 4MIUA 3D4DA 1KDCA 1Q1EA 1UWVA 4CGYB 5EJWA 5EBDA 2NZ1D 1VQJA 1FGBD 2Z6KA 3BDCA 3BZKA 3S14H 2KHJA 4JOIA 4DK1A 1X55A 1TWGH 2RDFA 4N8X1 3T4AC 5E7NA 2VQEQ 3GTMB 2I07B 2IHEA 1VQ8A 2GVAA 3G7LA 4LF6Q 5C44H 5COYA 2A1AA 2NZOA 2ES2A 4GZYC 5CYUA 2VUMB 4JI1Q 4AH6A 2NUCA 1EL0A 1S5ED 2Q2UA 1DXMA 1KNEA 3PUZA 1BCPD 3C1FA 4R4QA 3VR6A 1CA5A 1RIPA 5LMUQ 4X65L 1I4QA 1KL9A 4P2CB 5BN3A 1FJGQ 4JG2A 1S72A 3T53B 1R4QB 3IAYA 3ER0A 2JA7H 2F0KA 4A3JB 1HJPA 1LTRD 1W6KA 2XRQD 4JI4Q 4EVOA 4QMGA 4OO1H 3V96A 3UDFA 3CCEA 2WKDA 1WTOA 4DR5Q 1IBKQ 2F0TA 1JWSD 4FXGC 4IFDI 2G5DA 3R93A 4DR2L 2PZUA 3EIVA 3F8TA 4GKKL 1BCPF 1S5DD 1GXDC 2BDNA 1Q1BA 2B8GA 4TVAB 4AYBB 1NAPA 1H9SA 4LF5Q 4IOAA 4WJ3M 3I4MH 1PH1A 3S2HH 2ZTEA 1WFQA 4G4KA 4DV0L 1VQ5A 3KYHC 1HZAA 1O7IA 1YHBA 5JAVA 1GUNA 2HT1A 4A93G 3H91A 1MJEA 1QUQB 2EY2A 1I94Q 2NVYB 1PH4A 3SR1A 4IN3A 3OMGA 1XMOQ 3A7LA 1CI3M 4JI0Q 1HR0L 1RTNA 2B2YA 3BS1A 2SOBA 3BZCA 4A3MG 1LTBD 3K80C 3RZOH 3M7GA 4XQQA 2UUCQ 4IUTA 1PFMA 1WTVA 3ERSX 5E4XA 5LL6X 3TMEA 4K5VA 1A2TA 4PZ6A 4FF2A 2VL6A 5JJZA 4HIKA 3K7AH 5BN4A 2SDFA 3I3CA 3I4NG 5M3FH 3KF8A 2IX1A 1L2FA 1I50H 3HOWG 4RGOS 2EYFA 3M4OB 3LWUA 1UEBA 2OQKA 3K6OA 4DR7L 2NVTB 2BE5D 2I5LX 4LFBL 1YNJC 4ME3A 2QEXA 4DAPA 4AQYL 2UU9L 4ALPA 2B2UA 3QIAA 5LHY1 4LUOA 1HHVA 2HDLA 1GD7A 4HJ9A 4DAMA 4DR3Q 3GTQH 1K73C 1PRTC 1SNCA 1STAA 2P5ZX 3GTJB 1G8ZD 3SDZA 2EDGA 4A3EB 4DAYA 3U58A 3CRLC 1I4GA 1BBWA 2KCNA 1X56A 3A8KE 4LF4L 1KHIA 4C2MH 1KXLA 2QA4A 2YYZA 2XVSA 2B2TC 4HIOA 1VQ4A 2ZJRA 3A55A 3E0EA 2OF1A 4IPDA 3ERQA 1B53A 4LWCA 2EJMA 1K8AC 3AU7A 2NBFA 4R9WA 2KOLA 4IPCA 4DNTB 4HEDA 3BVMA 5ELFA 1WTXA 4JI8Q 3FPPA 2WAQG 3I70A 3HFZB 4OL7A 4IURA 4P74A 4A75A 4DR1L 4KHZA 2FFKB 3NEMA 3K8AA 2EY5A 1JWUD 1I6HB 3JC66 2O4XA 3FP9A 2Q8TA 1Y1VH 1B3QA 1I5FA 1NJIC 1SFOH 1W3SA 2N3SA 5LMNL 1YITA 2B63B 2PYKA 2UXDL 4DGZA 1VDZA 1B8AA 1PDQA 3R2TA 1SLJA 1STNA 3NE5B 1K9MC 3CC2A 4CDEC 1WI5A 1I4HA 2WB1G 3E5SA 4M8AA 3CPWA 3E9HA 4RAUC 2CWAA 4K2KA 5IGEA 1I3QH 1PH3A 2L4NA 2F52A 4R4TA 2QCPX 2TSSA 3A56A 4XYOA 1IW7D 2EY6A 5M5XH 1U9RA 5M5YH 3S17B 5G3LF 4WJ4A 4YWMA 3WOFA 3BYYB 1QZHA 1OTCA 2SNSA 4JI7L 2F3VA 4XT3B 2KBNA 5ELOA 2Z4HA 3HGBA 5JOBA 3UE1A 1TQOA 1N33L 1VCIA 3D6CA 4A3DB 3AB9A 2F0HA 5CV7A 2K52A 4DR6L 1F9PA 3GP7A 5C4JH 3NELA 3TP6A 4BA2I 4B3ML 4G7ZC 3E3XA 2GA4B 3KJOA 3D4RA 1YNNC 4OXPA 4C3JB 3KDFA 2QILA 1OXUA 3FKIB 3QWNA 5I4DA 4V190 2F4IA 1YI2A 4ABNA 1SE8A 1G6PA 2A6ED 4C3IH 2M00A 3GTPH 1EQVA 3PUXA 4O2DA 5IGBA 1HQRD 2JA5B 2MQHA 3GQBA 1H9SB 4PG3A 4LJZC 3GTMH 2H1EA 3NBHB 3HOYG 4DNRB 4KLKA 1ILQA 2Z6KC 2D2CC 3RN2A 1EZ8A 1SBBB 1R9TH 1EY8A 1K8GA 1STYA 2JJQA 1VS0A 2E2DC 3EJIA 4N9PA 2F0FA 1WCMH 2DGYA 2KVMA 2NN6H 3CCQA 1EYCA 3VYSA 4KHPL 2CH4A 3L9AX 5A35A 3UDXA 4BY7B 4A3KB 1JC7A 1MHWC 3TP8A 3PF5A 2F03A 1U5KA 1Y14B 3KF8B 2UXBL 5C6AA 2K4KA 4A3JH 2ID0A 5CV8A 4KJNA 3GV3A 1S4ZA 5CV4A 3MEHA 5I9OA 3SXHA 3ULJA 1NR4A 4H7BA 1NTGA 1UE7A 4LFAL 2PW7A 2IX3A 4AYBE 4ZK9B 1GUOA 3W3AA 3RLFA 3P7JA 3V2TA 1EQQA 3SK4A 2JEAI 1SYEA 3M4YA 3A7AB 3RZDB 3G4SA 2UU9Q 1SMXA 2C5CA 3K0YA 5C0XH 4HR7B 4IOCA 2ZXOA 3URYA 1H9JA 5JEAG 2R7DA 1TS4A 4DAYB 2EYHA 2KCCA 1V9PA 1JWMD 2Q8RE 1C7YA 5M3FG 2K5VA 1BDOA 2B2YC 2R3ZA 2WFWA 1Z47A 1F2YA 4DV3L 3U4VA 2I46A 2VQEL 3FPUB 5FLMG 3M4OH 1HZ9A 1E7ZA 4RKLA 4JI5L 5HGTA 1NSNS 2HCIA 2FMMA 2NVTH 1EWHA 1T5XD 2UXCQ 1AZQA 1EYDA 4JI6Q 2EOTA 5KYIA 3HOUG 4JBMA 1RTOA 1ZYRD 2BA0A 1LACA 5L37A 1ML0D 1Q8IA 2R92H 3S1NB 2QDBA 1TT2A 3J81E 4KJOA 4JCVE 1FNUA 1VQBA 1VQHA 5JJLA 4B08A 3DXJC 4CJ0B 1VQ6A 1K28A 3GTJH 3ZJYC 2RVLA 3R2IA 2NZHA 1K8MA 4RCOA 1T9HA 4DR1Q 2K5NA 1XWEA 3HOXB 3N6RA 4A3EH 1ESRA 2ZXRA 1O78A 4DR5L 2PI2E 1BCPB 4HCSA 1ILPA 3AYHB 4G7OC 4YWKA 2JA8B 2PNHA 1YVCA 5EQ0A 5C0XJ 1PH5A 2R7ZH 2V1CC 3MFGA 2E8GA 1RODA 1CQFA 1YNXA 3HP3A 4RWSC 3EBEA 1D5ZC 2WINB 2MNAA 5LMNQ 1WTPA 1N34L 1QVFA 1FGUA 1S3OA 1J5EL 1SMYD 1PZKD 1F2ZA 3QO2A 1I94L 4R8NA 1RD9D 4DR4L 5IP9H 1TWHB 1XMOL 2DNCA 4JI0L 1FL0A 3PIPA 1LTAD 4LF5L 5D3DA 4DV1L 4HIDA 3FHWA 4H13C 2WIIB 2EQSA 2K28A 2IHFA 1EZ6A 1XMQL 1I6HH 3RD4A 1X3FA 1G291 3D0FA 2JN4A 2KEDA 3H3VC 3NPPA 3F2UA 4L5SA 4X3UA 4EX5A 3S1RB 4XQNA 4ZKBB 3FVQA 2UUAL 1N33Q 3KDFB 2EY1A 3HOUB 5IE8A 4DR6Q 1E2WA 2CW0D 3OIQA 3SK5A 4F8MA 4ID6A 2VZAA 4PZ8A 4B3MQ 1MGSA 4U68A 2E2JH 2ASBA 1M90C 4KKTA 3KJPA 3CQZB 3CD6A 2AUJD 3MWYW 1BCPC 2J4XA 2ICEC 2RCNA 4HCEA 4NB3A 3LWEA 5IYBH 1Q12A 3OHXC 4X3KA 2VY3A 1ASYA 1XNRL 3G48A 2DJGC 5KNBA 3KOJA 3VR4A 2NB0A 3CCRA 1Y8NB 3DM3A 2JA6H 3PV0A 1KQSA 5C4XG 2KA7A 4A3CH 2IW3A 5ISRA 1GHKA 3M85A 4F7XA 3S16B 4C3HG 2UUBQ 1VQEA 5JVG3 4TRDA 3CMEA 3NP8A 1TWFH 2VXWA 3BVGA 1X65A 2N49A 2A68D 4JBWA 4A4IA 1EU3A 4C3JH 5T1GA 1KLGD 3UI2A 3S1MH 5T1IA 1RF2D 3I91A 3FKIH 2D0OA 2RDHA 3EA6A 4C3IG 4KHPQ 5DM73 2X6GA 4A76A 5JJKA 5F2DA 1VQFA 2K5HA 2OCEA 3NQIA 4MTNA 3X3MA 2BH8A 4JI8L 3HEJA 4ULLA 3J81L 2EZVA 5JPNC 2UXBQ 5IYDH 3GTLB 4A3LH 4I65A 2KJXA 3ICEA 2YTXA 3NENA 3OYYA 2WKCA 1STBA 1A15A 3NWSA 2KHSA 1NMFA 4JC0A 3RR5A 3VYRA 4FXKC 1JE5A 3KF6A 3D3RA 4ILWA 1WCMG 3MXGA 1IL8A 3S24A 3ZYYX 2F0DA 1H9MA 2LKVA 3KBXA 4FDBA 1WTHA 3SGIA 1LTTD 2K03A 4A3GG 4BY7H 4DV2L 3HOVB 1L1OC 4A3FH 4A3BH 2Y0SE 4N9TA 2FHTA 5I2YA 3F2DA 4LUVA 4DV7Q 4KY6A 5AJ3L 2B2WA 1JJ2A 5EKKA 4A3IH 5KIXA 2LY7A 1DONA 2PW5A 2A19A 4JYAL 2AWOA 4BBSH 3LNNA 4B9XA 4CKEA 3LGJA 2L5TA 4L8JA 2K75A 5GQOA 4DV3Q 5TSSA 4EGVA 2IJ0A 3PIO3 1HNXL 5M3MG 1Q86C 4OX9L 2K04A 1GOZA 5C4ZA 1WYDA 4JI5Q 3G6EA 4MN3A 2EE1A 2IWHA 3RZDH 3AFPA 3PO2H 1X6OA 3CAMA 1LTID 4F87A 4EQNA 4IJHA 1A6XA 3TS0A 1EWIA 5CR3A 2JXMB 4R8IA 1KABA 4DU9A 1CKNB 3GO5A 1EIFA 2AQ2B 4QUCA 1IYJB 1MI2A 4UP9A 3CCSA 2H4OA 3S9WA 4YCVA 2VQFL 1JJGA 1L0YB 1X54A 2IPKD 1A63A 3SVMA 2KCTA 4NP5A 1SYFA 4NXMQ 4POGA 3H3VH 1HA5A 4RCNA 1TVXA 3HKZG 3PSIA 2EJGC 2R92G 1CM9A 2VB2X 3MHBA 1N34Q 3CXCA 4GOPB 5JVH3 1DJRD 1Y8OB 4OONA 1J5EQ 1EY9A 3S15B 2F0VA 3NBHA 1WD0A 1J9OA 3FRPB 3E6ZX 2EYPA 3W5OA 3DUZA 4FVMA 1QNKA 1DOLA 4DR4Q 1SEBD 4DN4M 5DM63 1ICWA 4HSPA 1RCVD 1KDBA 5KGUA 3HOXH 1IW7C 5NUCA 4DV1Q 1PH2A 3OWFA 2K01A 1KNAA 1JQYD 4ZUJA 4DF7A 1XMQQ 3R3OA 3MZ5A 3CW2C 1JMCA 1V1PA 5M3MB 2QEJC 3Q24A 2EYMA 1BNZA 2JA8H 3CP0A 1SYBA 1YJNA 2E2HB 2UUAQ 4IFDH 4QL5A 5IP7G 2HD3A 2C35B 2DUDA 3HOZG 2R93H 3W1BA 1QE6A 1SXTA 2YV5A 3U4ZA 3GDEA 4JI3L 3ND9A 3Q6SA 2KEEA 3MXNA 1IYVA 3EQLC 1A2UA 4EQ5A 1TWHH 4R4IA 1Y1WG 5FLXc 3CHBD 3U50C 3I72A 1SE2A 2V4DA 3MXUA 2A8VA 1CHPD 3MXPA 4IPHA 5C3EG 1XNRQ 4QUFA 1NE3A 1FNVA 1LYLA 1VMPA 5J1ZA 3CU7A 2A6EC 1M4VA 3NHHA 3S1RH 3G6JB 1CKMA 3A8JE 1MJCA 2IY5B 1PTOD 1EQTA 3PO3H 2PQEA 1ENCA 3U9OA 3VA5A 2F0JA 1LLRD 4YCWA 5KNCA 3P1HA 1LT3D 1UE5A 2UXCL 1O80A 2YTYA 1Q8KA 4JI6L 2OQ0A 5D3IB 2K1BA 3MAQA 3J81i 1D1KA 1YZ6A 4A93B 3A0JA 1GVPA 3S2DB 5IYBG 2ZTDA 1S5BD 2JK8A 4BY1H 2A69D 3E0JA 3VA7A 3T1YL 2A74C 4A3MB 3STBD 4A3GB 3KF6B 1VQOA 1IZ6A 4XQJA 1IBLQ 2JE6I 2MUYA 4IFDJ 2JA6G 1U4PA 1PTOF 1PH9A 5K36H 5HY6A 3I4NB 5AFWA 3DWQA 4Q5VA 3HG9A 3T13A 3EN2A 1S5FD 3T1HQ 3HOWB 1YBYA 4BBRG 1K0RA 1HFGA 4CDDC 4BXXH 3S16H 1LABA 1VQGA 3I73A 2MO1A 3H94A 3S1QH 4K6DA 2KCMA 2XGTA 1ENFA 2IX0A 1JCKB 4LF8L 2GN5A 4DXGA 5FLXL 3I2ZA 2NVQB 5ELCA 3H0GH 1HRJA 3GTKH 4RGMA 4ZQ3A 2K7VA 1K83B 4ZAIA 4K5WA 4WORA 1HTPA 4QIWE 4DV2Q 3C2PA 4Y52H 1NNXA 1JE4A 1SNPA 2OT2A 5FJ8H 2K5QA 4IPGA 3I7FA 3KBGA 3D4WA 3D31A 1N36Q 1HNZL 2BCOA 1C9OA 4K5XA 2L9HA 5AJ3Q 2OTLA 2IL8A 2E74C 3F2BA 1D2BA 1EFWA 2PO4A 3ULLA 1CSQA 4K2LA 2NVXB 4JYAQ 3J7A5 2DY7A 4O0AA 3KLWA 4B3TQ 2O5JC 3K5NA 3AQQA 2N8NA 1HNXQ 4OX9Q 3DEPA 2MPMA 1A0IA 4ZKCB 2RHSB 4P71A 1B3AA 5IYCH 4X62Q 4XXEA 4M1UB 1GM5A 4V0BA 1SJHD 2WAQB 4NKLA 3I55A 2E2IB 1VQIA 4ZYSA 2BA1A 4A3IG 1EFID 2X6LA 1YNJD 4LAAA 5E4WC 3VR3A 1W2BA 4BBSG 2Q2HA 2F0EA 2EIFA 2Q8IB 1EYAA 2AKWB 2QF7A 4JPBW 2VQFQ 2EYOA 2Z0SA 1A62A 1IKLA 1II3A 1LTLA 1WVLA 2B2WC 2JSOA 1QWYA
