2K78A

Solution structure of the isdc neat domain bound to zinc protoporphyrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
126
structure length
126
Chain Sequence
SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein C
publication title The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.
pubmed doi rcsb
source organism Staphylococcus aureus (strain mw2)
molecule tags Heme-binding protein
total genus 12
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2k78A00
4MYPA 2ITEA 5D1QE 2Z6FA 3SZ6A 4FC3E 5D1ZI 4H8QA 2K78A 2Q7AA 3OVUB 4H8PA 3QUHA 3RTLA 2MOQA 3QZLA 3QZPA 4WJG3 3SIKA 2O1AA 2O6PA 3VUAA 3QZNA 2ITFA 3VTMA 2E7DA 3QZOA 4YMPA 3S48A 3QZMA 5D1XE 4NLAA 2H3KA 3RURA 3SZKC 3QUGA
chains in the Genus database with same CATH superfamily
3V6FA 5GGSA 5CAYB 4ZMTA 1VFBA 2MNWA 4LDCA 4U1HB 3BVUA 3I6GA 2DV6A 1L9TA 4LFHG 5B1CA 1HC1A 4QPEA 4YHMH 4AVJA 2WXGA 1NAKL 4IRJB 5T1LD 4DK3A 5B8CC 5JXED 2R69L 5J0BA 2AQTA 3O3EA 3CVHA 5E9NA 3P73B 3T0EB 3GBLA 1YN7A 2AZUA 1JAEA 2JCWA 1Y6KR 3VFPB 2R39A 1QNZL 2WXFA 3K8LA 4POUB 3L4VA 1I3RB 5IMLB 3ARRA 1R5VA 3SJVE 4MFHA 2NY0D 2CGRH 2XFXA 2YGOA 1ZTXL 1GPOL 5SWZD 4HK3J 2GW5A 4Z0BH 5A6MA 5D5ME 5AWNL 4QRPA 2FVNA 3SDXA 1HU8A 1IAIH 2ZJSH 4RWYL 2A6JB 4HEME 5KSAB 4JDZB 1HZLA 1F4YL 5C0JA 5CCKH 1H3TA 1QFUH 3S8WA 3CLEH 1I3GH 4X9GA 4XTRD 4J7RA 3U1SL 2XTJC 2OCJA 1MFMA 1MHPL 4MB3A 4U7MA 4TOYH 4WI0A 4HKBA 4J5VA 4HUXB 1SMDA 4B53A 2HT4C 1NGWB 3GBML 3W11C 3TESA 3MUZ1 2DJMA 2FWOB 3VRJB 2WVSA 4LL9A 1YC8A 4FFWC 4WKZB 3V0HA 3CN4A 3EXLA 4ZNEA 4FYSA 2Y36H 1I7ZA 5B39A 2WLIA 2EDLA 1SYSB 4J28A 2QVTA 1I8KB 1EK3A 3SE9H 1Q72H 1AOHA 4YHNB 2NQDA 3MHZA 4FOMA 4EI5C 4PJDA 2D3VA 4YSDA 3HFML 4APXB 2PPAA 1PDKB 1KDIA 4HLJA 1RZ7H 1AGDA 4HPYL 4UT9A 3L3GA 5DVOA 1QSEA 3NJIA 4XPHL 5DS1A 1IX2A 1OOWA 4YR6B 1IGYB 2DOCA 2VW4A 2GCYA 2UZYA 4HSCX 1NUDA 1JD9A 4HUCA 2GPZA 2OMUB 4PMFA 1FLRL 2AEQH 3T77A 5D2LA 2H7WA 3C87A 2VDPL 5DD3L 2WKGA 2ZKWA 5DSCA 4TNWK 5KUKA 1OAUH 4NO2B 1EFXB 3QI9A 4U6HB 1P1ZB 4DOHB 2Y6SD 2RJMA 4ZXBC 2A77L 4YVNA 1Q94B 1CYGA 1VACA 2H5UA 1KDJA 3HKZA 2YAPA 5GSVB 3TJHC 2O6CA 1YSOA 3JWDC 3GMRA 5D1XB 1AR2A 4A04A 2VN3A 3FW6A 4TUJA 2ARWA 5JPNC 2Q87A 3EOTL 3UGXA 4UQ2A 1S9VB 1EEUA 1PD0A 1RJZA 2EYSB 3GXDA 1LO4L 5B38A 3IB4A 4X4YA 1EZLA 2NNAB 1G7JA 4UNIA 4QJ4B 1J8KA 2O6EA 3CDGB 3TYFB 1AQMA 5DR5L 2GT9B 4G9FD 3C5ZC 4FULA 1J12A 5EIQA 2E7DA 3L5XH 3UAEA 4FGMA 2BRRL 1U93A 4AENB 2AABL 1QFWH 4JFXB 4DH2A 2FIRT 1MWOA 4WHYG 1TSRA 2H4EA 3CFCL 3SQBA 2B3RA 4AYGA 1XD1A 2AI0H 3Q7JA 3RVXC 3MMEB 3A0OA 3VXSA 1FHGA 3SO3B 2IGLA 4M43H 4Y2LA 2XQYK 3CZJA 3OGCB 5J11B 4R2GD 3ETBJ 1R3JB 3CBJB 3NSYA 1BAFL 3UIYA 4PJ7E 3IDGA 1BG9A 3VXPA 4YBQD 3MOBH 5J57B 4MS8D 1EGJA 1CDUA 3UZEA 3QDJE 1S7TA 2WK2A 3FQUA 2ZYRA 2Z35A 3GXFA 5K9JH 1U91B 1NAMH 1NIDA 4H8VA 4IJ3C 3UTOA 3ARSA 1X5ZA 4HH9B 5KAQF 1DFBL 2F8XC 1ZLEA 5EOTA 2EICA 2QKIC 4FZEH 1MFAH 1AD9B 2GBTA 3FQYA 5IHBA 3NJVA 1ZLUK 2GTZB 5DD0L 3QQ3B 3TIEA 3G6JA 2BIOA 2YK1H 3OQ3B 1MI5D 1LE9B 3GMNB 3ILQC 4KVNL 3U6RB 3ZKMD 1T89A 3EDDA 4WNQB 4JFWA 4XZUA 3U7AA 4KFMA 1A4KA 1QSFE 5T1JA 2J43A 5IMMB 5MHSD 3BD4A 4JO1L 1T20B 2CE6A 5SWSB 4AYID 4KVCL 5BOJA 5ESVB 1MRFL 4M8QA 3QIUD 5F7LB 4CILA 5DS8B 4ZMLA 3UTPD 3VNZA 5CD3B 4HJ0D 3JVFC 1D5IH 1NMAH 5CIPB 1HDMB 3GTVA 3FSVA 3TN0D 3TWYA 1FQ9C 4GY4A 4QRRA 3JYBA 3MRDB 3S36L 2LR4A 1YMMA 1FNHA 4QHNB 3IBEA 3MZTA 4D94A 5KG9A 5ELIA 4I88A 5DJCA 5GJTH 1W91A 2ZCZA 4JFPB 5I8EA 5DA0B 4A55A 2ZUQB 4M5SA 1JDDA 2ZE0A 1EERB 4N25A 4UZSA 5ISZA 4UIKL 3WKQA 3FNKA 3I85A 3KJ4C 3BZ4A 1UCBH 2HLEB 5C7ZA 3SY6A 5GGVH 2VXTL 1ES0B 2IXQB 2Q86B 4IIQC 1I9RL 2AF2A 2H26A 3K6SA 1O6SA 5E70A 4KJWC 1C9SA 3UC0L 5IY5B 1X9QA 3BPCA 2BMKA 1LWJA 4B27A 2P5PA 3EYFA 3GKWL 4CC4C 3ZRCC 1OALA 2UX6A 3GLAA 3BN9C 4GB9A 1G7LB 1XZWA 1J0HA 3WD5H 4KX7A 2JJSA 4C56E 3OSVA 3EH1A 3ZE2F 1TQWA 3ZK0A 4JKPH 1JHLL 4UDTB 4LLDA 3UFIA 7PAZA 4K3EH 5K59F 3ULUF 1L6ZA 4KTEH 5KVFH 4A2GA 4DN3L 4R8WH 4FHBD 3TXAA 3QYMA 2E6QA 4QLRA 2F08A 2DKSA 4LCCC 2NPLX 4KI5D 3RAJL 3D8MA 4X80L 3ZL4L 3AU1B 3QBTB 3MODL 3ZZ1A 4MQ7A 3BFWA 3VUAA 3V9EA 5BV7H 5IEHA 3MRLB 1MCIA 2JSFA 4FNRA 4DW2L 2ZCLH 3HE7A 5DK2A 4M29A 1NCNA 5LUMA 3PPEA 1DFXA 5IK3B 4A2MA 7CGTA 1MJ8L 1EJOH 5EULV 1A5FH 1HE8A 4PJHB 2V8MA 4JN1L 4ZAKC 3C08L 3V0WL 3BEWA 3U7YL 4OJEH 5TE4L 1FGNH 2GAZA 1Z7JA 5I76B 1XF5A 4KAQH 1AGFA 1NGXB 3MCLL 5CBAB 4MMXB 2YRPA 1G94A 4HU2A 4CNIB 2GJZB 3PY9A 4BFRA 4KRLB 3HRZA 1B0WA 1WV7T 2BIPA 5KSUA 1CTNA 4YHML 4Q6IB 5MENB 2QQKH 4I13B 4U1KB 1BOGA 2GBVA 2ZX8A 5SX5H 5HGGS 5CINH 2XWDA 3WNPA 1Q9WA 1CQKA 5FYLD 5T3XE 4JBSA 3T3MF 5C9KA 3C8HA 5JA8B 1KELH 4O02H 1XSJA 3N85H 1OF0A 4OIBA 4OM1L 3QZWG 1BIIB 2TRYA 2N0MA 3ZDWA 3DC0A 3HBQA 1VRSA 2MHAA 2MRYA 2CGRL 3I75A 1H19A 2EUVA 3EYVA 5GHWL 1A2YA 2PP7A 4DAGH 2XZQH 3PG2A 2NUPA 4X7FC 3RTQB 3NQKA 3WNJA 3WNKA 1CR9H 3ROOA 3G6DH 3P3TA 1IAIL 2D4DA 4QDGA 5JHLA 5CN2A 2ZJSL 4WI2A 5DMKB 1E5AA 3RWIA 1LE5A 4PMEA 2BM3A 3JTTA 1T04B 2CIIA 5CCKL 1QFUL 4RMUA 4D0DA 1I3GL 3MA7A 1OWRM 1RV6X 4Q9BA 1D5MA 3S5YA 5KS9B 4TOYL 4JFYA 3HMXH 4PRHB 2FIKA 2FHCA 4L4VE 1J8HB 4L48A 5AW6B 3GMQB 5I2IB 1NCTA 1A7NH 