2K75A

Solution nmr structure of the ob domain of ta0387 from thermoplasma acidophilum. northeast structural genomics consortium target tar80b.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
106
structure length
106
Chain Sequence
SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the OB domain of Ta0387 from Thermoplasma acidophilum.
rcsb
source organism Thermoplasma acidophilum
molecule tags Dna binding protein
molecule keywords uncharacterized protein Ta0387
total genus 12
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k75A01
1QVFA 4YY3L 2VY3A 3GD7A 5IP9H 2HHHQ 2Z6KA 1X9NA 3GTPH 4NPSA 2N3SA 1VQ6A 4YWLA 1N33L 1NJIC 1TWFH 1PFSA 3BZKA 2PMZE 3UDXA 4A3FH 1YJ9A 1HZBA 1PYSB 2ATWA 5C4XH 2VQEQ 3PF5A 3S1RH 1PH8A 3CC7A 2I5HA 3FP9A 1WCMG 2AKWB 3PUXA 3MXNB 4KLKA 4OWXB 1IBKL 1M90C 4POFA 1VCIA 3HOZH 5C0XJ 4H02A 3KFUA 1XMQQ 4OXPA 4A3IG 2AWNA 5BR8Q 1JJCB 3H0GH 1YJNA 2D0PA 2RHQB 4A3EH 5C3EG 1Y1VG 1J6QA 3STBC 1N36Q 4MZ9A 2DUDA 1U5KA 5LMUL 1I94L 2OTLA 5M5WH 3CCVA 4NXNL 1XMOL 2D0OA 4LF7Q 1E7ZA 3AFPA 1JJ2A 1HH2P 1R9TH 4X65Q 4LF9Q 3M4QA 3NBHB 2GVBA 2ZTDA 3BJUA 4A3BH 1PH9A 3HOWG 1I50H 1WOCA 3FKIG 3F2BA 4JBKA 1C9OA 1D7QA 3HOUH 1EYGA 2E5LQ 3S1NH 3EBEA 1GM5A 1Q1BA 2JA9A 2DGYA 1L0WA 1Z9FA 1XNRQ 1JJGA 3TQYA 4A3CG 2I5LX 3W1BA 3A5UA 4OWTB 2PQAA 1AH9A 1XMQL 3OW2A 1Q7YC 2A8VA 2K50A 2Z6KC 4YCVA 2EXDA 1Q81C 1HNZL 4BA2I 4LF4Q 1VQIA 1VQJA 2R6GA 2E5LL 3KLWA 3OTOL 2AWOA 1GO3E 1CKMA 1S3OA 4R4CA 2UUAL 4JI2Q 4DR1L 1EQQA 1J5EQ 4P71A 1Q46A 4B3TL 4JYAQ 4BY1H 3Q8DA 1N36L 4X62Q 3S2HH 2MNAA 1X6OA 1YEZA 2QGQA 1FGUA 5IYBG 1K73C 4JI7Q 4A93G 1UWVA 2OQKA 3AFQA 4UPAA 5AJ3Q 3OTOQ 2NVTH 1KD1C 3DM3A 3I4NG 2WFWA 3W5OA 2R7FA 3HOUG 2UUAQ 3PO3H 1QZHA 1SN8A 1YHAA 3CCSA 2JA7G 1B8AA 4BBSH 4B3SL 4GLXA 1HNWL 1VQBA 3M4PA 4LW1A 1L1OA 2CQOA 4LWCA 4A75A 2HQLA 1VQOA 1Y1WG 3E0EA 3JC66 2E2HH 4LF6L 3I55A 3HOVG 1VQPA 1QUQB 3MEFA 3U4ZA 4B3ML 2JA5G 1JE5A 4LUOA 5GADC 2KENA 1KXLA 1HNWQ 4A3EG 4LF5L 1WI5A 3VDYA 3ULJA 1PH2A 3CPWA 1VQLA 4LF4L 3PUWA 3SGIA 4DK6C 2UU9L 2K5NA 1TWGH 3RLNA 2B29A 4HJ8A 3A0JA 3BZCA 1VQ9A 1MKHA 4PZ7A 4BA1I 3T1YL 1DGSA 1U0LA 3M85A 3H15A 4LF5Q 1CKNA 5BR8L 1L1OC 3ER0A 1KAWA 2PI2E 1PA6A 5IP9G 5AJ3L 2IHEA 1V43A 1KQSA 1VQ5A 1L1OB 1EWIA 1HR0Q 2I5MX 4JI8Q 2ID0A 2YTYA 5LMUQ 1HR0W 2CCZA 1HJPA 1Y1WH 4OO1G 3CAMA 1KRSA 1QVCA 1V9PA 3HOXG 3G71A 3J81c 2GN5A 3A5ZB 4DV5Q 4JI5Q 3PO3G 4DR4L 4X65L 4DUZL 4BBRH 3A74A 2MO0A 4JG2A 4NB3A 4P74A 4JI0L 4BXXG 1BVSA 4A3GG 3K7UC 4GKKL 1NBWA 1BKBA 2NVXH 2JEAI 2R7DA 4OX9Q 5GAHC 4JBMA 4L5RC 1C0AA 5FLMG 3U58A 3G48A 4A4IA 3ULLA 2WAQE 1CSQA 4IO9A 3S15H 2K4KA 2OQ0A 1BBUA 4DR4Q 1VQFA 1Q82C 1VQ8A 4AIMA 3PGZA 4TQUS 1XPOA 2JQOA 4IPDA 4O0AA 2QEXA 4DV1Q 4DAYB 4L5TA 4J15A 4C3HH 1PYBA 1KRTA 5C0XI 4DV0L 3GO5A 2Q2TA 4JV5L 2E8GA 4UP8A 5M5XH 2XTIA 3KDFB 2VQFQ 1PH3A 2A19A 4PZ6A 1RL2A 1PH6A 3ZJYC 2JA5H 3F8TA 3HOYG 4DV2L 3M7NA 1PH7A 2B63G 4DR6Q 4DKAC 4DV1L 2KHIA 3GDEA 1CKOA 4BBSG 1QUQA 1N34Q 3CP0A 1IBML 2UUBL 2OWOA 3GTLH 4B3RQ 4DV4L 3AYHB 2JEBI 4GN5A 3HOXH 3IRBA 2A1AA 3LGJA 2YYZA 4DUZQ 2KBNA 4ALPA 2B3GA 4KI0A 3S17H 1OXUA 3HKZG 1X55A 3KJOA 1LYLA 1MJCA 1JMCA 1WFQA 4IFDG 3T1HL 2VZAA 2ZTEA 1RIPA 2MO1A 3H0GG 4BY1G 4UP7A 4R4TA 2QA4A 4DV0Q 4JV5Q 1Y1VH 2Y0SE 4GS3A 4B3MQ 4JCVE 1TWHH 3I2ZA 3I4OA 5LMNW 4L5SA 1E1TA 5JJKA 4YHHQ 3J80i 2IY5B 1Z47A 4GOPC 5IWAQ 1YIJA 1G6PA 3S1MH 1UE7A 3CCQA 4A3CH 3CCEA 3D0FA 3G4SA 4GNXA 2KCMA 4LFCQ 4B3RL 3KF8B 3AEVA 2CWAA 2CFMA 5M3MG 2D62A 3F1ZA 2EQSA 4HIDA 2IX0A 3JAMc 3K0XA 1K8GA 2PI2A 3AQQA 3D31A 4DV4Q 3J7A5 5IYDH 2WB1G 3GTKH 4YWMA 5LMNQ 1OXSC 2N78A 5IY0A 2N49A 3CXCA 3TS0A 1YVCA 4RG1A 1LUZA 2LSSA 4AYBE 4PZ8A 2JA6H 4GOPB 4A3KH 1CSPA 4UY8C 4QL5A 4WJ3M 2CKZB 1X3EA 2HIVA 5FJ8H 4IOCA 1BBWA 5FLXc 4AH6A 5C3EH 4IOAA 1TWCH 4KHPL 4HJAA 2VUMH 3UDGA 4A76A 2OCEA 4C3IH 4JI3L 4IJLA 1I6HH 4JI7L 5IWAL 1E24A 1LM0A 1MIUA 1T9HA 4IPGA 4ME3A 5JEAJ 4X64L 1VQMA 5ELNA 3M4OH 4GLAC 4BY7H 3GTGH 3H3VH 1K3RA 3HOYH 2YTVA 2F52A 1G51A 1KL9A 2PNHA 3WWVA 4EQ5A 5H1SE 1ASZA 2UXDL 4HJ7A 2VL6A 3E9HA 3I7FA 1I5FA 1X56A 1W2BA 4JI3Q 2H5XA 3PSIA 5IYCH 4A3BG 3RLOA 1N8RC 2ZTCA 3PIPA 4IPCA 4WJ4A 2L15A 2JJQA 4C2MH 1VQHA 2FXQA 4JI6L 1SE8A 1VQDA 1XNRL 4QQBX 3CC4A 1HZ9A 4AQYL 3J7ZC 1P8LA 4A3JH 4HJ5A 3DLLA 3I4MG 2RF4A 1YHBA 4GOPA 4A3KG 2RCNA 1HNZQ 1NMGA 3CD6A 1TXYA 2EIFA 2WP8J 1Q86C 4HJ9A 2R92G 4JOIA 5IYDG 2HHHL 1N32Q 2HT1A 2BA0A 4JI1L 3S2DH 2UXDQ 1VQ7A 1L2FA 2BA1A 4A3LG 1AE3A 2PQAB 4YHHL 2K52A 2VNUD 4X6AH 1XPRA 5M3MH 1GD7A 1UE5A 1UE1A 1SMXA 4R1JA 4DV6L 1E1OA 3S16H 4R4OA 4DV5L 3K81C 4A3DG 1UEBA 3NENA 2VUMG 3CMEA 2YTXA 4UP9A 2R93H 1N33Q 4LF6Q 5FLMH 4GKJQ 2K5HA 2VS1A 1XPUA 4JI6Q 1IBLQ 3FHWA 4DPGA 2HIXA 4YY3Q 1IBKQ 2JA8H 3K7AH 1EIYB 1PHJA 4K0KQ 4BBRG 4RMFA 2NZOA 2N8NA 2Q2IA 4A3GH 4APVA 1A62A 4LF8Q 2R7ZH 1O7IA 4DR2Q 1YJWA 3UDIA 4OWWB 3HKSA 1EOVA 1VQAA 3CCRA 4KHPQ 1XMOQ 3B6YA 4NXMQ 4DV2Q 4NXNQ 4A3MG 4DR6L 3K80C 1CKNB 3EN2A 2F3IA 3EIVA 4LFAQ 3PO2G 4LF8L 1N34L 2UUBQ 2RHSB 3G6EA 1I94Q 1NMFA 2JK8A 3J81j 4DV6Q 4HIKA 4LNQA 3L0OA 4JI4Q 1K8AC 2KHJA 1W3SA 5DLQE 1KIXA 5M3FH 4NXML 2Y0SG 4IPHA 3PIOA 2NN6I 1YI2A 4JBJA 4QY7A 1Q1EA 3CQZH 3TEHB 2IT1A 3RN2A 1S40A 5K36G 3PCOB 1IBLL 1PV4A 1SLJA 4Y7NH 1PH5A 4JI4L 3CCUA 4OX9L 2K14A 4L5QA 3TRZA 5JJIA 1NE3A 2E2IH 2ALYB 1A63A 3CMAA 4BXXH 4QIWE 1EUJA 4QJFA 2NN6G 4B3TQ 2MQHA 4A3MH 4YCUA 1LTLA 1VS0A 4X66L 4DR2L 1YHQA 4X62L 1YZ6A 1TWAH 3F2CA 5M5YH 1E3PA 1GVPA 2V1CC 1HR0L 1OXTA 2IHFA 2B63H 2F4VL 4R4IA 3NEMA 4DR1Q 3KYHC 4JI2L 4JI5L 4YWKA 1J5EL 1PH4A 2JA7H 2UXCL 4LFAL 4XTCS 4JI1Q 4GNXB 2XGTA 3HFZB 4B3SQ 4POGA 1FVIA 3L7ZC 1PH1A 2ZJQA 1VQEA 5HY6A 5C44H 4GNXC 5LMNL 3CCLA 3I4NH 3S14H 2CWPA 4IJHA 3OYYA 3CCJA 1G291 4P73A 3ULPA 4LFBL 3M9BA 3T1YQ 4DR3L 3GTQH 5E7NA 4JC0A 3CCMA 2IX1A 3GTOH 2ES2A 1A8VA 4MNOA 3NELA 5C4JH 2AMCB 3E9IA 1X65A 1HZCA 1HZAA 3CPFA 2Q2UA 5C44G 2E2JH 2BH8A 5GAGC 3U4VA 3FKIH 4P72A 4DR3Q 3HKZE 1QVGA 3PF4A 2I0QA 3J81i 3PUVA 1IXRA 4DR5L 3HOVH 1JB7A 1NY4A 3BU2A 4X64Q 1FJGQ 1EQRA 5GAEC 1X3GA 5ELOA 1H95A 2UU9Q 4PMWA 1IL2A 2OTJA 3S24A 2UXBQ 2K75A 3UE0A 1VQKA 3PUZA 3L2PA 4JI8L 1K0RA 3KDFA 3JAMi 3I56A 1VQGA 5EAYA 4EX5A 4DR5Q 2JA6G 4A93H 2VW9A 2UXCQ 4YCWA 1IZ6A 4GN3B 5IP7H 1K9MC 1HNXQ 3H3VI 1S72A 3ICEA 1XNQQ 5GQOA 4JYAL 1AE2A 4LUZA 4OONA 1X3FA 1NTGA 1SRUA 3STBD 1JT8A 1SROA 2ZJRA 1QZGA 1X54A 3RR5A 1OXVA 1VQNA 3CF5A 2WB1E 1VQCA 2C35B 4KHZA 3W1GA 1EFWA 3UDFA 4XIGS 3RN5A 4LUVA 2NZHA 1IYJB 5M3FG 1Q8KA 2LXKA 3RZOH 4DAMA 2AHOB 2UUCL 1FJGL 3GTMH 1D8LA 2Q2HA 3PV0A 5IT9c 3PO2H 4PG3A 2MFIA 3HOWH 4A3LH 2R7ZG 4HIMA 2KCTA 3KJPA 3PUYA 2GVAA 4HIOA 3K8AA 4DK3C 1P16A 1XTDA 1ASYA 3UE1A 3M3YH 1UE6A 4X66Q 5IYBH 3RNUA 1XNQL 4IFDJ 4A3JG 3TREA 4LF9L 2F4VQ 2NVYH 4DV7L 2R93G 3RZDH 3GTJH 2Z0SA 3ERSX 4OO1I 1HNXL 1YNXA 2YV5A 1IBMQ 5GROA 2JA8G 2ZM6Q 1KHIA 4A3DH 3HOZG 3CC2A 4MTNA 3T1HQ 4A3IH 1VQ4A 1YITA 3S1QH 3TS2A 4R4QA 2UUCQ 1CUKA 4K0KL 5IYCG 1YBYA 5HGQA 1WJJA 3F2DA 4DUYQ 5JEAG 4DV3L 1WCMH 4A3FG 1Q12A 2YU9H 1B70B 5JJLA 4JOIC 4JI0Q 5C4XG 5J3BA 1XJVA 1B7YB 4DR7L 2ASBA 4IFDI 4BY7G 4AQYQ 2BH2A 3U50C 2R92H 1KC8C 1WYDA 2LXJA 1K83H 1SFOH 4Y52H 4LFCL 5C0XG 4DNIA 3RLFA 4GKKQ 4JBWA 3KF6A 3I4MH 4DV7Q 1OTCA 1Y14B 1OXXK 1C7YA 1PVOA 4DR7Q 4O2DA 3J80c 4AYBG 1N32L 5FJ8G 1A0IA 2WAQG 5IP7G 4LFBQ 1E22A 4FDBA 4TVAB 2UXBL 2JE6I 1FL0A 4P75A 4C3JH 1N9WA 2VQFL 1MJEA 4QGUA 1SR3A 1EIFA 4GN4B 3CW2C 1I3QH 3KOJA 2ZJPA 4DUYL 1V1QA 2K5VA 4DV3Q 2ZM6L 3KF6B 2NVQH 4LF7L 2VQEL 4GLVB 4GKJL 5IE8A 1GKHA 1M1KC
chains in the Genus database with same CATH superfamily
4YY3L 3GD7A 2HHHQ 1X9NA 4RCOA 1VQ6A 4YWLA 2K1BA 2EYLA 3TN2A 1PYSB 1GUGA 1SNCA 5L37A 1IBKL 1WCMG 2AKWB 4ID6A 5T1IA 3HOZH 3K58A 4H02A 1EZ8A 1NSNS 3H0GH 1YJNA 4A3EH 3KK7A 4MZ9A 2H1EA 3L3OC 5M5WH 3NBIA 4NXNL 3V2TA 4LF7Q 3AFPA 4X65Q 1IW7C 1GHJA 1SEBD 3M4QA 2GVBA 4A3BH 2K03A 2RSOA 4JBKA 3FKIG 1GJXA 4CKCA 2E5LQ 3EBEA 1XNRQ 1SYFA 1JJGA 4A3CG 2I5LX 4OWTB 3QG1A 2XVSA 4ZKBB 1UUPA 1Q7YC 2A8VA 4I7AA 2F0IA 2FMCA 4BA2I 5ELBA 1VQJA 2R6GA 2WKDA 2KEDA 4R4CA 5A2QL 5DAUA 1J5EQ 1Q46A 3P75A 2M00A 4UDUC 3J7AV 2KHSA 1Q8IA 2JN4A 5M5WB 2MNAA 1X6OA 1KABA 1S5DD 1FGUA 1YEZA 1II3A 2J7ZA 3D4RA 2OQKA 3C1FA 4A93G 1G91A 5LL6S 3OTOQ 1RF2D 1KD1C 3I4NG 1K8OA 2WFWA 1F9SA 1MBYA 1QZHA 3CCSA 1I50B 1TY2A 4GLXA 2F0TA 1VQOA 4LWCA 2NBFA 3E0EA 4XXEA 2E2HH 2B63B 3I55A 3K5LA 4B3ML 3SK6A 1RODA 1JE5A 4LUOA 5GADC 2KENA 3TZUA 1HNWQ 1TS5A 4OHJA 2FHTA 2UU9L 2WB1B 2O4XA 5M9OA 2OXPA 1MHWC 1CHQD 1GHKA 3LWEA 4LF5Q 2NVTB 4TSSA 1EZ6A 1IYVA 1V43A 3D6CA 4QMGA 1L1OB 1KQSA 2JA5B 2I5MX 4JI8Q 1QNKA 1HR0W 4IZ8A 5I2YA 1Y1WH 4OO1G 4JI5Q 1V9PA 4DR4L 4X65L 4DUZL 4NB3A 1CFMA 3K7UC 2HUGA 1IYUA 2NVXH 5IT9E 2R7DA 4L5RC 1F9RA 5F2DA 4IO9A 3S15H 2OQ0A 4BS9A 4B08A 4EGVA 1VQ8A 5JPMC 3PGZA 4TQUS 1VF5C 2JQOA 4IPDA 5C0XH 2QEXA 3SE0A 4C1NK 1PYBA 3TP8A 2Q2TA 3WDNA 4UP8A 2VQFQ 2XTIA 3KDFB 1C4QA 1GXDC 5DM73 1RL2A 1PH6A 3Q22A 3F8TA 4DV2L 1EL0A 1PH7A 1ENFA 3HOVB 4BBSG 1HA5A 1QUQA 3CP0A 1N34Q 2EXZA 2F0OA 5K5PA 4GN5A 3HOXH 4KK7A 2A1AA 4DK0A 4MTKA 2PZUA 2YYZA 3VR3A 4KI0A 3S17H 4M1UB 3NP8A 3S15B 3H0GG 3WOFA 1HQMC 4UP7A 1BBXC 1Y1VH 4GS3A 3MXUA 4B3MQ 3NWSA 3I4OA 1EOTA 2XSCA 2A73B 2BE5C 2V4DA 1G6PA 1YIJA 2F1MA 3CCQA 3MEHA 5CBEE 1ZEQX 1ICFB 1PTOD 1DOLA 2CFMA 2EQSA 1D5MC 4ZRZA 1BUVT 4PNYA 3JAMc 2PI2A 3D31A 2LFNA 4FF4A 2XRQD 5C4XB 5FO8B 2WB1G 3GTKH 5LMNQ 2N78A 5IY0A 4IQZA 4RG1A 2B39A 5EBDA 4AYBE 1SNQA 3IKJA 2KEEA 4WJ3M 4HN7A 1X3EA 