chains in the Genus database with same CATH topology
2B63G 1G51A 2V1CC 1XPOA 2E8GA 3GTGH 4GOPC 5C44G 5JJIA 1YNXA 2UUBL 1V43A 3EBEA 4J15A 2MNAA 5LMNQ 2E5LQ 1N34L 1YEZA 3WWVA 1QVFA 1FGUA 3CCMA 3HOUH 4JOIC 1S3OA 2VUMH 1J5EL 3PO2G 4DK6C 2D62A 3J81j 3IRBA 4DV6Q 3B6YA 1HNWQ 2AMCB 4DK3C 3RLOA 1VQNA 3KFUA 2QGQA 3CCUA 2LXJA 1I94L 1VQLA 4DR4L 1SN8A 1P8LA 2HIXA 2JEBI 2RHQB 5IP9H 1XMOL 3CQZH 2KENA 4LF9L 4JI0L 4JV5Q 4GNXA 1FL0A 3PIPA 1Q1EA 2MFIA 4LF5L 1UWVA 4DV1L 2JA7G 4HIDA 3FHWA 2EQSA 3CPFA 2IHFA 1XMQL 1VQJA 1I6HH 4JI2L 2F4VL 2VW9A 1X3FA 2Z6KA 3BZKA 1G291 4YCUA 2KHJA 3D0FA 5EAYA 1EYGA 4JOIA 1RL2A 3GD7A 1X55A 3S14H 4OO1G 5IWAL 1HH2P 4L5SA 5GAHC 1TWGH 4MNOA 4EX5A 4HJAA 5E7NA 1X9NA 4A3DG 2VQEQ 4A3CG 1PH2A 1N33Q 2IHEA 2UUAL 3KDFB 4GN5A 1VQ8A 2GVAA 4DV4L 2CWPA 4GLVB 1Q7YC 5C44H 4LF6Q 3PGZA 5IE8A 2A1AA 2NZOA 4YWLA 3MXNB 4BA1I 5JEAJ 2ES2A 1Q46A 4JI1Q 4AH6A 4LF7Q 4NXNQ 1LM0A 2B3GA 2Q2UA 3JAMc 1VQAA 3I4MG 2CQOA 1J6QA 3PUZA 4X6AH 2VZAA 4R4QA 1OXVA 3M9BA 4LNQA 1PFSA 4PZ8A 2L15A 4B3MQ 4PZ7A 1RIPA 5LMUQ 2E2JH 4IOAA 4X65L 2ASBA 1M90C 1MKHA 3KJPA 3FKIG 3CD6A 3S15H 1KL9A 4UY8C 4JI3Q 1FJGQ 2RCNA 4NB3A 2I5MX 4JG2A 1S72A 5IYBH 2NVYH 1Q12A 2VY3A 3ER0A 1ASYA 2JA7H 1HJPA 4DV5Q 1XNRL 4JI4Q 4AIMA 1YJ9A 1EOVA 5IYDG 4X64L 3G48A 2ZM6L 4DV7L 4A3LG 3AFQA 3KOJA 1UE1A 2JA5G 4B3RQ 1QZGA 4GLAC 3UDFA 3CCRA 3CCEA 4GN4B 1KD1C 4DR5Q 3DM3A 1IBKQ 1PA6A 1VQCA 3K81C 2JA6H 4PMWA 3GTLH 3PV0A 1KQSA 4R1JA 1HR0W 4K0KL 4A3CH 5C4XG 3BU2A 4IFDI 4DR2L 3CC7A 3EIVA 3UDIA 3F8TA 4GKKL 3M85A 3CCVA 2UUBQ 1Q1BA 4TVAB 2CCZA 2JQOA 1VQEA 2HIVA 3CMEA 1H95A 4WJ3M 1PH5A 1TWFH 3RN5A 3I4MH 4GN3B 1PH1A 2KHIA 3J80i 2BH2A 3S2HH 2ZTEA 1WFQA 4DV0L 1VQ5A 1CKOA 3KYHC 1HZAA 1O7IA 1P16A 1X65A 1YHBA 2N49A 4JBWA 2HT1A 4A4IA 3TEHB 4C3JH 3OW2A 1VQDA 5ELNA 4HJ5A 1YJWA 1OXTA 1QUQB 1MJEA 3S1MH 3FKIH 4A93G 1I94Q 2D0OA 1E1TA 1PH4A 4B3SQ 4BY7G 3L2PA 3A5UA 4A3KG 4A76A 1XMOQ 1VQKA 4A3FG 4A3BG 4KHPQ 5JJKA 4DR6Q 4JI0Q 1HR0L 1VQFA 2K5HA 2OCEA 3BZCA 2Y0SG 4MTNA 4A3MG 3G71A 1KIXA 2BH8A 1DGSA 3K80C 4JI8L 2UUCQ 3HOVH 3RZOH 3T1YQ 3ERSX 2UXBQ 5IYDH 4A3LH 3ICEA 2YTXA 3NENA 3OYYA 4PZ6A 2VL6A 4HIKA 1SROA 2CKZB 3K7AH 3PO3G 4JC0A 1NMFA 5C4XH 3RR5A 3I4NG 5M3FH 1Q82C 1JE5A 3OTOL 2IX1A 1L2FA 3KF6A 1I50H 3HOWG 1B7YB 4OWTB 5IT9c 4C3HH 1UEBA 3CMAA 2OQKA 2NN6I 1WCMG 1BVSA 4IJLA 4DR7L 4NXML 1CKNA 2ZTCA 2HHHL 3S24A 1GKHA 2I5LX 4LFBL 4ME3A 2QEXA 4P73A 4AQYL 1SRUA 2UU9L 4X65Q 4FDBA 3SGIA 4R4OA 4ALPA 4A93H 4BY1G 4LF8Q 4LUOA 3S2DH 1VQPA 4LW1A 4GKJL 4A3GG 4YY3L 1GD7A 4BY7H 4DV2L 1L1OC 4A3FH 1IBMQ 2Y0SE 4A3BH 4HJ9A 2YU9H 4DAMA 4DR3Q 3GTQH 1NMGA 4A3MH 1K73C 4X66L 4XTCS 3F2DA 1N32L 3BJUA 4LUVA 4DV7Q 3M3YH 5AJ3L 5BR8L 1JJ2A 1E24A 1D8LA 4POFA 4GOPA 4A3IH 1NBWA 1Y1VG 3I4NH 4K0KQ 2A19A 1K3RA 4DR2Q 1HNZQ 3U58A 1TXYA 3W1GA 2AWOA 4BBSH 3HOWH 4JYAL 4GKKQ 1BBWA 3LGJA 1X56A 1L1OA 2K75A 1A8VA 5GQOA 4DV3Q 4LF4L 1KHIA 4C2MH 2I0QA 1KXLA 2QA4A 1HNXL 5M3MG 2JA9A 2YYZA 1Q86C 4OX9L 4HIOA 2B63H 1WYDA 4JI5Q 3G6EA 4DV0Q 5C0XI 1D7QA 1VQ4A 2ZJRA 3E0EA 2NVQH 4GLXA 1XNQL 1EUJA 4IPDA 1KRSA 5DLQE 3TREA 3PUVA 3RZDH 3AFPA 2ZJQA 5LMNW 4LWCA 3PO2H 1X6OA 2R6GA 3CAMA 1K8AC 1K83H 2N78A 4IJHA 2ZJPA 1BBUA 3TS0A 2IT1A 1HR0Q 1EWIA 4IPCA 4LUZA 5FJ8G 4JI8Q 4DUYL 2WAQG 4A75A 3HFZB 4DR1L 4P74A 4KHZA 1CKNB 3NEMA 3K8AA 3GO5A 1EIFA 4DUZQ 1IYJB 4UP9A 4UPAA 3CCSA 3S17H 3JC66 3HOXG 5J3BA 4YCVA 3H15A 3FP9A 2VQFL 1JJGA 1XTDA 1Y1VH 4YHHL 1I5FA 1N9WA 1X54A 4RG1A 3PIOA 1A63A 1NJIC 4TQUS 2PQAA 1SFOH 1W3SA 2N3SA 2E5LL 5LMNL 1YITA 2KCTA 1PV4A 1C0AA 2NVXH 2JA8G 4A3DH 2UXDL 5HGQA 4DR7Q 4NXMQ 1X3EA 5M3MH 5H1SE 2F3IA 4UP8A 2HHHQ 4POGA 1B8AA 4IFDG 1SLJA 1K9MC 3CC2A 4DV6L 3H3VH 4LFBQ 3HKZG 4AQYQ 3E9IA 3PSIA 1WI5A 2WB1G 5IYCG 4GNXB 2AHOB 2E2HH 1JB7A 2R92G 2R93G 1N34Q 4QJFA 3CXCA 3I56A 4GOPB 4P75A 3CPWA 3E9HA 4OONA 2CWAA 1J5EQ 1I3QH 4YY3Q 4R4TA 2F52A 1PH3A 2R7FA 4JBJA 5M5XH 4X66Q 3W5OA 3PUYA 5M5YH 4WJ4A 4DR4Q 1YHAA 2FXQA 4YWMA 2E2IH 2WP8J 3J7ZC 4LF9Q 1IBLL 1QZHA 4L5RC 1OTCA 3VDYA 4LF5Q 4JI7L 5ELOA 3HOXH 2KBNA 3UE1A 1JJCB 4NPSA 3J80c 1AE2A 1LUZA 4DV1Q 4H02A 1M1KC 1HZBA 1XMQQ 4JI2Q 1N33L 2F4VQ 5GAGC 1VCIA 3CW2C 5C0XJ 3I4OA 1JMCA 2JA5H 3TRZA 4LF6L 5IWAQ 2K52A 4DR6L 3T1HL 4JI1L 4LF4Q 2JA8H 3CP0A 5GADC 1YJNA 5GAEC 3A74A 2PI2A 3NELA 3HKZE 5C4JH 2UUAQ 4BA2I 2WB1E 4B3ML 4QL5A 1Z9FA 5IP7G 5LMUL 4DV4Q 3ULPA 4DKAC 3F1ZA 4Y7NH 2C35B 2DUDA 3HOZG 3KJOA 1YHQA 2R93H 3PUWA 1XNQQ 3W1BA 2PMZE 2NN6G 2YV5A 4OXPA 3U4ZA 3KDFA 3GDEA 1VQ9A 4JI3L 4RMFA 3RNUA 1OXUA 2MO0A 1FJGL 2OWOA 2I5HA 1YI2A 5IY0A 4EQ5A 1TWHH 4R4IA 1Y1WG 5FLXc 4DUYQ 1SE8A 4JI4L 3U50C 1PVOA 4C3IH 1G6PA 4A3KH 1E3PA 3GTPH 4LFCL 2AWNA 3PUXA 4O2DA 4A3JG 4B3RL 2ALYB 2A8VA 4L5QA 1V1QA 1E22A 1IBKL 4A3GH 3HKSA 4IPHA 4UP7A 5C3EG 2MQHA 1XNRQ 4HIMA 1NE3A 3L7ZC 1LYLA 4PG3A 1N36L 1IL2A 4X64Q 3K0XA 2ZM6Q 4L5TA 5K36G 3RLNA 3S1RH 1CKMA 2IY5B 1MJCA 3GTMH 1EQRA 3NBHB 3HOYG 3PO3H 4KLKA 2UXDQ 2Z6KC 3RN2A 3M7NA 4BXXG 3CF5A 1YIJA 4JBKA 4YCWA 1R9TH 5IP7H 4AYBG 1K8GA 2R7ZH 2JJQA 1VS0A 1UE5A 4P72A 2UXCL 3UDGA 4B3TL 2YTYA 1Q8KA 4JI6L 1WCMH 2Q2IA 3HOZH 3K7UC 2D0PA 2DGYA 2OQ0A 2UXBL 1S40A 3CCQA 1X3GA 1YZ6A 3J81i 4B3SL 4KHPL 4OWWB 1TWAH 3A0JA 4KI0A 1GVPA 1E1OA 3H0GG 1KRTA 3UDXA 5C0XG 5IYBG 2ZTDA 2JK8A 4X62L 1Y1WH 2UUCL 3PF5A 4BY1H 1FVIA 3T1YL 2GVBA 1U5KA 1Y14B 3KF8B 3STBD 4OO1I 3JAMi 3CC4A 3KF6B 1AE3A 3GTOH 1VQOA 2K4KA 4A3JH 3A5ZB 1IZ6A 2ID0A 1IBLQ 2Q2TA 2JE6I 1AH9A 1QUQA 4JI7Q 4QQBX 3PCOB 5C3EH 4IFDJ 3J81c 2JA6G 2ATWA 1PH9A 1SR3A 1VQMA 3H3VI 3STBC 5HY6A 3ULJA 2K14A 3EN2A 3HOYH 3T1HQ 1PH6A 1NTGA 1YBYA 1L0WA 4BBRG 1K0RA 1UE7A 1JT8A 3UE0A 1PYSB 4BXXH 1EIYB 3S16H 1HZCA 4LFAL 3OTOQ 2OTJA 4AYBE 4HJ7A 4OWXB 1VQGA 2MO1A 2LSSA 3RLFA 3S1QH 2KCMA 3M4PA 1CSPA 1PHJA 2CFMA 2XGTA 2IX0A 1EQQA 4LF8L 2GN5A 3AEVA 3I2ZA 2H5XA 2EXDA 2XTIA 1VQ7A 2JEAI 1IBML 3H0GH 3G4SA 2UU9Q 4DR3L 3GTKH 1SMXA 3TS2A 5M5WH 1KAWA 4IOCA 3HOVG 2RF4A 5JEAG 4IO9A 1GO3E 2R7DA 4GKJQ 4QIWE 1PYBA 4DAYB 3S1NH 4DV2Q 1U0LA 4LFCQ 4JV5L 4Y52H 3Q8DA 3CCLA 2HQLA 2WAQE 5FJ8H 1V9PA 1L1OB 4IPGA 3I7FA 2LXKA 1XJVA 1XPRA 1C7YA 2K50A 5M3FG 1OXSC 2K5VA 3D31A 1N36Q 1HNZL 1KC8C 1N32Q 2WFWA 1C9OA 4A3EG 1Z47A 5AJ3Q 5BR8Q 1OXXK 4HJ8A 4DV3L 2OTLA 3F2BA 3PF4A 4BBRH 3U4VA 2VQEL 1WJJA 5FLMG 1EFWA 3ULLA 2VNUD 4QY7A 1CSQA 3M4OH 1HZ9A 4JYAQ 1E7ZA 4JI5L 2R7ZG 3J7A5 5GROA 3F2CA 1PH7A 2NVTH 4DPGA 3DLLA 4NXNL 3TQYA 4LF7L 1HNWL 4O0AA 2UXCQ 3KLWA 4B3TQ 4JI6Q 4LFAQ 1QVCA 3HOUG 3AQQA 2N8NA 1HNXQ 1PH8A 4R4CA 1QVGA 4OX9Q 4JBMA 2VUMG 4APVA 2BA0A 3L0OA 2B29A 4MZ9A 1WOCA 1A0IA 3CCJA 1IXRA 2RHSB 4P71A 1N8RC 1B70B 5IYCH 3MEFA 2R92H 1XPUA 4X62Q 3M4QA 4JCVE 1GM5A 1VQBA 1VQHA 5IP9G 2YTVA 5JJLA 1NY4A 2PQAB 4DUZL 1ASZA 1VQ6A 3I55A 1BKBA 1CUKA 3GTJH 3ZJYC 1VQIA 2VS1A 2BA1A 2NZHA 4DNIA 4DV5L 4A3IG 1T9HA 1TWCH 4XIGS 4DR1Q 2K5NA 1MIUA 4GS3A 4A3EH 1W2BA 4BBSG 2Q2HA 4DR5L 2EIFA 2PI2E 4QGUA 2AKWB 2VQFQ 5FLMH 4YHHQ 1Q81C 2Z0SA 1A62A 3AYHB 1LTLA 1UE6A 4GNXC 4YWKA 2PNHA 1YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 G;  1G51 A;  2V1C C;  1XPO A;  2E8G A;  3GTG H;  4GOP C;  5C44 G;  5JJI A;  1YNX A;  2UUB L;  1V43 A;  3EBE A;  4J15 A;  2MNA