4LCWA 1ACZA 2BSSA 4X4MA 2HX9A 3LXBA 3A67H 3V4PA 1DE4B 1GS7A 2P5WB 1A4AA 3RFRA 1H5BB 5CO1A 5D96C 4BSVB 1N8ZB 2E9GA 2VAAB 5B22A 2PLTA 2ZX7A 4H25B 4RMBA 4TNGA 3WUWB 3V5HA 1A1OA 5DWUL 5AYUL 5INDA 3SE9L 1Q72L 4IOIA 3MBEC 4URTB 3ZKXB 2VDML 1FIEA 3O0RL 5E1GA 2EZ0C 2X4RA 3TO4A 1MWAA 1UXSA 1E27B 2MOVA 1CLCA 2ZQKA 3FTZA 4QRSB 5IOPB 3FQ2A 4IU3B 1RZ7L 4IKKA 1FNEA 4X7TA 4BKTC 3DXAE 4DEUA 5BRZB 1OGTB 4GG6B 5LDSA 1BQLH 4Z7AA 4Y4HC 3PPSA 5J06A 4RGNB 1DVFA 1E8YA 1SN5A 4FNLH 1AIFA 1ETZA 4G8GD 4UOW1 3SE4A 5DJ6B 3TBVA 4M48L 4L9LA 5L7XL 1ESOA 3TPUB 1ACXA 3RFZA 1S7QB 1BBJB 3BVXA 3VAEA 3RY6C 2BCMA 4AVKA 2WXPA 4JRYE 4DGUA 4JKMA 4ZW5A 1HEJC 3L3KA 1VSCA 2CDFA 4WTWA 4Y1AE 2ZXQA 2ZSWB 4OVVA 4XXCC 4U1SB 2CLVB 3LNGA 2YA0A 3X12B 4K7PH 4M9OA 5CJBA 3LHAA 3TEYA 3NJNA 3UTSB 1FFQA 1WAPA 2WVTA 2GSGA 4XPAH 4AM0B 4P3DB 3D69A 4N0YH 1BZ9A 4OZIE 3G3LA 4TTDC 3TNNA 3MDJA 1OV8A 5FB8A 3LS4H 4L8BB 1YY8B 3TGXA 1QTSA 3WJJC 1CE6B 1FAIH 3EFDH 2X05A 3G5XA 3EZ8A 2A2QT 5C0ND 4CC1A 4PQXA 3L5XL 4JRFA 4NAQA 2IQ9H 4P4RB 4J23A 3TZVB 7FABH 1QFWL 3FT1A 4N2CA 1N6QL 2CNZA 2LLNA 3MRNB 5TPWL 4ELKA 5DO8A 3FCSA 3GSWB 2AI0L 5CU5A 1IEAB 3S97C 2XV2A 1FORH 1ZVYA 2VUKA 1R3LB 1PCSA 3PL6C 4JFFA 4M43L 5HDBB 5HTSA 3TBWA 5JLZB 1VDGA 3RZCB 4OU3A 3KR3H 4KKLC 2HRPH 1SM3H 1XGUA 4M93C 2Q9OA 3QRGH 4QTIH 5EG6C 1SMAA 3Q5TA 4N4YB 4DO4A 3NFPB 3MOBL 1VFAA 2DMGA 4MA3A 1EAPB 1E8ZA 4IGBB 4PTUB 4FQLH 1OTTD 4XVSH 4HBQA 5DQ9B 1DCEA 2HTLD 4CMHB 4NQXB 1JS4A 2ENJA 3LZRA 5K9JL 3MRIA 1NAML 5HJ3A 4GYBA 5HHPB 1TCMA 2GSIB 3UBFA 3HN5A 1FSKC 1DVUA 1EV2E 1ET8A 1Y7VA 4FZEL 1MFAL 1TYRA 4JJ5B 4GAFB 3S35H 4F8QA 4D0CA 4RETB 5HHOD 4AH2B 3IJSB 4JHBA 4X2UA 3LXAA 5E23A 3M45A 3UTTD 1R24A 3FH8A 4L3CB 3RJOA 5K1NA 1VHPA 4HGMA 4PV1C 3ESUF 3B1TA 5E94B 1XTMA 3UAJD 1SBSL 3ARTA 4UU9A 1K2DB 4HIJA 4N87A 1E5YA 2IOIA 2VMEA 2YA1A 1WIPA 4Y2DA 3UYPA 3VI3F 3PRZA 4MXQC 1CTOA 2FDBP 3D4ZA 3IGUA 5ETUB 5KBLA 2XA3A 4PWFA 8PAZA 2CK0H 2D7NA 1NMAL 2DEWX 4GKOA 4NYLA 3VU2A 3ZY7A 3KLKA 1E4XI 1ZV2A 1RFDL 3RPKA 2BOBB 2Y7QA 4JGUA 4Z7VF 3K72B 3FQWA 1P84K 3KL0A 5GJTL 1G6VK 1HSAA 3U4EA 2J21A 5IFHH 1UM4L 4ZMVA 4HKJB 3VCLA 1HHGB 2RTTA 3EDEA 4TKWA 8FABB 3S0PA 3WHXA 3NK3A 5FUZL 5IOKA 1W72B 2ZPKH 1NSNH 1UCBL 5G55A 1F0LA 1FFPB 5GGVL 5CFAA 2DQFB 1MXDA 1BXXA 1LD9B 3C8KA 1KXVA 1NOLA 4BUGA 4A1RA 1LNUA 1I1FB 1JN6A 2YMOA 4WFGD 4HPHA 2AJSL 3A5VA 3Q13A 3EF4A 5DD5H 4HIHA 4PJ5D 1NBQA 1F11A 2NY2C 3DNKA 4XXDA 2ZOLB 4NNYB 1JWSA 3FU0A 3KXFB 2LLLA 3WD5L 4JVPA 3L3OC 1T66D 3LKOA 3IDMB 4LSPH 4BFKA 5I71B 2BY2A 3SGJC 1UQSA 3QDGD 2BIMA 4JKPL 2K4AA 4QOKA 3INUH 5DRXB 5ESAB 3GD1C 5A2KH 2GHZA 3P0YH 4KTEL 4LKCA 4WNJA 5KVFL 4R8WL 1I8AA 3EG9B 4PJAA 2O6PA 4UMGA 2ZWZA 2VXUH 3ILDA 2N1TE 3WY4A 1L7IH 1CS6A 1W6WA 3JWNH 1BD2A 5EO0B 1J9TA 5E9DD 1NDGA 1CICD 1X4XA 4J3SA 3CN2A 4WU5A 3FKUS 3DPBA 5I18H 4I3RH 5BV7L 1QUNA 3IFPB 2GJJA 2WZAA 1VFMA 5GS2H 4WSGA 2IIJA 4I5BB 2ZCLL 2G4EA 5F72S 3P3UA 2ATAA 4HUWB 3QJXA 1XGTB 1EJOL 5ABZA 3EO0A 3TBSA 2P42B 3FQTB 1A5FL 4ZK8A 1FL5B 2O6DA 4K7PX 1S9XB 4KJYA 1D2PA 3WO4C 1V7NH 1WBYB 1BECA 1FGNL 5K59E 3ULUE 1FYTD 3LNEA 3U9PH 4YGVA 3NEEA 2D2CC 3LJ3A 2ZUSA 5AVRB 4KAQL 3WEBA 5F7KC 3VXUD 5F8RC 5DFTA 3ARGB 4QHUA 4EI5B 4TSAH 3G08A 3LQMA 1FZJB 2X4PA 1PLGL 4MD4B 4NM8H 2QQKL 2EEBA 5F7UA 1YECH 3QUMA 3O6FD 5CINL 1TEFA 1CCZA 4QR7A 4K2UL 5T1KD 3DK0A 3CIAA 4PVNA 1NC2D 2OPCA 3GJFA 1KELL 4O02L 3N85L 2P3YA 5IFAL 4FYQA 1R5WB 2A6IB 3MV9A 4PJBA 1D5XA 1M7DB 3KGTA 3EBAA 4QTHB 3MYZA 3APNA 4P2RB 5AENA 3RNKA 1RULH 5MEPA 4FQXA 4YX2H 4HIEB 2XWBA 1K3IA 4P9HC 4DAGL 3UZQB 3LVTA 3O4OB 2V37A 1CR9L 1UACL 3G6DL 4GRWE 4DNLA 3KPPB 4OKVB 4OZFB 4WNSA 2WQUA 5C0BB 3L6FA 2Y07H 3S35X 3LPGA 4WI9A 1GCFA 1QLRB 4WV1A 3WFHA 1UJ3A 3O3DA 1OVZA 1H6UA 1RJCA 3FRPB 3TL5A 5M7QA 1COBA 5DMJB 1I1AD 3T3ME 5F3BA 1UG9A 1A7NL 1ZT4A 1A3ZA 1RURH 3C5ZB 1T7YA 2ZD0A 4OLZH 4WW1B 5JORA 3LRSA 2EDDA 3QR1A 1QATA 3ZSTA 2HFEA 5IW3A 3CTTA 1YDPB 2WLMA 1AC6A 3X3FL 3D0LA 3PJSA 4MB5A 4AXWB 2VJ8A 3CUPA 1BZ7B 1XL4A 4NQDD 2W94A 4GW1A 2H6PB 5I19L 1DJZA 4C83A 5I5JA 1G7PB 3X17A 3QI9C 3QNXA 3ZO9A 4BH8A 1BQLL 2OL3B 1IAOA 3FPXA 3GHBH 3ML8A 3SKOA 5D1ZB 3F85A 5HYFA 5KBKA 4OLUH 2CUIA 4KZDH 3VFVA 1ZGLA 3A4DA 2QR0A 4GW4B 3DX4A 2CCVA 1QKZH 2I07A 4PGEB 5D9SA 2QKIB 2YWZA 4OH2A 2FH8A 4JREB 4MA7H 3UABA 1VFOA 4N2OA 4P4KA 4UANA 3CDZB 5IB4B 3MQIA 4NJ9H 4F2ME 3IDIA 4K7PL 4CVUA 5FUOL 4XPAL 3QDMA 3IMTA 3LQAL 4J1UA 1FNGA 4N0YL 1I8LA 1RMFH 2ADIB 3GMOB 4DETA 3LAFA 3T4YB 4TQEL 3PWPA 3LS4L 4ZYKB 2WPGA 2WXHA 3MLWH 4YBLC 4KHXH 4M1CC 3EFDL 4AQ8A 2VZ1A 5LNDA 1BVKA 4Y89A 2IQ9L 1FBIH 5BQDA 2ORBH 1SEQH 3DUUB 1UA7A 4A68A 1A65A 2XI9A 4QEGA 2JIXB 4P2YA 3TOPA 3HNTH 1NTDA 5I23A 3MV7E 2PO6B 4EN3D 4RFEB 5T3XH 5EC1B 4OF0A 2PW2B 2C9RA 3NH7H 3HG2A 1SN0A 2VE6B 5ANMA 1GC1C 3KR3L 4BCXA 2HRPL 4BH7A 1SM3L 2DWEA 4Z7UA 3UZEC 5LGKA 3GF8A 3W9DA 4XO8A 3QRGL 4QTIL 5LAPA 3W39A 2BVYA 5CJXA 1NLDH 3E1F1 2DZEA 4P23A 1E5ZA 1OSPH 4XWGH 4GRMA 4E41D 1BF2A 3DURB 4KO5A 3KPSE 5BUAA 2LAAA 4WZ9A 1T4WA 3LN4B 2D0HA 3SPVB 4FQCL 1HEZB 1VADB 3FN3A 3HZKA 5AAMA 4EUPH 1AO7A 2RIKA 3KYKH 3MR9B 2FJHA 2X2HA 1JZGA 4AIEA 1NCGA 1ACYL 1QVOB 1YY9C 