2HIVA 5FJ8H 1DOKA 4RKBA 2HDMA 3S1QB 2OCEA 1BCPD 5IWAL 1T9HA 4X64L 3VR2A 5JEAJ 3I72A 5ELNA 5G3LD 4BY7H 3PO2B 1K3RA 3HOYH 4JPBW 1SJED 3WWVA 5H1SE 2RA4A 3I7FA 4R8IA 1I5FA 2EY5A 4JI3Q 3VA7A 3PSIA 2L55A 5IYCH 1N8RC 1LV9A 4CBVA 3WOEA 3FMCA 5C5LA 2F0WA 4C2MH 2FXQA 1XNRL 2C5CA 1ILPA 2NTSA 2K5DA 4HJ5A 2RF4A 3E5SA 2EYPA 3Q23A 1JE4A 1CQVA 1JB3A 2QF7A 3K6OA 1Q86C 1N32Q 1FR3A 5A2QE 1R4QB 2M2LA 3FDTA 3A7AB 1AE3A 2QDLA 2EOTA 2QW7A 5M3MH 2CHBD 1SNOA 1UE5A 1XYIA 2R92B 4R4OA 3RD4A 3K81C 3KF8A 1A2UA 1PRTC 2VUMG 2KQ3A 2EDGA 3NWTA 4UP9A 2IPKD 4A3EB 1N33Q 5EBCA 4CJ1B 1STNA 2K5HA 4XYQA 5BN3A 1IBLQ 1VF7A 2B2YA 1EYDA 2HIXA 1JQYD 2BE5D 4K0KQ 4BBRG 4RMFA 3BVMA 4LF8Q 1YJWA 3GQBA 1NR4A 3UDIA 1JOOA 3HOUB 1EOVA 1I4XA 1DYQA 1XMOQ 3K80C 3EN2A 2X69A 3G6EA 1I94Q 1PRTF 2AQ1B 1W3SA 3U9OA 4NXML 3NE5B 2Y0SG 1ZYRC 1YI2A 4A3KB 4JBJA 4FXGC 3TEHB 1S40A 4QCLA 4EVOA 1STAA 1LTTD 5CC4A 1PH5A 4Y7NH 4A3DB 1DCZA 4JI4L 1B1ZA 2K14A 5JVG3 1BCPC 4PMBA 5IGDA 4BXXH 1QOHA 4QJFA 2E74C 1SNPA 1YHQA 1UAPA 3EJIA 2LY7A 2V1CC 3S1NB 2IHFA 2B63H 3QOJA 4R4IA 2HDLA 3CRKC 4DR1Q 4JI2L 4JI5L 2JA7H 5FK9C 4XTCS 2E76C 3HFZB 4B3SQ 4HMJA 5HY6A 5M3FB 4ODGA 1TIID 1FGBD 4IJHA 4P73A 1F77A 3T1YQ 4DR3L 3GTQH 1KAAA 2KCNA 3TP6A 4MNOA 3NELA 5C4JH 3DUZA 2B8FA 4P72A 3SR1A 3PO3B 4DFAA 2I0QA 2Z8LA 1SYBA 1IXRA 2BDNA 4DR5L 1I4PA 1TWAB 1NY4A 1PMRA 4O42A 4XT1B 4K5VA 1AFPA 5ELOA 1H95A 5CORA 4KKSA 3VR4A 4RGOS 5D14A 1PRTD 4CHTB 3R2IA 1K0RA 3BDOA 3R3OA 1QG7A 4H7BA 4X3UA 5EAYA 4CJ2C 5I4DA 3JAML 4CDEC 2EZVA 1IZ6A 3ICEA 1HNXQ 3H94A 4OONA 1JT8A 1NTGA 1SRUA 2ZJRA 3X3MA 2RDFA 1OXVA 2WB1E 1VQCA 5JPNC 2C35B 1MSHA 2LS01 4KJNA 5AFWA 3A8IE 3A7LA 5D3IB 1SDFA 5C4ZA 2JP1A 4BY7B 3PV0A 4PG3A 5JEAH 1AW7A 2NTTA 3J7AF 1TS3A 4HIMA 3I90A 4FO2A 3KJPA 2F0EA 2JSOA 1D1KA 4HIOA 3K8AA 3MA2B 4DK3C 5FOBB 3UE1A 3IAYA 4FF3A 1O7YA 4DXFA 5CMDA 4X66Q 3M3YH 1NAPA 3TREA 2RQXA 3SHLA 4H13C 3MXPA 1RKNA 2FMMA 1IKLA 4N9TA 3V05A 4CDDC 4OO1I 2KECA 4K6LA 1IBMQ 1X3QA 1KHIA 4Y7NB 4A3DH 1EY9A 2VUMB 3S1QH 5FO9B 4FXDA 3A54A 4R4QA 1YBYA 1QILA 1WCMH 1Q12A 1B70B 3GTMB 4MIUA 5KGUA 2FFKB 1SNMA 4G7HC 2EY6A 4RCNA 4JBWA 3I4MH 1O80A 3HOZB 1JWMD 2CQAA 3PIP3 1OXXK 1EU3A 4DR7Q 4O2DA 2F0HA 1STHA 4AYBG 1N32L 1EY0A 5IP7G 1Y8OB 3TZDA 4TVAB 4CDFC 2JE6I 1FL0A 1G2SA 1N9WA 2VQFL 1MJEA 1SR3A 1EIFA 1TWCB 1FD7D 2DY8A 5EQ0A 2KA7A 3DWAA 2ZM6L 2IW3A 1TVXA 4GKJL 1GKHA 1M1KC 1NUCA 4LAAA 2Z6KA 3GTPH 4NPSA 2N3SA 3DMUA 3BYYB 2PMZE 1HZBA 2ATWA 2VQEQ 2I5HA 4KLKA 1ET6A 1M90C 4POFA 1VCIA 3TDQA 5C0XJ 3C46A 3N52A 5IGGA 2D0PA 4C3JG 5C3EG 1N36Q 2A6HC 2EYMA 2DUDA 3L9AX 3I70A 2OTLA 2P5ZX 4XQNA 2H4OA 2K28A 1KLGD 3MXNA 3V96A 4CKEA 5CV9A 1SNDA 4A3MB 1QB5D 2J4XA 3S1NH 1GM5A 2JA9A 1L0WA 3FVQA 3I91A 3W1BA 3A5UA 1WTOA 5CV6A 1XTCD 5CV8A 1RCVD 2Z6KC 4PMCA 1HNZL 1VQIA 1S4ZA 1DONA 1GO3E 1MGSA 1S3OA 2JA8B 4P71A 4X62Q 1K73C 2QGQA 5IYBG 1LTSD 3AFQA 4UPAA 5AJ3Q 2NVTH 3A55A 2D9UA 2WACA 4B3SL 3OIPA 3M4PA 4FNFA 5DEHA 1L1OA 2CQOA 4A75A 3ZYYX 2HQLA 2KUMA 3A8KE 3HOVG 2O5JC 2XIWA 4HTHA 5EGTA 1SMYC 4C56C 2JA5G 4LF5L 1B3AA 3VDYA 2WAQB 1HCZA 4LF4L 3PUWA 2Z4HA 1TWGH 3RLNA 1BCPB 1X3PA 3NK9A 1F9QA 1VQ9A 4LFBQ 1YNJC 1MKHA 3CU7A 5I6YA 1GUWA 1DGSA 3H15A 1RTNA 1EQTA 4TKOB 3ER0A 1KAWA 2HD3A 1KLUD 2PI2E 4X3KA 4ZAIA 3OWEB 4K8IA 2BCOA 1EWIA 1HR0Q 2YTYA 1HJPA 3LWUA 3HOXG 2GN5A 4DV5Q 2F0JA 2E2HB 2MO0A 4JG2A 4BXXG 1BVSA 1WTQA 1NBWA 1B9MA 1C0AA 5FLMG 1HXYD 4A4IA 1CSQA 1R4PB 2I46A 2A6ED 3QB3A 1VQFA 3NPPA 4CDCC 1TWGB 4O0AA 3GTOB 4L5TA 5C0XI 1SJHD 4B9WA 4DV0L 1EY8A 3GO5A 4JV5L 2E8GA 5KYLA 3U9SA 3DXJC 4PZ6A 1CK1A 2B2UA 2K5QA 3M7NA 4DR6Q 4DKAC 4DV1L 2KHIA 1F2MA 2OWOA 5FLXL 4DV4L 2AUKA 2B2WC 2JEBI 4OO1H 2PW7A 2PW5A 2KBNA 5TSSA 4ALPA 5EPKA 3MVVA 2N88A 3QIAA 3KJOA 1LYLA 1JMCA 1WFQA 4IFDG 5C44B 5I9PA 1LTGD 2MO1A 4BY1G 2L5TA 2RKSA 2SDFA 4R4TA 2QA4A 2Y0SE 1LTID 3I2ZA 1F2LA 1IHZA 5LMNW 4L5SA 4YHHQ 1VMPA 2BDOA 5IWAQ 1NCVA 3S1MH 1DZ1A 3SEBA 3CCEA 3D0FA 2RDHA 4GNXA 2KCMA 4LFCQ 3FKIB 3KF8B 4EQNA 4L8JA 5M3MG 3HKZB 3G7LA 3NSWA 4C3IG 3F1ZA 4HIDA 3Q0AA 1TR5A 4X3SA 5CV7A 1K8GA 2LKVA 4QUFA 1WD0A 2VB2X 1GOZA 1OXSC 3NUCA 2K6AA 2PNRC 2N49A 3CXCA 2XWBB 1LUZA 2CH4W 3NBHA 5J1ZA 2F0FA 1CSPA 4QL5A 1Y1VB 2CKZB 4IOCA 1HRJA 3UI2A 1D1IA 4AH6A 1CQFA 1TWCH 4KHPL 1R9TB 4C3IH 1CTMA 4IJLA 4JI7L 1I6HH 1GUOA 3M4OH 4GLAC 3GTGH 3GTPB 2YTVA 4EQ5A 1G51A 1KL9A 2UXDL 2Q8TA 5KNDA 1B2TA 1X56A 1W2BA 4I65A 2H5XA 3T4AC 3GTKB 4A3BG 1DOMA 3SXHA 5E1FA 3S14B 2A6EC 1VQDA 2R93B 4QQBX 4A3JH 1PXUA 2OT2A 3I4MG 3S2HB 1V1PB 2QDBA 4A3KG 1HNZQ 4G7OC 3OMGA 4JOIA 2HHHL 2BA0A 1JOKA 5COYA 1L2FA 1F9PA 1JC7A 1G2TA 1GD7A 2F0LA 4RKLA 3J80E 4R1JA 1E1OA 1SFOB 3N6RA 1HTPA 4A3DG 5JAVA 4X3TA 5JOBA 4HAEA 1YNNC 2EPBA 5KNCA 2K01A 1V8QA 2YTXA 1D2BA 4LF6Q 5FLMH 1XPUA 4C3JB 1IBKQ 1EIYB 1WTHA 2EYJA 4DNTB 2Q2IA 1Q3LA 3K57A 1ENAA 1O7IA 3URYA 4DR2Q 2EY1A 4LK1C 1GUTA 1J8IA 4KD4A 4IFDI 4A3MG 3P7JA 1CKNB 3PO2G 4L63B 4OL7A 4LF8L 2UUBQ 1LT4D 2PMZB 2JK8A 1ZXTA 3M4YA 4HIKA 4DK1A 1JICA 2KCCA 1KIXA 5IGCA 2NN6I 4QY7A 1Q1EA 3K0YA 3PCOB 4PV1C 5C4JB 1IBLL 1VMCA 1SLJA 4CKBA 5E3FA 5ELEA 1NE3A 2F0VA 3CMAA 4QIWE 4J8QA 2A68C 2MQHA 2ICEC 2DY7A 1BNZA 1YZ6A 1TWAH 3FRPB 3R2TA 3SVMA 4KY7A 5M5YH 4H44C 1HR0L 4JVZA 2F4VL 4YIJA 1FNWA 1B53A 3MFYA 4M8AA 5LL6X 4GNXB 1TKWB 4POGA 2ZJQA 1VQEA 5C44H 3S14H 5LMNL 2NUCA 2CWPA 3T53B 1JORA 2D2CC 3EQLC 1EY5A 3D4WA 3CCJA 2KJXA 2SOBA 3M9BA 4ABNA 3PQIA 1EY7A 4KJOA 2ES2A 3E9IA 2AMCB 5EKLA 1HZCA 1HZAA 2AQ3B 5C44G 3I73A 1O7LA 4QUCA 2A74C 2B2TC 3CRLC 4DR3Q 1QVGA 3EROA 3J81i 5C6AA 4ZKCB 4X64Q 1FJGQ 1LTAD 5GAEC 3SK8A 4BWGB 3HOXB 2UU9Q 2OTJA 4OEMB 2K75A 2G9HD 2UXBQ 4JI8L 3I8ZA 4A93H 3JAMi 4DR5Q 1VQGA 2UXCQ 2VW9A 4GN3B 1K9MC 1S72A 3RZDB 4ZUJA 3STBD 1SROA 3T56B 3RR5A 1VQNA 2DJFC 1ZKOA 4FVMA 4KHZA 3W1GA 1EFWA 4JK1C 2X6GA 3AU7A 2F4IA 4IUTA 1IW7D 2NZHA 2F0QA 4RAUC 1FJGL 4NW2A 1D8LA 2Q2HA 3T51B 3PO2H 1CZWA 2MFIA 3J7YW 1STYA 1DM0B 2RSNA 3PUYA 3NHHA 1P16A 1XTDA 1UE6A 1WTXA 4LF9L 2F4VQ 4DV7L 4IUNA 3RZDH 1HNXL 4BY1B 5C3EB 3HOZG 4IUVA 3S1MB 4A3IH 1YITA 1S5BD 2UUCQ 1CUKA 1ONLA 4K0KL 2A68D 1U4MA 3OOCA 4DUYQ 4DV3L 4BBSB 3M4OB 1AN8A 3IFTA 2ASBA 3K5NA 2JXMB 2RCFA 3K59A 2BH2A 1EIGA 3U50C 1WYDA 1SFOH 4Y52H 3TP5A 4QB4A 5C0XG 1ESFA 4DNIA 1WVLA 5IOCA 3KF6A 3FEWX 4DV7Q 1PVOA 1E2VA 3J80c 3H0GB 3TMEA 1A0IA 3PMFA 1E22A 2B2WA 4P75A 3OMCA 5ELCA 1WTVA 3CW2C 3EFXD 1V1QA 3OSOA 1I6HB 2EVBA 2DN8A 3BYTB 1QVFA 2VY3A 2MJ8A 5A35A 3HOYB 3NQIA 1TWFH 3BZKA 3UDXA 1YJ9A 5C4XH 3O13A 3CC7A 1B9NA 3PUXA 3MXNB 4OWXB 1FNUA 4KKUA 3KFUA 5HURA 1STGA 2NB0A 3VR6A 1N36L 3E6ZX 4DU9A 2RHQB 1J6QA 3MHBA 3STBC 4K2KA 3CCVA 3BS1A 1PDQA 1TY0A 1A2TA 2D0OA 2RBMA 5M5XB 4LF9Q 3NBHB 4P2CB 4G4KA 2ZTDA 3BJUA 1STEA 1JCKB 2K04A 3HOWG 5BN5A 2R61A 1C9OA 3PIO3 1EYGA 2PQAA 1AH9A 5CBAE 3FPPA 3OW2A 3C1EA 2L0CA 2EXDA 1CA5A 4LF4Q 4GZYC 4DAVA 2B2VA 5IODA 2AWOA 1CKMA 2UUAL 5C3XA 1E2WA 4BY1H 1JR0D 4HSPA 3Q8DA 3S2HH 4JI7Q 1BXTA 1D5ZC 2F3WA 2FJ2A 2B2YC 1ML0D 4F87A 3PO3H 1SBBB 1SN8A 2JA7G 1PFBA 4BBSH 2A69C 3TP7A 1B4OA 1VQBA 2EYOA 5M5YB 2WIIB 3BDLA 1VQPA 3MFGA 3S16B 3MEFA 3U4ZA 2NVXB 4OIKA 2PYKA 2DJGC 1SYGA 1CT1D 4A3EG 3OIQA 1CM9A 3SGIA 3BDCA 4DK6C 2K5NA 1LABA 1Y8PB 2Q8RE 5EJWA 3A0JA 3BZCA 4K5WA 4BA1I 4RGMA 3M85A 1CKNA 1EEID 2E75C 1WD1A 1L1OC 1AZPA 4OELB 2R7ZB 4H0LC 5AJ3L 2IHEA 1PFMA 3AMUA 2ID0A 1TQOA 3G71A 1QVCA 3J81c 3PO3G 1B50A 4N8FA 2KVMA 4BBRH 3A74A 4JI0L 4A3GG 1BKBA 1KNAA 3G48A 2WAQE 1S5ED 4DGZA 1KDAA 3VR5A 1A3UA 1IKMA 1XPOA 4Q5VA 3GTQB 3CQZB 4DV1Q 4DAYB 4J15A 4C3HH 1KRTA 1PTOF 4RWSC 1IL8A 3J80L 2SNMA 2A19A 2RDGA 2JA5H 4QIWB 4B3RQ 3KLRA 2UUBL 1GUSA 4U68A 1H9MA 1LTRD 3IL8A 2VB3X 3G6JB 1OXUA 1S5FD 1X55A 3HKZG 3QJYA 3T1HL 2VZAA 4DF7A 2ZTEA 1RIPA 1XX8A 4UAIA 4JCVE 2X6LA 3K7AB 5FO7B 1E1TA 5JJKA 2IY5B 1Z47A 4A3CH 1FYCA 1EQVA 2ZXPA 3G4SA 4FP5D 1EU4A 2RVLA 1E0BA 3DM1A 4B3RL 3HGBA 2A69D 2CWAA 4WRDA 5D3DA 1TS2A 3H09A 3C2PA 4LMQD 3K0XA 4PQXA 4DV4Q 5IYDH 4RGTA 1F2YA 4YWMA 3LX0A 2HCCA 1YVCA 2LSSA 4PZ8A 2JA6H 1ZYRD 2MGSA 2Y0SB 4UY8C 1PTOB 4IFDH 5C3EH 2XN9C 3UDGA 3C3LA 3H3VC 1MIUA 4IPGA 4CJ0B 3E0JA 1VQMA 1MD2D 5CR3A 1I4QA 3H3VH 1KNEA 2CH4A 3OHXC 4G7ZC 2J0TD 3P20A 2D5DA 3S9WA 2EJGC 2G5DA 3RLOA 1ICWA 2ZTCA 4NDXA 4IPCA 3PIPA 2L15A 3ERQA 2JJQA 4XYOA 3VYSA 5I2XA 4JI6L 1SE8A 1H9SB 5C3WA 3CC4A 2JA6B 4U673 1HZ9A 4KV6A 5IGEA 4AQYL 3J7ZC 3DLLA 1Z6HA 1YHBA 4GOPA 4OIJA 2RCNA 5G3LF 1NMGA 1TXYA 2NVQB 4HJ9A 1EYCA 2HT1A 5IT9L 2BA1A 2PQAB 2VNUD 1TWFB 1XPRA 2L4NA 1UE1A 4J6HA 4DV5L 1UEBA 2F0KA 2R93H 4GKJQ 5KNBA 3E3XA 2L12A 1E2ZA 4KTAA 2MPMA 2N8NA 3I4LA 2F03A 4APVA 2PZWA 1A62A 2R7ZH 1W6KA 4NMZA 1PTOC 1Y1WB 4OWWB 1VQAA 4DR6L 3HOWB 2F3IA 3EIVA 4L6TB 4LFAQ 1T5XD 2Z9HA 4DV6Q 2Q8IB 4LNQA 1HA6A 3J81E 2EYHA 1K8AC 5DLQE 5M3FH 4IPHA 3PIOA 1QCBD 2MUYA 4C3HG 2F0DA 4DAPA 1NR2A 1A6XA 2IT1A 2WV6D 5K36G 3VA5A 4L5QA 1D5XC 5JJIA 5D65A 2EJFC 1JWSD 2ALYB 2VXWA 1EUJA 2NN6G 1WTWA 4B3TQ 4X66L 4DR2L 4JYAL 4X62L 3F2CA 2K05A 1STBA 4XQJA 3KYHC 3D6WA 4YWKA 1HFNA 1PH4A 2UXCL 4N8X1 3K5MA 1PRTB 3L7ZC 4XDXA 3I4NH 3CCLA 5DM63 3R93A 4LFBL 2F0SA 3CCMA 2IX1A 3GTOH 1I3QB 1PLFA 2E2JH 5EKIA 5GAGC 1SXTA 3D8GA 1K28A 3FKIH 4F88A 4FF1A 2F0UA 1SYCA 3HKZE 3PF4A 2IJ0A 2JYOA 5LHY1 1JB7A 3BU2A 1RTOA 1X3GA 1KDCA 1MI2A 1IL2A 4FYDA 3S24A 1JOQA 1Y69U 1O78A 3HP3A 3UE0A 3AB9A 5CV4A 1VQKA 1SYDA 2DNCA 3PUZA 3L2PA 3KDFA 4HEDA 1RD9D 3ND9A 4RFBA 4G57A 4V0BA 3DWPA 5IP7H 3H3VI 2NVYB 5GQOA 1DD2A 2A6HD 2EYFA 1I4RA 2QILA 1PZJD 2G9DA 1RJTA 4HCSA 3DHQA 4XIGS 