A;  5LMN Q;  2E5L Q;  1N34 L;  1YEZ A;  3WWV A;  1QVF A;  1FGU A;  3CCM A;  3HOU H;  4JOI C;  1S3O A;  2VUM H;  1J5E L;  3PO2 G;  4DK6 C;  2D62 A;  3J81 j;  3IRB A;  4DV6 Q;  3B6Y A;  1HNW Q;  2AMC B;  4DK3 C;  3RLO A;  1VQN A;  3KFU A;  2QGQ A;  3CCU A;  2LXJ A;  1I94 L;  1VQL A;  4DR4 L;  1SN8 A;  1P8L A;  2HIX A;  2JEB I;  2RHQ B;  5IP9 H;  1XMO L;  3CQZ H;  2KEN A;  4LF9 L;  4JI0 L;  4JV5 Q;  4GNX A;  1FL0 A;  3PIP A;  1Q1E A;  2MFI A;  4LF5 L;  1UWV A;  4DV1 L;  2JA7 G;  4HID A;  3FHW A;  2EQS A;  3CPF A;  2IHF A;  1XMQ L;  1VQJ A;  1I6H H;  4JI2 L;  2F4V L;  2VW9 A;  1X3F A;  2Z6K A;  3BZK A;  1G29 1;  4YCU A;  2KHJ A;  3D0F A;  5EAY A;  1EYG A;  4JOI A;  1RL2 A;  3GD7 A;  1X55 A;  3S14 H;  4OO1 G;  5IWA L;  1HH2 P;  4L5S A;  5GAH C;  1TWG H;  4MNO A;  4EX5 A;  4HJA A;  5E7N A;  1X9N A;  4A3D G;  2VQE Q;  4A3C G;  1PH2 A;  1N33 Q;  2IHE A;  2UUA L;  3KDF B;  4GN5 A;  1VQ8 A;  2GVA A;  4DV4 L;  2CWP A;  4GLV B;  1Q7Y C;  5C44 H;  4LF6 Q;  3PGZ A;  5IE8 A;  2A1A A;  2NZO A;  4YWL A;  3MXN B;  4BA1 I;  5JEA J;  2ES2 A;  1Q46 A;  4JI1 Q;  4AH6 A;  4LF7 Q;  4NXN Q;  1LM0 A;  2B3G A;  2Q2U A;  3JAM c;  1VQA A;  3I4M G;  2CQO A;  1J6Q A;  3PUZ A;  4X6A H;  2VZA A;  4R4Q A;  1OXV A;  3M9B A;  4LNQ A;  1PFS A;  4PZ8 A;  2L15 A;  4B3M Q;  4PZ7 A;  1RIP A;  5LMU Q;  2E2J H;  4IOA A;  4X65 L;  2ASB A;  1M90 C;  1MKH A;  3KJP A;  3FKI G;  3CD6 A;  3S15 H;  1KL9 A;  4UY8 C;  4JI3 Q;  1FJG Q;  2RCN A;  4NB3 A;  2I5M X;  4JG2 A;  1S72 A;  5IYB H;  2NVY H;  1Q12 A;  2VY3 A;  3ER0 A;  1ASY A;  2JA7 H;  1HJP A;  4DV5 Q;  1XNR L;  4JI4 Q;  4AIM A;  1YJ9 A;  1EOV A;  5IYD G;  4X64 L;  3G48 A;  2ZM6 L;  4DV7 L;  4A3L G;  3AFQ A;  3KOJ A;  1UE1 A;  2JA5 G;  4B3R Q;  1QZG A;  4GLA C;  3UDF A;  3CCR A;  3CCE A;  4GN4 B;  1KD1 C;  4DR5 Q;  3DM3 A;  1IBK Q;  1PA6 A;  1VQC A;  3K81 C;  2JA6 H;  4PMW A;  3GTL H;  3PV0 A;  1KQS A;  4R1J A;  1HR0 W;  4K0K L;  4A3C H;  5C4X G;  3BU2 A;  4IFD I;  4DR2 L;  3CC7 A;  3EIV A;  3UDI A;  3F8T A;  4GKK L;  3M85 A;  3CCV A;  2UUB Q;  1Q1B A;  4TVA B;  2CCZ A;  2JQO A;  1VQE A;  2HIV A;  3CME A;  1H95 A;  4WJ3 M;  1PH5 A;  1TWF H;  3RN5 A;  3I4M H;  4GN3 B;  1PH1 A;  2KHI A;  3J80 i;  2BH2 A;  3S2H H;  2ZTE A;  1WFQ A;  4DV0 L;  1VQ5 A;  1CKO A;  3KYH C;  1HZA A;  1O7I A;  1P16 A;  1X65 A;  1YHB A;  2N49 A;  4JBW A;  2HT1 A;  4A4I A;  3TEH B;  4C3J H;  3OW2 A;  1VQD A;  5ELN A;  4HJ5 A;  1YJW A;  1OXT A;  1QUQ B;  1MJE A;  3S1M H;  3FKI H;  4A93 G;  1I94 Q;  2D0O A;  1E1T A;  1PH4 A;  4B3S Q;  4BY7 G;  3L2P A;  3A5U A;  4A3K G;  4A76 A;  1XMO Q;  1VQK A;  4A3F G;  4A3B G;  4KHP Q;  5JJK A;  4DR6 Q;  4JI0 Q;  1HR0 L;  1VQF A;  2K5H A;  2OCE A;  3BZC A;  2Y0S G;  4MTN A;  4A3M G;  3G71 A;  1KIX A;  2BH8 A;  1DGS A;  3K80 C;  4JI8 L;  2UUC Q;  3HOV H;  3RZO H;  3T1Y Q;  3ERS X;  2UXB Q;  5IYD H;  4A3L H;  3ICE A;  2YTX A;  3NEN A;  3OYY A;  4PZ6 A;  2VL6 A;  4HIK A;  1SRO A;  2CKZ B;  3K7A H;  3PO3 G;  4JC0 A;  1NMF A;  5C4X H;  3RR5 A;  3I4N G;  5M3F H;  1Q82 C;  1JE5 A;  3OTO L;  2IX1 A;  1L2F A;  3KF6 A;  1I50 H;  3HOW G;  1B7Y B;  4OWT B;  5IT9 c;  4C3H H;  1UEB A;  3CMA A;  2OQK A;  2NN6 I;  1WCM G;  1BVS A;  4IJL A;  4DR7 L;  4NXM L;  1CKN A;  2ZTC A;  2HHH L;  3S24 A;  1GKH A;  2I5L X;  4LFB L;  4ME3 A;  2QEX A;  4P73 A;  4AQY L;  1SRU A;  2UU9 L;  4X65 Q;  4FDB A;  3SGI A;  4R4O A;  4ALP A;  4A93 H;  4BY1 G;  4LF8 Q;  4LUO A;  3S2D H;  1VQP A;  4LW1 A;  4GKJ L;  4A3G G;  4YY3 L;  1GD7 A;  4BY7 H;  4DV2 L;  1L1O C;  4A3F H;  1IBM Q;  2Y0S E;  4A3B H;  4HJ9 A;  2YU9 H;  4DAM A;  4DR3 Q;  3GTQ H;  1NMG A;  4A3M H;  1K73 C;  4X66 L;  4XTC S;  3F2D A;  1N32 L;  3BJU A;  4LUV A;  4DV7 Q;  3M3Y H;  5AJ3 L;  5BR8 L;  1JJ2 A;  1E24 A;  1D8L A;  4POF A;  4GOP A;  4A3I H;  1NBW A;  1Y1V G;  3I4N H;  4K0K Q;  2A19 A;  1K3R A;  4DR2 Q;  1HNZ Q;  3U58 A;  1TXY A;  3W1G A;  2AWO A;  4BBS H;  3HOW H;  4JYA L;  4GKK Q;  1BBW A;  3LGJ A;  1X56 A;  1L1O A;  2K75 A;  1A8V A;  5GQO A;  4DV3 Q;  4LF4 L;  1KHI A;  4C2M H;  2I0Q A;  1KXL A;  2QA4 A;  1HNX L;  5M3M G;  2JA9 A;  2YYZ A;  1Q86 C;  4OX9 L;  4HIO A;  2B63 H;  1WYD A;  4JI5 Q;  3G6E A;  4DV0 Q;  5C0X I;  1D7Q A;  1VQ4 A;  2ZJR A;  3E0E A;  2NVQ H;  4GLX A;  1XNQ L;  1EUJ A;  4IPD A;  1KRS A;  5DLQ E;  3TRE A;  3PUV A;  3RZD H;  3AFP A;  2ZJQ A;  5LMN W;  4LWC A;  3PO2 H;  1X6O A;  2R6G A;  3CAM A;  1K8A C;  1K83 H;  2N78 A;  4IJH A;  2ZJP A;  1BBU A;  3TS0 A;  2IT1 A;  1HR0 Q;  1EWI A;  4IPC A;  4LUZ A;  5FJ8 G;  4JI8 Q;  4DUY L;  2WAQ G;  4A75 A;  3HFZ B;  4DR1 L;  4P74 A;  4KHZ A;  1CKN B;  3NEM A;  3K8A A;  3GO5 A;  1EIF A;  4DUZ Q;  1IYJ B;  4UP9 A;  4UPA A;  3CCS A;  3S17 H;  3JC6 6;  3HOX G;  5J3B A;  4YCV A;  3H15 A;  3FP9 A;  2VQF L;  1JJG A;  1XTD A;  1Y1V H;  4YHH L;  1I5F A;  1N9W A;  1X54 A;  4RG1 A;  3PIO A;  1A63 A;  1NJI C;  4TQU S;  2PQA A;  1SFO H;  1W3S A;  2N3S A;  2E5L L;  5LMN L;  1YIT A;  2KCT A;  1PV4 A;  1C0A A;  2NVX H;  2JA8 G;  4A3D H;  2UXD L;  5HGQ A;  4DR7 Q;  4NXM Q;  1X3E A;  5M3M H;  5H1S E;  2F3I A;  4UP8 A;  2HHH Q;  4POG A;  1B8A A;  4IFD G;  1SLJ A;  1K9M C;  3CC2 A;  4DV6 L;  3H3V H;  4LFB Q;  3HKZ G;  4AQY Q;  3E9I A;  3PSI A;  1WI5 A;  2WB1 G;  5IYC G;  4GNX B;  2AHO B;  2E2H H;  1JB7 A;  2R92 G;  2R93 G;  1N34 Q;  4QJF A;  3CXC A;  3I56 A;  4GOP B;  4P75 A;  3CPW A;  3E9H A;  4OON A;  2CWA A;  1J5E Q;  1I3Q H;  4YY3 Q;  4R4T A;  2F52 A;  1PH3 A;  2R7F A;  4JBJ A;  5M5X H;  4X66 Q;  3W5O A;  3PUY A;  5M5Y H;  4WJ4 A;  4DR4 Q;  1YHA A;  2FXQ A;  4YWM A;  2E2I H;  2WP8 J;  3J7Z C;  4LF9 Q;  1IBL L;  1QZH A;  4L5R C;  1OTC A;  3VDY A;  4LF5 Q;  4JI7 L;  5ELO A;  3HOX H;  2KBN A;  3UE1 A;  1JJC B;  4NPS A;  3J80 c;  1AE2 A;  1LUZ A;  4DV1 Q;  4H02 A;  1M1K C;  1HZB A;  1XMQ Q;  4JI2 Q;  1N33 L;  2F4V Q;  5GAG C;  1VCI A;  3CW2 C;  5C0X J;  3I4O A;  1JMC A;  2JA5 H;  3TRZ A;  4LF6 L;  5IWA Q;  2K52 A;  4DR6 L;  3T1H L;  4JI1 L;  4LF4 Q;  2JA8 H;  3CP0 A;  5GAD C;  1YJN A;  5GAE C;  3A74 A;  2PI2 A;  3NEL A;  3HKZ E;  5C4J H;  2UUA Q;  4BA2 I;  2WB1 E;  4B3M L;  4QL5 A;  1Z9F A;  5IP7 G;  5LMU L;  4DV4 Q;  3ULP A;  4DKA C;  3F1Z A;  4Y7N H;  2C35 B;  2DUD A;  3HOZ G;  3KJO A;  1YHQ A;  2R93 H;  3PUW A;  1XNQ Q;  3W1B A;  2PMZ E;  2NN6 G;  2YV5 A;  4OXP A;  3U4Z A;  3KDF A;  3GDE A;  1VQ9 A;  4JI3 L;  4RMF A;  3RNU A;  1OXU A;  2MO0 A;  1FJG L;  2OWO A;  2I5H A;  1YI2 A;  5IY0 A;  4EQ5 A;  1TWH H;  4R4I A;  1Y1W G;  5FLX c;  4DUY Q;  1SE8 A;  4JI4 L;  3U50 C;  1PVO A;  4C3I H;  1G6P A;  4A3K H;  1E3P A;  3GTP H;  4LFC L;  2AWN A;  3PUX A;  4O2D A;  4A3J G;  4B3R L;  2ALY B;  2A8V A;  4L5Q A;  1V1Q A;  1E22 A;  1IBK L;  4A3G H;  3HKS A;  4IPH A;  4UP7 A;  5C3E G;  2MQH A;  1XNR Q;  4HIM A;  1NE3 A;  3L7Z C;  1LYL A;  4PG3 A;  1N36 L;  1IL2 A;  4X64 Q;  3K0X A;  2ZM6 Q;  4L5T A;  5K36 G;  3RLN A;  3S1R H;  1CKM A;  2IY5 B;  1MJC A;  3GTM H;  1EQR A;  3NBH B;  3HOY G;  3PO3 H;  4KLK A;  2UXD Q;  2Z6K C;  3RN2 A;  3M7N A;  4BXX G;  3CF5 A;  1YIJ A;  4JBK A;  4YCW A;  1R9T H;  5IP7 H;  4AYB G;  1K8G A;  2R7Z H;  2JJQ A;  1VS0 A;  1UE5 A;  4P72 A;  2UXC L;  3UDG A;  4B3T L;  2YTY A;  1Q8K A;  4JI6 L;  1WCM H;  2Q2I A;  3HOZ H;  3K7U C;  2D0P A;  2DGY A;  2OQ0 A;  2UXB L;  