3LZQA 2D7PA 5T1DL 4AKOA 4KV5F 4DP1X 5EORH 2BLFA 1BWWA 1LEGB 1CL7H 1T89C 1A4BA 3WIHH 1JVLA 1W0WA 2OJ1A 3F6IA 1NCAH 2Y9RT 4PEEA 4ZFOB 5C0RH 3PABA 4LDOB 1MRCH 5JW4M 1P9MA 4XBPA 2APXA 2AQPA 3T4AB 2XBZA 3BW9A 5DZAA 3VXRB 3NOIA 3DO3A 4Z8FL 4XOBA 5I0VA 3CSTA 4HA1A 5E9AA 1TETL 1ANUA 2A7BA 3Q8FA 3ZTCC 3JV6B 3EYSH 4ZI8A 5I73C 2CK0L 4EVNA 2CBMA 4CBPA 2ENYA 1WJ3A 2MWCA 1ND0A 1JRHH 2VMDA 3MOAH 1LEKB 5DU7A 4R3SA 32C2A 2AQ2A 4GSXA 3RVTD 4L3EB 2J8UE 2EINB 2X9XA 5J12B 5E8DH 3QUYD 4CSSA 3FRUA 5BPPA 2VQ1B 2ADYA 5IFHL 4MRBA 3J2PA 5IJVA 1FNLA 1ZE3C 2GG1A 4PW4A 2VKWA 4AGNA 4AVIA 2BJML 2ZPKL 1NSNL 3QARA 5F6HI 2XXFA 1NANI 2O4EA 3D2UA 3RWGA 2ICCA 1QRNE 4Q2ZB 5EF2A 1ZT7B 1E5UI 2YS4A 3ATDA 4E0RB 5IB5B 2TAAA 3OGOE 2JJSC 4MSWB 3GUTA 3VI3E 1UCTA 2VYRE 2GTWA 2P4AB 3IMVA 5DD5L 2VUYA 4DPRA 2AV7A 4ATTA 3GNMH 4LL4A 3OVUB 4ABWA 1AS8A 4XO3A 4UNVA 3TFKD 4WQOA 5DEGA 1I7TB 4GUOA 3DX6B 1AMXA 1MVUB 1QLEH 4HDIB 3MRBB 2NXYD 4LPCA 3JV5A 4N6RA 4Z7QB 5AVWB 2MQCA 3SY0B 2C34A 4H1LB 2YPLB 3HI1A 1KJVA 2MPVA 4JM2F 3SQOL 3HZMB 4Z7VE 1IM9A 4FKEA 5CEZH 3INUL 3CCHB 3P0YL 1CG9B 3VSTA 2VLKA 4TVPE 2LTQC 1U58B 3J7HA 3GK8H 5C09B 1L7IL 2WC7A 1U8LA 3ARDB 3UYRH 1QHOA 3HE7C 4FG2A 5F1IA 3EYOB 5D7LD 4YZFF 4U3HA 2BOCA 4OLXH 4PLJD 5I18L 2PABA 4I3RL 5JYMA 1M2OA 4XOCA 4S0TD 1FNFA 5EN2A 3C75A 5F7EH 1G9NH 4RBPK 3KM2A 5DXWA 2BW4A 2WUBH 2ODHA 1NIBA 4AQ1A 2WZPA 1GSMA 2VC2H 1JV5A 3FSOA 4U31A 4LZKA 2ZNXA 4JL1A 1KJ2A 1V7NL 1KJMB 4JB9H 3FQ1A 5A2LH 3U9PL 5IWLA 3HG0A 3OZ9H 4HZLA 3H9SE 4AK1A 2C9UA 4IBZA 3WBDA 4KTGA 5TDOB 1S7RA 2V5MA 3D3VB 4NO0D 4QAWA 3HG1A 4AQAA 3T2PA 2Z91B 3D1MC 3QDJD 4TSAL 2KQMA 2YPVH 4NUJB 1E8WA 2JKIS 4PJXB 1IQDA 4NM8L 4FA8A 2PYFA 4PJGA 5FX3A 4ENEC 1YECL 3DI3B 3GXTA 2XX0A 4Y4HB 3GRWA 1QHQA 2ICES 1OB1B 4G80B 5EUKB 3NVQA 4FHJA 1N3NB 4EZJA 5GGUA 1E9OA 1TTUA 2QMJA 4NUPA 4URKA 5FLVA 2DM3A 2JLPA 1FHNA 4ODSH 1RULL 4PRNB 3SBPA 5KAQG 2CAKA 4ODWA 1T4KB 1L4IA 3OR6A 2Y23A 5KSBE 3MJ8A 1RK1B 1EEYB 1QSFD 4KMTH 3LOWA 1ZD6A 3LEXA 1WYJA 4JPQA 3HLAA 2WLZA 4KROC 4FLQA 4OGZA 4PPTA 1IIIA 4DVBA 4PBVC 2F54A 2WWNA 2W9EH 5MEQA 5JW4R 1U30A 3S5LB 4OIAA 4ODTL 2ZG1A 4QIRA 2ETWA 4RRPG 4LVNC 1G43A 1B6DA 4O4YL 3O6KH 3ATAA 4N8CH 1SDAB 3N0AA 1RURL 1TQUA 4OLZL 5DFWH 1UB6B 1A6ZB 3FBKA 3G6AA 1S5HB 4MD0A 1BJ8A 2BS71 3FT2B 3RPIA 4V1DE 3KPQB 5E5MA 4AYBA 4FFZA 2YQ2A 4JFTA 4UTBH 4KO7A 3ZE0B 1JDAA 4CA4A 3SD2A 1BM3H 2OTUA 3QO0B 2P5ED 3G9AB 1N67A 4ONOA 1IBDA 2ENSA 2B59A 5ACZA 3DROA 3QG7H 1DVFC 1D9KD 2FLMA 3SE4C 4L9LC 3V9CA 3RFZC 1QO3A 1X5GA 3PNWA 4WWID 4KKBD 4A6YH 2JJVA 4L4TD 1HHJB 3RB5A 3DDGA 3GHBL 4PJ9D 2BY3A 4C56D 4I3SH 1PZ5B 2E59A 2OR7A 2BNRA 4MB4A 4OLUL 2XN2A 3US0A 4XMPH 4KZDL 2VO5A 5C0AA 4JFEB 1N5YH 1A4JB 3V5KA 1QKZL 4OGYH 5A2JH 4MA7L 3RWDA 3LVEA 2R9HC 3SDAB 1Z2KA 4OQTH 1OF2B 3S3BB 4GNKB 3RHWF 2X4OB 3L3JA 5EZOL 2CO6A 2PN5A 5EOQH 2D73A 3ASNB 5CZRA 4DZ8B 1JK8B 3RHWK 4UTAH 2Z93B 2DEXX 3FT4B 3MUUA 4L5FE 3T0EE 3TT3H 3QH3A 3KS0H 2WSDA 4MKMA 4A67A 3EXJA 1OAXH 5C1MB 5B1JA 2FJGA 4I0PB 4P57B 3MLWL 4AGQA 1UKSA 4B9GA 4PJEA 3VXNB 4C47A 4LBAA 4Q14A 1FBIL 4R7DB 1SEQL 3ZL2A 5JIMA 3IF1B 1CGYA 2P8PA 3HNTL 5E8NA 1D7CA 2AJYH 2VN4A 5C9JA 4FQIH 3RGVC 4JAMA 2DL2A 5DHYA 3NH7L 4HGWA 4PGCA 2ZKMX 4LESA 4PY8I 5IKCB 3QWOB 3QIBB 1JV2B 3GXIA 3ZKNC 2UVFA 2XPGA 4PGZA 2OQJA 1GSKA 3MV8A 2CR3A 1NLDL 3V0FA 4XWGL 2PXYA 3MTRA 3BIKA 1NBYA 1P2CB 4NBXB 5D7SL 1GZHA 5TDPA 4ORGA 4B9KC 3U0TB 2C3VA 3T1FB 4LSDA 2GI0A 3Q0HA 4LCVA 4OJCA 1HHIA 3VD5A 4ZUVA 4AT6A 4LF3B 3VWJB 4OZHF 5IIEA 5EU6B 5DJ2B 1PS3A 3DSFL 3KYKL 4Q56A 1GH7A 1R3KB 2NY2B 4R6UA 3FCBA 3T8XB 4ALAC 1RZFH 6FABH 4GO8A 3OX8A 1GRWA 3LDBC 5EORL 2XIBA 5DVLA 1XMWA 1CL7L 4S11A 3WIHL 4BFOA 4MNGA 4LGRB 1NCAL 4ZFFA 5C0RL 5IW6A 3TCTA 1MRCL 4Z7WF 4LPTA 1AGEB 1PL3A 3HC0A 4TUOB 1KBGH 3RGBA 3HAEA 4K07A 1KIPB 2PW1B 1D5BB 3NABH 1UXWA 1E4JA 5DYFA 3SBRA 3ARZA 4N2BA 1UB5A 4QO1B 3ELAT 3R8BB 5JHMA 4UM9D 2GIMA 1IE4A 4BV1A 4Y5VA 4N5EC 3ARPA 2GUOB 1JPST 3NFNB 1CGTA 3LH8A 2XETA 3BPNC 1JRHL 5HDBF 1HESA 5F9OH 2XYBA 3DTUB 2AP2A 4AGLA 3SDDC 5IHWA 5D1XE 2GB2A 4KV5E 2EE6A 3QNYA 1R9FA 2XA8H 1KXVC 2XN9B 2R29L 3HTLX 2ISDA 3DX7A 3SYQA 3DO7B 2HT4D 3W11D 4L4JA 5HY9B 1H8LA 5L2KD 4PWKA 2VLME 3CFMA 2O5NA 1F4WH 3DXAD 4AV0A 4LSSL 3NJGA 4FFWD 4P99A 1UADC 5E4OA 1B88A 3CVHB 4YLCA 3B6SB 4WUUB 3GGWB 4YDVA 1Y0LB 1YN7B 4YHKH 5KVEH 1W15A 1NOFA 2C3XA 4LXFA 3B9DA 3WG7B 3GNML 3ET9F 4GMSH 4JRYD 1LK3L 3RURA 3ARBB 4OV6F 1FNSH 1R5VB 5FYJE 2XFXB 2LABA 4P2OB 3IETB 4Y1AD 1OE3A 5GSRA 4MNQA 5K9QI 2C7UA 3CVBA 4F8NA 4BQBA 4ICXA 1VCBC 2AXWA 2QSTA 3GKZA 3NRFA 3QQ9C 5CEZL 1INDH 5EEVA 4N1HB 1MFDH 1HXMB 4F92B 3FHAA 3KNBA 2B5IC 3Q6FA 4J27A 3GK8L 4JDEA 3QQNA 4L8SB 5ENWB 4MJIE 3QYCA 4JN2B 5JZ7D 1HWGB 3UYRL 1ORQA 2GJ6B 3NFSH 5GRXG 4ZXBD 4YO0A 4BFGA 3V8CA 3CZGA 4Y19B 4OLXL 3TJHD 4P3CH 2I9LB 1J5HA 2HXAA 4WI0B 2G9HA 3BXNB 5DUPH 2Q0ZX 3BP5B 1G6RA 4RCAA 5BVPH 5E6RB 4UNUA 4XPGH 1GZPA 5DZVA 5IT2H 5FV1L 1ICTA 2KL6A 1A3RL 4HLEA 2OXGB 2BNQB 3CZKA 4BEIA 1UWYA 1I7ZB 5B39B 2VC2L 2WLIB 5FECA 3LCYA 5AKVA 1K4DA 3AG4B 1N19A 4UQCA 1HHHA 4PJDB 3VFUA 4R7VA 4PJBF 3KYMA 4PW3A 1AGDB 1IJ9A 3OZ9L 2CUHA 4HGKC 