3RN5A 3GP7A 3D4DA 3NTIA 3A56A 2L9HA 5IGBA 3EVQA 5IT9c 1BQQT 4KY5A 1TU2B 5FKAC 3I3CA 2AQ2B 1HQRD 5T1GA 2KCTA 4ME5A 1HFGA 5DNFA 2SNSA 4MN3A 1ASYA 1FNVA 5IYBH 3RNUA 4MHEA 4A3JG 4IFDJ 2M9VA 3W3AA 2L11A 1CI3M 3GTJH 4K6DA 3ERSX 4TRDA 1YNXA 2OEOA 2YV5A 3QWNA 5GROA 2JA8G 5JVH3 4HR7B 3CC2A 3ONAB 1JWUD 4MTNA 3TS2A 3P1HA 5IYCG 3R8BA 1VDZA 3F2DA 2K5WA 5JEAG 4A3FG 2QEJC 5JJLA 5C4XG 4JI0Q 2IWHA 1LACA 1XJVA 1B7YB 3GTGB 4IALA 1WTRA 4BY7G 4AQYQ 2R92H 1MSGA 4LFCL 2BOSA 3RLFA 4GKKQ 1SE3A 1CZGA 1EYAA 1I6VC 3EA6A 1Y14B 1C7YA 1ET9A 4LJZC 5FJ8G 4FXKC 2WAQG 3DEPA 1I4GA 4C3JH 4IURA 4HMIA 4QGUA 1QNUA 1I3QH 1LTBD 3KOJA 2ZJPA 2NVQH 1BOSA 4B9XA 5IE8A 1PH2A 4JW0A 1WCMB 2B2UC 2EE1A 1U4PA 5KEEA 5IP9H 4RHSA 2SEBD 1N33L 1NJIC 1PFSA 2MHVA 3QO2A 4A3FH 4ZUIA 1SYEA 1CHPD 1K83B 3S1RH 3PF5A 1PH8A 1K3BC 3FP9A 1EWCA 5KYIA 4IUQA 5FLXE 1XMQQ 1EY4A 4OXPA 1EEFD 4A3IG 2AWNA 5BR8Q 1JJCB 2ZXOA 4O1NA 1DJRD 1HTLD 1Y1VG 2F0NA 3D3RA 1U5KA 5LMUL 3X3NA 1I94L 1XMOL 3H6MA 5I9OA 1E7ZA 1JJ2A 1HH2P 1R9TH 1BCPF 2Z4IA 4KN7C 1U4RA 3RZOB 3VYUA 1S5CD 1SAPA 1PH9A 1I50H 1WOCA 5IGFA 3F2BA 1D7QA 3HOUH 1F2ZA 1Q1BA 3VYTA 2DGYA 3MC0B 1Z9FA 3TBIB 3TQYA 1HUMA 5J39A 1XMQL 1Y8NB 1AP0A 2K50A 4YCVA 1Q81C 2E5LL 3KLWA 3OTOL 2F0PA 1U4LA 4JI2Q 4DR1L 1EQQA 4C1NI 3HS0C 4B3TL 4JYAQ 4GKKL 1Z7TA 1UWVA 2XRSD 3HG9A 1G8ZD 4A3GB 3DM3A 3W5OA 4KMUC 2R7FA 1AEXA 3HOUG 2UUAQ 4WJWA 1H9JA 1DXMA 1YHAA 1B8AA 3NTKA 3S2DB 5JJZA 1B3QA 1HNWL 4LW1A 4LF6L 1Y1WG 3JC66 4J1MA 3KBXA 3Q6SA 1QUQB 3OPOA 1KXLA 1WI5A 3ULJA 5EPLA 1KTKA 4CGYB 3CPWA 1VQLA 5KRUA 2O2LD 2WKCA 1PTOH 2TSSA 3OWFA 2B29A 1GUNA 4HJ8A 3T1YL 4PZ7A 1U0LA 4V190 3Q24A 5BR8L 4DA2A 4Z9CB 1PA6A 5IP9G 2CW0C 4S3SA 3VYRA 4XQQA 5LMUQ 4XT3B 2CCZA 3CAMA 1KRSA 2LMCB 3A5ZB 5C4HA 4ZLTF 4P74A 4ZCKA 1TS4A 1EIHA 4F8MA 2JEAI 3IFDA 4OX9Q 5GAHC 4JBMA 3U58A 4C2MB 3ULLA 2K4KA 4DR4Q 1BBUA 2NYZD 1LT3D 1Q82C 4AIMA 1K8MA 1LT5D 1TWHB 5CV5A 4RA8A 4RHRA 5M5XH 1PH3A 3ZJYC 2YU9B 3HOYG 2I07B 2B63G 3GDEA 1CKOA 3BVGA 1IBML 3GTLH 1EFID 3NTHA 5NUCA 1M8AA 3AYHB 3FPUB 3IRBA 3LGJA 4DUZQ 3DEOA 2B3GA 2PPBC 4DN4M 4KD3A 1MJCA 3BZDB 1H9SA 3GV3A 2KOLA 3OW7A 4DV0Q 1L0XB 4JV5Q 1TWHH 2ICIA 2QCPX 3J80i 2N55A 2PCFB 1PZID 4GOPC 2HQEA 1UE7A 4OGQC 1T5EA 3AEVA 1XWEA 1XXGA 1UEAB 2D62A 4KKTA 2IX0A 2Z1CA 4HCEA 3AQQA 1HPCA 3QOLA 3S1RB 4IUUA 1SMYD 4I7ZC 3J7A5 2Z6BA 3T13A 3MTSA 5BN4A 3TS0A 2AUJD 3H91A 3F2UA 4GOPB 4A3KH 3GTJB 4A3JB 1BBWA 1YNJD 2ENBA 3SDZA 5FLXc 5KIXA 4IOAA 4RH6A 4HJAA 2VUMH 4DNRB 1QE6A 2O5IC 4A3IB 4A76A 2IX3A 4JI3L 2CW0D 2B8GA 2PQEA 3J81L 2B2TA 1E24A 1LM0A 4ME3A 4WFN3 5IIFA 2F52A 3RMHA 1ASZA 2PNHA 5M3MB 3KUPA 4HJ7A 1NNXA 2EY2A 2VL6A 3E9HA 3NXWA 3KLSX 4WJ4A 1WTPA 5ISRA 1VQHA 1CA6A 3DWQA 1P8LA 1A3TA 1AZQA 1U9RA 1HHVA 3CD6A 3RUZA 2EIFA 2E2DC 5CGKA 2WP8J 2R92G 5IYDG 3MZ5A 1KDBA 1X32A 4JI1L 5C5MA 3S2DH 2UXDQ 1VQ7A 4A3LG 1BR9A 4YHHL 2K52A 3GTLB 2F0MA 2NWGA 4X6AH 4KHVA 1LLRD 1SMXA 4DV6L 3S16H 4DAYA 5K36H 1SE4A 3NENA 3CMEA 1A15A 3K5OA 1C48A 4K2LA 1ILQA 2VS1A 4FF2A 4JI6Q 3FHWA 4DPGA 4YY3Q 1RDPD 3K7AH 2JA8H 4UHVA 1PHJA 3KLSA 2NZOA 4K14A 3GV6A 3MAQA 2C9OA 4A3GH 2K7VA 5E4XA 3HKSA 4KN4C 3CCRA 1Q90A 4KHPQ 4NXNQ 3B6YA 4NXMQ 4DV2Q 4ILWA 4WORA 1N34L 2RHSB 1NMFA 3J81j 4NP5A 1D6EC 4F7XA 3L0OA 4JI4Q 2KHJA 1V1OA 4ZYSA 5EKKA 3CQZH 4ULLA 3RN2A 2CVRA 1TT2A 1A3VA 1RHPA 1PV4A 4OX9L 3CHBD 3CCUA 3TRZA 4E6IA 2E2IH 1A63A 3HEJA 2OF1A 3SK5A 2XWJB 2R3ZA 4YCUA 1LTLA 1VS0A 4A3MH 1B44D 1OO9B 1E3PA 1GVPA 1OXTA 3T16A 4BBRB 3NEMA 3HZXA 2F0GA 1J5EL 4IN3A 3ITPA 2B2VC 4JI1Q 4LFAL 4N9PA 5ELFA 2FINB 2XGTA 4A93B 1FVIA 1PH1A 1EY6A 4GNXC 2K33A 1L0YB 2EJMA 2F3VA 3OYYA 1G291 3ULPA 2PZTA 5E7NA 4JC0A 2DNEA 5HGTA 1A8VA 1UNSA 1W6JA 1EWHA 1X65A 3CPFA 2Q2UA 1PZKD 1LO5D 2BH8A 3U4VA 2HCIA 5ELDA 2E2IB 2PO4A 1C8CA 1I4HA 3KBGA 2ZT9C 3PUVA 3BVZA 2IL8A 3HOVH 2NN6H 1EQRA 4A3FB 5E4WC 4PMWA 2JA7B 1BO0A 3MWYW 3NQTA 4K5XA 1HUNA 1YNND 3I56A 4AYBB 3ND8A 4EX5A 2JA6G 3I4NB 1SSOA 4YCWA 4R8NA 1XNQQ 4IUPA 1AE2A 4LUZA 1X3FA 4Q0FA 2QKIC 1QZGA 1X54A 3BG3A 4NKLA 4C3HB 3CF5A 5CYUA 3UDFA 4LUVA 3SK4A 1IYJB 2NZ1D 1Q8KA 2LXKA 5M3FG 3RZOH 5EPJA 4DAMA 4A3BB 3W2DA 2AHOB 2UUCL 3GTMH 4RGNA 1BF4A 3HOWH 4A3LH 2R7ZG 3A8JE 1H9RA 2TMPA 2GVAA 5I6WA 1M4VA 3I4MB 1G6ZA 1XNQL 3MXGA 4QF4A 2K32A 2NVYH 5J22A 1QWYA 4KY6A 2R93G 2Z0SA 4EQOA 3TSSA 3HRZC 2ZM6Q 3T1HQ 3QR8A 1VQ4A 1SE2A 4ZQ3A 4DXGA 4C3IB 3LNNA 4EQPA 5HGQA 1WJJA 2YU9H 1H9KA 2MP1A 4JOIC 1K0SA 1ESRA 5J3BA 2L1BA 4DR7L 4R9WA 4ZK9B 1KC8C 2LXJA 1K83H 1LT6D 1J9OA 2XNAC 3M3YB 3S17B 1BDOA 1OTCA 4HSVA 1PFNA 1O7ZA 4K8JA 2ZXRA 4FDBA 2A5HA 2UXBL 1PYWD 1V1PA 3CKIB 4GN4B 3M7GA 2E2JB 4DUYL 4DV3Q 2K5VA 3JAME 3KF6B 2WINB 2VQEL 4LF7L 4GLVB 1VQ5A 1ENCA 2GA4B 1QJOA
chains in the Genus database with same CATH topology
1QVFA 4YY3L 2VY3A 3GD7A 5IP9H 2HHHQ 2Z6KA 1X9NA 3GTPH 4NPSA 2N3SA 1VQ6A 4YWLA 1N33L 1NJIC 1TWFH 1PFSA 3BZKA 2PMZE 3UDXA 4A3FH 1YJ9A 1HZBA 1PYSB 2ATWA 5C4XH 2VQEQ 3PF5A 3S1RH 1PH8A 3CC7A 2I5HA 3FP9A 1WCMG 2AKWB 3PUXA 3MXNB 4KLKA 4OWXB 1IBKL 1M90C 4POFA 1VCIA 3HOZH 5C0XJ 4H02A 3KFUA 1XMQQ 4OXPA 4A3IG 2AWNA 5BR8Q 1JJCB 3H0GH 1YJNA 2D0PA 2RHQB 4A3EH 5C3EG 1Y1VG 1J6QA 3STBC 1N36Q 4MZ9A 2DUDA 1U5KA 5LMUL 1I94L 2OTLA 5M5WH 3CCVA 4NXNL 1XMOL 2D0OA 4LF7Q 1E7ZA 3AFPA 1JJ2A 1HH2P 1R9TH 4X65Q 4LF9Q 3M4QA 3NBHB 2GVBA 2ZTDA 3BJUA 4A3BH 1PH9A 3HOWG 1I50H 1WOCA 3FKIG 3F2BA 4JBKA 1C9OA 1D7QA 3HOUH 1EYGA 2E5LQ 3S1NH 3EBEA 1GM5A 1Q1BA 2JA9A 2DGYA 1L0WA 1Z9FA 1XNRQ 1JJGA 3TQYA 4A3CG 2I5LX 3W1BA 3A5UA 4OWTB 2PQAA 1AH9A 1XMQL 3OW2A 1Q7YC 2A8VA 2K50A 2Z6KC 4YCVA 2EXDA 1Q81C 1HNZL 4BA2I 4LF4Q 1VQIA 1VQJA 2R6GA 2E5LL 3KLWA 3OTOL 2AWOA 1GO3E 1CKMA 1S3OA 4R4CA 2UUAL 4JI2Q 4DR1L 1EQQA 1J5EQ 4P71A 1Q46A 4B3TL 4JYAQ 4BY1H 3Q8DA 1N36L 4X62Q 3S2HH 2MNAA 1X6OA 1YEZA 2QGQA 1FGUA 5IYBG 1K73C 4JI7Q 4A93G 1UWVA 2OQKA 3AFQA 4UPAA 5AJ3Q 3OTOQ 2NVTH 1KD1C 3DM3A 3I4NG 2WFWA 3W5OA 2R7FA 3HOUG 2UUAQ 3PO3H 1QZHA 1SN8A 1YHAA 3CCSA 2JA7G 1B8AA 4BBSH 4B3SL 4GLXA 1HNWL 1VQBA 3M4PA 4LW1A 1L1OA 2CQOA 4LWCA 4A75A 2HQLA 1VQOA 1Y1WG 3E0EA 3JC66 2E2HH 4LF6L 3I55A 3HOVG 1VQPA 1QUQB 3MEFA 3U4ZA 4B3ML 2JA5G 1JE5A 4LUOA 5GADC 2KENA 1KXLA 1HNWQ 4A3EG 4LF5L 1WI5A 3VDYA 3ULJA 1PH2A 3CPWA 1VQLA 4LF4L 3PUWA 3SGIA 4DK6C 2UU9L 2K5NA 1TWGH 3RLNA 2B29A 4HJ8A 3A0JA 3BZCA 1VQ9A 1MKHA 4PZ7A 4BA1I 3T1YL 1DGSA 1U0LA 3M85A 3H15A 4LF5Q 1CKNA 5BR8L 1L1OC 3ER0A 1KAWA 2PI2E 1PA6A 5IP9G 5AJ3L 2IHEA 1V43A 1KQSA 1VQ5A 1L1OB 1EWIA 1HR0Q 2I5MX 4JI8Q 2ID0A 2YTYA 5LMUQ 1HR0W 2CCZA 1HJPA 1Y1WH 4OO1G 3CAMA 1KRSA 1QVCA 1V9PA 3HOXG 3G71A 3J81c 2GN5A 3A5ZB 4DV5Q 4JI5Q 3PO3G 4DR4L 4X65L 4DUZL 4BBRH 3A74A 2MO0A 4JG2A 4NB3A 4P74A 4JI0L 4BXXG 1BVSA 4A3GG 3K7UC 4GKKL 1NBWA 1BKBA 2NVXH 2JEAI 2R7DA 4OX9Q 5GAHC 4JBMA 4L5RC 1C0AA 5FLMG 3U58A 3G48A 4A4IA 3ULLA 2WAQE 1CSQA 4IO9A 3S15H 2K4KA 2OQ0A 1BBUA 4DR4Q 1VQFA 1Q82C 1VQ8A 4AIMA 3PGZA 4TQUS 1XPOA 2JQOA 4IPDA 4O0AA 2QEXA 4DV1Q 4DAYB 4L5TA 4J15A 4C3HH 1PYBA 1KRTA 5C0XI 4DV0L 3GO5A 2Q2TA 4JV5L 2E8GA 4UP8A 5M5XH 2XTIA 3KDFB 2VQFQ 1PH3A 2A19A 4PZ6A 1RL2A 1PH6A 3ZJYC 2JA5H 3F8TA 3HOYG 4DV2L 3M7NA 1PH7A 2B63G 4DR6Q 4DKAC 4DV1L 2KHIA 3GDEA 1CKOA 4BBSG 1QUQA 1N34Q 3CP0A 1IBML 2UUBL 2OWOA 3GTLH 4B3RQ 4DV4L 3AYHB 2JEBI 4GN5A 3HOXH 3IRBA 2A1AA 3LGJA 2YYZA 4DUZQ 2KBNA 4ALPA 2B3GA 4KI0A 3S17H 1OXUA 3HKZG 1X55A 3KJOA 1LYLA 1MJCA 1JMCA 1WFQA 4IFDG 3T1HL 2VZAA 2ZTEA 1RIPA 2MO1A 3H0GG 4BY1G 4UP7A 4R4TA 2QA4A 4DV0Q 4JV5Q 1Y1VH 2Y0SE 4GS3A 4B3MQ 4JCVE 1TWHH 3I2ZA 3I4OA 5LMNW 4L5SA 1E1TA 5JJKA 4YHHQ 3J80i 2IY5B 1Z47A 4GOPC 5IWAQ 1YIJA 1G6PA 3S1MH 1UE7A 3CCQA 4A3CH 3CCEA 3D0FA 3G4SA 4GNXA 2KCMA 4LFCQ 4B3RL 3KF8B 3AEVA 2CWAA 2CFMA 5M3MG 2D62A 3F1ZA 2EQSA 4HIDA 2IX0A 3JAMc 3K0XA 1K8GA 2PI2A 3AQQA 3D31A 4DV4Q 3J7A5 5IYDH 2WB1G 3GTKH 4YWMA 5LMNQ 1OXSC 2N78A 5IY0A 2N49A 3CXCA 3TS0A 1YVCA 4RG1A 1LUZA 2LSSA 4AYBE 4PZ8A 2JA6H 4GOPB 4A3KH 1CSPA 4UY8C 4QL5A 4WJ3M 2CKZB 1X3EA 2HIVA 5FJ8H 4IOCA 1BBWA 5FLXc 4AH6A 5C3EH 4IOAA 1TWCH 4KHPL 4HJAA 2VUMH 3UDGA 4A76A 2OCEA 4C3IH 4JI3L 4IJLA 1I6HH 4JI7L 5IWAL 1E24A 1LM0A 1MIUA 1T9HA 4IPGA 4ME3A 5JEAJ 4X64L 1VQMA 5ELNA 3M4OH 4GLAC 4BY7H 3GTGH 3H3VH 1K3RA 3HOYH 2YTVA 2F52A 1G51A 1KL9A 2PNHA 3WWVA 4EQ5A 5H1SE 1ASZA 2UXDL 4HJ7A 2VL6A 3E9HA 3I7FA 1I5FA 1X56A 1W2BA 4JI3Q 2H5XA 3PSIA 5IYCH 4A3BG 3RLOA 1N8RC 2ZTCA 3PIPA 4IPCA 4WJ4A 2L15A 2JJQA 4C2MH 1VQHA 2FXQA 4JI6L 1SE8A 1VQDA 1XNRL 4QQBX 3CC4A 1HZ9A 4AQYL 3J7ZC 1P8LA 4A3JH 4HJ5A 3DLLA 3I4MG 2RF4A 1YHBA 4GOPA 4A3KG 2RCNA 1HNZQ 1NMGA 3CD6A 1TXYA 2EIFA 2WP8J 1Q86C 4HJ9A 2R92G 4JOIA 5IYDG 2HHHL 1N32Q 2HT1A 2BA0A 4JI1L 3S2DH 2UXDQ 1VQ7A 1L2FA 2BA1A 4A3LG 1AE3A 2PQAB 4YHHL 2K52A 2VNUD 4X6AH 1XPRA 5M3MH 1GD7A 1UE5A 1UE1A 1SMXA 4R1JA 4DV6L 1E1OA 3S16H 4R4OA 4DV5L 3K81C 4A3DG 1UEBA 3NENA 2VUMG 3CMEA 2YTXA 4UP9A 2R93H 1N33Q 4LF6Q 5FLMH 4GKJQ 2K5HA 2VS1A 1XPUA 4JI6Q 1IBLQ 3FHWA 4DPGA 2HIXA 4YY3Q 1IBKQ 2JA8H 3K7AH 1EIYB 1PHJA 4K0KQ 4BBRG 4RMFA 2NZOA 2N8NA 2Q2IA 4A3GH 4APVA 1A62A 4LF8Q 2R7ZH 1O7IA 4DR2Q 1YJWA 3UDIA 4OWWB 3HKSA 1EOVA 1VQAA 3CCRA 4KHPQ 1XMOQ 3B6YA 4NXMQ 4DV2Q 4NXNQ 4A3MG 4DR6L 3K80C 1CKNB 3EN2A 2F3IA 3EIVA 4LFAQ 3PO2G 4LF8L 1N34L 2UUBQ 2RHSB 3G6EA 1I94Q 1NMFA 2JK8A 3J81j 4DV6Q 4HIKA 4LNQA 3L0OA 4JI4Q 1K8AC 2KHJA 1W3SA 5DLQE 1KIXA 5M3FH 4NXML 2Y0SG 4IPHA 3PIOA 2NN6I 1YI2A 4JBJA 4QY7A 1Q1EA 3CQZH 3TEHB 2IT1A 3RN2A 1S40A 5K36G 3PCOB 1IBLL 1PV4A 1SLJA 4Y7NH 1PH5A 4JI4L 3CCUA 4OX9L 2K14A 4L5QA 3TRZA 