1S40 A;  3CCQ A;  1X3G A;  1YZ6 A;  3J81 i;  4B3S L;  4KHP L;  4OWW B;  1TWA H;  3A0J A;  4KI0 A;  1GVP A;  1E1O A;  3H0G G;  1KRT A;  3UDX A;  5C0X G;  5IYB G;  2ZTD A;  2JK8 A;  4X62 L;  1Y1W H;  2UUC L;  3PF5 A;  4BY1 H;  1FVI A;  3T1Y L;  2GVB A;  1U5K A;  1Y14 B;  3KF8 B;  3STB D;  4OO1 I;  3JAM i;  3CC4 A;  3KF6 B;  1AE3 A;  3GTO H;  1VQO A;  2K4K A;  4A3J H;  3A5Z B;  1IZ6 A;  2ID0 A;  1IBL Q;  2Q2T A;  2JE6 I;  1AH9 A;  1QUQ A;  4JI7 Q;  4QQB X;  3PCO B;  5C3E H;  4IFD J;  3J81 c;  2JA6 G;  2ATW A;  1PH9 A;  1SR3 A;  1VQM A;  3H3V I;  3STB C;  5HY6 A;  3ULJ A;  2K14 A;  3EN2 A;  3HOY H;  3T1H Q;  1PH6 A;  1NTG A;  1YBY A;  1L0W A;  4BBR G;  1K0R A;  1UE7 A;  1JT8 A;  3UE0 A;  1PYS B;  4BXX H;  1EIY B;  3S16 H;  1HZC A;  4LFA L;  3OTO Q;  2OTJ A;  4AYB E;  4HJ7 A;  4OWX B;  1VQG A;  2MO1 A;  2LSS A;  3RLF A;  3S1Q H;  2KCM A;  3M4P A;  1CSP A;  1PHJ A;  2CFM A;  2XGT A;  2IX0 A;  1EQQ A;  4LF8 L;  2GN5 A;  3AEV A;  3I2Z A;  2H5X A;  2EXD A;  2XTI A;  1VQ7 A;  2JEA I;  1IBM L;  3H0G H;  3G4S A;  2UU9 Q;  4DR3 L;  3GTK H;  1SMX A;  3TS2 A;  5M5W H;  1KAW A;  4IOC A;  3HOV G;  2RF4 A;  5JEA G;  4IO9 A;  1GO3 E;  2R7D A;  4GKJ Q;  4QIW E;  1PYB A;  4DAY B;  3S1N H;  4DV2 Q;  1U0L A;  4LFC Q;  4JV5 L;  4Y52 H;  3Q8D A;  3CCL A;  2HQL A;  2WAQ E;  5FJ8 H;  1V9P A;  1L1O B;  4IPG A;  3I7F A;  2LXK A;  1XJV A;  1XPR A;  1C7Y A;  2K50 A;  5M3F G;  1OXS C;  2K5V A;  3D31 A;  1N36 Q;  1HNZ L;  1KC8 C;  1N32 Q;  2WFW A;  1C9O A;  4A3E G;  1Z47 A;  5AJ3 Q;  5BR8 Q;  1OXX K;  4HJ8 A;  4DV3 L;  2OTL A;  3F2B A;  3PF4 A;  4BBR H;  3U4V A;  2VQE L;  1WJJ A;  5FLM G;  1EFW A;  3ULL A;  2VNU D;  4QY7 A;  1CSQ A;  3M4O H;  1HZ9 A;  4JYA Q;  1E7Z A;  4JI5 L;  2R7Z G;  3J7A 5;  5GRO A;  3F2C A;  1PH7 A;  2NVT H;  4DPG A;  3DLL A;  4NXN L;  3TQY A;  4LF7 L;  1HNW L;  4O0A A;  2UXC Q;  3KLW A;  4B3T Q;  4JI6 Q;  4LFA Q;  1QVC A;  3HOU G;  3AQQ A;  2N8N A;  1HNX Q;  1PH8 A;  4R4C A;  1QVG A;  4OX9 Q;  4JBM A;  2VUM G;  4APV A;  2BA0 A;  3L0O A;  2B29 A;  4MZ9 A;  1WOC A;  1A0I A;  3CCJ A;  1IXR A;  2RHS B;  4P71 A;  1N8R C;  1B70 B;  5IYC H;  3MEF A;  2R92 H;  1XPU A;  4X62 Q;  3M4Q A;  4JCV E;  1GM5 A;  1VQB A;  1VQH A;  5IP9 G;  2YTV A;  5JJL A;  1NY4 A;  2PQA B;  4DUZ L;  1ASZ A;  1VQ6 A;  3I55 A;  1BKB A;  1CUK A;  3GTJ H;  3ZJY C;  1VQI A;  2VS1 A;  2BA1 A;  2NZH A;  4DNI A;  4DV5 L;  4A3I G;  1T9H A;  1TWC H;  4XIG S;  4DR1 Q;  2K5N A;  1MIU A;  4GS3 A;  4A3E H;  1W2B A;  4BBS G;  2Q2H A;  4DR5 L;  2EIF A;  2PI2 E;  4QGU A;  2AKW B;  2VQF Q;  5FLM H;  4YHH Q;  1Q81 C;  2Z0S A;  1A62 A;  3AYH B;  1LTL A;  1UE6 A;  4GNX C;  4YWK A;  2PNH A;  1YVC A; 
#chains in the Genus database with same CATH topology
 1XPO A;  1VF5 C;  5C44 G;  1SNQ A;  2UUB L;  4J15 A;  1PRT D;  2QW7 A;  1YEZ A;  2K05 A;  4I7A A;  1GUG A;  2WB1 B;  4JOI C;  4Y7N B;  3KK7 A;  2VUM H;  1EY5 A;  3PO2 G;  3P20 A;  3J81 j;  5CV5 A;  3B6Y A;  1JOK A;  1SYC A;  2PMZ B;  2F1M A;  3OIP A;  3CCU A;  3QB3 A;  1BO0 A;  1Z7T A;  1SN8 A;  2RHQ B;  2KEN A;  1SMY C;  4GNX A;  1B50 A;  1V1P B;  2JA7 G;  2K33 A;  4I7Z C;  2O5I C;  4JI2 L;  2VW9 A;  1PMR A;  4YCU A;  4OO1 G;  3GD7 A;  5IWA L;  4CBV A;  1HH2 P;  4MNO A;  4HJA A;  1UAP A;  1X9N A;  1AP0 A;  1I6V C;  2EVB A;  4GN5 A;  1Q3L A;  1HXY D;  2PNR C;  2MP1 A;  4GLV B;  3PGZ A;  1SDF A;  4YWL A;  3MXN B;  4BA1 I;  4LF7 Q;  3KFU A;  1HNW Q;  1BBX C;  3I4M G;  2B2V A;  5FKA C;  1ZEQ X;  3BDO A;  3TZD A;  3M9B A;  4LNQ A;  2L15 A;  1GUW A;  4PZ7 A;  3H09 A;  1E2V A;  1JOO A;  3FMC A;  5ELB A;  4C56 C;  2XRS D;  1MKH A;  1TWA B;  2F0N A;  2L11 A;  2SEB D;  2F0S A;  3S15 H;  4UY8 C;  4JI3 Q;  1H9K A;  1QOH A;  1D1I A;  5EPL A;  5IT9 E;  4DXF A;  2NVY H;  1ET9 A;  3S14 B;  5EKI A;  4DV5 Q;  1F9S A;  2XNA C;  4AIM A;  1TWG B;  4X64 L;  2ZM6 L;  4DV7 L;  2PZW A;  3AFQ A;  3TDQ A;  1UE1 A;  1QZG A;  4GN4 B;  1KD1 C;  1VQC A;  5ELD A;  4PMW A;  1HR0 W;  4R1J A;  3HOY B;  2PZT A;  4B9W A;  4RGT A;  5IGF A;  3CC7 A;  2CQA A;  1ENA A;  4J6H A;  2HIV A;  1H95 A;  3TBI B;  2BH2 A;  3DWP A;  1B9M A;  2DNE A;  1P16 A;  4NMZ A;  3SEB A;  1ICF B;  1VQD A;  5ELN A;  4HJ5 A;  1YJW A;  5I6W A;  4J8Q A;  4KN4 C;  2N88 A;  2CVR A;  5M5W B;  3A5U A;  3G71 A;  1KIX A;  1TY0 A;  5CC4 A;  5IOD A;  3T1Y Q;  5I2X A;  1LT5 D;  3X3N A;  3VR5 A;  2B2U C;  5FK9 C;  1LV9 A;  2QDL A;  1YNN D;  1HCZ A;  3PO3 G;  3K5O A;  1Q82 C;  4FYD A;  5IT9 c;  4IQZ A;  3I4M B;  1EEF D;  4IJL A;  1BVS A;  4NXM L;  1CKN A;  4OHJ A;  1MSH A;  1FYC A;  1PXU A;  4P73 A;  3RMH A;  1SRU A;  1L0X B;  1BOS A;  3A54 A;  5J39 A;  1F9Q A;  1U4R A;  4R4O A;  1O7Y A;  4A93 H;  4BY1 G;  4LF8 Q;  3RUZ A;  4OEL B;  3S2D H;  4GKJ L;  4LW1 A;  1LTS D;  4S3S A;  3RZO B;  2PCF B;  3ONA B;  1NUC A;  1NMG A;  4A3M H;  4KD4 A;  4XTC S;  3K7A B;  1N32 L;  3BJU A;  1TWC B;  2TMP A;  5CMD A;  5M3F B;  5BR8 L;  2O2L D;  1E24 A;  1D8L A;  1I50 B;  4POF A;  4GOP A;  1NBW A;  2HUG A;  1Y1V G;  2DN8 A;  3I4N H;  4K0K Q;  1K3R A;  1HNZ Q;  1TXY A;  3W1G A;  5BN5 A;  3HOW H;  1ESF A;  1XTC D;  5KRU A;  1SE4 A;  1EIG A;  1K8O A;  3OMC A;  4JK1 C;  3CRK C;  4CJ2 C;  5DNF A;  3QG1 A;  2B63 H;  5KND A;  1D7Q A;  4JVZ A;  1LT6 D;  2ZT9 C;  3DMU A;  1TY2 A;  2NVQ H;  3BYT B;  3J80 E;  3PUV A;  2ZJQ A;  3GTQ B;  5LMN W;  1E0B A;  1K83 H;  2EPB A;  3O13 A;  5A2Q E;  5FJ8 G;  2CHB D;  2J7Z A;  5KYL A;  3I90 A;  2DY8 A;  5IT9 L;  5CGK A;  3S17 H;  1E2Z A;  4HAE A;  4WRD A;  1WTW A;  1NCV A;  1Y8P B;  1ZKO A;  1PZJ D;  5EPJ A;  4N8F A;  4TQU S;  4C2M B;  1ZXT A;  2F0P A;  3D6W A;  3H6M A;  2E5L L;  1CK1 A;  1C0A A;  1PV4 A;  2NVX H;  4A3D H;  4IUP A;  1JOR A;  5FO7 B;  1X3E A;  2HHH Q;  4UP8 A;  4OIJ A;  2M2L A;  3SE0 A;  4DV6 L;  1R4P B;  4GNX B;  3CKI B;  1C48 A;  5IYC G;  1JB7 A;  2KQ3 A;  4QJF A;  4ZUI A;  3IKJ A;  4YY3 Q;  1RKN A;  4KMU C;  3PQI A;  2F3W A;  4X66 Q;  1GJX A;  2L12 A;  3PUY A;  1W6J A;  4JW0 A;  2FXQ A;  3Q0A A;  1PTO B;  2E2I H;  3J7Z C;  3K5L A;  1VMC A;  1IBL L;  4L5R C;  3J80 c;  1SFO B;  1AE2 A;  1LUZ A;  3QR8 A;  4H02 A;  2B39 A;  4JI2 Q;  2JA5 H;  4MHE A;  5IIF A;  5IWA Q;  1M8A A;  3T1H L;  1KDA A;  4EQO A;  1TS2 A;  5GAD C;  1SYD A;  1IYU A;  3DM1 A;  4HTH A;  5GAE C;  1SJE D;  5HUR A;  2PI2 A;  2WB1 E;  1ET6 A;  1B2T A;  3F1Z A;  4Y7N H;  1I3Q B;  1Z6H A;  1XNQ Q;  2PMZ E;  2NN6 G;  5M5X B;  1VQ9 A;  4RMF A;  2MO0 A;  3W2D A;  1D5X C;  2D5D A;  4DUY Q;  2DJF C;  1IKM A;  2BE5 C;  2A6H D;  3NBI A;  1SAP A;  2F0W A;  4A3K H;  4CKC A;  4B3R L;  4A3J G;  4UDU C;  4G7H C;  4L5Q A;  1V1Q A;  4YIJ A;  1E22 A;  3WOE A;  1N36 L;  4X64 Q;  3K0X A;  3NTI A;  2ZM6 Q;  4L5T A;  3Q22 A;  5C4X B;  3QJY A;  2MGS A;  1EQR A;  1F2M A;  4HMI A;  1CT1 D;  4C3H B;  3BVZ A;  3TP7 A;  1B44 D;  2HQE A;  4AYB G;  2RCF A;  1WTQ A;  4B3T L;  1F9R A;  2Q2I A;  1PTO C;  1HQM C;  1X3G A;  4B3S L;  1TWA H;  4HN7 A;  1CTM A;  4C3I B;  1ONL A;  5C0X G;  4ODG A;  3GTP B;  4X62 L;  2B2V C;  2D9U A;  3J80 L;  2YU9 B;  4HMJ A;  1FVI A;  1DZ1 A;  2GVB A;  3I8Z A;  4OO1 I;  1TII D;  5JPM C;  3A5Z B;  2Q2T A;  1Q90 A;  1STH A;  5A2Q L;  1AH9 A;  4QQB X;  3M3Y B;  5C5L A;  2A69 C;  3C1E A;  3H3V I;  3IFD A;  3STB C;  1DOM A;  2K14 A;  3HOY H;  1PH6 A;  1L0W A;  1R9T