1QSEB 3IPBA 1IT9H 4X5XB 4Y2OA 2UZYB 3ABGA 1I7RA 3B7SA 1Q0XH 3L7EB 3WSQH 3C6EA 4HZAA 3EJCA 4YZFE 3BAYA 3T77B 5FYLH 5DSCB 3U36A 3FU7B 4E5XB 3QI9B 4ONFL 3WLBB 2AV1A 2B14A 1IMHC 2QADC 1AD0A 2UWEA 3R19A 4RFOH 3HR5A 5BMFH 1W8EA 5LGJA 2CJUH 3OV6A 5IBTH 3FO2A 4FQXC 1OKEA 5G4OA 4U0RB 4ZFGL 3MLTA 1RIHL 3G7TA 2JI2A 1G4RA 4WEUD 3FUIA 4I4WA 3KDMB 3NCWA 4ODSL 4TUJB 2FO4B 3H0TA 3FHEA 1OSYA 5C08D 3KBEA 1UYWH 2DN7A 2VW7A 2WVVB 2CRMA 5TDNA 1RJZB 2FECI 3KBFA 3GSQA 2W0FB 4KMTL 5TF0A 4H40A 1XGPA 3PWNA 4WV1C 1UJ3C 4IOSA 4YSPA 4K15A 5B38B 5AD0B 5I5MA 2V17H 4GAYA 5GZNA 1WFJA 2AKRA 1F6AA 3KE0A 1RZGB 4NSKB 3N50A 1T1XB 5KN5B 3V10A 3WXVH 4H88L 4RAHA 5KW9H 1L7TL 1CDIA 4MXWH 2CDGB 3O6KL 4H8WH 3MRJA 4N8CL 4YBLB 3PQYA 4PJFA 2HZHA 1URLA 4YPGB 5J13C 3ULVF 3VXQA 3HBZA 1UASA 1RLWA 2YBGA 5DJZB 4LHQB 3R8QA 4CKQA 4S1SH 1YJDC 3QAZC 4NQEB 2FBRA 3O3AA 1BM3L 3IDGB 4Z5RB 5IUCA 3QG7L 2NZ1A 1JK9A 4GSDL 3MRKB 4FJ6A 2P45B 1GOFA 2NW2B 5IB2A 5FWRA 1MAMH 2PWHA 3GSVA 1P7HL 4TVPH 2NUTA 4A6YL 1DVXA 1IGIH 2PPCA 5INCA 1SFDA 2DQJL 4PGBA 5TE6H 5LWYL 4K73A 4PWEA 4F1SA 4CU7A 1ED3A 5JW4N 2Z65C 1S5IH 4HJSA 2W59A 1QBBA 5D1ZI 2VO8A 1ILSA 4R26H 3AABA 5FGCB 4P4KC 3IAPA 4KJWD 4K7FA 4LLMA 3OJDA 2OMZA 3G6JB 1N5YL 3U2SB 4OGYL 1EPFA 4XPBL 4QLWA 1Z9PA 1OAZH 4Y0GA 4XZUB 5TD4A 3O6LL 1KULA 1I8LC 1GKOA 4HHAA 5HGBA 3M88A 3TF7C 4JNXA 5MENE 1A4KB 1KTDA 4N8UA 1HZKA 2MKLC 5FO7B 4TS6A 3FHQA 1XWVA 3M17B 3UERA 1QWUA 3AWFA 5F1SA 4AQ8C 4HEPG 2I69A 4M8QB 4IBSA 4UTAL 5HD8C 2Q5BA 4AOFA 3TT3L 2EAEA 4YAQA 4HSQA 2JTDA 1OAXL 1NC4D 1S7WB 4HFWA 2FATL 5I16B 4YNYA 4FJZA 4NAJA 1AACA 5KG9B 5DJCB 5I8EB 3OAYK 2W88A 4N2GA 2R2HB 1FG2A 3ULUD 5ISZB 1C1EH 3P2TA 1J5OH 4HWZB 3B3BA 1G1YA 1M71B 2AJYL 5KYYA 4BWUA 2PPFA 4FQIL 4JGMA 4P23C 2R29A 1JZ4A 4NP9A 2XWRA 3PWUA 3O2DL 1KXQE 4DEPB 3MCG1 1XIWD 2H26B 4AUYA 3H3KA 1E50A 1O6SB 4H26A 4WHYH 1GXEA 3BPCB 5KYUA 2WCGA 5AAMC 5KS9E 3D5OF 4ZAKD 1J48A 1W0YT 3K2UH 3L13A 3DBXA 4JZOA 2X1WL 4PRHE 3X11B 1NFAA 3ORJA 1XH3A 4HIXL 1QTYT 4BSJA 4LB8A 3WIIH 3QFJA 1TTFA 2R56H 2LV4A 2WBJA 2WQAA 3D85D 5D1QC 3IJHA 4UV4H 2YSTA 2X89A 1XEUA 2QBWA 4LLDB 1RZFL 6FABL 3QSKB 1P9MC 2E4TA 4JFHE 3H3BC 3GI9H 3MYJA 5EZLB 4DFHA 3CPLA 4JL2A 3RWHA 1H6EA 4C54A 5E1IA 3A6CH 2E4FA 4I9XA 4Q74A 5I75B 2VMFA 2X6VA 4ZMNA 2W91A 3MJ7B 2EE9A 3HPLA 2AXFA 3GTTA 3LKRA 5BRZE 5LO7A 3LRHA 2OCCB 3F00A 4MQ7B 5AOMA 4BE6A 3FT0A 4RGNE 5IEHB 4G71B 4HX1A 3NABL 3HE7B 2E46A 1DQQA 4E9RA 5IG7A 1FFNB 1PKQB 2EIBA 2YQBA 3L95B 4GSUA 4YVUA 3TCLB 1T0NB 5H37A 4ZFZA 3NPSC 2D9CA 5C3TA 5HHQB 3BEWB 2F68X 1XGZA 4X5RA 3KPRB 1PX3A 4KRPD 3RU8H 1U42A 2GAZB 3PGDB 2PWGA 4X6FA 1F97A 3O2VH 2V9UA 3K71B 1SJXA 5EO9A 3IWUA 1MW2A 1AGFB 5F7DA 4FEMA 1T1ZB 2ESVB 1ZRUA 3UTSE 3WEOA 3RB7A 1U8JA 2X70A 5FR3A 4Z7WE 3HRZB 2EDEA 1KGUA 4F5CA 1W0VA 1PZDA 3GB7B 3MC0A 4XNXH 5T1LA 5JXEA 1P5VA 4K94H 1YNTF 1BOGB 2X0VA 2ATPB 3VSUA 4MYPA 4RZCA 3PXJA 4Z18A 2VDPB 1XXFC 4K9EH 3UP6A 1KPRB 4HCFA 5CEYB 3QPQC 3LKSB 4I87A 1E2WA 1R19A 3MBED 2OMYA 4C4KT 1MLCB 4B6ZA 2EZ0D 4FNSA 1A6PA 1T1WA 5FM8A 4PRID 4F58L 2ZYIA 2DMKA 3EJTA 4N2DA 3I75B 4L5FH 4TUKH 1MSPA 5HDBE 1JXJA 2YZ8A 3EYVB 5HGDA 5AVZB 2GABA 4DP0X 1A2YB 1XTLA 5SWZA 3POHA 4QYAA 5GRYA 3UJJH 1INDL 1HH9A 1XQ4A 1N0XH 1MCJA 1MFDL 4ACPA 3RWIB 4FG6D 4GRLC 1LE5B 3ECUA 4ADGA 3JTTB 3WJMB 3FFCB 4XMKH 4WGKA 4HK3N 4OB5H 4XP9L 2CGYA 3TYGH 2EECA 3M6DA 3MA7B 3RVVD 1D5MB 2HKHH 4AQ1C 5DUPL 4DQOH 4ZRGA 5LXVA 2FIKB 2PUQT 5KBPA 5BVPL 1KXTA 1HL4A 2A74B 2NY5C 4NNPH 5C0IA 1RIUH 4LCWB 3K6NA 4XPGL 3DBSA 3V4PB 5JPMA 5IT2L 5E2UH 3KGRA 3AJ7A 3QCTH 1DBBH 4ABUA 4B60A 3MV7D 5IWLC 3NZ8A 2DQTL 1A02N 1I8MA 4OCSH 4AM0Q 1HNFA 4Z76A 1G4MA 3V5HB 4TTDD 1VAHA 3LIUA 4POZC 4HC1A 5INDB 3BRFA 4IOIB 1BX2B 4FL4C 4UQ3B 2VR6A 5AYQA 3TO4B 1U21A 1XCTB 3HI5H 1UXSB 3MNDA 4M8VA 2GY5A 4RA3A 5F21B 1FNEB 4X7TB 3PHQA 4N0RA 1IT9L 2BFGA 4MD5A 4X98B 4U1IA 3JT0A 1LQBC 2AQNA 3F01A 3WSQL 3OD3A 4Q4EA 1OP5K 1DVFB 1ET7A 1QPPA 4JHZA 5I8OH 3WOVA 3TBVB 1VEMA 5FYLL 3PL6D 4ZQTA 1UWGH 5J89A 3T5WA 1WTLA 1CLZH 2QZQA 3P3SA 1E7VA 4KKLD 4XOEA 1ZLSH 4A2LA 4GKNA 4RFOL 5BMFL 4S1RH 2FQEA 3AWGA 5IMKB 2CJUL 4GO6B 5CZXC 2EDHA 4PJIA 3I6KA 2E9WA 4N26A 4R7NB 2IAND 2QFRA 5FW6A 4HUVB 4Z3TA 1YYMH 3ES6A 3VDAA 4EBQH 1U4FA 2O6FA 1LO2H 3UBXA 4OT1L 4N9OB 3CZLA 4JHUA 3D6GA 4GS7B 1RPUA 4RIRA 4BKLB 4DHLA 2N3JA 1UYWL 2GSGB 3ZTEA 3L9RA 2GSMB 5KJ4A 5AALA 5C0DA 3RI5F 1T2JA 3PHSA 1I9JH 4BXVA 3OHXA 3VD9A 3WENA 3Q8CA 2V6HA 4U2ZA 2IDSA 3RI5K 1SHXA 4A63A 3KXFE 2WZ5A 3NTCH 4G9FA 4RMVA 5I1EL 4KX9A 4LOEA 3SYPA 3WXVL 5FOBA 3VI4B 3CSPA 4WEEA 3HE6A 3UTZB 3FQNA 5KW9L 4L8CA 3RNQA 4J2XA 4KY1H 2ZXGA 3QGVA 1OP9A 2HG5B 4MXWL 5D7JB 3WJLA 2QZ5A 4YBHA 3IRCA 4ELKB 1C12B 3FCSB 4H8WL 4F7PA 1U3HA 3ZQWA 1O7DE 4AYMC 4MXQD 4PB0H 4RESB 2PPEA 4S1SL 5AOLA 2X2JA 4ELMA 2A9MH 2FX8H 3ABKB 4DZBA 1BP3B 3RQ3A 1QRND 3O2DA 3QUZA 3Q06A 3FFDA 4PJXF 4MA3B 1VFAB 2ED7A 2FD6L 3B9KA 3QXWA 1DVTA 1LP9B 4JY4B 2GTQA 3O4LE 5EFIA 2OMXA 1MAML 2AITA 2AMGA 1IGIL 2PR9A 4WK0B 5TE6L 1CT8A 3ESMA 2DQEH 4QHKI 3BD5A 5IUSA 4IEFB 1FFOA 5ACLA 4D9QE 3DJTA 1YEWA 1S5IL 1DN0A 4BWWA 3U9UB 4DP9X 2ITFA 3FS9A 4D0CB 3FB6A 2CPUA 