5JJIA 1NE3A 2E2IH 2ALYB 1A63A 3CMAA 4BXXH 4QIWE 1EUJA 4QJFA 2NN6G 4B3TQ 2MQHA 4A3MH 4YCUA 1LTLA 1VS0A 4X66L 4DR2L 1YHQA 4X62L 1YZ6A 1TWAH 3F2CA 5M5YH 1E3PA 1GVPA 2V1CC 1HR0L 1OXTA 2IHFA 2B63H 2F4VL 4R4IA 3NEMA 4DR1Q 3KYHC 4JI2L 4JI5L 4YWKA 1J5EL 1PH4A 2JA7H 2UXCL 4LFAL 4XTCS 4JI1Q 4GNXB 2XGTA 3HFZB 4B3SQ 4POGA 1FVIA 3L7ZC 1PH1A 2ZJQA 1VQEA 5HY6A 5C44H 4GNXC 5LMNL 3CCLA 3I4NH 3S14H 2CWPA 4IJHA 3OYYA 3CCJA 1G291 4P73A 3ULPA 4LFBL 3M9BA 3T1YQ 4DR3L 3GTQH 5E7NA 4JC0A 3CCMA 2IX1A 3GTOH 2ES2A 1A8VA 4MNOA 3NELA 5C4JH 2AMCB 3E9IA 1X65A 1HZCA 1HZAA 3CPFA 2Q2UA 5C44G 2E2JH 2BH8A 5GAGC 3U4VA 3FKIH 4P72A 4DR3Q 3HKZE 1QVGA 3PF4A 2I0QA 3J81i 3PUVA 1IXRA 4DR5L 3HOVH 1JB7A 1NY4A 3BU2A 4X64Q 1FJGQ 1EQRA 5GAEC 1X3GA 5ELOA 1H95A 2UU9Q 4PMWA 1IL2A 2OTJA 3S24A 2UXBQ 2K75A 3UE0A 1VQKA 3PUZA 3L2PA 4JI8L 1K0RA 3KDFA 3JAMi 3I56A 1VQGA 5EAYA 4EX5A 4DR5Q 2JA6G 4A93H 2VW9A 2UXCQ 4YCWA 1IZ6A 4GN3B 5IP7H 1K9MC 1HNXQ 3H3VI 1S72A 3ICEA 1XNQQ 5GQOA 4JYAL 1AE2A 4LUZA 4OONA 1X3FA 1NTGA 1SRUA 3STBD 1JT8A 1SROA 2ZJRA 1QZGA 1X54A 3RR5A 1OXVA 1VQNA 3CF5A 2WB1E 1VQCA 2C35B 4KHZA 3W1GA 1EFWA 3UDFA 4XIGS 3RN5A 4LUVA 2NZHA 1IYJB 5M3FG 1Q8KA 2LXKA 3RZOH 4DAMA 2AHOB 2UUCL 1FJGL 3GTMH 1D8LA 2Q2HA 3PV0A 5IT9c 3PO2H 4PG3A 2MFIA 3HOWH 4A3LH 2R7ZG 4HIMA 2KCTA 3KJPA 3PUYA 2GVAA 4HIOA 3K8AA 4DK3C 1P16A 1XTDA 1ASYA 3UE1A 3M3YH 1UE6A 4X66Q 5IYBH 3RNUA 1XNQL 4IFDJ 4A3JG 3TREA 4LF9L 2F4VQ 2NVYH 4DV7L 2R93G 3RZDH 3GTJH 2Z0SA 3ERSX 4OO1I 1HNXL 1YNXA 2YV5A 1IBMQ 5GROA 2JA8G 2ZM6Q 1KHIA 4A3DH 3HOZG 3CC2A 4MTNA 3T1HQ 4A3IH 1VQ4A 1YITA 3S1QH 3TS2A 4R4QA 2UUCQ 1CUKA 4K0KL 5IYCG 1YBYA 5HGQA 1WJJA 3F2DA 4DUYQ 5JEAG 4DV3L 1WCMH 4A3FG 1Q12A 2YU9H 1B70B 5JJLA 4JOIC 4JI0Q 5C4XG 5J3BA 1XJVA 1B7YB 4DR7L 2ASBA 4IFDI 4BY7G 4AQYQ 2BH2A 3U50C 2R92H 1KC8C 1WYDA 2LXJA 1K83H 1SFOH 4Y52H 4LFCL 5C0XG 4DNIA 3RLFA 4GKKQ 4JBWA 3KF6A 3I4MH 4DV7Q 1OTCA 1Y14B 1OXXK 1C7YA 1PVOA 4DR7Q 4O2DA 3J80c 4AYBG 1N32L 5FJ8G 1A0IA 2WAQG 5IP7G 4LFBQ 1E22A 4FDBA 4TVAB 2UXBL 2JE6I 1FL0A 4P75A 4C3JH 1N9WA 2VQFL 1MJEA 4QGUA 1SR3A 1EIFA 4GN4B 3CW2C 1I3QH 3KOJA 2ZJPA 4DUYL 1V1QA 2K5VA 4DV3Q 2ZM6L 3KF6B 2NVQH 4LF7L 2VQEL 4GLVB 4GKJL 5IE8A 1GKHA 1M1KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF A;  4YY3 L;  2VY3 A;  3GD7 A;  5IP9 H;  2HHH Q;  2Z6K A;  1X9N A;  3GTP H;  4NPS A;  2N3S A;  1VQ6 A;  4YWL A;  1N33 L;  1NJI C;  1TWF H;  1PFS A;  3BZK A;  2PMZ E;  3UDX A;  4A3F H;  1YJ9 A;  1HZB A;  1PYS B;  2ATW A;  5C4X H;  2VQE Q;  3PF5 A;  3S1R H;  1PH8 A;  3CC7 A;  2I5H A;  3FP9 A;  1WCM G;  2AKW B;  3PUX A;  3MXN B;  4KLK A;  4OWX B;  1IBK L;  1M90 C;  4POF A;  1VCI A;  3HOZ H;  5C0X J;  4H02 A;  3KFU A;  1XMQ Q;  4OXP A;  4A3I G;  2AWN A;  5BR8 Q;  1JJC B;  3H0G H;  1YJN A;  2D0P A;  2RHQ B;  4A3E H;  5C3E G;  1Y1V G;  1J6Q A;  3STB C;  1N36 Q;  4MZ9 A;  2DUD A;  1U5K A;  5LMU L;  1I94 L;  2OTL A;  5M5W H;  3CCV A;  4NXN L;  1XMO L;  2D0O A;  4LF7 Q;  1E7Z A;  3AFP A;  1JJ2 A;  1HH2 P;  1R9T H;  4X65 Q;  4LF9 Q;  3M4Q A;  3NBH B;  2GVB A;  2ZTD A;  3BJU A;  4A3B H;  1PH9 A;  3HOW G;  1I50 H;  1WOC A;  3FKI G;  3F2B A;  4JBK A;  1C9O A;  1D7Q A;  3HOU H;  1EYG A;  2E5L Q;  3S1N H;  3EBE A;  1GM5 A;  1Q1B A;  2JA9 A;  2DGY A;  1L0W A;  1Z9F A;  1XNR Q;  1JJG A;  3TQY A;  4A3C G;  2I5L X;  3W1B A;  3A5U A;  4OWT B;  2PQA A;  1AH9 A;  1XMQ L;  3OW2 A;  1Q7Y C;  2A8V A;  2K50 A;  2Z6K C;  4YCV A;  2EXD A;  1Q81 C;  1HNZ L;  4BA2 I;  4LF4 Q;  1VQI A;  1VQJ A;  2R6G A;  2E5L L;  3KLW A;  3OTO L;  2AWO A;  1GO3 E;  1CKM A;  1S3O A;  4R4C A;  2UUA L;  4JI2 Q;  4DR1 L;  1EQQ A;  1J5E Q;  4P71 A;  1Q46 A;  4B3T L;  4JYA Q;  4BY1 H;  3Q8D A;  1N36 L;  4X62 Q;  3S2H H;  2MNA A;  1X6O A;  1YEZ A;  2QGQ A;  1FGU A;  5IYB G;  1K73 C;  4JI7 Q;  4A93 G;  1UWV A;  2OQK A;  3AFQ A;  4UPA A;  5AJ3 Q;  3OTO Q;  2NVT H;  1KD1 C;  3DM3 A;  3I4N G;  2WFW A;  3W5O A;  2R7F A;  3HOU G;  2UUA Q;  3PO3 H;  1QZH A;  1SN8 A;  1YHA A;  3CCS A;  2JA7 G;  1B8A A;  4BBS H;  4B3S L;  4GLX A;  1HNW L;  1VQB A;  3M4P A;  4LW1 A;  1L1O A;  2CQO A;  4LWC A;  4A75 A;  2HQL A;  1VQO A;  1Y1W G;  3E0E A;  3JC6 6;  2E2H H;  4LF6 L;  3I55 A;  3HOV G;  1VQP A;  1QUQ B;  3MEF A;  3U4Z A;  4B3M L;  2JA5 G;  1JE5 A;  4LUO A;  5GAD C;  2KEN A;  1KXL A;  1HNW Q;  4A3E G;  4LF5 L;  1WI5 A;  3VDY A;  3ULJ A;  1PH2 A;  3CPW A;  1VQL A;  4LF4 L;  3PUW A;  3SGI A;  4DK6 C;  2UU9 L;  2K5N A;  1TWG H;  3RLN A;  2B29 A;  4HJ8 A;  3A0J A;  3BZC A;  1VQ9 A;  1MKH A;  4PZ7 A;  4BA1 I;  3T1Y L;  1DGS A;  1U0L A;  3M85 A;  3H15 A;  4LF5 Q;  1CKN A;  5BR8 L;  1L1O C;  3ER0 A;  1KAW A;  2PI2 E;  1PA6 A;  5IP9 G;  5AJ3 L;  2IHE A;  1V43 A;  1KQS A;  1VQ5 A;  1L1O B;  1EWI A;  1HR0 Q;  2I5M X;  4JI8 Q;  2ID0 A;  2YTY A;  5LMU Q;  1HR0 W;  2CCZ A;  1HJP A;  1Y1W H;  4OO1 G;  3CAM A;  1KRS A;  1QVC A;  1V9P A;  3HOX G;  3G71 A;  3J81 c;  2GN5 A;  3A5Z B;  4DV5 Q;  4JI5 Q;  3PO3 G;  4DR4 L;  4X65 L;  4DUZ L;  4BBR H;  3A74 A;  2MO0 A;  4JG2 A;  4NB3 A;  4P74 A;  4JI0 L;  4BXX G;  1BVS A;  4A3G G;  3K7U C;  4GKK L;  1NBW A;  1BKB A;  2NVX H;  2JEA I;  2R7D A;  4OX9 Q;  5GAH C;  4JBM A;  4L5R C;  1C0A A;  5FLM G;  3U58 A;  3G48 A;  4A4I A;  3ULL A;  2WAQ E;  1CSQ A;  4IO9 A;  3S15 H;  2K4K A;  2OQ0 A;  1BBU A;  4DR4 Q;  1VQF A;  1Q82 C;  1VQ8 A;  4AIM A;  3PGZ A;  4TQU S;  1XPO A;  2JQO A;  4IPD A;  4O0A A;  2QEX A;  4DV1 Q;  4DAY B;  4L5T A;  4J15 A;  4C3H H;  1PYB A;  1KRT A;  5C0X I;  4DV0 L;  3GO5 A;  2Q2T A;  4JV5 L;  2E8G A;  4UP8 A;  5M5X H;  2XTI A;  3KDF B;  2VQF Q;  1PH3 A;  2A19 A;  4PZ6 A;  1RL2 A;  1PH6 A;  3ZJY C;  2JA5 H;  3F8T A;  3HOY G;  4DV2 L;  3M7N A;  1PH7 A;  2B63 G;  4DR6 Q;  4DKA C;  4DV1 L;  2KHI A;  3GDE A;  1CKO A;  4BBS G;  1QUQ A;  1N34 Q;  3CP0 A;  1IBM L;  2UUB L;  2OWO A;  3GTL H;  4B3R Q;  4DV4 L;  3AYH B;  2JEB I;  4GN5 A;  3HOX H;  3IRB A;  2A1A A;  3LGJ A;  2YYZ A;  4DUZ Q;  2KBN A;  4ALP A;  2B3G A;  4KI0 A;  3S17 H;  1OXU A;  3HKZ G;  1X55 A;  3KJO A;  1LYL A;  1MJC A;  1JMC A;  1WFQ A;  4IFD G;  3T1H L;  2VZA A;  2ZTE A;  1RIP A;  2MO1 A;  3H0G G;  4BY1 G;  4UP7 A;  4R4T A;  2QA4 A;  4DV0 Q;  4JV5 Q;  1Y1V H;  2Y0S E;  4GS3 A;  4B3M Q;  4JCV E;  1TWH H;  3I2Z A;  3I4O A;  5LMN W;  4L5S A;  1E1T A;  5JJK A;  4YHH Q;  3J80 i;  2IY5 B;  1Z47 A;  4GOP C;  5IWA Q;  1YIJ A;  1G6P A;  3S1M H;  1UE7 A;  3CCQ A;  4A3C H;  3CCE A;  3D0F A;  3G4S A;  4GNX A;  2KCM A;  4LFC Q;  4B3R L;  3KF8 B;  3AEV A;  2CWA A;  2CFM A;  5M3M G;  2D62 A;  3F1Z A;  2EQS A;  4HID A;  2IX0 A;  3JAM c;  3K0X A;  1K8G A;  2PI2 A;  3AQQ A;  3D31 A;  4DV4 Q;  3J7A 5;  5IYD H;  2WB1 G;  3GTK H;  4YWM A;  5LMN Q;  1OXS C;  2N78 A;  5IY0 A;  2N49 A;  3CXC A;  3TS0 A;  1YVC A;  4RG1 A;  1LUZ A;  2LSS A;  4AYB E;  4PZ8 A;  2JA6 H;  4GOP B;  4A3K H;  1CSP A;  4UY8 C;  4QL5 A;  4WJ3 M;  2CKZ B;  1X3E A;  2HIV A;  5FJ8 H;  4IOC A;  1BBW A;  5FLX c;  4AH6 A;  5C3E H;  4IOA A;  1TWC H;  4KHP L;  4HJA A;  2VUM H;  3UDG A;  4A76 A;  2OCE A;  4C3I H;  4JI3 L;  4IJL A;  1I6H H;  4JI7 L;  5IWA L;  1E24 A;  1LM0 A;  1MIU A;  1T9H A;  4IPG A;  4ME3 A;  5JEA J;  4X64 L;  1VQM A;  5ELN A;  3M4O H;  4GLA C;  4BY7 H;  3GTG H;  3H3V H;  1K3R A;  3HOY H;  2YTV A;  2F52 A;  1G51 A;  1KL9 A;  2PNH A;  3WWV A;  4EQ5 A;  5H1S E;  1ASZ A;  2UXD L;  4HJ7 A;  2VL6 A;  3E9H A;  3I7F A;  1I5F A;  1X56 A;  1W2B A;  4JI3 Q;  2H5X A;  3PSI A;  5IYC H;  4A3B G;  3RLO A;  1N8R C;  2ZTC A;  3PIP A;  4IPC A;  4WJ4 A;  2L15 A;  2JJQ A;  4C2M H;  1VQH A;  2FXQ A;  4JI6 L;  1SE8 A;  1VQD A;  1XNR L;  4QQB X;  3CC4 A;  1HZ9 A;  4AQY L;  3J7Z C;  1P8L A;  4A3J H;  4HJ5 A;  3DLL A;  3I4M G;  2RF4 A;  1YHB A;  4GOP A;  4A3K G;  2RCN A;  1HNZ Q;  1NMG A;  3CD6 A;  1TXY A;  2EIF A;  2WP8 J;  1Q86 C;  4HJ9 A;  2R92 G;  4JOI A;  5IYD G;  2HHH L;  1N32 Q;  2HT1 A;  2BA0 A;  4JI1 L;  3S2D H;  2UXD Q;  1VQ7 A;  1L2F A;  2BA1 A;  4A3L G;  1AE3 A;  2PQA B;  4YHH L;  2K52 A;  2VNU D;  4X6A H;  1XPR A;  5M3M H;  1GD7 A;  1UE5 A;  1UE1 A;  1SMX A;  4R1J A;  4DV6 L;  1E1O A;  3S16 H;  4R4O A;  4DV5 L;  3K81 C;  4A3D G;  1UEB A;  3NEN A;  2VUM G;  3CME A;  2YTX A;  4UP9 A;  2R93 H;  1N33 Q;  4LF6 Q;  5FLM H;  4GKJ Q;  2K5H A;  2VS1 A;  1XPU A;  4JI6 Q;  1IBL Q;  3FHW A;  4DPG A;  2HIX A;  4YY3 Q;  1IBK Q;  2JA8 H;  3K7A H;  1EIY B;  1PHJ A;  4K0K Q;  4BBR G;  4RMF A;  2NZO A;  2N8N A;  2Q2I A;  4A3G H;  4APV A;  1A62 A;  4LF8 Q;  2R7Z H;  1O7I A;  4DR2 Q;  1YJW A;  3UDI A;  4OWW B;  3HKS A;  1EOV A;  1VQA A;  3CCR A;  4KHP Q;  1XMO Q;  3B6Y A;  4NXM Q;  4DV2 Q;  4NXN Q;  4A3M G;  4DR6 L;  3K80 C;  1CKN B;  3EN2 A;  2F3I A;  3EIV A;  4LFA Q;  3PO2 G;  4LF8 L;  1N34 L;  2UUB Q;  2RHS B;  3G6E A;  1I94 Q;  1NMF A;  2JK8 A;  3J81 j;  4DV6 Q;  4HIK A;  4LNQ A;  3L0O A;  4JI4 Q;  1K8A C;  2KHJ A;  1W3S A;  5DLQ E;  1KIX A;  5M3F H;  4NXM L;  2Y0S G;  4IPH A;  3PIO A;  2NN6 I;  1YI2 A;  4JBJ A;  4QY7 A;  1Q1E A;  3CQZ H;  3TEH B;  2IT1 A;  3RN2 A;  1S40 A;  5K36 G;  3PCO B;  1IBL L;  1PV4 A;  1SLJ A;  4Y7N H;  1PH5 A;  4JI4 L;  3CCU A;  4OX9 L;  2K14 A;  4L5Q A;  3TRZ A;  5JJI A;  1NE3 A;  2E2I H;  2ALY B;  1A63 A;  3CMA A;  4BXX H;  4QIW E;  1EUJ A;  4QJF A;  2NN6 G;  4B3T Q;  2MQH A;  4A3M H;  4YCU A;  