B;  1KTK A;  1JT8 A;  5DAU A;  5CV9 A;  1EIY B;  1HZC A;  5D14 A;  1WCM B;  2L0C A;  3QOL A;  3DEO A;  2LSS A;  4H44 C;  1GUT A;  1CSP A;  3M4P A;  5C3X A;  2CFM A;  3NK9 A;  5FLX E;  1U4L A;  2WAC A;  1GUS A;  2H5X A;  1VQ7 A;  2XTI A;  4KN7 C;  1IBM L;  1TS5 A;  1LO5 D;  3C3L A;  5C5M A;  5DEH A;  5M5W H;  1I4R A;  4X3S A;  2RF4 A;  3OW7 A;  4IO9 A;  2F0L A;  1GO3 E;  4GKJ Q;  3QOJ A;  3S1N H;  1U0L A;  4LFC Q;  3Q8D A;  2HQL A;  4IAL A;  1STG A;  1XJV A;  4KTA A;  4XDX A;  1OXS C;  1PRT B;  1N32 Q;  4A3E G;  5BR8 Q;  4FF4 A;  1OXX K;  5FO9 B;  1MSG A;  4QY7 A;  2R7Z G;  4RGN A;  4PMC A;  1DYQ A;  4J1M A;  1X3P A;  4DPG A;  3DLL A;  4LF7 L;  4FP5 D;  1HNW L;  2OXP A;  3L3O C;  4TKO B;  3U9S A;  4R4C A;  1XYI A;  4APV A;  1UUP A;  2B29 A;  1WOC A;  3MFY A;  3PMF A;  3MTS A;  1FNW A;  3MEF A;  5JEA H;  5IP9 G;  4F88 A;  1EY6 A;  1NY4 A;  3I4L A;  4DUZ L;  5D65 A;  2RSO A;  1AFP A;  2G9D A;  2VS1 A;  4DV5 L;  4FO2 A;  3JAM E;  1TWC H;  1HUM A;  3PIP 3;  1JB3 A;  4O42 A;  3VR2 A;  4QGU A;  2XWJ B;  2JP1 A;  5FLM H;  4NDX A;  1Q81 C;  1UE6 A;  1C8C A;  3NSW A;  2B63 G;  2Z6B A;  1G51 A;  4GOP C;  3MVV A;  2E5L Q;  1K0S A;  4L6T B;  3WWV A;  3HKZ B;  5KEE A;  3HOU H;  2R92 B;  2A5H A;  1HUN A;  4DV6 Q;  4KKS A;  2AMC B;  2C9O A;  4RH6 A;  2XIW A;  2QGQ A;  3ND8 A;  2LXJ A;  2JEB I;  1P8L A;  5EGT A;  1LTG D;  3CQZ H;  4LF9 L;  4JV5 Q;  3TZU A;  2E76 C;  1AZP A;  1EIH A;  2MFI A;  1KAA A;  2K5W A;  4BS9 A;  3CPF A;  2LFN A;  2F4V L;  5EAY A;  1EYG A;  1SSO A;  1RL2 A;  1DOK A;  4XYQ A;  5GAH C;  2R7Z B;  4A3D G;  1DD2 A;  4A3C G;  4RFB A;  2AQ3 B;  5CBA E;  3KLS X;  2QKI C;  4DV4 L;  2CWP A;  1Q7Y C;  2HDM A;  4NXN Q;  5JEA J;  1Q46 A;  1EY0 A;  1LM0 A;  2B3G A;  2A73 B;  3JAM c;  1HTL D;  1VQA A;  2CQO A;  1J6Q A;  3HOZ B;  4X6A H;  1X32 A;  1A3T A;  1OXV A;  1PFS A;  1PLF A;  4OIK A;  2Z1C A;  2J0T D;  4KHV A;  4C3J G;  4RA8 A;  1B9N A;  3FKI G;  1Y1W B;  3K59 A;  2I5M X;  3GTO B;  4Z9C B;  4CHT B;  4ME5 A;  1PTO H;  5G3L D;  4CDF C;  1FD7 D;  2RBM A;  1YJ9 A;  1EOV A;  5IYD G;  1PYW D;  5C3E B;  4A3L G;  1U4M A;  2JA5 G;  4B3R Q;  2K5D A;  4GLA C;  4FNF A;  1A3U A;  1PA6 A;  3K81 C;  3GTL H;  1EOT A;  4K0K L;  3BU2 A;  1XX8 A;  3UDI A;  3BZD B;  3NTK A;  3CCV A;  1XXG A;  2CCZ A;  2RKS A;  2JQO A;  3P75 A;  3OPO A;  3RN5 A;  2E2J B;  4GN3 B;  2KHI A;  3J80 i;  2F0O A;  1CKO A;  1AEX A;  4QCL A;  3OW2 A;  3TEH B;  1CQV A;  1OXT A;  3FEW X;  1E1T A;  4B3S Q;  4BY7 G;  5CV6 A;  3L2P A;  4A3K G;  1VQK A;  4A3B G;  4A3F G;  2Y0S G;  1GHJ A;  1QG7 A;  1DGS A;  3HOV H;  2F0I A;  3KLS A;  5IGC A;  1ZYR C;  2F0Q A;  2JA6 B;  2XN9 C;  1G91 A;  1NR2 A;  4DK0 A;  1SRO A;  2CKZ B;  3VYT A;  5C4X H;  3JAM L;  3OTO L;  4ZCK A;  4LK1 C;  4BBR B;  4K14 A;  3R8B A;  1B7Y B;  3AMU A;  1TWF B;  4OWT B;  4C3H H;  4X3T A;  1C4Q A;  3CMA A;  2NN6 I;  2M9V A;  1WTR A;  2ZTC A;  2HHH L;  5FOB B;  1GKH A;  3S1M B;  5EBC A;  2KEC A;  4K8J A;  4KK7 A;  4X65 Q;  3VYU A;  2EJF C;  1QJO A;  2EYL A;  3TSS A;  3NWT A;  1VQP A;  3NQT A;  4H0L C;  4YY3 L;  2F0G A;  1IBM Q;  2L55 A;  3DWA A;  3KUP A;  5E3F A;  2YU9 H;  2FMC A;  4IUN A;  5EPK A;  4IUQ A;  1SNM A;  3K58 A;  4X66 L;  1RHP A;  1EWC A;  4QB4 A;  2XWB B;  3D8G A;  3M3Y H;  1OO9 B;  1S5C D;  4KY5 A;  1BQQ T;  2K32 A;  4CJ1 B;  4G57 A;  1J8I A;  5E1F A;  4BWG B;  4DR2 Q;  1AN8 A;  1IHZ A;  2MJ8 A;  4GKK Q;  2ZXP A;  4FF3 A;  1L1O A;  1A8V A;  1STE A;  3EFX D;  5CBE E;  3GTG B;  4RHS A;  2I0Q A;  1D6E C;  1PRT F;  2JA9 A;  3OOC A;  3T56 B;  1PZI D;  1UEA B;  4DV0 Q;  5C0X I;  4GLX A;  4RKB A;  1EUJ A;  5DLQ E;  1KRS A;  3TRE A;  3K57 A;  4A3F B;  1XNQ L;  4UHV A;  4A3B B;  1HFN A;  2Y0S B;  2RSN A;  1F77 A;  1WD1 A;  2R6G A;  1SNO A;  2N78 A;  2ZJP A;  1BBU A;  2IT1 A;  1HR0 Q;  4IZ8 A;  2XSC A;  4LUZ A;  2AQ1 B;  4DUY L;  2CW0 C;  1DM0 B;  3ITP A;  4A3I B;  1SYG A;  4DUZ Q;  1CA6 A;  1CZW A;  4UPA A;  5LL6 S;  2RDG A;  3J7Y W;  3HOX G;  3IL8 A;  5J3B A;  3H15 A;  4BBS B;  2HCC A;  4KY7 A;  1XTD A;  4YHH L;  1N9W A;  4RG1 A;  3NUC A;  3TP5 A;  3PIO A;  2PQA A;  1DCZ A;  2JA8 G;  5HGQ A;  5C44 B;  5FO8 B;  4E6I A;  4DR7 Q;  1T5E A;  3T16 A;  2F3I A;  4QF4 A;  5M3M H;  5H1S E;  3MA2 B;  4IFD G;  4LFB Q;  1EY7 A;  5C4H A;  1JOQ A;  4AQY Q;  3E9I A;  2VB3 X;  2E2H H;  2AHO B;  4MTK A;  5EKL A;  3PO2 B;  3T51 B;  1G6Z A;  2R93 G;  3I56 A;  2KUM A;  4P75 A;  3LX0 A;  4PNY A;  5C3W A;  2R7F A;  4JBJ A;  1EEI D;  3HZX A;  1TU2 B;  1YHA A;  2FJ2 A;  2JA7 B;  3N52 A;  2WP8 J;  4LF9 Q;  2A68 C;  3VDY A;  2L1B A;  1JJC B;  4NPS A;  1M1K C;  1HZB A;  3HS0 C;  1F2L A;  2F4V Q;  5GAG C;  3I4O A;  2LS0 1;  3ERO A;  5IGD A;  3TRZ A;  1I4P A;  1SND A;  4LF6 L;  2X69 A;  3DHQ A;  4K8I A;  1BXT A;  4JI1 L;  4LF4 Q;  4IUV A;  3KLR A;  2FIN B;  1VF7 A;  3A74 A;  4UAI A;  3HKZ E;  1SE3 A;  4O1N A;  3ULP A;  1Z9F A;  5LMU L;  4DV4 Q;  4DKA C;  3S2H B;  1YHQ A;  2LMC B;  3PUW A;  4C1N K;  1BF4 A;  4DAV A;  1G2T A;  3RNU A;  1FJG L;  2OWO A;  2N55 A;  2WV6 D;  1MBY A;  4TSS A;  2I5H A;  5IY0 A;  4RHR A;  4JI4 L;  4HSV A;  5I6Y A;  1PVO A;  2RQX A;  1E3P A;  1K3B C;  4LFC L;  2AWN A;  3Q23 A;  1BR9 A;  2ALY B;  1IBK L;  4A3G H;  3HKS A;  4UP7 A;  4HIM A;  1H9R A;  2ICI A;  1RJT A;  3L7Z C;  1IL2 A;  1HPC A;  4K6L A;  5K36 G;  2A6H C;  3RLN A;  4KKU A;  2UXD Q;  3M7N A;  4BXX G;  3CF5 A;  2PPB C;  1YIJ A;  4JBK A;  3MC0 B;  2R93 B;  2R61 A;  1QB5 D;  1UNS A;  1V1O A;  4OEM B;  5IP7 H;  4P72 A;  3UDG A;  3HOZ H;  1V8Q A;  3K7U C;  2D0P A;  1S40 A;  2BOS A;  4OWW B;  1CZG A;  4KI0 A;  1KRT A;  1E1O A;  3H0G G;  3OSO A;  1Y1W H;  2UUC L;  1CHQ D;  5COR A;  3JAM i;  3CC4 A;  3GTO H;  1AE3 A;  4KV6 A;  5K5P A;  1X3Q A;  3GV6 A;  1B4O A;  1QUQ A;  1JIC A;  4JI7 Q;  3PCO B;  5C3E H;  2SNM A;  3J81 c;  1QIL A;  2ATW A;  4OGQ C;  1SR3 A;  2B8F A;  1VQM A;  3PO3 B;  2F0M A;  2B2T A;  4LMQ D;  3C46 A;  3UE0 A;  1PYS B;  2AUK A;  3SK8 A;  3OTO Q;  2F0U A;  2OTJ A;  3A8I E;  4HJ7 A;  4OWX B;  2K6A A;  2BDO A;  4FXD A;  1PHJ A;  3IFT A;  1O7Z A;  3AEV A;  3TN2 A;  2EXD A;  1BUV T;  4PMB A;  4BY1 B;  1FR3 A;  3BDL A;  3J7A V;  1QCB D;  4DR3 L;  3BG3 A;  3HRZ C;  3TS2 A;  2NWG A;  1B1Z A;  1KAW A;  4KD3 A;  1G2S A;  1TR5 A;  3EVQ A;  3HOV G;  2G9H D;  1JR0 D;  2Z9H A;  1PYB A;  4DFA A;  4JV5 L;  3CCL A;  1EU4 A;  1I4X A;  3K5M A;  2WAQ E;  1L1O B;  1XPR A;  2LXK A;  1KLU D;  1LT4 D;  2K50 A;  2NYZ D;  2NTS A;  1QNU A;  4PV1 C;  1KC8 C;  1Y1V B;  1RDP D;  5I9P A;  4FF1 A;  4HJ8 A;  3PF4 A;  4BBR H;  2MHV A;  1WJJ A;  1EY4 A;  3S1Q B;  2VNU D;  2OEO A;  2EXZ A;  3NXW A;  5GRO A;  3F2C A;  1PH7 A;  3SHL A;  4NXN L;  3TQY A;  3WDN A;  2ENB A;  1CFM A;  4NW2 A;  1QVC A;  2JYO A;  2RA4 A;  3H0G B;  2Z8L A;  1PH8 A;  1O7L A;  4XT1 B;  3SK6 A;  1QVG A;  3GTK B;  2VUM G;  3L0O A;  4ZLT F;  4MZ9 A;  3CCJ A;  4PQX A;  1IXR A;  1N8R C;  1B70 B;  2EYJ A;  5IOC A;  1XPU A;  4WJW A;  1D5M C;  1PFN A;  3M4Q A;  4QIW B;  5ELE A;  5M9O A;  3V05 A;  4L63 B;  2YTV A;  5IGG A;  4WFN 3;  1ASZ A;  2PQA B;  5M5Y B;  3NTH A;  1BKB A;  1CUK A;  1PFB A;  4DNI A;  4XIG S;  3J7A F;  1MIU A;  4GS3 A;  4CDC C;  4IUU A;  2NTT A;  4U67 3;  4YHH Q;  2E75 C;  4GNX C;  4LFA Q;  3FDT A;  3GTG H;  1Y69 U;  5JJI A;  5C4J