4R26L 4XCFH 3CFEA 4U3SA 3II1A 4G42B 4TPRH 2FBOJ 3VGBA 3HPJB 1X5XA 5BJTB 3ULVE 2AC0A 1MI5A 4DF9A 5EBMA 2UY6A 1MNNA 1OAZL 1MH5B 2QHRH 4AGPA 1FCGA 4UU9B 4ZX4A 1UATA 1F6FB 2F7PA 2F7RA 3H9YA 4NKMA 3W0WB 1KENL 4EXPX 4Y2DB 3UYPB 3H9HB 4Y9EA 2P43B 5CZVH 1B2YA 1NMBH 1DLFH 3C09C 3QIUA 5I9QC 3H1ZA 3U79A 4JKKA 2EIZB 2AEIT 1H8OA 3MN8A 2W95A 3U1QA 2GKIA 3WFDH 3L5IA 4U1NA 1TTCA 1NGPH 2XPYA 4O51B 5C0FB 2NR6D 4WGWB 3TN0A 4FFYH 2JQMA 2Y7QB 4U33A 1MVYA 5I0YA 2XCMC 3ZO0A 4P2RE 1JPFA 1NEZB 5H4YA 3ZE0F 5CIPH 2APFA 3SD5A 4YN3A 3U4EB 4BFBD 1CDCA 5EU4A 5B1AB 3VCLB 1J5OL 1UT2A 1V05A 3NESA 4CW1A 1FDLH 2NY1B 3H9SD 3WN5A 2PXYC 2IGFL 1KTKE 1M05B 1AMYA 1QMUA 1GZHC 2YAEA 3C8KB 3OR7A 3N40F 3OWRA 5CP3H 4YDLC 5FF6A 5KTEH 3BUQA 1JG9A 1SHWA 2EE3A 2EACA 1LNUB 3L1OH 5BRQA 1YA5A 5DD1H 4RVBA 3C5XA 3S3DB 4ZPVB 5K69A 5EIIA 3G04A 3K2UL 4YHLH 3G5ZA 2FYYA 3L9BA 2XC8A 2XWEA 3QR2A 3HRPA 4TRPH 5F8QC 1TVHB 4XXDB 1KGYE 1G9ML 5D6DC 4K5OA 3WIIL 4AV4A 3FONA 4JR9L 2P9RA 2V5YA 4XCCH 1SXSA 2HTKC 5CILH 4UV4L 1NCBH 2D03L 3N5AA 1EHKB 2MMXA 3H85A 2Y1AA 4LKCB 3ZT5A 4E2OA 3GI9L 1CU4H 4BCZA 3A21A 4RMRA 1EAJA 3A6CL 2PYEB 4P46B 1RUQH 1IBFA 2OW6A 4CDGC 4Y5VC 2IOMA 2B5IB 3EYUH 3S88H 4I48B 1CD8A 3B3IA 5D1QE 4QRPD 2YXMA 4N2NA 3KYAA 2OSYA 3LZLA 2W80C 4HD5A 3WTXA 3V52H 3FTXA 4H8QA 2D7TL 2MNJB 5EZIH 3QXVA 3EO0B 4HIQA 3TBSB 4KI1A 1WHOA 4R5VA 4M7ZB 1WBXB 4WWKD 4NN6B 5HYSB 4PAZA 3RU8L 5DT1H 4MCYA 4XVJL 4YGVB 3O2VL 3U0PA 5BZDA 3OM3B 2Y2YA 5BS0E 5C0CB 2VDMB 4JFZL 2G2RA 4PSPA 4K8RC 2DQHH 4PTTA 3I9GH 1N2RA 1CLOL 3FO1B 4KBPA 5CR8A 3ZMNA 5MERA 5CWSB 2P49B 1CK0L 1YEGL 3IDJA 2WTRA 3F5WA 1GHFH 3RILA 4XNXL 3LEVH 1OZUA 4I77L 2X12A 1BEYH 3TFBA 1HH6A 1GZQA 1NJ9B 4K9EL 3OLDA 1KZQA 1CD0A 5I1HL 2DKMA 1NBZA 5LCVA 5HHMD 1Y6MR 2G0LA 1EAQA 1LWRA 4FP8H 4B5ZA 4TUKL 2DJUA 5DURD 3GTNA 3NJFA 2NW3A 1A9VA 5LJYH 5F3HA 4O2FB 4L23A 3ZTNH 2DI7A 3UJJL 1WZ1L 4LNRB 1N0XL 5FW7A 4ZSOA 1D7DA 2G2NA 4XMKL 3T0ED 4YEEA 3SOTA 4OB5L 3TYGL 3L6FB 4HK0B 3IFNH 2HKHL 1F3RB 1UJ3B 3O3DB 2XWJB 3RX5A 3V0EA 2H1XA 2Q3AA 2Y3NA 3TBYA 4DQOL 1TMQA 3B83A 4NNPL 1RIUL 5L2JB 4PR5A 4ATWA 1P84J 3KZ8A 3VFTA 4M7JH 5E2UL 4WK4B 5I74B 3QCTL 1DBBL 1AGCA 2JKRM 2HFEB 1EX0A 5SWQB 4XNMB 4OFQA 3GSRA 4OCSL 5JR1L 5IEKA 3CXHJ 5E1QA 2W65A 4UT6L 5DA4A 2JK5A 3RVUC 4M1CD 4PRBA 3HI5L 3VXRE 3VXSD 1RIVH 1FL6A 4OLEA 3IJ7A 5IMOA 1CURA 1O9ZA 5D71H 5E00A 4P0DA 4B41A 1R3HA 3K8KA 1JGIA 4KO6A 5FKAB 4LVHC 5C07A 1ADQL 1FN4A 3GZKA 5I8OL 1NCIA 4MBOA 4G8GA 1YNKH 1NAMB 1U8IA 3ENEA 4M4RA 5BXFA 1UWGL 2X6UA 1P7KA 2UXGA 3CFIC 4JO8A 4P5TB 4ZMAT 1CLZL 5D2NB 1ZLSL 3VFVB 1HCFX 4YHYC 2FWSA 3QUKB 3MSPA 1ZGLB 2QR0B 1KFAH 4S1RL 4ECNA 1J0JA 3PIQA 3VB9A 2SEBA 5IBLD 3RE0A 3CDCA 2ZYSA 4PWHA 1H0DA 4XB8A 4G3YH 5FM5O 5DS2A 3H3PH 5IQLA 1T1YA 1J87A 4X8XA 1Z5LA 4EBQL 4NO3A 3V0JA 1EHLH 3MUJA 3IDIB 4FZ8H 4AZ8B 1QI3A 1IEBB 4XP6H 5GZNC 1ZAGA 5KYXA 4N1CA 2HLAA 2XJKA 3QDMB 1FNGB 2C3WA 4X6CA 3BOVA 1YY9D 1I9JL 1BZ8A 5C7XH 3LH2H 4OZ4B 3BIBX 1FZKB 4RGMB 3NTCL 2AANA 3PWJA 5AZEH 5HJGA 4YPJA 3SE6A 4Z7QE 1M6OB 4KY1L 4HP5A 2YPLE 3DJRA 4LHUD 1P7QD 1VF5C 3M7FB 3ZYJA 2EDJA 5C8JA 1YCSA 4R4FL 3EGXB 1E4WL 5IM7A 4QRRD 1NBVH 5ANMB 5C09E 1YMMD 3NZUA 5FA4A 4PB0L 4BELD 4JO2H 2A9ML 2FX8L 3BFQG 1FP5A 4GFTB 2DWEB 2IWEA 1MCWW 4H13C 4BH7B 5T3ZE 3W39B 1HL8A 4L1DA 3ISYA 4NPYB 3NA4A 4X8JA 1RJLA 2I25N 3L17A 1T7XA 3QHZH 2QVKA 3S3CB 2BP8B 3NEXA 3PAZA 1CFQA 1Y1UA 2WLKA 4RFNC 3Q2LA 3MXVH 4WHCA 2BIQA 5LXGH 2HRGA 2DQEL 5FYJD 3BPLC 2EIJB 3L4XA 4JHAH 3WEMA 4I2XA 1O6VA 3L5HA 4HKXB 4HG4J 3ZDYB 5SX4I 1HQ4B 3OAZH 5D7KE 4XCFL 3E2HB 3T6QC 4NHUB 3IGKA 4TPRL 1Z9OA 1RUPH 3JUZA 3PABB 4LDEB 3UTTA 1LO3H 3EO1A 1RJYA 1PNDA 4MJID 3SGDI 1AQKL 3D3VE 5C3LD 2VABA 1ZMYA 3GDCA 4MA8L 2KPWA 2QHRL 2V3EA 5GXBB 5I1CH 4PJXE 5BQ7A 1CXEA 5BV7B 1I82A 5CZVL 1NMBL 3ATBA 5JNYB 3BZEA 1DLFL 1TJGH 1V5JA 2IPUG 3DYPA 4EVNB 4IRZA 3WFDL 5C97A 5DZNA 1NGPL 1UH2A 2YD8A 1ND0B 3P4NA 3QXAA 4FFYL 4R3SB 32C2B 4IU2B 4LIQH 1FVDA 1NQBA 1KB9J 3C60A 3BKCL 4JM2D 3GBDA 4WI4A 1E28B 1XH0A 3VQMA 1KLFB 5IJVB 3K6OA 2CSPA 2ZSVB 2ICWJ 2EDWA 1FL3A 3ZQ9A 1FDLL 4GUPA 3FSAA 1BZDA 2K9FB 3D2UB 5EH1A 1DEDA 3NT0A 5KTEL 3T65B 2PCXA 3HUJB 1LEIA 3ETBF 1KBWA 3L1OL 2WBJC 1DJYA 5DD1L 3O11A 3REVB 1W72H 1E67A 2TRHA 4F15C 2DMBA 3KWWB 2AV7B 4YHLL 4TRPL 4FQQA 5BZXA 4AC4A 4E9VA 1O9WA 5DEGB 4O02B 4Y1SA 1G7MB 1T0MB 4N6RB 1NOAA 5JOPE 2ZXDA 4S2SB 4XCCL 2OI9B 2R59A 1MFCH 3QDGA 1NCBL 4MQTB 3ZE0E 3DUSB 3C2SA 1FE8H 2W60B 4FX5A 1CU4L 4PREB 2Y25A 1QZ1A 2L8AA 1WCQA 3FUHA 3AXHA 1U8LB 2LQRA 4RNRB 5F1IB 3DV6B 5E9DA 5B4MC 1NZRA 2ZP8A 4J3OF 2X38A 1RUQL 3VFOA 2LW3A 1JWUA 1CFNB 3EYUL 2GK0B 3S88L 1O7SA 1P6WA 5EN2B 2VLRB 4ZUSB 5F1NA 4RH4A 3STZB 4OSUH 5EZIL 3KYOA 7TAAA 4J3OC 4MNHB 3B4NA 3QEHA 1JV5B 3EYQC 3IJYA 3V5DA 3VD1A 1E6OH 1KT2A 4KROD 4P5RA 1WCBA 4LAQH 1FYTA 5DT1L 1ZHLA 4MCNA 4B0MM 5JXEC 1J86A 4UT6A 3MBWB 2HVBA 2R23A 4IMKA 1EXUA 4QT5B 3IT8D 3QJTB 4XO9A 1ITCA 4L29B 4R0LB 5I0WA 2D7MA 1S7RB 2DQHL 4AQAB 3HG1B 3O6MH 1ZLWK 5DFVC 4WWPA 3Q5OA 4OUUA 5JDSA 1GHFL 3SPIA 3APFA 3LEVL 2G5RA 3FO9A 1BEYL 1DQVA 4NZTH 4PJGB 4H0HB 2YEQA 3GXPA 1IVLA 3OMNB 1ADQA 4PRPB 1HAUA 5IQOA 