1LTL A;  1VS0 A;  4X66 L;  4DR2 L;  1YHQ A;  4X62 L;  1YZ6 A;  1TWA H;  3F2C A;  5M5Y H;  1E3P A;  1GVP A;  2V1C C;  1HR0 L;  1OXT A;  2IHF A;  2B63 H;  2F4V L;  4R4I A;  3NEM A;  4DR1 Q;  3KYH C;  4JI2 L;  4JI5 L;  4YWK A;  1J5E L;  1PH4 A;  2JA7 H;  2UXC L;  4LFA L;  4XTC S;  4JI1 Q;  4GNX B;  2XGT A;  3HFZ B;  4B3S Q;  4POG A;  1FVI A;  3L7Z C;  1PH1 A;  2ZJQ A;  1VQE A;  5HY6 A;  5C44 H;  4GNX C;  5LMN L;  3CCL A;  3I4N H;  3S14 H;  2CWP A;  4IJH A;  3OYY A;  3CCJ A;  1G29 1;  4P73 A;  3ULP A;  4LFB L;  3M9B A;  3T1Y Q;  4DR3 L;  3GTQ H;  5E7N A;  4JC0 A;  3CCM A;  2IX1 A;  3GTO H;  2ES2 A;  1A8V A;  4MNO A;  3NEL A;  5C4J H;  2AMC B;  3E9I A;  1X65 A;  1HZC A;  1HZA A;  3CPF A;  2Q2U A;  5C44 G;  2E2J H;  2BH8 A;  5GAG C;  3U4V A;  3FKI H;  4P72 A;  4DR3 Q;  3HKZ E;  1QVG A;  3PF4 A;  2I0Q A;  3J81 i;  3PUV A;  1IXR A;  4DR5 L;  3HOV H;  1JB7 A;  1NY4 A;  3BU2 A;  4X64 Q;  1FJG Q;  1EQR A;  5GAE C;  1X3G A;  5ELO A;  1H95 A;  2UU9 Q;  4PMW A;  1IL2 A;  2OTJ A;  3S24 A;  2UXB Q;  2K75 A;  3UE0 A;  1VQK A;  3PUZ A;  3L2P A;  4JI8 L;  1K0R A;  3KDF A;  3JAM i;  3I56 A;  1VQG A;  5EAY A;  4EX5 A;  4DR5 Q;  2JA6 G;  4A93 H;  2VW9 A;  2UXC Q;  4YCW A;  1IZ6 A;  4GN3 B;  5IP7 H;  1K9M C;  1HNX Q;  3H3V I;  1S72 A;  3ICE A;  1XNQ Q;  5GQO A;  4JYA L;  1AE2 A;  4LUZ A;  4OON A;  1X3F A;  1NTG A;  1SRU A;  3STB D;  1JT8 A;  1SRO A;  2ZJR A;  1QZG A;  1X54 A;  3RR5 A;  1OXV A;  1VQN A;  3CF5 A;  2WB1 E;  1VQC A;  2C35 B;  4KHZ A;  3W1G A;  1EFW A;  3UDF A;  4XIG S;  3RN5 A;  4LUV A;  2NZH A;  1IYJ B;  5M3F G;  1Q8K A;  2LXK A;  3RZO H;  4DAM A;  2AHO B;  2UUC L;  1FJG L;  3GTM H;  1D8L A;  2Q2H A;  3PV0 A;  5IT9 c;  3PO2 H;  4PG3 A;  2MFI A;  3HOW H;  4A3L H;  2R7Z G;  4HIM A;  2KCT A;  3KJP A;  3PUY A;  2GVA A;  4HIO A;  3K8A A;  4DK3 C;  1P16 A;  1XTD A;  1ASY A;  3UE1 A;  3M3Y H;  1UE6 A;  4X66 Q;  5IYB H;  3RNU A;  1XNQ L;  4IFD J;  4A3J G;  3TRE A;  4LF9 L;  2F4V Q;  2NVY H;  4DV7 L;  2R93 G;  3RZD H;  3GTJ H;  2Z0S A;  3ERS X;  4OO1 I;  1HNX L;  1YNX A;  2YV5 A;  1IBM Q;  5GRO A;  2JA8 G;  2ZM6 Q;  1KHI A;  4A3D H;  3HOZ G;  3CC2 A;  4MTN A;  3T1H Q;  4A3I H;  1VQ4 A;  1YIT A;  3S1Q H;  3TS2 A;  4R4Q A;  2UUC Q;  1CUK A;  4K0K L;  5IYC G;  1YBY A;  5HGQ A;  1WJJ A;  3F2D A;  4DUY Q;  5JEA G;  4DV3 L;  1WCM H;  4A3F G;  1Q12 A;  2YU9 H;  1B70 B;  5JJL A;  4JOI C;  4JI0 Q;  5C4X G;  5J3B A;  1XJV A;  1B7Y B;  4DR7 L;  2ASB A;  4IFD I;  4BY7 G;  4AQY Q;  2BH2 A;  3U50 C;  2R92 H;  1KC8 C;  1WYD A;  2LXJ A;  1K83 H;  1SFO H;  4Y52 H;  4LFC L;  5C0X G;  4DNI A;  3RLF A;  4GKK Q;  4JBW A;  3KF6 A;  3I4M H;  4DV7 Q;  1OTC A;  1Y14 B;  1OXX K;  1C7Y A;  1PVO A;  4DR7 Q;  4O2D A;  3J80 c;  4AYB G;  1N32 L;  5FJ8 G;  1A0I A;  2WAQ G;  5IP7 G;  4LFB Q;  1E22 A;  4FDB A;  4TVA B;  2UXB L;  2JE6 I;  1FL0 A;  4P75 A;  4C3J H;  1N9W A;  2VQF L;  1MJE A;  4QGU A;  1SR3 A;  1EIF A;  4GN4 B;  3CW2 C;  1I3Q H;  3KOJ A;  2ZJP A;  4DUY L;  1V1Q A;  2K5V A;  4DV3 Q;  2ZM6 L;  3KF6 B;  2NVQ H;  4LF7 L;  2VQE L;  4GLV B;  4GKJ L;  5IE8 A;  1GKH A;  1M1K C; 
#chains in the Genus database with same CATH topology
 4YY3 L;  3GD7 A;  2HHH Q;  1X9N A;  4RCO A;  1VQ6 A;  4YWL A;  2K1B A;  2EYL A;  3TN2 A;  1PYS B;  1GUG A;  1SNC A;  5L37 A;  1IBK L;  1WCM G;  2AKW B;  4ID6 A;  5T1I A;  3HOZ H;  3K58 A;  4H02 A;  1EZ8 A;  1NSN S;  3H0G H;  1YJN A;  4A3E H;  3KK7 A;  4MZ9 A;  2H1E A;  3L3O C;  5M5W H;  3NBI A;  4NXN L;  3V2T A;  4LF7 Q;  3AFP A;  4X65 Q;  1IW7 C;  1GHJ A;  1SEB D;  3M4Q A;  2GVB A;  4A3B H;  2K03 A;  2RSO A;  4JBK A;  3FKI G;  1GJX A;  4CKC A;  2E5L Q;  3EBE A;  1XNR Q;  1SYF A;  1JJG A;  4A3C G;  2I5L X;  4OWT B;  3QG1 A;  2XVS A;  4ZKB B;  1UUP A;  1Q7Y C;  2A8V A;  4I7A A;  2F0I A;  2FMC A;  4BA2 I;  5ELB A;  1VQJ A;  2R6G A;  2WKD A;  2KED A;  4R4C A;  5A2Q L;  5DAU A;  1J5E Q;  1Q46 A;  3P75 A;  2M00 A;  4UDU C;  3J7A V;  2KHS A;  1Q8I A;  2JN4 A;  5M5W B;  2MNA A;  1X6O A;  1KAB A;  1S5D D;  1FGU A;  1YEZ A;  1II3 A;  2J7Z A;  3D4R A;  2OQK A;  3C1F A;  4A93 G;  1G91 A;  5LL6 S;  3OTO Q;  1RF2 D;  1KD1 C;  3I4N G;  1K8O A;  2WFW A;  1F9S A;  1MBY A;  1QZH A;  3CCS A;  1I50 B;  1TY2 A;  4GLX A;  2F0T A;  1VQO A;  4LWC A;  2NBF A;  3E0E A;  4XXE A;  2E2H H;  2B63 B;  3I55 A;  3K5L A;  4B3M L;  3SK6 A;  1ROD A;  1JE5 A;  4LUO A;  5GAD C;  2KEN A;  3TZU A;  1HNW Q;  1TS5 A;  4OHJ A;  2FHT A;  2UU9 L;  2WB1 B;  2O4X A;  5M9O A;  2OXP A;  1MHW C;  1CHQ D;  1GHK A;  3LWE A;  4LF5 Q;  2NVT B;  4TSS A;  1EZ6 A;  1IYV A;  1V43 A;  3D6C A;  4QMG A;  1L1O B;  1KQS A;  2JA5 B;  2I5M X;  4JI8 Q;  1QNK A;  1HR0 W;  4IZ8 A;  5I2Y A;  1Y1W H;  4OO1 G;  4JI5 Q;  1V9P A;  4DR4 L;  4X65 L;  4DUZ L;  4NB3 A;  1CFM A;  3K7U C;  2HUG A;  1IYU A;  2NVX H;  5IT9 E;  2R7D A;  4L5R C;  1F9R A;  5F2D A;  4IO9 A;  3S15 H;  2OQ0 A;  4BS9 A;  4B08 A;  4EGV A;  1VQ8 A;  5JPM C;  3PGZ A;  4TQU S;  1VF5 C;  2JQO A;  4IPD A;  5C0X H;  2QEX A;  3SE0 A;  4C1N K;  1PYB A;  3TP8 A;  2Q2T A;  3WDN A;  4UP8 A;  2VQF Q;  2XTI A;  3KDF B;  1C4Q A;  1GXD C;  5DM7 3;  1RL2 A;  1PH6 A;  3Q22 A;  3F8T A;  4DV2 L;  1EL0 A;  1PH7 A;  1ENF A;  3HOV B;  4BBS G;  1HA5 A;  1QUQ A;  3CP0 A;  1N34 Q;  2EXZ A;  2F0O A;  5K5P A;  4GN5 A;  3HOX H;  4KK7 A;  2A1A A;  4DK0 A;  4MTK A;  2PZU A;  2YYZ A;  3VR3 A;  4KI0 A;  3S17 H;  4M1U B;  3NP8 A;  3S15 B;  3H0G G;  3WOF A;  1HQM C;  4UP7 A;  1BBX C;  1Y1V H;  4GS3 A;  3MXU A;  4B3M Q;  3NWS A;  3I4O A;  1EOT A;  2XSC A;  2A73 B;  2BE5 C;  2V4D A;  1G6P A;  1YIJ A;  2F1M A;  3CCQ A;  3MEH A;  5CBE E;  1ZEQ X;  1ICF B;  1PTO D;  1DOL A;  2CFM A;  2EQS A;  1D5M C;  4ZRZ A;  1BUV T;  4PNY A;  3JAM c;  2PI2 A;  3D31 A;  2LFN A;  4FF4 A;  2XRQ D;  5C4X B;  5FO8 B;  2WB1 G;  3GTK H;  5LMN Q;  2N78 A;  5IY0 A;  4IQZ A;  4RG1 A;  2B39 A;  5EBD A;  4AYB E;  1SNQ A;  3IKJ A;  2KEE A;  4WJ3 M;  4HN7 A;  1X3E A;  2HIV A;  5FJ8 H;  1DOK A;  4RKB A;  2HDM A;  3S1Q B;  2OCE A;  1BCP D;  5IWA L;  1T9H A;  4X64 L;  3VR2 A;  5JEA J;  3I72 A;  5ELN A;  5G3L D;  4BY7 H;  3PO2 B;  1K3R A;  3HOY H;  4JPB W;  1SJE D;  3WWV A;  5H1S E;  2RA4 A;  3I7F A;  4R8I A;  1I5F A;  2EY5 A;  4JI3 Q;  3VA7 A;  3PSI A;  2L55 A;  5IYC H;  1N8R C;  1LV9 A;  4CBV A;  3WOE A;  3FMC A;  5C5L A;  2F0W A;  4C2M H;  2FXQ A;  1XNR L;  2C5C A;  1ILP A;  2NTS A;  2K5D A;  4HJ5 A;  2RF4 A;  3E5S A;  2EYP A;  3Q23 A;  1JE4 A;  1CQV A;  1JB3 A;  2QF7 A;  3K6O A;  1Q86 C;  1N32 Q;  1FR3 A;  5A2Q E;  1R4Q B;  2M2L A;  3FDT A;  3A7A B;  1AE3 A;  2QDL A;  2EOT A;  2QW7 A;  5M3M H;  2CHB D;  1SNO A;  1UE5 A;  1XYI A;  2R92 B;  4R4O A;  3RD4 A;  3K81 C;  3KF8 A;  1A2U A;  1PRT C;  2VUM G;  2KQ3 A;  2EDG A;  3NWT A;  4UP9 A;  2IPK D;  4A3E B;  1N33 Q;  5EBC A;  4CJ1 B;  1STN A;  2K5H A;  4XYQ A;  5BN3 A;  1IBL Q;  1VF7 A;  2B2Y A;  1EYD A;  2HIX A;  1JQY D;  2BE5 D;  4K0K Q;  4BBR G;  4RMF A;  3BVM A;  4LF8 Q;  1YJW A;  3GQB A;  1NR4 A;  3UDI A;  1JOO A;  3HOU B;  1EOV A;  1I4X A;  1DYQ A;  1XMO Q;  3K80 C;  3EN2 A;  2X69 A;  3G6E A;  1I94 Q;  1PRT F;  2AQ1 B;  1W3S A;  3U9O A;  4NXM L;  3NE5 B;  2Y0S G;  1ZYR C;  1YI2 A;  4A3K B;  4JBJ A;  4FXG C;  3TEH B;  1S40 A;  4QCL A;  4EVO A;  1STA A;  1LTT D;  5CC4 A;  1PH5 A;  4Y7N H;  4A3D B;  1DCZ A;  4JI4 L;  1B1Z A;  2K14 A;  5JVG 3;  1BCP C;  4PMB A;  5IGD A;  4BXX H;  1QOH A;  4QJF A;  2E74 C;  1SNP A;  1YHQ A;  1UAP A;  3EJI A;  2LY7 A;  2V1C C;  3S1N B;  2IHF A;  2B63 H;  3QOJ A;  4R4I A;  2HDL A;  3CRK C;  4DR1 Q;  4JI2 L;  4JI5 L;  2JA7 H;  5FK9 C;  4XTC S;  2E76 C;  3HFZ B;  4B3S Q;  4HMJ A;  5HY6 A;  5M3F B;  4ODG A;  1TII D;  1FGB D;  4IJH A;  4P73 A;  1F77 A;  3T1Y Q;  4DR3 L;  3GTQ H;  1KAA A;  2KCN A;  3TP6 A;  4MNO A;  3NEL A;  5C4J H;  3DUZ A;  2B8F A;  4P72 A;  3SR1 A;  3PO3 B;  4DFA A;  2I0Q A;  2Z8L A;  1SYB A;  1IXR A;  2BDN A;  4DR5 L;  1I4P A;  1TWA B;  1NY4 A;  1PMR A;  4O42 A;  4XT1 B;  4K5V A;  1AFP A;  5ELO A;  1H95 A;  5COR A;  4KKS A;  3VR4 A;  4RGO S;  5D14 A;  1PRT D;  4CHT B;  3R2I A;  1K0R A;  3BDO A;  3R3O A;  1QG7 A;  4H7B A;  4X3U A;  5EAY A;  4CJ2 C;  5I4D A;  3JAM L;  4CDE C;  2EZV A;  1IZ6 A;  3ICE A;  1HNX Q;  3H94 A;  4OON A;  1JT8 A;  1NTG A;  1SRU A;  2ZJR A;  3X3M A;  2RDF A;  1OXV A;  2WB1 E;  1VQC A;  5JPN C;  2C35 B;  1MSH A;  2LS0 1;  4KJN A;  5AFW A;  3A8I E;  3A7L A;  5D3I B;  1SDF A;  5C4Z A;  2JP1 A;  4BY7 B;  3PV0 A;  4PG3 A;  5JEA H;  1AW7 A;  2NTT A;  3J7A F;  1TS3 A;  4HIM A;  3I90 A;  4FO2 A;  3KJP A;  2F0E A;  2JSO A;  1D1K A;  4HIO A;  3K8A A;  3MA2 B;  4DK3 C;  5FOB B;  3UE1 A;  3IAY A;  4FF3 A;  1O7Y A;  4DXF A;  5CMD A;  4X66 Q;  3M3Y H;  1NAP A;  3TRE A;  2RQX A;  3SHL A;  4H13 C;  3MXP A;  1RKN A;  2FMM A;  1IKL A;  4N9T A;  3V05 A;  4CDD C;  4OO1 I;  2KEC A;  4K6L A;  1IBM Q;  1X3Q A;  1KHI A;  4Y7N B;  4A3D H;  1EY9 A;  2VUM B;  3S1Q H;  5FO9 B;  4FXD A;  3A54 A;  4R4Q A;  1YBY A;  1QIL A;  1WCM H;  1Q12 A;  1B70 B;  3GTM B;  4MIU A;  5KGU A;  2FFK B;  1SNM A;  4G7H C;  2EY6 A;  4RCN A;  4JBW A;  3I4M H;  1O80 A;  3HOZ B;  1JWM D;  2CQA A;  3PIP 3;  1OXX K;  1EU3 A;  4DR7 Q;  4O2D A;  2F0H A;  1STH A;  4AYB G;  1N32 L;  1EY0 A;  5IP7 G;  