B;  1V43 A;  2Z4I A;  3OWE B;  5J22 A;  3CCM A;  4DK6 C;  2D62 A;  3IRB A;  4EQP A;  4ZRZ A;  1TS3 A;  4C1N I;  1TKW B;  4DK3 C;  3RLO A;  1VQN A;  4Q0F A;  1VQL A;  1MD2 D;  4DA2 A;  4CKB A;  2CH4 W;  1A3V A;  2HIX A;  1AW7 A;  1HA6 A;  4MIU A;  3D4D A;  1KDC A;  1Q1E A;  1UWV A;  4CGY B;  5EJW A;  5EBD A;  2NZ1 D;  1VQJ A;  1FGB D;  2Z6K A;  3BDC A;  3BZK A;  3S14 H;  2KHJ A;  4JOI A;  4DK1 A;  1X55 A;  1TWG H;  2RDF A;  4N8X 1;  3T4A C;  5E7N A;  2VQE Q;  3GTM B;  2I07 B;  2IHE A;  1VQ8 A;  2GVA A;  3G7L A;  4LF6 Q;  5C44 H;  5COY A;  2A1A A;  2NZO A;  2ES2 A;  4GZY C;  5CYU A;  2VUM B;  4JI1 Q;  4AH6 A;  2NUC A;  1EL0 A;  1S5E D;  2Q2U A;  1DXM A;  1KNE A;  3PUZ A;  1BCP D;  3C1F A;  4R4Q A;  3VR6 A;  1CA5 A;  1RIP A;  5LMU Q;  4X65 L;  1I4Q A;  1KL9 A;  4P2C B;  5BN3 A;  1FJG Q;  4JG2 A;  1S72 A;  3T53 B;  1R4Q B;  3IAY A;  3ER0 A;  2JA7 H;  2F0K A;  4A3J B;  1HJP A;  1LTR D;  1W6K A;  2XRQ D;  4JI4 Q;  4EVO A;  4QMG A;  4OO1 H;  3V96 A;  3UDF A;  3CCE A;  2WKD A;  1WTO A;  4DR5 Q;  1IBK Q;  2F0T A;  1JWS D;  4FXG C;  4IFD I;  2G5D A;  3R93 A;  4DR2 L;  2PZU A;  3EIV A;  3F8T A;  4GKK L;  1BCP F;  1S5D D;  1GXD C;  2BDN A;  1Q1B A;  2B8G A;  4TVA B;  4AYB B;  1NAP A;  1H9S A;  4LF5 Q;  4IOA A;  4WJ3 M;  3I4M H;  1PH1 A;  3S2H H;  2ZTE A;  1WFQ A;  4G4K A;  4DV0 L;  1VQ5 A;  3KYH C;  1HZA A;  1O7I A;  1YHB A;  5JAV A;  1GUN A;  2HT1 A;  4A93 G;  3H91 A;  1MJE A;  1QUQ B;  2EY2 A;  1I94 Q;  2NVY B;  1PH4 A;  3SR1 A;  4IN3 A;  3OMG A;  1XMO Q;  3A7L A;  1CI3 M;  4JI0 Q;  1HR0 L;  1RTN A;  2B2Y A;  3BS1 A;  2SOB A;  3BZC A;  4A3M G;  1LTB D;  3K80 C;  3RZO H;  3M7G A;  4XQQ A;  2UUC Q;  4IUT A;  1PFM A;  1WTV A;  3ERS X;  5E4X A;  5LL6 X;  3TME A;  4K5V A;  1A2T A;  4PZ6 A;  4FF2 A;  2VL6 A;  5JJZ A;  4HIK A;  3K7A H;  5BN4 A;  2SDF A;  3I3C A;  3I4N G;  5M3F H;  3KF8 A;  2IX1 A;  1L2F A;  1I50 H;  3HOW G;  4RGO S;  2EYF A;  3M4O B;  3LWU A;  1UEB A;  2OQK A;  3K6O A;  4DR7 L;  2NVT B;  2BE5 D;  2I5L X;  4LFB L;  1YNJ C;  4ME3 A;  2QEX A;  4DAP A;  4AQY L;  2UU9 L;  4ALP A;  2B2U A;  3QIA A;  5LHY 1;  4LUO A;  1HHV A;  2HDL A;  1GD7 A;  4HJ9 A;  4DAM A;  4DR3 Q;  3GTQ H;  1K73 C;  1PRT C;  1SNC A;  1STA A;  2P5Z X;  3GTJ B;  1G8Z D;  3SDZ A;  2EDG A;  4A3E B;  4DAY A;  3U58 A;  3CRL C;  1I4G A;  1BBW A;  2KCN A;  1X56 A;  3A8K E;  4LF4 L;  1KHI A;  4C2M H;  1KXL A;  2QA4 A;  2YYZ A;  2XVS A;  2B2T C;  4HIO A;  1VQ4 A;  2ZJR A;  3A55 A;  3E0E A;  2OF1 A;  4IPD A;  3ERQ A;  1B53 A;  4LWC A;  2EJM A;  1K8A C;  3AU7 A;  2NBF A;  4R9W A;  2KOL A;  4IPC A;  4DNT B;  4HED A;  3BVM A;  5ELF A;  1WTX A;  4JI8 Q;  3FPP A;  2WAQ G;  3I70 A;  3HFZ B;  4OL7 A;  4IUR A;  4P74 A;  4A75 A;  4DR1 L;  4KHZ A;  2FFK B;  3NEM A;  3K8A A;  2EY5 A;  1JWU D;  1I6H B;  3JC6 6;  2O4X A;  3FP9 A;  2Q8T A;  1Y1V H;  1B3Q A;  1I5F A;  1NJI C;  1SFO H;  1W3S A;  2N3S A;  5LMN L;  1YIT A;  2B63 B;  2PYK A;  2UXD L;  4DGZ A;  1VDZ A;  1B8A A;  1PDQ A;  3R2T A;  1SLJ A;  1STN A;  3NE5 B;  1K9M C;  3CC2 A;  4CDE C;  1WI5 A;  1I4H A;  2WB1 G;  3E5S A;  4M8A A;  3CPW A;  3E9H A;  4RAU C;  2CWA A;  4K2K A;  5IGE A;  1I3Q H;  1PH3 A;  2L4N A;  2F52 A;  4R4T A;  2QCP X;  2TSS A;  3A56 A;  4XYO A;  1IW7 D;  2EY6 A;  5M5X H;  1U9R A;  5M5Y H;  3S17 B;  5G3L F;  4WJ4 A;  4YWM A;  3WOF A;  3BYY B;  1QZH A;  1OTC A;  2SNS A;  4JI7 L;  2F3V A;  4XT3 B;  2KBN A;  5ELO A;  2Z4H A;  3HGB A;  5JOB A;  3UE1 A;  1TQO A;  1N33 L;  1VCI A;  3D6C A;  4A3D B;  3AB9 A;  2F0H A;  5CV7 A;  2K52 A;  4DR6 L;  1F9P A;  3GP7 A;  5C4J H;  3NEL A;  3TP6 A;  4BA2 I;  4B3M L;  4G7Z C;  3E3X A;  2GA4 B;  3KJO A;  3D4R A;  1YNN C;  4OXP A;  4C3J B;  3KDF A;  2QIL A;  1OXU A;  3FKI B;  3QWN A;  5I4D A;  4V19 0;  2F4I A;  1YI2 A;  4ABN A;  1SE8 A;  1G6P A;  2A6E D;  4C3I H;  2M00 A;  3GTP H;  1EQV A;  3PUX A;  4O2D A;  5IGB A;  1HQR D;  2JA5 B;  2MQH A;  3GQB A;  1H9S B;  4PG3 A;  4LJZ C;  3GTM H;  2H1E A;  3NBH B;  3HOY G;  4DNR B;  4KLK A;  1ILQ A;  2Z6K C;  2D2C C;  3RN2 A;  1EZ8 A;  1SBB B;  1R9T H;  1EY8 A;  1K8G A;  1STY A;  2JJQ A;  1VS0 A;  2E2D C;  3EJI A;  4N9P A;  2F0F A;  1WCM H;  2DGY A;  2KVM A;  2NN6 H;  3CCQ A;  1EYC A;  3VYS A;  4KHP L;  2CH4 A;  3L9A X;  5A35 A;  3UDX A;  4BY7 B;  4A3K B;  1JC7 A;  1MHW C;  3TP8 A;  3PF5 A;  2F03 A;  1U5K A;  1Y14 B;  3KF8 B;  2UXB L;  5C6A A;  2K4K A;  4A3J H;  2ID0 A;  5CV8 A;  4KJN A;  3GV3 A;  1S4Z A;  5CV4 A;  3MEH A;  5I9O A;  3SXH A;  3ULJ A;  1NR4 A;  4H7B A;  1NTG A;  1UE7 A;  4LFA L;  2PW7 A;  2IX3 A;  4AYB E;  4ZK9 B;  1GUO A;  3W3A A;  3RLF A;  3P7J A;  3V2T A;  1EQQ A;  3SK4 A;  2JEA I;  1SYE A;  3M4Y A;  3A7A B;  3RZD B;  3G4S A;  2UU9 Q;  1SMX A;  2C5C A;  3K0Y A;  5C0X H;  4HR7 B;  4IOC A;  2ZXO A;  3URY A;  1H9J A;  5JEA G;  2R7D A;  1TS4 A;  4DAY B;  2EYH A;  2KCC A;  1V9P A;  1JWM D;  2Q8R E;  1C7Y A;  5M3F G;  2K5V A;  1BDO A;  2B2Y C;  2R3Z A;  2WFW A;  1Z47 A;  1F2Y A;  4DV3 L;  3U4V A;  2I46 A;  2VQE L;  3FPU B;  5FLM G;  3M4O H;  1HZ9 A;  1E7Z A;  4RKL A;  4JI5 L;  5HGT A;  1NSN S;  2HCI A;  2FMM A;  2NVT H;  1EWH A;  1T5X D;  2UXC Q;  1AZQ A;  1EYD A;  4JI6 Q;  2EOT A;  5KYI A;  3HOU G;  4JBM A;  1RTO A;  1ZYR D;  2BA0 A;  1LAC A;  5L37 A;  1ML0 D;  1Q8I A;  2R92 H;  3S1N B;  2QDB A;  1TT2 A;  3J81 E;  4KJO A;  4JCV E;  1FNU A;  1VQB A;  1VQH A;  5JJL A;  4B08 A;  3DXJ C;  4CJ0 B;  1VQ6 A;  1K28 A;  3GTJ H;  3ZJY C;  2RVL A;  3R2I A;  2NZH A;  1K8M A;  4RCO A;  1T9H A;  4DR1 Q;  2K5N A;  1XWE A;  3HOX B;  3N6R A;  4A3E H;  1ESR A;  2ZXR A;  1O78 A;  4DR5 L;  2PI2 E;  1BCP B;  4HCS A;  1ILP A;  3AYH B;  4G7O C;  4YWK A;  2JA8 B;  2PNH A;  1YVC A;  5EQ0 A;  5C0X J;  1PH5 A;  2R7Z H;  2V1C C;  3MFG A;  2E8G A;  1ROD A;  1CQF A;  1YNX A;  3HP3 A;  4RWS C;  3EBE A;  1D5Z C;  2WIN B;  2MNA A;  5LMN Q;  1WTP A;  1N34 L;  1QVF A;  1FGU A;  1S3O A;  1J5E L;  1SMY D;  1PZK D;  1F2Z A;  3QO2 A;  1I94 L;  4R8N A;  1RD9 D;  4DR4 L;  5IP9 H;  1TWH B;  1XMO L;  2DNC A;  4JI0 L;  1FL0 A;  3PIP A;  1LTA D;  4LF5 L;  5D3D A;  4DV1 L;  4HID A;  3FHW A;  4H13 C;  2WII B;  2EQS A;  2K28 A;  2IHF A;  1EZ6 A;  1XMQ L;  1I6H H;  3RD4 A;  1X3F A;  1G29 1;  3D0F A;  2JN4 A;  2KED A;  3H3V C;  3NPP A;  3F2U A;  4L5S A;  4X3U A;  4EX5 A;  3S1R B;  4XQN A;  4ZKB B;  3FVQ A;  2UUA L;  1N33 Q;  3KDF B;  2EY1 A;  3HOU B;  5IE8 A;  4DR6 Q;  1E2W A;  2CW0 D;  3OIQ A;  3SK5 A;  4F8M A;  4ID6 A;  2VZA A;  4PZ8 A;  4B3M Q;  1MGS A;  4U68 A;  2E2J H;  2ASB A;  1M90 C;  4KKT A;  3KJP A;  3CQZ B;  3CD6 A;  2AUJ D;  3MWY W;  1BCP C;  2J4X A;  2ICE C;  2RCN A;  4HCE A;  4NB3 A;  3LWE A;  5IYB H;  1Q12 A;  3OHX C;  4X3K A;  2VY3 A;  1ASY A;  1XNR L;  3G48 A;  2DJG C;  5KNB A;  3KOJ A;  3VR4 A;  2NB0 A;  3CCR A;  1Y8N B;  3DM3 A;  2JA6 H;  3PV0 A;  1KQS A;  5C4X G;  2KA7 A;  4A3C H;  2IW3 A;  5ISR A;  1GHK A;  3M85 A;  4F7X A;  3S16 B;  4C3H G;  2UUB Q;  1VQE A;  5JVG 3;  4TRD A;  3CME A;  3NP8 A;  1TWF H;  2VXW A;  3BVG A;  1X65 A;  2N49 A;  2A68 D;  4JBW A;  4A4I A;  1EU3 A;  4C3J H;  5T1G A;  1KLG D;  3UI2 A;  3S1M H;  5T1I A;  1RF2 D;  3I91 A;  3FKI H;  2D0O A;  2RDH A;  3EA6 A;  4C3I G;  4KHP Q;  5DM7 3;  2X6G A;  4A76 A;  5JJK A;  5F2D A;  1VQF A;  2K5H A;  2OCE A;  3NQI A;  4MTN A;  