3VB8A 4JY5H 4A2EA 4EI6A 2NYYC 5T1KA 2V2WB 3BAEH 4I89A 4B9PA 1BFTA 1NC2A 4OD2A 2WZ6A 3QEUB 5GGUB 3F7LA 3QUXB 4Y4KA 2NY4D 4QKTA 4ZOEA 2EVJA 1CVRA 3ZZSA 1IM3A 5ID0B 4FP8L 2YUZA 4NC1C 1SY6A 2OZ4H 1NKRA 1CGXA 1CIUA 4YHIB 4UQAA 2J1YA 4ODWB 5AW8B 2CR0A 1GL4B 4OD1H 3MJ8B 3ZTNL 5MEND 5ECGA 4ZS7H 1J5IA 4XTRC 5KOMC 3RUGB 5H35A 4NDMB 5DEJA 5I1AA 1Y18A 3DJZA 2ZYHA 1AE6H 3FO0H 2HCZX 1LL1A 3VXME 5GRZA 3JWDH 4DVBB 4HWBA 3IFNL 3NN8B 2F54B 5JPMC 3BQUA 2QGEA 4DK5A 4X5LA 4UZUA 2OTPA 2ZP0T 4LDLB 5EU6E 3LKNA 1YN6A 4HALA 2R27A 4QY8A 4G9DB 3P0VH 3ZHKA 1I1AA 4UQIM 4CGTA 4NNXA 1OAKH 3T9WA 1KYOK 4O2CA 1KMGA 4P2QD 4M7JL 2OTWA 3RPIB 3H2QA 1N6UA 1MCQA 1GMIA 1KGWA 2OJEB 2NNRA 5E5MB 5KVGH 4N9GA 3UX9B 2GC7C 3BP4A 4APQD 1EJ8A 6PCYA 3CSBA 4FAAB 2B59B 2V3DA 1DHKA 2Q7YB 3JZYA 4NQDA 2X4UB 2B4CH 2V2XA 3OAYH 1QQDA 4P3WA 1GGBH 1KIQB 1L3NA 4JFFD 3S7GA 4HJJH 1WFOA 4NO5B 4PJCA 1A1NA 4PRHD 5D71L 5J9PA 4KK9C 2Y6SC 5I0ZA 3DJ9A 1CD1B 4ZD3L 2BNUA 1H3UA 1F90H 1RZ8B 3RGVD 5E0FA 1YNKL 3WMPA 2H3NA 1IGTA 4UYQA 3AB0C 1KFAL 3ZKND 2VLJE 3LQZB 2NX5E 1M7UA 2XN9E 3QO1A 4GIPD 5KANG 2VSDA 4ODXB 4G3YL 3FT3B 4ZT1A 4Y8AA 1KOAA 2X1XR 3HB3B 4YE0A 3OHXC 3J27A 1ZSHA 5F89A 1EHLL 5ALCH 4FZ8L 2EDFA 3NDZE 4R5TA 4ZUUA 2XKSA 2CO6B 5TF1H 2OX5A 5KBNC 4ZDHB 3BVDB 2MTPA 4WUUE 5E4EC 4JJHA 4ELMF 3HE6C 1XR9B 2KI6A 3QIWB 3LH2L 5JW5A 3WJLC 1XGQA 1S8DB 3FB8B 5TTRA 3MLZH 4GW5B 1OGAB 2NTFA 4WO0A 5AZEL 3FUFA 2AXJA 1V3JA 2XNAA 3STLB 1U3HC 3IMWA 2ZXEB 3TX4A 1XGRA 5JHBA 1E9QA 5E8OB 2VGLM 5E8NB 5DMYA 3QUZC 3WKML 3BHBB 4JAMB 5DHYB 3CMOH 2H1LM 4HGWB 3B9KC 2Y7OA 4N5ED 4ERSH 2H0PA 4YK4B 5FFGA 2FX7H 4F8OA 2GJ6E 1RSFA 2I7SA 3IGFA 4NM4H 5CSZB 3RRQA 2OQJB 4P04A 3MV8B 4Y19E 4RLDA 5GIRA 2BVOB 3BIKB 1NBYB 3MFGB 4RGOH 4U6XB 4PG9A 5TDPB 1V7MH 3MRGB 3SDDD 5A16A 3QXUA 4PWJA 4XBGA 4NPKA 3N40P 1SJEB 3ZMRA 3HNVH 4Y5YA 1R3IH 1U2HA 4XHJC 4BGLA 3EHBC 5F3FA 2BNQE 1YPZA 4X99A 2Q6WA 5LXGL 4EZKA 3QJZA 2B20A 4JHAL 4TM9A 3K0WA 4WRLA 1TCRB 3OX8B 1TVBA 4JFOB 3Q43A 4L1HA 1U33A 3GSNH 3WCYA 3BN3B 3TH2T 5DHXB 3DTDA 1J10A 2Z7ZA 1KTLA 2IDQA 1DUYB 3D39D 4M7LH 3RY5A 4XN2A 1AAJA 4XX1G 3FQRA 2YEZA 5DEZA 5IW6B 3BYTA 4KDWA 4HEMA 2X4QA 1LO3L 3HC0B 1NFIB 2Z0BA 1OE1A 2CLRB 4QOKD 2CRZA 3SKMA 4JQVA 1BWMA 5I1CL 2LHAA 5GZOD 4HJ0C 3TA3B 2Y1VA 5IQ7L 2EEXA 2CK2A 2YEVB 2FSEB 1U8QB 3TN0C 4Y5VB 2EO9A 5DJXA 3V8OA 3BAJA 1TJGL 4NZUH 2OYKA 4F9PA 2YFNA 4LLWA 3EFFA 5AAWA 1IGJA 3SPGA 3IKCA 4LIQL 2AJUH 3UACA 4QF1B 3WE6A 3QNYB 4MBRA 2AQQA 4FXKA 3RL1A 4Y4FB 2N7AA 5ADPH 1WFNA 4KKAD 4GKSA 4PLNC 2VDOH 4I18A 4XXWA 3BLBA 3WHE0 5MP6H 1GGTA 5I6XC 3OKEA 3V4UL 5J5EA 1UH4A 1DP0A 2L7QA 4YE4H 4PJ8A 2G75A 4CVWA 1DQLH 2FGWH 2FYVA 4LLQB 3QVAA 4YDVB 2WKOA 2O1AA 3NP4A 3UPRA 3MLVL 3BP6A 1NKOA 2ZICA 5I8CA 4QJ3B 1B3JA 1O5PA 1HZHH 2NY3C 4Z3JA 4BYHA 3CXFA 3BKJH 2HRLA 4HOXA 3S96A 3AS2A 1Q9LB 2YXFA 3S9DB 1WC7A 4QYOB 2JVUA 4MNQB 3DHMA 1HNYA 3LRLA 1MFCL 4FC3E 3VQ2C 1RAMA 4NQEE 4R4ND 3PCYA 4W9DC 4M6MH 1FE8L 3KNBB 2AGJL 5EEWA 3MV9D 5BRPA 1ZS8A 2W9LA 2BSED 5IZ7A 1ZXQA 4YO0B 1IAII 4QKXB 1JBJA 4FQXD 2RR3A 4M1GH 1WTGT 1GJIA 2G9HB 4LEOA 3KXFD 4OLYH 4R90H 2IAMD 1YAIA 4UM8A 4E9QA 43C9A 2Y1YA 4OLWH 3GZPA 1UM6H 3U30C 4OSUL 5FGCE 1A6UH 1CDGA 1WE5A 5IB3B 2BPBA 3LIZH 1J9QA 4R83A 1QI5A 2ADJB 1XVSA 4A7QA 3MREB 1K4DB 1JERA 3D07A 4FXLA 2D7OA 1BVLA 3AXLA 1GOGA 1DQDL 1HHHB 3CFBA 4WO4A 3IXAA 3T0XA 3QFDB 5LVEA 1TJXA 1XB6A 4PJ7A 3LTVA 3QULA 4LPWA 3BFOA 1KC5H 4OD3H 4CU8A 3FF7A 1FVCA 3EH5B 4MXVF 4Y2OB 1CTMA 3L1GA 5ESQA 1I7RB 3O6ML 4XCNA 2QPUA 1KIUA 3O4LD 5CUSH 4N20A 3QEGL 1TG8A 3QDJA 5CEXA 3WEXB 3O2WH 2B1AH 3I3BA 3RIFF 3U36B 4NZTL 2WAHA 4OCLC 4WTZA 4D8PA 1TJMA 5EBGA 1VB9A 4XMVA 1E4KA 3RDTA 5FWQA 4J6IA 3RIFK 2GBAA 3BAEL 2H8PA 5AVSB 2YRLA 4MJ2A 1NUFA 2EADA 4WFHE 3OLGA 1WFTA 1T7ZA 3C2AL 3MLTB 5FO8B 2JH2A 3ULVD 1S9WA 4YHYB 2OZ4L 4MDRA 1DJHA 1Z32X 5TH2A 3H0TB 4MHHI 1CD9B 2MCMA 3ZR5A 1LO0H 4BSWA 4MWFB 4XC3H 4ZS7L 4FQHB 1QSFA 3B9AA 1XGPB 2WGNB 1MUJA 2QPSA 3OMIB 3GZQA 5DEFA 4EAEA 1RK0A 3FO0L 4OAWA 4P4KD 1HVXA 1F6AB 2X4TA 4X5WB 4WGVB 3JWDL 2GI7A 1CWVA 2C4FU 1ASQA 5JTWA 3KCPB 5ICZB 3KJ6H 3ILPB 2BHFA 4EDWH 3P0VL 1Q9OB 2VDRH 4GG8A 4OJYA 1OAKL 3PQYB 1N8OE 1URIA 3KEHA 4PJFB 3VH8B 2OFQA 1ZTXE 1QFWI 2ITCA 3PWPD 2Z92A 2DY2A 4OFIA 1ZHNB 3VXQB 4IRSB 2R8SH 5DVKA 1PZAA 3CGTA 3TVMC 5HD8D 2H41A 2R2EA 5D4QA 4D7PA 4M7KL 1I85A 3O3AB 1MZZA 2P5EA 4AIOA 1TU2B 5D7IB 3C6LB 1II4E 1D9KA 5EPMB 4HYTB 3ULSB 3QNZA 4YGAB 5IB2B 1FJ1A 1PKQE 4LLVB 5INCB 2QPFA 4G8IA 4PGBB 3N1MC 2CHXA 1F8TL 2HFFA 4LU5H 4L18A 1F90L 4ANUA 4C56A 5I1DB 1FNAA 3BSZA 5AW3B 4OF8A 4EUPB 2YQGA 4JRXE 1MHHA 5T8IA 3KPRE 1Z9SA 2BZCA 3FTYA 3HI6H 1P5UA 1J8RA 4K7FB 3OJDB 2QQLH 2ITDB 4J6RH 4LP4A 4NQVA 1N0LA 1AO7D 4OJAA 4ETQB 1DJIA 2ESVE 4HZ1A 3DTXA 3PGCA 3HAEG 2E7MA 3BGFB 3HZVB 3C6SA 5ACMA 4G70B 3RX8A 4HBCH 4MDIB 1BAGA 3ZKSD 3L3DA 2WXIA 1J0KA 1CGSH 1DDHA 3IRZA 3MOQA 4G5ZH 4MJ5A 5ALCL 2HLFD 5TF1L 4NN7C 5D1QD 3E0GA 4P9ML 5MEOA 3O9WA 4OZGF 1YYLH 3O8XB 3FN9A 4OCNC 3NRQA 1M2VA 1SXNA 2DKUA 3DO4A 1M1XA 2ZWSA 3O45A 4LCIL 1TKWA 5TFSL 3MLZL 4CUCA 4U3CA 2EKSA 1MW3A 1BF5A 3DMMC 1FG2B 3D0AA 4W9EC 3ESOA 5BS0D 4KQ0A 