1Y8O B;  3TZD A;  4TVA B;  4CDF C;  2JE6 I;  1FL0 A;  1G2S A;  1N9W A;  2VQF L;  1MJE A;  1SR3 A;  1EIF A;  1TWC B;  1FD7 D;  2DY8 A;  5EQ0 A;  2KA7 A;  3DWA A;  2ZM6 L;  2IW3 A;  1TVX A;  4GKJ L;  1GKH A;  1M1K C;  1NUC A;  4LAA A;  2Z6K A;  3GTP H;  4NPS A;  2N3S A;  3DMU A;  3BYY B;  2PMZ E;  1HZB A;  2ATW A;  2VQE Q;  2I5H A;  4KLK A;  1ET6 A;  1M90 C;  4POF A;  1VCI A;  3TDQ A;  5C0X J;  3C46 A;  3N52 A;  5IGG A;  2D0P A;  4C3J G;  5C3E G;  1N36 Q;  2A6H C;  2EYM A;  2DUD A;  3L9A X;  3I70 A;  2OTL A;  2P5Z X;  4XQN A;  2H4O A;  2K28 A;  1KLG D;  3MXN A;  3V96 A;  4CKE A;  5CV9 A;  1SND A;  4A3M B;  1QB5 D;  2J4X A;  3S1N H;  1GM5 A;  2JA9 A;  1L0W A;  3FVQ A;  3I91 A;  3W1B A;  3A5U A;  1WTO A;  5CV6 A;  1XTC D;  5CV8 A;  1RCV D;  2Z6K C;  4PMC A;  1HNZ L;  1VQI A;  1S4Z A;  1DON A;  1GO3 E;  1MGS A;  1S3O A;  2JA8 B;  4P71 A;  4X62 Q;  1K73 C;  2QGQ A;  5IYB G;  1LTS D;  3AFQ A;  4UPA A;  5AJ3 Q;  2NVT H;  3A55 A;  2D9U A;  2WAC A;  4B3S L;  3OIP A;  3M4P A;  4FNF A;  5DEH A;  1L1O A;  2CQO A;  4A75 A;  3ZYY X;  2HQL A;  2KUM A;  3A8K E;  3HOV G;  2O5J C;  2XIW A;  4HTH A;  5EGT A;  1SMY C;  4C56 C;  2JA5 G;  4LF5 L;  1B3A A;  3VDY A;  2WAQ B;  1HCZ A;  4LF4 L;  3PUW A;  2Z4H A;  1TWG H;  3RLN A;  1BCP B;  1X3P A;  3NK9 A;  1F9Q A;  1VQ9 A;  4LFB Q;  1YNJ C;  1MKH A;  3CU7 A;  5I6Y A;  1GUW A;  1DGS A;  3H15 A;  1RTN A;  1EQT A;  4TKO B;  3ER0 A;  1KAW A;  2HD3 A;  1KLU D;  2PI2 E;  4X3K A;  4ZAI A;  3OWE B;  4K8I A;  2BCO A;  1EWI A;  1HR0 Q;  2YTY A;  1HJP A;  3LWU A;  3HOX G;  2GN5 A;  4DV5 Q;  2F0J A;  2E2H B;  2MO0 A;  4JG2 A;  4BXX G;  1BVS A;  1WTQ A;  1NBW A;  1B9M A;  1C0A A;  5FLM G;  1HXY D;  4A4I A;  1CSQ A;  1R4P B;  2I46 A;  2A6E D;  3QB3 A;  1VQF A;  3NPP A;  4CDC C;  1TWG B;  4O0A A;  3GTO B;  4L5T A;  5C0X I;  1SJH D;  4B9W A;  4DV0 L;  1EY8 A;  3GO5 A;  4JV5 L;  2E8G A;  5KYL A;  3U9S A;  3DXJ C;  4PZ6 A;  1CK1 A;  2B2U A;  2K5Q A;  3M7N A;  4DR6 Q;  4DKA C;  4DV1 L;  2KHI A;  1F2M A;  2OWO A;  5FLX L;  4DV4 L;  2AUK A;  2B2W C;  2JEB I;  4OO1 H;  2PW7 A;  2PW5 A;  2KBN A;  5TSS A;  4ALP A;  5EPK A;  3MVV A;  2N88 A;  3QIA A;  3KJO A;  1LYL A;  1JMC A;  1WFQ A;  4IFD G;  5C44 B;  5I9P A;  1LTG D;  2MO1 A;  4BY1 G;  2L5T A;  2RKS A;  2SDF A;  4R4T A;  2QA4 A;  2Y0S E;  1LTI D;  3I2Z A;  1F2L A;  1IHZ A;  5LMN W;  4L5S A;  4YHH Q;  1VMP A;  2BDO A;  5IWA Q;  1NCV A;  3S1M H;  1DZ1 A;  3SEB A;  3CCE A;  3D0F A;  2RDH A;  4GNX A;  2KCM A;  4LFC Q;  3FKI B;  3KF8 B;  4EQN A;  4L8J A;  5M3M G;  3HKZ B;  3G7L A;  3NSW A;  4C3I G;  3F1Z A;  4HID A;  3Q0A A;  1TR5 A;  4X3S A;  5CV7 A;  1K8G A;  2LKV A;  4QUF A;  1WD0 A;  2VB2 X;  1GOZ A;  1OXS C;  3NUC A;  2K6A A;  2PNR C;  2N49 A;  3CXC A;  2XWB B;  1LUZ A;  2CH4 W;  3NBH A;  5J1Z A;  2F0F A;  1CSP A;  4QL5 A;  1Y1V B;  2CKZ B;  4IOC A;  1HRJ A;  3UI2 A;  1D1I A;  4AH6 A;  1CQF A;  1TWC H;  4KHP L;  1R9T B;  4C3I H;  1CTM A;  4IJL A;  4JI7 L;  1I6H H;  1GUO A;  3M4O H;  4GLA C;  3GTG H;  3GTP B;  2YTV A;  4EQ5 A;  1G51 A;  1KL9 A;  2UXD L;  2Q8T A;  5KND A;  1B2T A;  1X56 A;  1W2B A;  4I65 A;  2H5X A;  3T4A C;  3GTK B;  4A3B G;  1DOM A;  3SXH A;  5E1F A;  3S14 B;  2A6E C;  1VQD A;  2R93 B;  4QQB X;  4A3J H;  1PXU A;  2OT2 A;  3I4M G;  3S2H B;  1V1P B;  2QDB A;  4A3K G;  1HNZ Q;  4G7O C;  3OMG A;  4JOI A;  2HHH L;  2BA0 A;  1JOK A;  5COY A;  1L2F A;  1F9P A;  1JC7 A;  1G2T A;  1GD7 A;  2F0L A;  4RKL A;  3J80 E;  4R1J A;  1E1O A;  1SFO B;  3N6R A;  1HTP A;  4A3D G;  5JAV A;  4X3T A;  5JOB A;  4HAE A;  1YNN C;  2EPB A;  5KNC A;  2K01 A;  1V8Q A;  2YTX A;  1D2B A;  4LF6 Q;  5FLM H;  1XPU A;  4C3J B;  1IBK Q;  1EIY B;  1WTH A;  2EYJ A;  4DNT B;  2Q2I A;  1Q3L A;  3K57 A;  1ENA A;  1O7I A;  3URY A;  4DR2 Q;  2EY1 A;  4LK1 C;  1GUT A;  1J8I A;  4KD4 A;  4IFD I;  4A3M G;  3P7J A;  1CKN B;  3PO2 G;  4L63 B;  4OL7 A;  4LF8 L;  2UUB Q;  1LT4 D;  2PMZ B;  2JK8 A;  1ZXT A;  3M4Y A;  4HIK A;  4DK1 A;  1JIC A;  2KCC A;  1KIX A;  5IGC A;  2NN6 I;  4QY7 A;  1Q1E A;  3K0Y A;  3PCO B;  4PV1 C;  5C4J B;  1IBL L;  1VMC A;  1SLJ A;  4CKB A;  5E3F A;  5ELE A;  1NE3 A;  2F0V A;  3CMA A;  4QIW E;  4J8Q A;  2A68 C;  2MQH A;  2ICE C;  2DY7 A;  1BNZ A;  1YZ6 A;  1TWA H;  3FRP B;  3R2T A;  3SVM A;  4KY7 A;  5M5Y H;  4H44 C;  1HR0 L;  4JVZ A;  2F4V L;  4YIJ A;  1FNW A;  1B53 A;  3MFY A;  4M8A A;  5LL6 X;  4GNX B;  1TKW B;  4POG A;  2ZJQ A;  1VQE A;  5C44 H;  3S14 H;  5LMN L;  2NUC A;  2CWP A;  3T53 B;  1JOR A;  2D2C C;  3EQL C;  1EY5 A;  3D4W A;  3CCJ A;  2KJX A;  2SOB A;  3M9B A;  4ABN A;  3PQI A;  1EY7 A;  4KJO A;  2ES2 A;  3E9I A;  2AMC B;  5EKL A;  1HZC A;  1HZA A;  2AQ3 B;  5C44 G;  3I73 A;  1O7L A;  4QUC A;  2A74 C;  2B2T C;  3CRL C;  4DR3 Q;  1QVG A;  3ERO A;  3J81 i;  5C6A A;  4ZKC B;  4X64 Q;  1FJG Q;  1LTA D;  5GAE C;  3SK8 A;  4BWG B;  3HOX B;  2UU9 Q;  2OTJ A;  4OEM B;  2K75 A;  2G9H D;  2UXB Q;  4JI8 L;  3I8Z A;  4A93 H;  3JAM i;  4DR5 Q;  1VQG A;  2UXC Q;  2VW9 A;  4GN3 B;  1K9M C;  1S72 A;  3RZD B;  4ZUJ A;  3STB D;  1SRO A;  3T56 B;  3RR5 A;  1VQN A;  2DJF C;  1ZKO A;  4FVM A;  4KHZ A;  3W1G A;  1EFW A;  4JK1 C;  2X6G A;  3AU7 A;  2F4I A;  4IUT A;  1IW7 D;  2NZH A;  2F0Q A;  4RAU C;  1FJG L;  4NW2 A;  1D8L A;  2Q2H A;  3T51 B;  3PO2 H;  1CZW A;  2MFI A;  3J7Y W;  1STY A;  1DM0 B;  2RSN A;  3PUY A;  3NHH A;  1P16 A;  1XTD A;  1UE6 A;  1WTX A;  4LF9 L;  2F4V Q;  4DV7 L;  4IUN A;  3RZD H;  1HNX L;  4BY1 B;  5C3E B;  3HOZ G;  4IUV A;  3S1M B;  4A3I H;  1YIT A;  1S5B D;  2UUC Q;  1CUK A;  1ONL A;  4K0K L;  2A68 D;  1U4M A;  3OOC A;  4DUY Q;  4DV3 L;  4BBS B;  3M4O B;  1AN8 A;  3IFT A;  2ASB A;  3K5N A;  2JXM B;  2RCF A;  3K59 A;  2BH2 A;  1EIG A;  3U50 C;  1WYD A;  1SFO H;  4Y52 H;  3TP5 A;  4QB4 A;  5C0X G;  1ESF A;  4DNI A;  1WVL A;  5IOC A;  3KF6 A;  3FEW X;  4DV7 Q;  1PVO A;  1E2V A;  3J80 c;  3H0G B;  3TME A;  1A0I A;  3PMF A;  1E22 A;  2B2W A;  4P75 A;  3OMC A;  5ELC A;  1WTV A;  3CW2 C;  3EFX D;  1V1Q A;  3OSO A;  1I6H B;  2EVB A;  2DN8 A;  3BYT B;  1QVF A;  2VY3 A;  2MJ8 A;  5A35 A;  3HOY B;  3NQI A;  1TWF H;  3BZK A;  3UDX A;  1YJ9 A;  5C4X H;  3O13 A;  3CC7 A;  1B9N A;  3PUX A;  3MXN B;  4OWX B;  1FNU A;  4KKU A;  3KFU A;  5HUR A;  1STG A;  2NB0 A;  3VR6 A;  1N36 L;  3E6Z X;  4DU9 A;  2RHQ B;  1J6Q A;  3MHB A;  3STB C;  4K2K A;  3CCV A;  3BS1 A;  1PDQ A;  1TY0 A;  1A2T A;  2D0O A;  2RBM A;  5M5X B;  4LF9 Q;  3NBH B;  4P2C B;  4G4K A;  2ZTD A;  3BJU A;  1STE A;  1JCK B;  2K04 A;  3HOW G;  5BN5 A;  2R61 A;  1C9O A;  3PIO 3;  1EYG A;  2PQA A;  1AH9 A;  5CBA E;  3FPP A;  3OW2 A;  3C1E A;  2L0C A;  2EXD A;  1CA5 A;  4LF4 Q;  4GZY C;  4DAV A;  2B2V A;  5IOD A;  2AWO A;  1CKM A;  2UUA L;  5C3X A;  1E2W A;  4BY1 H;  1JR0 D;  4HSP A;  3Q8D A;  3S2H H;  4JI7 Q;  1BXT A;  1D5Z C;  2F3W A;  2FJ2 A;  2B2Y C;  1ML0 D;  4F87 A;  3PO3 H;  1SBB B;  1SN8 A;  2JA7 G;  1PFB A;  4BBS H;  2A69 C;  3TP7 A;  1B4O A;  1VQB A;  2EYO A;  5M5Y B;  2WII B;  3BDL A;  1VQP A;  3MFG A;  3S16 B;  3MEF A;  3U4Z A;  2NVX B;  4OIK A;  2PYK A;  2DJG C;  1SYG A;  1CT1 D;  4A3E G;  3OIQ A;  1CM9 A;  3SGI A;  3BDC A;  4DK6 C;  2K5N A;  1LAB A;  1Y8P B;  2Q8R E;  5EJW A;  3A0J A;  3BZC A;  4K5W A;  4BA1 I;  4RGM A;  3M85 A;  1CKN A;  1EEI D;  2E75 C;  1WD1 A;  1L1O C;  1AZP A;  4OEL B;  2R7Z B;  4H0L C;  5AJ3 L;  2IHE A;  1PFM A;  3AMU A;  2ID0 A;  1TQO A;  3G71 A;  1QVC A;  3J81 c;  3PO3 G;  1B50 A;  4N8F A;  2KVM A;  4BBR H;  3A74 A;  4JI0 L;  4A3G G;  1BKB A;  1KNA A;  3G48 A;  2WAQ E;  1S5E D;  4DGZ A;  1KDA A;  3VR5 A;  1A3U A;  1IKM A;  1XPO A;  4Q5V A;  3GTQ B;  3CQZ B;  4DV1 Q;  4DAY B;  4J15 A;  4C3H H;  1KRT A;  1PTO F;  4RWS C;  1IL8 A;  3J80 L;  2SNM A;  2A19 A;  2RDG A;  2JA5 H;  4QIW B;  4B3R Q;  3KLR A;  2UUB L;  1GUS A;  4U68 A;  1H9M A;  1LTR D;  3IL8 A;  2VB3 X;  3G6J B;  1OXU A;  1S5F D;  1X55 A;  3HKZ G;  3QJY A;  3T1H L;  2VZA A;  4DF7 A;  2ZTE A;  1RIP A;  1XX8 A;  4UAI A;  4JCV E;  2X6L A;  3K7A B;  5FO7 B;  1E1T A;  5JJK A;  2IY5 B;  1Z47 A;  4A3C H;  1FYC A;  1EQV A;  2ZXP A;  3G4S A;  4FP5 D;  1EU4 A;  2RVL A;  1E0B A;  3DM1 A;  4B3R L;  3HGB A;  2A69 D;  2CWA A;  4WRD A;  5D3D A;  1TS2 A;  3H09 A;  3C2P A;  4LMQ D;  3K0X A;  4PQX A;  4DV4 Q;  5IYD H;  4RGT A;  1F2Y A;  4YWM A;  3LX0 A;  2HCC A;  1YVC A;  2LSS A;  4PZ8 A;  2JA6 H;  1ZYR D;  2MGS A;  2Y0S B;  4UY8 C;  1PTO B;  4IFD H;  5C3E H;  2XN9 C;  3UDG A;  3C3L A;  3H3V C;  1MIU A;  4IPG A;  4CJ0 B;  3E0J A;  1VQM A;  1MD2 D;  5CR3 A;  1I4Q A;  3H3V H;  1KNE A;  2CH4 A;  3OHX C;  4G7Z C;  2J0T D;  3P20 A;  2D5D A;  3S9W A;  2EJG C;  2G5D A;  3RLO A;  1ICW A;  2ZTC A;  4NDX A;  4IPC A;  3PIP A;  2L15 A;  3ERQ A;  2JJQ A;  4XYO A;  3VYS A;  5I2X A;  4JI6 L;  1SE8 A;  1H9S B;  5C3W A;  3CC4 A;  2JA6 B;  4U67 3;  1HZ9 A;  4KV6 A;  5IGE A;  4AQY L;  3J7Z C;  3DLL A;  1Z6H A;  1YHB A;  4GOP A;  4OIJ A;  2RCN A;  5G3L F;  1NMG A;  1TXY A;  2NVQ B;  4HJ9 A;  1EYC A;  2HT1 A;  5IT9 L;  2BA1 A;  2PQA B;  2VNU D;  1TWF B;  1XPR A;  2L4N A;  1UE1 A;  4J6H A;  4DV5 L;  1UEB A;  2F0K A;  2R93 H;  4GKJ Q;  5KNB A;  3E3X A;  2L12 A;  1E2Z A;  4KTA A;  2MPM A;  2N8N A;  3I4L A;  2F03 A;  