3X3M A;  2BH8 A;  4JI8 L;  3HEJ A;  4ULL A;  3J81 L;  2EZV A;  5JPN C;  2UXB Q;  5IYD H;  3GTL B;  4A3L H;  4I65 A;  2KJX A;  3ICE A;  2YTX A;  3NEN A;  3OYY A;  2WKC A;  1STB A;  1A15 A;  3NWS A;  2KHS A;  1NMF A;  4JC0 A;  3RR5 A;  3VYR A;  4FXK C;  1JE5 A;  3KF6 A;  3D3R A;  4ILW A;  1WCM G;  3MXG A;  1IL8 A;  3S24 A;  3ZYY X;  2F0D A;  1H9M A;  2LKV A;  3KBX A;  4FDB A;  1WTH A;  3SGI A;  1LTT D;  2K03 A;  4A3G G;  4BY7 H;  4DV2 L;  3HOV B;  1L1O C;  4A3F H;  4A3B H;  2Y0S E;  4N9T A;  2FHT A;  5I2Y A;  3F2D A;  4LUV A;  4DV7 Q;  4KY6 A;  5AJ3 L;  2B2W A;  1JJ2 A;  5EKK A;  4A3I H;  5KIX A;  2LY7 A;  1DON A;  2PW5 A;  2A19 A;  4JYA L;  2AWO A;  4BBS H;  3LNN A;  4B9X A;  4CKE A;  3LGJ A;  2L5T A;  4L8J A;  2K75 A;  5GQO A;  4DV3 Q;  5TSS A;  4EGV A;  2IJ0 A;  3PIO 3;  1HNX L;  5M3M G;  1Q86 C;  4OX9 L;  2K04 A;  1GOZ A;  5C4Z A;  1WYD A;  4JI5 Q;  3G6E A;  4MN3 A;  2EE1 A;  2IWH A;  3RZD H;  3AFP A;  3PO2 H;  1X6O A;  3CAM A;  1LTI D;  4F87 A;  4EQN A;  4IJH A;  1A6X A;  3TS0 A;  1EWI A;  5CR3 A;  2JXM B;  4R8I A;  1KAB A;  4DU9 A;  1CKN B;  3GO5 A;  1EIF A;  2AQ2 B;  4QUC A;  1IYJ B;  1MI2 A;  4UP9 A;  3CCS A;  2H4O A;  3S9W A;  4YCV A;  2VQF L;  1JJG A;  1L0Y B;  1X54 A;  2IPK D;  1A63 A;  3SVM A;  2KCT A;  4NP5 A;  1SYF A;  4NXM Q;  4POG A;  3H3V H;  1HA5 A;  4RCN A;  1TVX A;  3HKZ G;  3PSI A;  2EJG C;  2R92 G;  1CM9 A;  2VB2 X;  3MHB A;  1N34 Q;  3CXC A;  4GOP B;  5JVH 3;  1DJR D;  1Y8O B;  4OON A;  1J5E Q;  1EY9 A;  3S15 B;  2F0V A;  3NBH A;  1WD0 A;  1J9O A;  3FRP B;  3E6Z X;  2EYP A;  3W5O A;  3DUZ A;  4FVM A;  1QNK A;  1DOL A;  4DR4 Q;  1SEB D;  4DN4 M;  5DM6 3;  1ICW A;  4HSP A;  1RCV D;  1KDB A;  5KGU A;  3HOX H;  1IW7 C;  5NUC A;  4DV1 Q;  1PH2 A;  3OWF A;  2K01 A;  1KNA A;  1JQY D;  4ZUJ A;  4DF7 A;  1XMQ Q;  3R3O A;  3MZ5 A;  3CW2 C;  1JMC A;  1V1P A;  5M3M B;  2QEJ C;  3Q24 A;  2EYM A;  1BNZ A;  2JA8 H;  3CP0 A;  1SYB A;  1YJN A;  2E2H B;  2UUA Q;  4IFD H;  4QL5 A;  5IP7 G;  2HD3 A;  2C35 B;  2DUD A;  3HOZ G;  2R93 H;  3W1B A;  1QE6 A;  1SXT A;  2YV5 A;  3U4Z A;  3GDE A;  4JI3 L;  3ND9 A;  3Q6S A;  2KEE A;  3MXN A;  1IYV A;  3EQL C;  1A2U A;  4EQ5 A;  1TWH H;  4R4I A;  1Y1W G;  5FLX c;  3CHB D;  3U50 C;  3I72 A;  1SE2 A;  2V4D A;  3MXU A;  2A8V A;  1CHP D;  3MXP A;  4IPH A;  5C3E G;  1XNR Q;  4QUF A;  1NE3 A;  1FNV A;  1LYL A;  1VMP A;  5J1Z A;  3CU7 A;  2A6E C;  1M4V A;  3NHH A;  3S1R H;  3G6J B;  1CKM A;  3A8J E;  1MJC A;  2IY5 B;  1PTO D;  1EQT A;  3PO3 H;  2PQE A;  1ENC A;  3U9O A;  3VA5 A;  2F0J A;  1LLR D;  4YCW A;  5KNC A;  3P1H A;  1LT3 D;  1UE5 A;  2UXC L;  1O80 A;  2YTY A;  1Q8K A;  4JI6 L;  2OQ0 A;  5D3I B;  2K1B A;  3MAQ A;  3J81 i;  1D1K A;  1YZ6 A;  4A93 B;  3A0J A;  1GVP A;  3S2D B;  5IYB G;  2ZTD A;  1S5B D;  2JK8 A;  4BY1 H;  2A69 D;  3E0J A;  3VA7 A;  3T1Y L;  2A74 C;  4A3M B;  3STB D;  4A3G B;  3KF6 B;  1VQO A;  1IZ6 A;  4XQJ A;  1IBL Q;  2JE6 I;  2MUY A;  4IFD J;  2JA6 G;  1U4P A;  1PTO F;  1PH9 A;  5K36 H;  5HY6 A;  3I4N B;  5AFW A;  3DWQ A;  4Q5V A;  3HG9 A;  3T13 A;  3EN2 A;  1S5F D;  3T1H Q;  3HOW B;  1YBY A;  4BBR G;  1K0R A;  1HFG A;  4CDD C;  4BXX H;  3S16 H;  1LAB A;  1VQG A;  3I73 A;  2MO1 A;  3H94 A;  3S1Q H;  4K6D A;  2KCM A;  2XGT A;  1ENF A;  2IX0 A;  1JCK B;  4LF8 L;  2GN5 A;  4DXG A;  5FLX L;  3I2Z A;  2NVQ B;  5ELC A;  3H0G H;  1HRJ A;  3GTK H;  4RGM A;  4ZQ3 A;  2K7V A;  1K83 B;  4ZAI A;  4K5W A;  4WOR A;  1HTP A;  4QIW E;  4DV2 Q;  3C2P A;  4Y52 H;  1NNX A;  1JE4 A;  1SNP A;  2OT2 A;  5FJ8 H;  2K5Q A;  4IPG A;  3I7F A;  3KBG A;  3D4W A;  3D31 A;  1N36 Q;  1HNZ L;  2BCO A;  1C9O A;  4K5X A;  2L9H A;  5AJ3 Q;  2OTL A;  2IL8 A;  2E74 C;  3F2B A;  1D2B A;  1EFW A;  2PO4 A;  3ULL A;  1CSQ A;  4K2L A;  2NVX B;  4JYA Q;  3J7A 5;  2DY7 A;  4O0A A;  3KLW A;  4B3T Q;  2O5J C;  3K5N A;  3AQQ A;  2N8N A;  1HNX Q;  4OX9 Q;  3DEP A;  2MPM A;  1A0I A;  4ZKC B;  2RHS B;  4P71 A;  1B3A A;  5IYC H;  4X62 Q;  4XXE A;  4M1U B;  1GM5 A;  4V0B A;  1SJH D;  2WAQ B;  4NKL A;  3I55 A;  2E2I B;  1VQI A;  4ZYS A;  2BA1 A;  4A3I G;  1EFI D;  2X6L A;  1YNJ D;  4LAA A;  5E4W C;  3VR3 A;  1W2B A;  4BBS G;  2Q2H A;  2F0E A;  2EIF A;  2Q8I B;  1EYA A;  2AKW B;  2QF7 A;  4JPB W;  2VQF Q;  2EYO A;  2Z0S A;  1A62 A;  1IKL A;  1II3 A;  1LTL A;  1WVL A;  2B2W C;  2JSO A;  1QWY A; 
#chains in the Genus database with same CATH homology
 2B63 G;  1G51 A;  2V1C C;  1XPO A;  2E8G A;  3GTG H;  4GOP C;  5C44 G;  5JJI A;  1YNX A;  2UUB L;  1V43 A;  3EBE A;  4J15 A;  2MNA A;  5LMN Q;  2E5L Q;  1N34 L;  1YEZ A;  3WWV A;  1QVF A;  1FGU A;  3CCM A;  3HOU H;  4JOI C;  1S3O A;  2VUM H;  1J5E L;  3PO2 G;  4DK6 C;  2D62 A;  3J81 j;  3IRB A;  4DV6 Q;  3B6Y A;  1HNW Q;  2AMC B;  4DK3 C;  3RLO A;  1VQN A;  3KFU A;  2QGQ A;  3CCU A;  2LXJ A;  1I94 L;  1VQL A;  4DR4 L;  1SN8 A;  1P8L A;  2HIX A;  2JEB I;  2RHQ B;  5IP9 H;  1XMO L;  3CQZ H;  2KEN A;  4LF9 L;  4JI0 L;  4JV5 Q;  4GNX A;  1FL0 A;  3PIP A;  1Q1E A;  2MFI A;  4LF5 L;  1UWV A;  4DV1 L;  2JA7 G;  4HID A;  3FHW A;  2EQS A;  3CPF A;  2IHF A;  1XMQ L;  1VQJ A;  1I6H H;  4JI2 L;  2F4V L;  2VW9 A;  1X3F A;  2Z6K A;  3BZK A;  1G29 1;  4YCU A;  2KHJ A;  3D0F A;  5EAY A;  1EYG A;  4JOI A;  1RL2 A;  3GD7 A;  1X55 A;  3S14 H;  4OO1 G;  5IWA L;  1HH2 P;  4L5S A;  5GAH C;  1TWG H;  4MNO A;  4EX5 A;  4HJA A;  5E7N A;  1X9N A;  4A3D G;  2VQE Q;  4A3C G;  1PH2 A;  1N33 Q;  2IHE A;  2UUA L;  3KDF B;  4GN5 A;  1VQ8 A;  2GVA A;  4DV4 L;  2CWP A;  4GLV B;  1Q7Y C;  5C44 H;  4LF6 Q;  3PGZ A;  5IE8 A;  2A1A A;  2NZO A;  4YWL A;  3MXN B;  4BA1 I;  5JEA J;  2ES2 A;  1Q46 A;  4JI1 Q;  4AH6 A;  4LF7 Q;  4NXN Q;  1LM0 A;  2B3G A;  2Q2U A;  3JAM c;  1VQA A;  3I4M G;  2CQO A;  1J6Q A;  3PUZ A;  4X6A H;  2VZA A;  4R4Q A;  1OXV A;  3M9B A;  4LNQ A;  1PFS A;  4PZ8 A;  2L15 A;  4B3M Q;  4PZ7 A;  1RIP A;  5LMU Q;  2E2J H;  4IOA A;  4X65 L;  2ASB A;  1M90 C;  1MKH A;  3KJP A;  3FKI G;  3CD6 A;  3S15 H;  1KL9 A;  4UY8 C;  4JI3 Q;  1FJG Q;  2RCN A;  4NB3 A;  2I5M X;  4JG2 A;  1S72 A;  5IYB H;  2NVY H;  1Q12 A;  2VY3 A;  3ER0 A;  1ASY A;  2JA7 H;  1HJP A;  4DV5 Q;  1XNR L;  4JI4 Q;  4AIM A;  1YJ9 A;  1EOV A;  5IYD G;  4X64 L;  3G48 A;  2ZM6 L;  4DV7 L;  4A3L G;  3AFQ A;  3KOJ A;  1UE1 A;  2JA5 G;  4B3R Q;  1QZG A;  4GLA C;  3UDF A;  3CCR A;  3CCE A;  4GN4 B;  1KD1 C;  4DR5 Q;  3DM3 A;  1IBK Q;  1PA6 A;  1VQC A;  3K81 C;  2JA6 H;  4PMW A;  3GTL H;  3PV0 A;  1KQS A;  4R1J A;  1HR0 W;  4K0K L;  4A3C H;  5C4X G;  3BU2 A;  4IFD I;  4DR2 L;  3CC7 A;  3EIV A;  3UDI A;  3F8T A;  4GKK L;  3M85 A;  3CCV A;  2UUB Q;  1Q1B A;  4TVA B;  2CCZ A;  2JQO A;  1VQE A;  2HIV A;  3CME A;  1H95 A;  4WJ3 M;  1PH5 A;  1TWF H;  3RN5 A;  3I4M H;  4GN3 B;  1PH1 A;  2KHI A;  3J80 i;  2BH2 A;  3S2H H;  2ZTE A;  1WFQ A;  4DV0 L;  1VQ5 A;  1CKO A;  3KYH C;  1HZA A;  1O7I A;  1P16 A;  1X65 A;  1YHB A;  2N49 A;  4JBW A;  2HT1 A;  4A4I A;  3TEH B;  4C3J H;  3OW2 A;  1VQD A;  5ELN A;  4HJ5 A;  1YJW A;  1OXT A;  1QUQ B;  1MJE A;  3S1M H;  3FKI H;  4A93 G;  1I94 Q;  2D0O A;  1E1T A;  1PH4 A;  4B3S Q;  4BY7 G;  3L2P A;  3A5U A;  4A3K G;  4A76 A;  1XMO Q;  1VQK A;  4A3F G;  4A3B G;  4KHP Q;  5JJK A;  4DR6 Q;  4JI0 Q;  1HR0 L;  1VQF A;  2K5H A;  2OCE A;  3BZC A;  2Y0S G;  4MTN A;  