1UKTA 3TCXA 1WGVA 4LLUB 3ZGHA 4CMMB 5DHEA 1HOCB 3GIZH 4H5SB 1R17A 2R0KH 1LGVA 3FFCE 5DI8B 4ERSL 4XNQB 3QEQB 2FX7L 1OTTC 5EO1A 4NM4L 2HTLC 3F12B 2V8LA 4KC3B 3N1FC 1F02I 1KY6A 4I0CC 1G9MC 3BCDA 4RGOL 3ETSA 4XNZC 1T83A 4KOBA 5C2BH 3UMTA 2YUXA 4KGLA 1XH3B 1V7ML 3BWSA 4XCYA 3AQYA 2XLLA 3QRBA 2NOYA 3MTXA 3V0VB 3TO2A 3W3BA 5HHNA 3HNVL 4YDJA 1R3IL 4F15B 1WAAF 4IJTA 1G5GA 2QQQA 3IJHB 2XSKA 5FCUH 2WGXA 4RDQG 3IK2A 4HU8A 3NGBC 4NZJA 3GSNL 5BO0D 2V9QA 2XVKA 3RWHB 4N3TA 4UOZA 1N10A 4AEEA 2EIEA 2Q2LA 4PRDB 4BD4A 4G7VH 4MGXA 3UPCA 2ZOTA 4AW7A 2AXFB 4BK5A 3BEVB 3KL5A 1IM9D 4ZO9A 2NXZC 2AAAA 1U8HA 4L37A 1E5CA 2DAVA 2VLKD 1WZKA 2MOGA 2VH5H 4QXVA 5I30H 1DQQB 3LMJH 4Q89A 5E6ID 4UM9A 5IG7B 2MQGA 2APBA 4L4VA 4YEFA 1A14H 1AKJD 2WQXA 3C60C 5E2JA 3DRQA 1A8ZA 1U8PA 4ZFZB 3RYMA 2W81C 2DLEA 4JPWL 3W56A 4WU7A 8CGTA 1AR1C 4GRLD 5EF0A 2VC2B 4GPVA 4TLKA 2AJUL 1JGLL 5IVZA 3KLQA 5ADPL 5F7DB 1E3ZA 4FXGB 2XRAH 1AOZA 3VWKD 3VXRD 4Y8DC 2EDNA 1SQ2N 2VDOL 4BUHA 1W16A 5TK2A 1W0VB 3DXAA 5T1LB 5KJRH 5MP6L 3GXNA 2MFNA 2DMHA 3QC6X 3DRTB 4YE4L 4J8RA 2VXVL 4E9XA 4QD2E 1DQLL 4RZCB 3U82B 3RLSA 5FCSH 1P4BH 1T66C 3DK2A 3VI4E 3J07A 4POZD 5DD6A 3M46A 2OMYB 3VD2A 1HZHL 5I82A 4JRYA 3QXDA 3SDCB 3CVHH 1MHEA 1U3YA 3BKJL 2XACC 4G6FB 2WTPA 2CBPA 2H45A 2NY0B 4HFUH 1SF3A 5EDSA 4Y1AA 4MQSB 1WD9A 2CALA 4OVUA 2VDQH 5SWZB 1ETB1 2BP3A 4HV8A 4LGSB 3B56A 2OSXA 4JVUA 5I1JH 1HWHB 4AZUA 2DTMH 4M6ML 2A73B 4EF3A 5F7FA 1Q9KA 3PLYA 5T5FA 1A6TA 3DVGA 2CIKB 2OMTB 5BVJB 1LP9E 1CXLA 1AGBA 4ZXBA 2JE8A 4X6DB 2YD9A 1KEMH 3P77A 5LAXB 1W8NA 1X5AA 4M1GL 3S8FB 4LRIA 4XVUD 5F7NC 4OLYL 4R90L 1DSFH 3D34A 4KY2A 4P9HH 3U2JA 5AG8A 1B0RA 4TVUA 3ZOAA 3QJOA 5JPMB 3D9AH 1HXYB 4OLWL 1UM6L 4Y5XB 2E6JA 1A6UL 1GY1A 3NIDB 3IAQA 4K3DL 2VN7A 4WCYH 1CXKA 1I8MB 4IMKC 3F7RA 1AQDA 3AC0A 1KBPA 4TN9A 5FUCE 5DRWA 4GBXC 1VZIA 4G5AA 2GEQA 3SKJH 3U9WA 2FSDA 2K0RA 3SHSA 3W0WE 3MLPA 4PV9B 5TE7H 1KC5L 5ABAA 1K4CA 3MACL 1WH0A 9PCYA 1VKXA 5FHBH 4U1IB 4EE2A 2JXMA 1JZIA 5E56A 4CKVX 5CUSL 2JWYA 1CYXA 1KPUA 4H4NA 2OK0H 4PV8B 5SX5K 1KBBA 1U92A 3O2WL 4U1GB 4A6YB 5J6HA 1CYWA 4Y4KC 1EZSA 4B7IA 4UT9H 2B15A 2K9UA 3BH9A 1TR7A 3NRPA 3L16A 1ET5A 1EHNA 1ROWA 2VR4A 5D7KD 1TQBC 2OYMA 5DDHA 1NCOA 3SBQA 3I6KB 1DQJA 1X5KA 4FS0A 1LO5A 4ISVB 1KWGA 3MRCB 2OW7A 5HI5C 1S7VA 3P9LB 4WSKA 4F7EA 3SODB 3UBXB 3C5SB 3D3VD 1FFTB 4JDVA 1GGUA 1LO0L 1OP3H 4XNDA 4IBTA 5B1KA 4PGJA 5FAAA 3E3QC 4XC3L 5C0AD 1Z6JT 4E9SA 3GM0A 3BQUC 5C0DB 1DQTA 2DM2A 3OHXB 3VVWA 1T5KA 4U7KA 1I1AC 3IAGC 4PHZA 4XMWA 1JPGA 4G9FB 1BBDH 4GIOA 4U4IA 2ITEA 4WEBH 1NWPA 4L8CB 3FQNB 4H8UA 1CO1A 3SGKA 4PN6A 2XBTA 5HYIA 4MZ2A 5E8EB 3VJ6A 1RPQA 3BD3A 2VDRL 4F7PB 1I7UB 3G5VA 3OXRB 3NIGB 3QJFA 4L1TA 5KYNA 3MCKB 4R2GB 5CJQH 2OMWA 3FUEA 4DZBB 4OKDA 4YQXH 2PYEE 5ICXA 4JDTH 2PWDA 2DTSA 1KLGA 2ZKHH 4RRPA 4NJAH 1YEHH 3MRFB 3V79C 1MCPH 1SHSA 4ZUWB 4JY6A 5EFIB 1OK8A 2OMXB 4DVRH 3OG6B 3U4AA 1U9KA 2DH3A 1CT8B 3UZVB 5E08H 1BREA 5CLWA 1VESA 4LU5L 2MCG1 4HXAH 4AMWA 1E2ZA 1EGJH 5JOPD 5DHVA 2PXYD 3T3PF 1OM9A 4UT7H 1BZEA 43CAA 3CFEB 4U3SB 5AW5B 5IROA 3GWJA 3PHOA 5F71A 5JQ6H 3D12B 3IFLH 3GSOA 1IBBA 2QQLL 4I85A 4HW6A 4J6RL 4XVTH 1MI5B 4XAWL 3QE5A 5C0CE 5A40E 2EO7A 4MMZB 4UWQB 1XF3A 2UY6B 2YBRA 5EBMB 3JUYA 3RWJA 4F8TA 4YFLI 5I24A 2XT1B 1AXSA 4OIFA 7PCYA 1MCEA 5CLZA 1CGSL 2YMXH 3OG4B 4UQEA 1LK2A 4G7YL 2RQEA 1ZWIA 5H37G 3QIUB 3EOBB 5A7BA 1GVIA 1KCSH 4UOJA 3WHE1 2P8LB 2QVFB 3BAXA 3CZFA 1NMCB 1T2QH 3WDIA 4C4KO 4HT1L 3TN0B 4J3OG 4MAUL 2Y5TA 1JPFB 4XP1H 1FV1B 1NWOA 4L0PB 4M00A 2DBLH 3TNMB 2ED9A 2YGNA 1RCYA 2H6OA 2HVKB 4H2CA 4Y16C 2Z1PA 3WN5B 3GIZL 4L8DA 4LSRH 3OR7B 1OL0A 2R0KL 4LP5A 3FTGB 5FF6B 1S7SA 5IW1A 3Q8AA 1XIWA 5D5MF 4JFUA 4MX7A 4MDJA 5DRNA 2XG4A 4R97B 4Y5YC 4ZAKA 2XV3A 3H7BA 5C2BL 3G5ZB 2FYYB 4QGTA 1NAKH 1ZE3H 3O3BA 4U1MA 2D3JA 2BX5A 2W0KA 3NIFB 4DO6A 4K8RD 4ORZC 4XMXA 5E1HB 2ZWNA 1CXIA 5FCUL 1Z66A 2JI1A 3SYCA 2CM6A 1X9UA 5IVOA 1WZAA 1QNZH 1JNHA 4JQVC 4JHVA 3LNHA 5DRZA 4IDJH 1IZKA 5H2BB 3OKNB 1GS8A 1JMZA 2CO1A 4G7VL 3K80A 2G5BA 5CKGA 4NPJA 1UVQA 2ICEB 1DCLA 3RA7H 3VXMD 1L0PA 1PIGA 1SUJA 4F9PC 1GA2A 3B3IB 4MAYC 2YPKA 4OFPA 4G8FA 3VFSB 2HMIC 3VWJD 2VH5L 1DDTA 1BFVH 5AAWC 1CDBA 3LMJL 5GISH 2WCSA 1F4YH 2DF3A 5D2NE 1ZLVH 3ZRSA 1G7QA 1A14L 3I3DA 5FKPA 3FH5A 3DV4A 4I9WE 3VTAA 4FXKC 2NSXA 1MHPH 2H6UA 2EQDA 4GQZA 1A7BA 2Y4SA 3VG9C 1WAAE 3S37H 4RWHA 2EC8A 4Z3FA 1KEGH 4FNUA 1TSHA 1C08B 4MCYB 2FT8A 5BZDB 4WW2B 4P8QA 3EOAA 4OM0H 1JZ2A 1ORSA 2P24B 3BI9X 4PJ8C 2RQ8A 5MERB 2J3SA 3IDJB 2WTRB 3DVNB 5KJRL 1SXAA 3U6XS 1PKOA 4O58H 3TFKC 2YGVA 3EH3B 2CRYA 5AW4B 5DK0A 5IJCC 1P4BL 4HPYH 2NXYC 2PWFA 3HMWH 4XPHH 1YUHB 1EVUA 1MQ8A 4NX0A 4A7GA 1NBZB 1EO7A 3MBEA 3RVUD 3REWB 4IOFC 2VLJD 3CZEA 5DD3H 1TZAA 2NX5D 4MCZB 4HFUL 4XN8A 4P2AA 4QHLB 5KVDH 4KXDA 2NW3B 4TQ8A 4WAFA 1QYGH 5EBWA 2VDQL 3OXSB 3MJWA 2ED8A 2EKJA 3E1ZA 4HWNA 4F2MA 5I1JL 2DTML 4UIMB 3Q1EA 4F9LA 4ZSOB 5IB1A 1NL0L 3KCWA 4EJ1C 2HFGL 4OCWH 1X9LA 1EIBA 2QTEA 3F7VA 3K6IA 2V33A 5SV3A 4BRVA 2BC4A 2WLJA 1X6NA 5G5DA 1KEML 1RZQA 2XXCB 2X88A 3KLDA 1RP9A 5JHLH 1BMZA 3TBYB 5LN8A 4FEIA 4QUOA 3X1EA 4P2OD 4ZX5A 