4APV A;  2PZW A;  1A62 A;  2R7Z H;  1W6K A;  4NMZ A;  1PTO C;  1Y1W B;  4OWW B;  1VQA A;  4DR6 L;  3HOW B;  2F3I A;  3EIV A;  4L6T B;  4LFA Q;  1T5X D;  2Z9H A;  4DV6 Q;  2Q8I B;  4LNQ A;  1HA6 A;  3J81 E;  2EYH A;  1K8A C;  5DLQ E;  5M3F H;  4IPH A;  3PIO A;  1QCB D;  2MUY A;  4C3H G;  2F0D A;  4DAP A;  1NR2 A;  1A6X A;  2IT1 A;  2WV6 D;  5K36 G;  3VA5 A;  4L5Q A;  1D5X C;  5JJI A;  5D65 A;  2EJF C;  1JWS D;  2ALY B;  2VXW A;  1EUJ A;  2NN6 G;  1WTW A;  4B3T Q;  4X66 L;  4DR2 L;  4JYA L;  4X62 L;  3F2C A;  2K05 A;  1STB A;  4XQJ A;  3KYH C;  3D6W A;  4YWK A;  1HFN A;  1PH4 A;  2UXC L;  4N8X 1;  3K5M A;  1PRT B;  3L7Z C;  4XDX A;  3I4N H;  3CCL A;  5DM6 3;  3R93 A;  4LFB L;  2F0S A;  3CCM A;  2IX1 A;  3GTO H;  1I3Q B;  1PLF A;  2E2J H;  5EKI A;  5GAG C;  1SXT A;  3D8G A;  1K28 A;  3FKI H;  4F88 A;  4FF1 A;  2F0U A;  1SYC A;  3HKZ E;  3PF4 A;  2IJ0 A;  2JYO A;  5LHY 1;  1JB7 A;  3BU2 A;  1RTO A;  1X3G A;  1KDC A;  1MI2 A;  1IL2 A;  4FYD A;  3S24 A;  1JOQ A;  1Y69 U;  1O78 A;  3HP3 A;  3UE0 A;  3AB9 A;  5CV4 A;  1VQK A;  1SYD A;  2DNC A;  3PUZ A;  3L2P A;  3KDF A;  4HED A;  1RD9 D;  3ND9 A;  4RFB A;  4G57 A;  4V0B A;  3DWP A;  5IP7 H;  3H3V I;  2NVY B;  5GQO A;  1DD2 A;  2A6H D;  2EYF A;  1I4R A;  2QIL A;  1PZJ D;  2G9D A;  1RJT A;  4HCS A;  3DHQ A;  4XIG S;  3RN5 A;  3GP7 A;  3D4D A;  3NTI A;  3A56 A;  2L9H A;  5IGB A;  3EVQ A;  5IT9 c;  1BQQ T;  4KY5 A;  1TU2 B;  5FKA C;  3I3C A;  2AQ2 B;  1HQR D;  5T1G A;  2KCT A;  4ME5 A;  1HFG A;  5DNF A;  2SNS A;  4MN3 A;  1ASY A;  1FNV A;  5IYB H;  3RNU A;  4MHE A;  4A3J G;  4IFD J;  2M9V A;  3W3A A;  2L11 A;  1CI3 M;  3GTJ H;  4K6D A;  3ERS X;  4TRD A;  1YNX A;  2OEO A;  2YV5 A;  3QWN A;  5GRO A;  2JA8 G;  5JVH 3;  4HR7 B;  3CC2 A;  3ONA B;  1JWU D;  4MTN A;  3TS2 A;  3P1H A;  5IYC G;  3R8B A;  1VDZ A;  3F2D A;  2K5W A;  5JEA G;  4A3F G;  2QEJ C;  5JJL A;  5C4X G;  4JI0 Q;  2IWH A;  1LAC A;  1XJV A;  1B7Y B;  3GTG B;  4IAL A;  1WTR A;  4BY7 G;  4AQY Q;  2R92 H;  1MSG A;  4LFC L;  2BOS A;  3RLF A;  4GKK Q;  1SE3 A;  1CZG A;  1EYA A;  1I6V C;  3EA6 A;  1Y14 B;  1C7Y A;  1ET9 A;  4LJZ C;  5FJ8 G;  4FXK C;  2WAQ G;  3DEP A;  1I4G A;  4C3J H;  4IUR A;  4HMI A;  4QGU A;  1QNU A;  1I3Q H;  1LTB D;  3KOJ A;  2ZJP A;  2NVQ H;  1BOS A;  4B9X A;  5IE8 A;  1PH2 A;  4JW0 A;  1WCM B;  2B2U C;  2EE1 A;  1U4P A;  5KEE A;  5IP9 H;  4RHS A;  2SEB D;  1N33 L;  1NJI C;  1PFS A;  2MHV A;  3QO2 A;  4A3F H;  4ZUI A;  1SYE A;  1CHP D;  1K83 B;  3S1R H;  3PF5 A;  1PH8 A;  1K3B C;  3FP9 A;  1EWC A;  5KYI A;  4IUQ A;  5FLX E;  1XMQ Q;  1EY4 A;  4OXP A;  1EEF D;  4A3I G;  2AWN A;  5BR8 Q;  1JJC B;  2ZXO A;  4O1N A;  1DJR D;  1HTL D;  1Y1V G;  2F0N A;  3D3R A;  1U5K A;  5LMU L;  3X3N A;  1I94 L;  1XMO L;  3H6M A;  5I9O A;  1E7Z A;  1JJ2 A;  1HH2 P;  1R9T H;  1BCP F;  2Z4I A;  4KN7 C;  1U4R A;  3RZO B;  3VYU A;  1S5C D;  1SAP A;  1PH9 A;  1I50 H;  1WOC A;  5IGF A;  3F2B A;  1D7Q A;  3HOU H;  1F2Z A;  1Q1B A;  3VYT A;  2DGY A;  3MC0 B;  1Z9F A;  3TBI B;  3TQY A;  1HUM A;  5J39 A;  1XMQ L;  1Y8N B;  1AP0 A;  2K50 A;  4YCV A;  1Q81 C;  2E5L L;  3KLW A;  3OTO L;  2F0P A;  1U4L A;  4JI2 Q;  4DR1 L;  1EQQ A;  4C1N I;  3HS0 C;  4B3T L;  4JYA Q;  4GKK L;  1Z7T A;  1UWV A;  2XRS D;  3HG9 A;  1G8Z D;  4A3G B;  3DM3 A;  3W5O A;  4KMU C;  2R7F A;  1AEX A;  3HOU G;  2UUA Q;  4WJW A;  1H9J A;  1DXM A;  1YHA A;  1B8A A;  3NTK A;  3S2D B;  5JJZ A;  1B3Q A;  1HNW L;  4LW1 A;  4LF6 L;  1Y1W G;  3JC6 6;  4J1M A;  3KBX A;  3Q6S A;  1QUQ B;  3OPO A;  1KXL A;  1WI5 A;  3ULJ A;  5EPL A;  1KTK A;  4CGY B;  3CPW A;  1VQL A;  5KRU A;  2O2L D;  2WKC A;  1PTO H;  2TSS A;  3OWF A;  2B29 A;  1GUN A;  4HJ8 A;  3T1Y L;  4PZ7 A;  1U0L A;  4V19 0;  3Q24 A;  5BR8 L;  4DA2 A;  4Z9C B;  1PA6 A;  5IP9 G;  2CW0 C;  4S3S A;  3VYR A;  4XQQ A;  5LMU Q;  4XT3 B;  2CCZ A;  3CAM A;  1KRS A;  2LMC B;  3A5Z B;  5C4H A;  4ZLT F;  4P74 A;  4ZCK A;  1TS4 A;  1EIH A;  4F8M A;  2JEA I;  3IFD A;  4OX9 Q;  5GAH C;  4JBM A;  3U58 A;  4C2M B;  3ULL A;  2K4K A;  4DR4 Q;  1BBU A;  2NYZ D;  1LT3 D;  1Q82 C;  4AIM A;  1K8M A;  1LT5 D;  1TWH B;  5CV5 A;  4RA8 A;  4RHR A;  5M5X H;  1PH3 A;  3ZJY C;  2YU9 B;  3HOY G;  2I07 B;  2B63 G;  3GDE A;  1CKO A;  3BVG A;  1IBM L;  3GTL H;  1EFI D;  3NTH A;  5NUC A;  1M8A A;  3AYH B;  3FPU B;  3IRB A;  3LGJ A;  4DUZ Q;  3DEO A;  2B3G A;  2PPB C;  4DN4 M;  4KD3 A;  1MJC A;  3BZD B;  1H9S A;  3GV3 A;  2KOL A;  3OW7 A;  4DV0 Q;  1L0X B;  4JV5 Q;  1TWH H;  2ICI A;  2QCP X;  3J80 i;  2N55 A;  2PCF B;  1PZI D;  4GOP C;  2HQE A;  1UE7 A;  4OGQ C;  1T5E A;  3AEV A;  1XWE A;  1XXG A;  1UEA B;  2D62 A;  4KKT A;  2IX0 A;  2Z1C A;  4HCE A;  3AQQ A;  1HPC A;  3QOL A;  3S1R B;  4IUU A;  1SMY D;  4I7Z C;  3J7A 5;  2Z6B A;  3T13 A;  3MTS A;  5BN4 A;  3TS0 A;  2AUJ D;  3H91 A;  3F2U A;  4GOP B;  4A3K H;  3GTJ B;  4A3J B;  1BBW A;  1YNJ D;  2ENB A;  3SDZ A;  5FLX c;  5KIX A;  4IOA A;  4RH6 A;  4HJA A;  2VUM H;  4DNR B;  1QE6 A;  2O5I C;  4A3I B;  4A76 A;  2IX3 A;  4JI3 L;  2CW0 D;  2B8G A;  2PQE A;  3J81 L;  2B2T A;  1E24 A;  1LM0 A;  4ME3 A;  4WFN 3;  5IIF A;  2F52 A;  3RMH A;  1ASZ A;  2PNH A;  5M3M B;  3KUP A;  4HJ7 A;  1NNX A;  2EY2 A;  2VL6 A;  3E9H A;  3NXW A;  3KLS X;  4WJ4 A;  1WTP A;  5ISR A;  1VQH A;  1CA6 A;  3DWQ A;  1P8L A;  1A3T A;  1AZQ A;  1U9R A;  1HHV A;  3CD6 A;  3RUZ A;  2EIF A;  2E2D C;  5CGK A;  2WP8 J;  2R92 G;  5IYD G;  3MZ5 A;  1KDB A;  1X32 A;  4JI1 L;  5C5M A;  3S2D H;  2UXD Q;  1VQ7 A;  4A3L G;  1BR9 A;  4YHH L;  2K52 A;  3GTL B;  2F0M A;  2NWG A;  4X6A H;  4KHV A;  1LLR D;  1SMX A;  4DV6 L;  3S16 H;  4DAY A;  5K36 H;  1SE4 A;  3NEN A;  3CME A;  1A15 A;  3K5O A;  1C48 A;  4K2L A;  1ILQ A;  2VS1 A;  4FF2 A;  4JI6 Q;  3FHW A;  4DPG A;  4YY3 Q;  1RDP D;  3K7A H;  2JA8 H;  4UHV A;  1PHJ A;  3KLS A;  2NZO A;  4K14 A;  3GV6 A;  3MAQ A;  2C9O A;  4A3G H;  2K7V A;  5E4X A;  3HKS A;  4KN4 C;  3CCR A;  1Q90 A;  4KHP Q;  4NXN Q;  3B6Y A;  4NXM Q;  4DV2 Q;  4ILW A;  4WOR A;  1N34 L;  2RHS B;  1NMF A;  3J81 j;  4NP5 A;  1D6E C;  4F7X A;  3L0O A;  4JI4 Q;  2KHJ A;  1V1O A;  4ZYS A;  5EKK A;  3CQZ H;  4ULL A;  3RN2 A;  2CVR A;  1TT2 A;  1A3V A;  1RHP A;  1PV4 A;  4OX9 L;  3CHB D;  3CCU A;  3TRZ A;  4E6I A;  2E2I H;  1A63 A;  3HEJ A;  2OF1 A;  3SK5 A;  2XWJ B;  2R3Z A;  4YCU A;  1LTL A;  1VS0 A;  4A3M H;  1B44 D;  1OO9 B;  1E3P A;  1GVP A;  1OXT A;  3T16 A;  4BBR B;  3NEM A;  3HZX A;  2F0G A;  1J5E L;  4IN3 A;  3ITP A;  2B2V C;  4JI1 Q;  4LFA L;  4N9P A;  5ELF A;  2FIN B;  2XGT A;  4A93 B;  1FVI A;  1PH1 A;  1EY6 A;  4GNX C;  2K33 A;  1L0Y B;  2EJM A;  2F3V A;  3OYY A;  1G29 1;  3ULP A;  2PZT A;  5E7N A;  4JC0 A;  2DNE A;  5HGT A;  1A8V A;  1UNS A;  1W6J A;  1EWH A;  1X65 A;  3CPF A;  2Q2U A;  1PZK D;  1LO5 D;  2BH8 A;  3U4V A;  2HCI A;  5ELD A;  2E2I B;  2PO4 A;  1C8C A;  1I4H A;  3KBG A;  2ZT9 C;  3PUV A;  3BVZ A;  2IL8 A;  3HOV H;  2NN6 H;  1EQR A;  4A3F B;  5E4W C;  4PMW A;  2JA7 B;  1BO0 A;  3MWY W;  3NQT A;  4K5X A;  1HUN A;  1YNN D;  3I56 A;  4AYB B;  3ND8 A;  4EX5 A;  2JA6 G;  3I4N B;  1SSO A;  4YCW A;  4R8N A;  1XNQ Q;  4IUP A;  1AE2 A;  4LUZ A;  1X3F A;  4Q0F A;  2QKI C;  1QZG A;  1X54 A;  3BG3 A;  4NKL A;  4C3H B;  3CF5 A;  5CYU A;  3UDF A;  4LUV A;  3SK4 A;  1IYJ B;  2NZ1 D;  1Q8K A;  2LXK A;  5M3F G;  3RZO H;  5EPJ A;  4DAM A;  4A3B B;  3W2D A;  2AHO B;  2UUC L;  3GTM H;  4RGN A;  1BF4 A;  3HOW H;  4A3L H;  2R7Z G;  3A8J E;  1H9R A;  2TMP A;  2GVA A;  5I6W A;  1M4V A;  3I4M B;  1G6Z A;  1XNQ L;  3MXG A;  4QF4 A;  2K32 A;  2NVY H;  5J22 A;  1QWY A;  4KY6 A;  2R93 G;  2Z0S A;  4EQO A;  3TSS A;  3HRZ C;  2ZM6 Q;  3T1H Q;  3QR8 A;  1VQ4 A;  1SE2 A;  4ZQ3 A;  4DXG A;  4C3I B;  3LNN A;  4EQP A;  5HGQ A;  1WJJ A;  2YU9 H;  1H9K A;  2MP1 A;  4JOI C;  1K0S A;  1ESR A;  5J3B A;  2L1B A;  4DR7 L;  4R9W A;  4ZK9 B;  1KC8 C;  2LXJ A;  1K83 H;  1LT6 D;  1J9O A;  2XNA C;  3M3Y B;  3S17 B;  1BDO A;  1OTC A;  4HSV A;  1PFN A;  1O7Z A;  4K8J A;  2ZXR A;  4FDB A;  2A5H A;  2UXB L;  1PYW D;  1V1P A;  3CKI B;  4GN4 B;  3M7G A;  2E2J B;  4DUY L;  4DV3 Q;  2K5V A;  3JAM E;  3KF6 B;  2WIN B;  2VQE L;  4LF7 L;  4GLV B;  1VQ5 A;  1ENC A;  2GA4 B;  1QJO A; 
#chains in the Genus database with same CATH homology