4A3M G;  3G71 A;  1KIX A;  2BH8 A;  1DGS A;  3K80 C;  4JI8 L;  2UUC Q;  3HOV H;  3RZO H;  3T1Y Q;  3ERS X;  2UXB Q;  5IYD H;  4A3L H;  3ICE A;  2YTX A;  3NEN A;  3OYY A;  4PZ6 A;  2VL6 A;  4HIK A;  1SRO A;  2CKZ B;  3K7A H;  3PO3 G;  4JC0 A;  1NMF A;  5C4X H;  3RR5 A;  3I4N G;  5M3F H;  1Q82 C;  1JE5 A;  3OTO L;  2IX1 A;  1L2F A;  3KF6 A;  1I50 H;  3HOW G;  1B7Y B;  4OWT B;  5IT9 c;  4C3H H;  1UEB A;  3CMA A;  2OQK A;  2NN6 I;  1WCM G;  1BVS A;  4IJL A;  4DR7 L;  4NXM L;  1CKN A;  2ZTC A;  2HHH L;  3S24 A;  1GKH A;  2I5L X;  4LFB L;  4ME3 A;  2QEX A;  4P73 A;  4AQY L;  1SRU A;  2UU9 L;  4X65 Q;  4FDB A;  3SGI A;  4R4O A;  4ALP A;  4A93 H;  4BY1 G;  4LF8 Q;  4LUO A;  3S2D H;  1VQP A;  4LW1 A;  4GKJ L;  4A3G G;  4YY3 L;  1GD7 A;  4BY7 H;  4DV2 L;  1L1O C;  4A3F H;  1IBM Q;  2Y0S E;  4A3B H;  4HJ9 A;  2YU9 H;  4DAM A;  4DR3 Q;  3GTQ H;  1NMG A;  4A3M H;  1K73 C;  4X66 L;  4XTC S;  3F2D A;  1N32 L;  3BJU A;  4LUV A;  4DV7 Q;  3M3Y H;  5AJ3 L;  5BR8 L;  1JJ2 A;  1E24 A;  1D8L A;  4POF A;  4GOP A;  4A3I H;  1NBW A;  1Y1V G;  3I4N H;  4K0K Q;  2A19 A;  1K3R A;  4DR2 Q;  1HNZ Q;  3U58 A;  1TXY A;  3W1G A;  2AWO A;  4BBS H;  3HOW H;  4JYA L;  4GKK Q;  1BBW A;  3LGJ A;  1X56 A;  1L1O A;  2K75 A;  1A8V A;  5GQO A;  4DV3 Q;  4LF4 L;  1KHI A;  4C2M H;  2I0Q A;  1KXL A;  2QA4 A;  1HNX L;  5M3M G;  2JA9 A;  2YYZ A;  1Q86 C;  4OX9 L;  4HIO A;  2B63 H;  1WYD A;  4JI5 Q;  3G6E A;  4DV0 Q;  5C0X I;  1D7Q A;  1VQ4 A;  2ZJR A;  3E0E A;  2NVQ H;  4GLX A;  1XNQ L;  1EUJ A;  4IPD A;  1KRS A;  5DLQ E;  3TRE A;  3PUV A;  3RZD H;  3AFP A;  2ZJQ A;  5LMN W;  4LWC A;  3PO2 H;  1X6O A;  2R6G A;  3CAM A;  1K8A C;  1K83 H;  2N78 A;  4IJH A;  2ZJP A;  1BBU A;  3TS0 A;  2IT1 A;  1HR0 Q;  1EWI A;  4IPC A;  4LUZ A;  5FJ8 G;  4JI8 Q;  4DUY L;  2WAQ G;  4A75 A;  3HFZ B;  4DR1 L;  4P74 A;  4KHZ A;  1CKN B;  3NEM A;  3K8A A;  3GO5 A;  1EIF A;  4DUZ Q;  1IYJ B;  4UP9 A;  4UPA A;  3CCS A;  3S17 H;  3JC6 6;  3HOX G;  5J3B A;  4YCV A;  3H15 A;  3FP9 A;  2VQF L;  1JJG A;  1XTD A;  1Y1V H;  4YHH L;  1I5F A;  1N9W A;  1X54 A;  4RG1 A;  3PIO A;  1A63 A;  1NJI C;  4TQU S;  2PQA A;  1SFO H;  1W3S A;  2N3S A;  2E5L L;  5LMN L;  1YIT A;  2KCT A;  1PV4 A;  1C0A A;  2NVX H;  2JA8 G;  4A3D H;  2UXD L;  5HGQ A;  4DR7 Q;  4NXM Q;  1X3E A;  5M3M H;  5H1S E;  2F3I A;  4UP8 A;  2HHH Q;  4POG A;  1B8A A;  4IFD G;  1SLJ A;  1K9M C;  3CC2 A;  4DV6 L;  3H3V H;  4LFB Q;  3HKZ G;  4AQY Q;  3E9I A;  3PSI A;  1WI5 A;  2WB1 G;  5IYC G;  4GNX B;  2AHO B;  2E2H H;  1JB7 A;  2R92 G;  2R93 G;  1N34 Q;  4QJF A;  3CXC A;  3I56 A;  4GOP B;  4P75 A;  3CPW A;  3E9H A;  4OON A;  2CWA A;  1J5E Q;  1I3Q H;  4YY3 Q;  4R4T A;  2F52 A;  1PH3 A;  2R7F A;  4JBJ A;  5M5X H;  4X66 Q;  3W5O A;  3PUY A;  5M5Y H;  4WJ4 A;  4DR4 Q;  1YHA A;  2FXQ A;  4YWM A;  2E2I H;  2WP8 J;  3J7Z C;  4LF9 Q;  1IBL L;  1QZH A;  4L5R C;  1OTC A;  3VDY A;  4LF5 Q;  4JI7 L;  5ELO A;  3HOX H;  2KBN A;  3UE1 A;  1JJC B;  4NPS A;  3J80 c;  1AE2 A;  1LUZ A;  4DV1 Q;  4H02 A;  1M1K C;  1HZB A;  1XMQ Q;  4JI2 Q;  1N33 L;  2F4V Q;  5GAG C;  1VCI A;  3CW2 C;  5C0X J;  3I4O A;  1JMC A;  2JA5 H;  3TRZ A;  4LF6 L;  5IWA Q;  2K52 A;  4DR6 L;  3T1H L;  4JI1 L;  4LF4 Q;  2JA8 H;  3CP0 A;  5GAD C;  1YJN A;  5GAE C;  3A74 A;  2PI2 A;  3NEL A;  3HKZ E;  5C4J H;  2UUA Q;  4BA2 I;  2WB1 E;  4B3M L;  4QL5 A;  1Z9F A;  5IP7 G;  5LMU L;  4DV4 Q;  3ULP A;  4DKA C;  3F1Z A;  4Y7N H;  2C35 B;  2DUD A;  3HOZ G;  3KJO A;  1YHQ A;  2R93 H;  3PUW A;  1XNQ Q;  3W1B A;  2PMZ E;  2NN6 G;  2YV5 A;  4OXP A;  3U4Z A;  3KDF A;  3GDE A;  1VQ9 A;  4JI3 L;  4RMF A;  3RNU A;  1OXU A;  2MO0 A;  1FJG L;  2OWO A;  2I5H A;  1YI2 A;  5IY0 A;  4EQ5 A;  1TWH H;  4R4I A;  1Y1W G;  5FLX c;  4DUY Q;  1SE8 A;  4JI4 L;  3U50 C;  1PVO A;  4C3I H;  1G6P A;  4A3K H;  1E3P A;  3GTP H;  4LFC L;  2AWN A;  3PUX A;  4O2D A;  4A3J G;  4B3R L;  2ALY B;  2A8V A;  4L5Q A;  1V1Q A;  1E22 A;  1IBK L;  4A3G H;  3HKS A;  4IPH A;  4UP7 A;  5C3E G;  2MQH A;  1XNR Q;  4HIM A;  1NE3 A;  3L7Z C;  1LYL A;  4PG3 A;  1N36 L;  1IL2 A;  4X64 Q;  3K0X A;  2ZM6 Q;  4L5T A;  5K36 G;  3RLN A;  3S1R H;  1CKM A;  2IY5 B;  1MJC A;  3GTM H;  1EQR A;  3NBH B;  3HOY G;  3PO3 H;  4KLK A;  2UXD Q;  2Z6K C;  3RN2 A;  3M7N A;  4BXX G;  3CF5 A;  1YIJ A;  4JBK A;  4YCW A;  1R9T H;  5IP7 H;  4AYB G;  1K8G A;  2R7Z H;  2JJQ A;  1VS0 A;  1UE5 A;  4P72 A;  2UXC L;  3UDG A;  4B3T L;  2YTY A;  1Q8K A;  4JI6 L;  1WCM H;  2Q2I A;  3HOZ H;  3K7U C;  2D0P A;  2DGY A;  2OQ0 A;  2UXB L;  1S40 A;  3CCQ A;  1X3G A;  1YZ6 A;  3J81 i;  4B3S L;  4KHP L;  4OWW B;  1TWA H;  3A0J A;  4KI0 A;  1GVP A;  1E1O A;  3H0G G;  1KRT A;  3UDX A;  5C0X G;  5IYB G;  2ZTD A;  2JK8 A;  4X62 L;  1Y1W H;  2UUC L;  3PF5 A;  4BY1 H;  1FVI A;  3T1Y L;  2GVB A;  1U5K A;  1Y14 B;  3KF8 B;  3STB D;  4OO1 I;  3JAM i;  3CC4 A;  3KF6 B;  1AE3 A;  3GTO H;  1VQO A;  2K4K A;  4A3J H;  3A5Z B;  1IZ6 A;  2ID0 A;  1IBL Q;  2Q2T A;  2JE6 I;  1AH9 A;  1QUQ A;  4JI7 Q;  4QQB X;  3PCO B;  5C3E H;  4IFD J;  3J81 c;  2JA6 G;  2ATW A;  1PH9 A;  1SR3 A;  1VQM A;  3H3V I;  3STB C;  5HY6 A;  3ULJ A;  2K14 A;  3EN2 A;  3HOY H;  3T1H Q;  1PH6 A;  1NTG A;  1YBY A;  1L0W A;  4BBR G;  1K0R A;  1UE7 A;  1JT8 A;  3UE0 A;  1PYS B;  4BXX H;  1EIY B;  3S16 H;  1HZC A;  4LFA L;  3OTO Q;  2OTJ A;  4AYB E;  4HJ7 A;  4OWX B;  1VQG A;  2MO1 A;  2LSS A;  3RLF A;  3S1Q H;  2KCM A;  3M4P A;  1CSP A;  1PHJ A;  2CFM A;  2XGT A;  2IX0 A;  1EQQ A;  4LF8 L;  2GN5 A;  3AEV A;  3I2Z A;  2H5X A;  2EXD A;  2XTI A;  1VQ7 A;  2JEA I;  1IBM L;  3H0G H;  3G4S A;  2UU9 Q;  4DR3 L;  3GTK H;  1SMX A;  3TS2 A;  5M5W H;  1KAW A;  4IOC A;  3HOV G;  2RF4 A;  5JEA G;  4IO9 A;  1GO3 E;  2R7D A;  4GKJ Q;  4QIW E;  1PYB A;  4DAY B;  3S1N H;  4DV2 Q;  1U0L A;  4LFC Q;  4JV5 L;  4Y52 H;  3Q8D A;  3CCL A;  2HQL A;  2WAQ E;  5FJ8 H;  1V9P A;  1L1O B;  4IPG A;  3I7F A;  2LXK A;  1XJV A;  1XPR A;  1C7Y A;  2K50 A;  5M3F G;  1OXS C;  2K5V A;  3D31 A;  1N36 Q;  1HNZ L;  1KC8 C;  1N32 Q;  2WFW A;  1C9O A;  4A3E G;  1Z47 A;  5AJ3 Q;  5BR8 Q;  1OXX K;  4HJ8 A;  4DV3 L;  2OTL A;  3F2B A;  3PF4 A;  4BBR H;  3U4V A;  2VQE L;  1WJJ A;  5FLM G;  1EFW A;  3ULL A;  2VNU D;  4QY7 A;  1CSQ A;  3M4O H;  1HZ9 A;  4JYA Q;  1E7Z A;  4JI5 L;  2R7Z G;  3J7A 5;  5GRO A;  3F2C A;  1PH7 A;  2NVT H;  4DPG A;  3DLL A;  4NXN L;  3TQY A;  4LF7 L;  1HNW L;  4O0A A;  2UXC Q;  3KLW A;  4B3T Q;  4JI6 Q;  4LFA Q;  1QVC A;  3HOU G;  3AQQ A;  2N8N A;  1HNX Q;  1PH8 A;  4R4C A;  1QVG A;  4OX9 Q;  4JBM A;  2VUM G;  4APV A;  2BA0 A;  3L0O A;  2B29 A;  4MZ9 A;  1WOC A;  1A0I A;  3CCJ A;  1IXR A;  2RHS B;  4P71 A;  1N8R C;  1B70 B;  5IYC H;  3MEF A;  2R92 H;  1XPU A;  4X62 Q;  3M4Q A;  4JCV E;  1GM5 A;  1VQB A;  1VQH A;  5IP9 G;  2YTV A;  5JJL A;  1NY4 A;  2PQA B;  4DUZ L;  1ASZ A;  1VQ6 A;  3I55 A;  1BKB A;  1CUK A;  3GTJ H;  3ZJY C;  1VQI A;  2VS1 A;  2BA1 A;  2NZH A;  4DNI A;  4DV5 L;  4A3I G;  1T9H A;  1TWC H;  4XIG S;  4DR1 Q;  2K5N A;  1MIU A;  4GS3 A;  4A3E H;  1W2B A;  4BBS G;  2Q2H A;  4DR5 L;  2EIF A;  2PI2 E;  4QGU A;  2AKW B;  2VQF Q;  5FLM H;  4YHH Q;  1Q81 C;  2Z0S A;  1A62 A;  3AYH B;  1LTL A;  1UE6 A;  4GNX C;  4YWK A;  2PNH A;  1YVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...