2OR9H 4P9HL 1LO4H 5ERWA 5DTFA 3L7FA 4JPSA 2ZWYA 4WO4C 3D9AL 1L0XA 1AGCB 2DQCL 4LSVH 3QYNA 3MGAA 2IH9A 3L81A 3P54A 3PFQA 5DR5H 3MV7A 5KVFE 4IS6A 3FTUA 1N4XL 4G1EB 4WCYL 5K33A 3GSRB 3ATFA 2AABH 1I8IB 2DYRB 5DLLA 1WP6A 2W65B 3V4PH 1DBKH 2HYMA 1QLFA 4IHOA 1RUML 2FLRT 3CFCH 3VXTA 1NUGA 4EOWH 2Z7YA 5AVTB 3SKJL 1ONQA 3MJ9A 3DX1A 4LVOC 5GGTA 3BZFB 5IMOB 3BMVA 4RMTA 3ESPA 2WP3T 5FHBL 1IFRA 1PQZA 3KPSA 1E4KC 2NNCA 1R3HB 3RDTC 5HDOA 4XMLH 2I9TA 2OK0L 1MWAH 2BS9A 5F1OB 1OIOA 4W6XB 1U8IB 2BNQD 4M4RB 5BXFB 1Q0EA 1P7KB 1VEPA 3F7KA 3OWEA 4ADIA 1XSOA 1INQB 1OAYH 3FU8A 2B8OT 3PIQB 3BVNB 3MVSA 4XE0A 4CADB 5L0QC 4Z3GA 3H8NA 2OLDA 4Q6KA 3IE9A 1PAZA 2A9NH 1TDQA 2A4CA 2IANA 2APVA 4F7CB 2BSBA 3F2LA 4NO3B 2NDGA 3MRHB 4PG2A 4QXUH 5AQ0A 3HUJE 2QMKA 1ZVSA 5DD0H 5KYXB 3AMLA 2IJ0C 2HLAB 2LLGA 1CE1H 3E6HA 4X6CB 5EB9A 5DCCA 5IQNA 4RSVA 3MRQB 3B37A 3DX3A 2V7NA 5T1MB 4NN7B 4N90E 4LMQI 1IARB 3DSNA 1UOVA 2ZIDA 3HN3A 1BBDL 4PRAA 4WEBL 3TONA 4NIKB 4KVCH 4S1QH 2EIKB 1GCYA 3TIDA 3WNNA 1I85C 1T5XA 1L6PA 3NSCA 2Q20A 3P3YA 3CH8A 4NQCE 4W81A 1X5HA 3I6LE 4YHPA 3E6FB 3T2OA 3S36H 3US9A 1C5DB 1D9KC 3KPNB 2JB5H 4L9DA 4JDTL 4JS7A 4BA0A 1QRNA 5EIIG 4CSTA 5GJSH 5ICYA 4UIKH 4F8LA 4X8JB 4JQIL 5TQ0H 2J2ZA 4NB7A 2X4SA 4NJAL 1YEHL 2YXVA 5CJ5A 4KK6C 3KEDA 1I9EA 4L0YA 3BUYA 2VLRE 3S37X 3FCTA 2C9PA 3VI3A 1KB5L 4DVRL 1CFQB 5J1AB 2J6EA 1LJMA 3N42B 1P5UC 5IJBC 2AVFA 5E08L 1P69B 5JIIA 4HXAL 4DP7X 1GC1L 1EGJL 1M7IA 3FOLA 4F57L 4I2XB 4N5UA 5EEXA 2ZUVA 2ERJB 4UT7L 3S3JA 4RA0C 5DYOA 4Z7VA 3GKWH 3INOA 1XGYH 5HHOB 4NQED 1I1YB 3QFJD 5JQ6L 4QRTB 2HVJB 3VQ1C 2WBJD 4XN4A 3DARA 3AS0A 2SODB 1XFPA 1CL7I 4PP2A 3NJKA 3OF6A 3K81A 3O9WC 4N86A 3L3OA 3K6DA 1WAEA 3HJEA 3X13A 4ALAH 2LT9A 4NUGH 4PJGE 1LM8V 4PRPE 3SGJA 3WYRA 2CKNA 4F7TA 1P4LB 3PXLA 1TPXB 4X5QA 1KCSL 4X80H 4PP1D 5DJYB 2R7EB 5AVYB 3ZL4H 2QDWA 1FO0A 1HE7A 2VN6A 1T2QL 3P4NB 1UOLA 3K8MA 2NR6A 5I1GH 1FVDB 4DW2H 3N44B 1M57B 5B4MD 2DB8A 5AG9A 4Z77B 2FX9L 3CC5A 2DIEA 4XP1L 2UXTA 1GYCA 1JRHI 2DBLL 1CDYA 5D7IF 3US1A 3EIFA 3SYOA 3FC8A 1QA9B 1KG0A 3RUGE 2DI9A 4Z7NB 1HNGA 3H9SA 4JN1H 2OMVB 4LSRL 3U7YH 1PGRB 2WO3B 2MPAL 3DJSA 2WBKA 2G2PA 3I74A 4J3OD 1SF5A 3OPUA 1I1CA 3ARFD 3EJSA 2FTAA 2LAGB 1AZZC 5HYJD 2F54E 3O11B 2OYLA 3EYQD 3MCLH 2HG0A 2YD0A 2FT6A 4PJ5B 5ECJE 2ICWB 3C12A 5KEZA 4ODVH 4KKCC 3TTYA 2ZUWA 5FYJL 2ADFH 3ECWA 4XN7A 4WIQA 4ANXA 5ILTL 5CCGE 5DFVD 1R5IB 1DZBA 5JIPA 5JDJA 3F84A 3BWAB 4BK5C 1U8CA 4KQ4H 4OM1H 5DJ0B 1JXFA 3SPCA 5KSBA 4IDJL 2AJZA 4XMZA 1BCIA 1I3UA 1T22B 2EO1A 2NYYD 1N7MH 1KTCA 5E9DB 1CICB 4JE4B 3VFOB 4P2CG 5GHWH 1H15A 3RA7L 3WIFB 4GT7A 2EVGA 2LGNA 2FZ3A 2Q3ZA 3IJ8A 4JCWA 3F65A 5IGXH 5F93C 5E2TH 4LPUA 1BFVL 3SEPA 3I9AA 5GISL 4YLBA 3KWUA 1L9NA 1N59B 3JXAA 1BG1A 1L5GA 2XIIA 4I1NB 4PS7A 1GAFH 3ZDXB 3IJYB 3ZT6A 3S37L 3PJNA 1J7VR 1J88A 1YNLH 2F53E 4PD4K 1KEGL 4WWKA 1KT2B 1D6VL 1ZHLB 4HAGA 1ZV5A 5A2CA 1AS6A 4NCC1 4M02A 2BDNH 2EYRA 3WDJA 4OM0L 5D6CA 2JQAA 3VXUB 3WI9A 4DKFH 1T21A 5L4JA 1IL1B 1D7FA 3GIVA 1A47A 4OUUB 5JDSB 2AXGA 4X6BA 1B0GB 5DWUH 5AYUH 2J1ZA 2FNBA 4O58L 2AW2A 2VDMH 3O0RH 4LRNL 4MJ6B 3O6FB 3GSXA 2JI3A 1OGAE 3ZE1B 5T1KB 2KZ1B 3HMWL 2C26A 4JRXD 4OZIF 3S36X 2VL4A 3KPRD 1Z0MA 5GS1A 4TNWF 2HSIA 3QUMH 1KXHA 4WFEE 4M48H 4JQXC 5L7XH 2ZX9A 3DKHA 3GJFH 5KVDL 1QI4A 3M86A 4KK9D 5CS7A 1MHCA 1QYGL 4IKIA 5JZ7C 5K9KB 4F1ZA 4NFCA 4IRJA 3WGUB 4DPBX 1EEZB 1GY2A 3S2CA 4V33A 4LRIC 4OCWL 3QZWB 5JMRA 2J88H 4DPCX 3KYNA 4J3XA 2WO4A 3P73A 1JL8A 3CZNA 4PYGA 3T0EA 1CBVL 2JNZA 4YIQB 2RCSL 2VL5B 5JHLL 5IHZB 3PP3H 5F0MB 2NY7H 4HWEH 1N70A 4FI7A 1AHWC 1SUHA 1I3RA 5IMLA 1I1AB 1PD1A 1OPGH 2WZ0A 4NQTA 2OR9L 1CQYA 4O2CB 3AQDA 3M1OA 3W38A 4LBEA 4LSVL 2M1KA 1G9NC 2XV6B 4MA1B 2FBJL 3HE6D 4N9GB 2CKBL 3PAVA 1XDTT 4M8RA 4JDZA 5EBLA 4X4KA 3JWNE 1N6QH 3V4PL 1DBKL 3FFOA 5TPWH 4GEIA 4HLZG 3R06B 2CO3A 2V2XB 3KH4A 3NCJL 4EOWL 1QQDB 2AK1L 1A7RH 1NGZB 1U3HD 3K91A 4JQIA 4HUXA 5EDXA 5FYKD 5J9PB 1NGWA 2WCPA 2Q10A 4ZMXA 4XMLL 5EU5B 1KB5A 1MWAL 3QUZD 4J12A 5HI4D 1YJDH 4WKZA 1JWMA 2GFBB 4FA7B 2H3NB 1CXFA 3B9KD 2IDUA 3H55A 4HJGA 3CN3A 3R7QA 5HHXH 1OAYL 1IU1A 4XHQA 1C8PA 1QOKA 4LEBA 1I8KA 3P40A 1VGKB 4MJHA 4HF5H 3EJZC 4WJ5B 4FHKA 2E74C 3NSDA 1F2QA 3E80A 5F9AC 2A9NL 3K2KA 1PDKA 4UAOB 5F89B 2DWSA 3GMMA 4X6DF 4YR6A 3EFOA 3UBXI 4QXUL 4X83A 3AXIA 2OX5B 4XHJD 3EHBD 3CSYB 2WNXA 4UQBA 3QJHB 5E4AA 2RFXA 1CE1L 4HKZA 3NSXA 5JHDE 5CR1A 2WWOA 3NYKA 4KXZI 3SGKC 2J8HA 3SIKA 1DQIA 4U6HA 1OB0A 1UOKA 4AQOA 2CZNA 4GP8B 5JW5B 1TLKA 1FAKT 1SBSH 2ID5A 5C71A 3NIDF 1Q94A 2NTFB 2E8ZA 5GSVA 2WLNA 2XNAB 4JG5A 4GQQA 2WXRA 4EIBA 2LU7A 3U0WL 3L4WA 3OL2A 3TV8A 2O61A 4QRFA 1JZ5A 4S1QL 3PWLB 3LKQA 4UOQA 4LHUA 5D1XA 1P7QA 4JZNA 3E7JA 4EN3B 1X7QA 1R1CA 1ZY9A 1RFDH 4JPIB 2D3NA 4BCYA 2EYSA 2HUEA 4CRPA 2JB5L 4Y88A 1Q0YH 1H8SA 3A4AA 2NNAA 4FTVE 4OF6A 5GJSL 3CDGA 1T3FB 1UM4H 5GIRB 3TYFA 1ZSDB 2GT9A 2HKFH 4N0UB 3N91A 4P06A 1UZ6F 5TQ0L 4E41B 2YZ1A 5FUZH 3ISWA 4XPTH 3HVNA 4XBGB 2E86A 4JFXA 1N5AB 4Y5YB 5IROC 1YPZB 4X99B 5GS0C 3MMEA 1SYVA 2AJSH 4JFSA 3ZIMA 1TVBB 4ZMYA 1EXGA 1MFBH 1XGYL 3CN0A 1H3VA 3W81A 1X5FA 2Z7UA 3FQRB 4C8XA 2YEZB