 1QVF A;  4YY3 L;  2VY3 A;  3GD7 A;  5IP9 H;  2HHH Q;  2Z6K A;  1X9N A;  3GTP H;  4NPS A;  2N3S A;  1VQ6 A;  4YWL A;  1N33 L;  1NJI C;  1TWF H;  1PFS A;  3BZK A;  2PMZ E;  3UDX A;  4A3F H;  1YJ9 A;  1HZB A;  1PYS B;  2ATW A;  5C4X H;  2VQE Q;  3PF5 A;  3S1R H;  1PH8 A;  3CC7 A;  2I5H A;  3FP9 A;  1WCM G;  2AKW B;  3PUX A;  3MXN B;  4KLK A;  4OWX B;  1IBK L;  1M90 C;  4POF A;  1VCI A;  3HOZ H;  5C0X J;  4H02 A;  3KFU A;  1XMQ Q;  4OXP A;  4A3I G;  2AWN A;  5BR8 Q;  1JJC B;  3H0G H;  1YJN A;  2D0P A;  2RHQ B;  4A3E H;  5C3E G;  1Y1V G;  1J6Q A;  3STB C;  1N36 Q;  4MZ9 A;  2DUD A;  1U5K A;  5LMU L;  1I94 L;  2OTL A;  5M5W H;  3CCV A;  4NXN L;  1XMO L;  2D0O A;  4LF7 Q;  1E7Z A;  3AFP A;  1JJ2 A;  1HH2 P;  1R9T H;  4X65 Q;  4LF9 Q;  3M4Q A;  3NBH B;  2GVB A;  2ZTD A;  3BJU A;  4A3B H;  1PH9 A;  3HOW G;  1I50 H;  1WOC A;  3FKI G;  3F2B A;  4JBK A;  1C9O A;  1D7Q A;  3HOU H;  1EYG A;  2E5L Q;  3S1N H;  3EBE A;  1GM5 A;  1Q1B A;  2JA9 A;  2DGY A;  1L0W A;  1Z9F A;  1XNR Q;  1JJG A;  3TQY A;  4A3C G;  2I5L X;  3W1B A;  3A5U A;  4OWT B;  2PQA A;  1AH9 A;  1XMQ L;  3OW2 A;  1Q7Y C;  2A8V A;  2K50 A;  2Z6K C;  4YCV A;  2EXD A;  1Q81 C;  1HNZ L;  4BA2 I;  4LF4 Q;  1VQI A;  1VQJ A;  2R6G A;  2E5L L;  3KLW A;  3OTO L;  2AWO A;  1GO3 E;  1CKM A;  1S3O A;  4R4C A;  2UUA L;  4JI2 Q;  4DR1 L;  1EQQ A;  1J5E Q;  4P71 A;  1Q46 A;  4B3T L;  4JYA Q;  4BY1 H;  3Q8D A;  1N36 L;  4X62 Q;  3S2H H;  2MNA A;  1X6O A;  1YEZ A;  2QGQ A;  1FGU A;  5IYB G;  1K73 C;  4JI7 Q;  4A93 G;  1UWV A;  2OQK A;  3AFQ A;  4UPA A;  5AJ3 Q;  3OTO Q;  2NVT H;  1KD1 C;  3DM3 A;  3I4N G;  2WFW A;  3W5O A;  2R7F A;  3HOU G;  2UUA Q;  3PO3 H;  1QZH A;  1SN8 A;  1YHA A;  3CCS A;  2JA7 G;  1B8A A;  4BBS H;  4B3S L;  4GLX A;  1HNW L;  1VQB A;  3M4P A;  4LW1 A;  1L1O A;  2CQO A;  4LWC A;  4A75 A;  2HQL A;  1VQO A;  1Y1W G;  3E0E A;  3JC6 6;  2E2H H;  4LF6 L;  3I55 A;  3HOV G;  1VQP A;  1QUQ B;  3MEF A;  3U4Z A;  4B3M L;  2JA5 G;  1JE5 A;  4LUO A;  5GAD C;  2KEN A;  1KXL A;  1HNW Q;  4A3E G;  4LF5 L;  1WI5 A;  3VDY A;  3ULJ A;  1PH2 A;  3CPW A;  1VQL A;  4LF4 L;  3PUW A;  3SGI A;  4DK6 C;  2UU9 L;  2K5N A;  1TWG H;  3RLN A;  2B29 A;  4HJ8 A;  3A0J A;  3BZC A;  1VQ9 A;  1MKH A;  4PZ7 A;  4BA1 I;  3T1Y L;  1DGS A;  1U0L A;  3M85 A;  3H15 A;  4LF5 Q;  1CKN A;  5BR8 L;  1L1O C;  3ER0 A;  1KAW A;  2PI2 E;  1PA6 A;  5IP9 G;  5AJ3 L;  2IHE A;  1V43 A;  1KQS A;  1VQ5 A;  1L1O B;  1EWI A;  1HR0 Q;  2I5M X;  4JI8 Q;  2ID0 A;  2YTY A;  5LMU Q;  1HR0 W;  2CCZ A;  1HJP A;  1Y1W H;  4OO1 G;  3CAM A;  1KRS A;  1QVC A;  1V9P A;  3HOX G;  3G71 A;  3J81 c;  2GN5 A;  3A5Z B;  4DV5 Q;  4JI5 Q;  3PO3 G;  4DR4 L;  4X65 L;  4DUZ L;  4BBR H;  3A74 A;  2MO0 A;  4JG2 A;  4NB3 A;  4P74 A;  4JI0 L;  4BXX G;  1BVS A;  4A3G G;  3K7U C;  4GKK L;  1NBW A;  1BKB A;  2NVX H;  2JEA I;  2R7D A;  4OX9 Q;  5GAH C;  4JBM A;  4L5R C;  1C0A A;  5FLM G;  3U58 A;  3G48 A;  4A4I A;  3ULL A;  2WAQ E;  1CSQ A;  4IO9 A;  3S15 H;  2K4K A;  2OQ0 A;  1BBU A;  4DR4 Q;  1VQF A;  1Q82 C;  1VQ8 A;  4AIM A;  3PGZ A;  4TQU S;  1XPO A;  2JQO A;  4IPD A;  4O0A A;  2QEX A;  4DV1 Q;  4DAY B;  4L5T A;  4J15 A;  4C3H H;  1PYB A;  1KRT A;  5C0X I;  4DV0 L;  3GO5 A;  2Q2T A;  4JV5 L;  2E8G A;  4UP8 A;  5M5X H;  2XTI A;  3KDF B;  2VQF Q;  1PH3 A;  2A19 A;  4PZ6 A;  1RL2 A;  1PH6 A;  3ZJY C;  2JA5 H;  3F8T A;  3HOY G;  4DV2 L;  3M7N A;  1PH7 A;  2B63 G;  4DR6 Q;  4DKA C;  4DV1 L;  2KHI A;  3GDE A;  1CKO A;  4BBS G;  1QUQ A;  1N34 Q;  3CP0 A;  1IBM L;  2UUB L;  2OWO A;  3GTL H;  4B3R Q;  4DV4 L;  3AYH B;  2JEB I;  4GN5 A;  3HOX H;  3IRB A;  2A1A A;  3LGJ A;  2YYZ A;  4DUZ Q;  2KBN A;  4ALP A;  2B3G A;  4KI0 A;  3S17 H;  1OXU A;  3HKZ G;  1X55 A;  3KJO A;  1LYL A;  1MJC A;  1JMC A;  1WFQ A;  4IFD G;  3T1H L;  2VZA A;  2ZTE A;  1RIP A;  2MO1 A;  3H0G G;  4BY1 G;  4UP7 A;  4R4T A;  2QA4 A;  4DV0 Q;  4JV5 Q;  1Y1V H;  2Y0S E;  4GS3 A;  4B3M Q;  4JCV E;  1TWH H;  3I2Z A;  3I4O A;  5LMN W;  4L5S A;  1E1T A;  5JJK A;  4YHH Q;  3J80 i;  2IY5 B;  1Z47 A;  4GOP C;  5IWA Q;  1YIJ A;  1G6P A;  3S1M H;  1UE7 A;  3CCQ A;  4A3C H;  3CCE A;  3D0F A;  3G4S A;  4GNX A;  2KCM A;  4LFC Q;  4B3R L;  3KF8 B;  3AEV A;  2CWA A;  2CFM A;  5M3M G;  2D62 A;  3F1Z A;  2EQS A;  4HID A;  2IX0 A;  3JAM c;  3K0X A;  1K8G A;  2PI2 A;  3AQQ A;  3D31 A;  4DV4 Q;  3J7A 5;  5IYD H;  2WB1 G;  3GTK H;  4YWM A;  5LMN Q;  1OXS C;  2N78 A;  5IY0 A;  2N49 A;  3CXC A;  3TS0 A;  1YVC A;  4RG1 A;  1LUZ A;  2LSS A;  4AYB E;  4PZ8 A;  2JA6 H;  4GOP B;  4A3K H;  1CSP A;  4UY8 C;  4QL5 A;  4WJ3 M;  2CKZ B;  1X3E A;  2HIV A;  5FJ8 H;  4IOC A;  1BBW A;  5FLX c;  4AH6 A;  5C3E H;  4IOA A;  1TWC H;  4KHP L;  4HJA A;  2VUM H;  3UDG A;  4A76 A;  2OCE A;  4C3I H;  4JI3 L;  4IJL A;  1I6H H;  4JI7 L;  5IWA L;  1E24 A;  1LM0 A;  1MIU A;  1T9H A;  4IPG A;  4ME3 A;  5JEA J;  4X64 L;  1VQM A;  5ELN A;  3M4O H;  4GLA C;  4BY7 H;  3GTG H;  3H3V H;  1K3R A;  3HOY H;  2YTV A;  2F52 A;  1G51 A;  1KL9 A;  2PNH A;  3WWV A;  4EQ5 A;  5H1S E;  1ASZ A;  2UXD L;  4HJ7 A;  2VL6 A;  3E9H A;  3I7F A;  1I5F A;  1X56 A;  1W2B A;  4JI3 Q;  2H5X A;  3PSI A;  5IYC H;  4A3B G;  3RLO A;  1N8R C;  2ZTC A;  3PIP A;  4IPC A;  4WJ4 A;  2L15 A;  2JJQ A;  4C2M H;  1VQH A;  2FXQ A;  4JI6 L;  1SE8 A;  1VQD A;  1XNR L;  4QQB X;  3CC4 A;  1HZ9 A;  4AQY L;  3J7Z C;  1P8L A;  4A3J H;  4HJ5 A;  3DLL A;  3I4M G;  2RF4 A;  1YHB A;  4GOP A;  4A3K G;  2RCN A;  1HNZ Q;  1NMG A;  3CD6 A;  1TXY A;  2EIF A;  2WP8 J;  1Q86 C;  4HJ9 A;  2R92 G;  4JOI A;  5IYD G;  2HHH L;  1N32 Q;  2HT1 A;  2BA0 A;  4JI1 L;  3S2D H;  2UXD Q;  1VQ7 A;  1L2F A;  2BA1 A;  4A3L G;  1AE3 A;  2PQA B;  4YHH L;  2K52 A;  2VNU D;  4X6A H;  1XPR A;  5M3M H;  1GD7 A;  1UE5 A;  1UE1 A;  1SMX A;  4R1J A;  4DV6 L;  1E1O A;  3S16 H;  4R4O A;  4DV5 L;  3K81 C;  4A3D G;  1UEB A;  3NEN A;  2VUM G;  3CME A;  2YTX A;  4UP9 A;  2R93 H;  1N33 Q;  4LF6 Q;  5FLM H;  4GKJ Q;  2K5H A;  2VS1 A;  1XPU A;  4JI6 Q;  1IBL Q;  3FHW A;  4DPG A;  2HIX A;  4YY3 Q;  1IBK Q;  2JA8 H;  3K7A H;  1EIY B;  1PHJ A;  4K0K Q;  4BBR G;  4RMF A;  2NZO A;  2N8N A;  2Q2I A;  4A3G H;  4APV A;  1A62 A;  4LF8 Q;  2R7Z H;  1O7I A;  4DR2 Q;  1YJW A;  3UDI A;  4OWW B;  3HKS A;  1EOV A;  1VQA A;  3CCR A;  4KHP Q;  1XMO Q;  3B6Y A;  4NXM Q;  4DV2 Q;  4NXN Q;  4A3M G;  4DR6 L;  3K80 C;  1CKN B;  3EN2 A;  2F3I A;  3EIV A;  4LFA Q;  3PO2 G;  4LF8 L;  1N34 L;  2UUB Q;  2RHS B;  3G6E A;  1I94 Q;  1NMF A;  2JK8 A;  3J81 j;  4DV6 Q;  4HIK A;  4LNQ A;  3L0O A;  4JI4 Q;  1K8A C;  2KHJ A;  1W3S A;  5DLQ E;  1KIX A;  5M3F H;  4NXM L;  2Y0S G;  4IPH A;  3PIO A;  2NN6 I;  1YI2 A;  4JBJ A;  4QY7 A;  1Q1E A;  3CQZ H;  3TEH B;  2IT1 A;  3RN2 A;  1S40 A;  5K36 G;  3PCO B;  1IBL L;  1PV4 A;  1SLJ A;  4Y7N H;  1PH5 A;  4JI4 L;  3CCU A;  4OX9 L;  2K14 A;  4L5Q A;  3TRZ A;  5JJI A;  1NE3 A;  2E2I H;  2ALY B;  1A63 A;  3CMA A;  4BXX H;  4QIW E;  1EUJ A;  4QJF A;  2NN6 G;  4B3T Q;  2MQH A;  4A3M H;  4YCU A;  1LTL A;  1VS0 A;  4X66 L;  4DR2 L;  1YHQ A;  4X62 L;  1YZ6 A;  1TWA H;  3F2C A;  5M5Y H;  1E3P A;  1GVP A;  2V1C C;  1HR0 L;  1OXT A;  2IHF A;  2B63 H;  2F4V L;  4R4I A;  3NEM A;  4DR1 Q;  3KYH C;  4JI2 L;  4JI5 L;  4YWK A;  1J5E L;  1PH4 A;  2JA7 H;  2UXC L;  4LFA L;  4XTC S;  4JI1 Q;  4GNX B;  2XGT A;  3HFZ B;  4B3S Q;  4POG A;  1FVI A;  3L7Z C;  1PH1 A;  2ZJQ A;  1VQE A;  5HY6 A;  5C44 H;  4GNX C;  5LMN L;  3CCL A;  3I4N H;  3S14 H;  2CWP A;  4IJH A;  3OYY A;  3CCJ A;  1G29 1;  4P73 A;  3ULP A;  4LFB L;  3M9B A;  3T1Y Q;  4DR3 L;  3GTQ H;  5E7N A;  4JC0 A;  3CCM A;  2IX1 A;  3GTO H;  2ES2 A;  1A8V A;  4MNO A;  3NEL A;  5C4J H;  2AMC B;  3E9I A;  1X65 A;  1HZC A;  1HZA A;  3CPF A;  2Q2U A;  5C44 G;  2E2J H;  2BH8 A;  5GAG C;  3U4V A;  3FKI H;  4P72 A;  4DR3 Q;  3HKZ E;  1QVG A;  3PF4 A;  2I0Q A;  3J81 i;  3PUV A;  1IXR A;  4DR5 L;  3HOV H;  1JB7 A;  1NY4 A;  3BU2 A;  4X64 Q;  1FJG Q;  1EQR A;  5GAE C;  1X3G A;  5ELO A;  1H95 A;  2UU9 Q;  4PMW A;  1IL2 A;  2OTJ A;  3S24 A;  2UXB Q;  2K75 A;  3UE0 A;  1VQK A;  3PUZ A;  3L2P A;  4JI8 L;  1K0R A;  3KDF A;  3JAM i;  3I56 A;  1VQG A;  5EAY A;  4EX5 A;  4DR5 Q;  2JA6 G;  4A93 H;  2VW9 A;  2UXC Q;  4YCW A;  1IZ6 A;  4GN3 B;  5IP7 H;  1K9M C;  1HNX Q;  3H3V I;  1S72 A;  3ICE A;  1XNQ Q;  5GQO A;  4JYA L;  1AE2 A;  4LUZ A;  4OON A;  1X3F A;  1NTG A;  1SRU A;  3STB D;  1JT8 A;  1SRO A;  2ZJR A;  1QZG A;  1X54 A;  3RR5 A;  1OXV A;  1VQN A;  3CF5 A;  2WB1 E;  1VQC A;  2C35 B;  4KHZ A;  3W1G A;  1EFW A;  3UDF A;  4XIG S;  3RN5 A;  4LUV A;  2NZH A;  1IYJ B;  5M3F G;  1Q8K A;  2LXK A;  3RZO H;  4DAM A;  2AHO B;  2UUC L;  1FJG L;  3GTM H;  1D8L A;  2Q2H A;  3PV0 A;  5IT9 c;  3PO2 H;  4PG3 A;  2MFI A;  3HOW H;  4A3L H;  2R7Z G;  4HIM A;  2KCT A;  3KJP A;  3PUY A;  2GVA A;  4HIO A;  3K8A A;  4DK3 C;  1P16 A;  1XTD A;  1ASY A;  3UE1 A;  3M3Y H;  1UE6 A;  4X66 Q;  5IYB H;  3RNU A;  1XNQ L;  4IFD J;  4A3J G;  3TRE A;  4LF9 L;  2F4V Q;  2NVY H;  4DV7 L;  2R93 G;  3RZD H;  3GTJ H;  2Z0S A;  3ERS X;  4OO1 I;  1HNX L;  1YNX A;  2YV5 A;  1IBM Q;  5GRO A;  2JA8 G;  2ZM6 Q;  1KHI A;  4A3D H;  3HOZ G;  3CC2 A;  4MTN A;  3T1H Q;  4A3I H;  1VQ4 A;  1YIT A;  3S1Q H;  3TS2 A;  4R4Q A;  2UUC Q;  1CUK A;  4K0K L;  5IYC G;  1YBY A;  5HGQ A;  1WJJ A;  3F2D A;  4DUY Q;  5JEA G;  4DV3 L;  1WCM H;  4A3F G;  1Q12 A;  2YU9 H;  1B70 B;  5JJL A;  4JOI C;  4JI0 Q;  5C4X G;  5J3B A;  1XJV A;  1B7Y B;  4DR7 L;  2ASB A;  4IFD I;  4BY7 G;  4AQY Q;  2BH2 A;  3U50 C;  2R92 H;  1KC8 C;  1WYD A;  2LXJ A;  1K83 H;  1SFO H;  4Y52 H;  4LFC L;  5C0X G;  4DNI A;  3RLF A;  4GKK Q;  4JBW A;  3KF6 A;  3I4M H;  4DV7 Q;  1OTC A;  1Y14 B;  1OXX K;  1C7Y A;  1PVO A;  4DR7 Q;  4O2D A;  3J80 c;  4AYB G;  1N32 L;  5FJ8 G;  1A0I A;  2WAQ G;  5IP7 G;  4LFB Q;  1E22 A;  4FDB A;  4TVA B;  2UXB L;  2JE6 I;  1FL0 A;  4P75 A;  4C3J H;  1N9W A;  2VQF L;  1MJE A;  4QGU A;  1SR3 A;  1EIF A;  4GN4 B;  3CW2 C;  1I3Q H;  3KOJ A;  2ZJP A;  4DUY L;  1V1Q A;  2K5V A;  4DV3 Q;  2ZM6 L;  3KF6 B;  2NVQ H;  4LF7 L;  2VQE L;  4GLV B;  4GKJ L;  5IE8 A;  1GKH A;  1M1K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...