2K78A

Solution structure of the isdc neat domain bound to zinc protoporphyrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
126
structure length
126
Chain Sequence
SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Heme-binding protein
molecule keywords Iron-regulated surface determinant protein C
publication title The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.
pubmed doi rcsb
source organism Staphylococcus aureus (strain mw2)
total genus 12
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2k78A00
2O1AA 3QZPA 4YMPA 3RURA 5D1QE 4FC3E 2H3KA 5D1XE 3RTLA 4H8PA 4WJG3 4H8QA 2O6PA 2K78A 3QZLA 4MYPA 2ITFA 3QUHA 3QZMA 2MOQA 3SZKC 2ITEA 2E7DA 3VTMA 3S48A 4NLAA 3SIKA 3SZ6A 3OVUB 3QZOA 5D1ZI 2Q7AA 3VUAA 2Z6FA 3QZNA 3QUGA
chains in the Genus database with same CATH superfamily
3HB3D 1TQWA 1MIMH 3IXAA 5J5EA 1D6VL 3VTAA 3CUPA 4UB0H 1MF2L 4LOUD 1F4XH 1OGTB 3FB7B 4G8GD 3U6RA 3D50A 3ZJAA 2VITA 3N91A 3QGVA 4TUUA 3QNXB 4FAAB 4JFPA 1RZQA 1N5YH 3EO1B 2OFQA 3K0WA 1ND0A 5F0JB 1L7TL 3OB8A 5AKSA 4GUPB 5IB4B 5DEZA 1NGQH 3IRZA 1EJ6A 2MHAA 4I0PD 2FATL 3HMWH 3OAYH 1MRDL 4DPRA 3GBNL 3WY3A 4Y16C 3GLDA 3MCKB 1FP5A 1KELH 2APXA 4N1CA 5I17B 4XXCA 2A9NH 5F9JA 4LT7A 4H7VA 2HFEB 2Y1VA 3UO1L 5DD1H 3E8UL 1FFPB 4LRIC 1HHKB 4MNQB 2EVFA 1HOCA 5DHYB 3ZE2F 3KPRA 5HJGA 3T3PB 4TV3A 1MCOH 1NIBA 3L4UA 1R6VA 3GMLA 2JCCA 1NGPH 1RHHA 4KNUA 1GIGL 3WYRA 2VSCA 2CKBA 4APQA 2R23B 3VXUD 1T1YB 2F58H 4U1GC 2F2HA 5KG9A 4NNYA 3U7WH 1UB6A 3VXMB 2BOCB 1NAMB 3QJXA 4J5VA 1N59B 5BRPA 2D8KA 1GYUA 5GRZA 4XMLL 2BY3A 4NQVA 3VXUE 5EF2A 3KHQA 1XBRA 5EU4B 4RBPK 4NDMA 4AV0A 1BVLA 1FNEA 5EF1A 2VDMH 1XL6A 2ZXQA 3ESPA 3ML9A 3PL6C 5TPWL 2G5BB 3L5WB 1T4KB 2EDYA 1KPRA 4P4RB 3CLEL 4N8UA 4GW1A 3S3PA 2DYSB 1R19A 3VFPB 4Z77B 5DJ2A 4GB9A 2JKIS 3QARA 3OC8A 5IROA 1QYGL 1E30A 3MJ9A 3VNYA 3CPUA 1SXZA 3KS0J 5I82A 4YMPA 1D3CA 3WLWD 1TKWA 1HEZB 2DLFL 4IRZH 2FYVA 1JGLH 3V9FA 5ICXA 1G5GA 1N6VA 2X2HA 4LDOB 4PPTA 1CFQA 5I6KA 3ME0A 3M45A 1U3HA 5F8RC 5FW8A 2OS7A 1BBDH 4DFIA 1XH3A 2CIKA 1RZ7L 3BFQG 4HG4K 3AWEA 1HNFA 4UT9L 1RZFL 2YXMA 3WMQA 1F4WL 4NN5B 3VJ6A 1JP5A 4M1DL 2B39A 3L45A 3WEXB 1NFDA 3UXFA 4U6YB 1KJVB 4UYPA 4UAOC 5CR8A 5IKCB 1OW0C 2DQCL 2ZCHH 4DZ8B 4N0CD 3CSTA 1BQLL 5D6CB 1K72A 3BAEH 1CFTB 3V0VB 2HUEA 1YAZA 2WGXA 3ILPA 2VDPL 4ZXBD 2KKQA 4N5EC 1FAIH 3CDFA 3RWJA 2IH9A 2BNUB 4XVTL 2FH8A 4Z7NE 3C2SA 1KXTB 3KPSB 4X5PA 3MRJA 2N7AA 3SZ6A 3OJVC 3FQNB 2J8UB 5JPNB 5IVNA 2YAHA 2G60L 4TVPL 4XX5A 1U8JB 4TNWF 3QEUA 3EYQC 3ZR6A 1LP9A 4G6MH 1MW0A 3IU4L 3WDJA 4P2OA 4DO4A 2KQNA 4QT5A 3RY5A 4JQXC 1YQVH 3KLSA 4OD3H 4U0RB 4OAWB 1FGNH 4E41D 3CHSA 1UURA 5IREA 4JDVB 4FEMA 4ADJA 3C09B 1MJ8L 6PAZA 2KI6A 3M86A 3AG4B 3QFJB 4A67A 5LGKA 2ICEA 2APSA 4KZDL 5E1AA 3LS4L 3NJGA 4XCNA 3IM1A 4CAGA 4WU5B 4E41E 3P02A 4U1JA 4DPCX 4TQHA 3G5ZA 2F6AA 2XIDA 3NA4A 3QJRB 3VMOA 3PHQB 1RU9L 2E9GA 3ZYIA 4WNJA 2FIKA 4UILL 3G6JB 3L3KA 3D0VB 3HPJA 4CJ1A 2APFA 5J89A 4OUUA 1DVYA 1FL5B 4WKXA 4ACTA 3W9DA 3VD2A 4ETYA 4Y5YC 5A1AA 3B9DA 1QWNA 5DZ9A 1QEXA 1PIGA 1QAWA 1MI5E 1PYWB 1S8DB 4UIKH 1Z9PA 5AZEH 4D0CA 2C9UA 2VERN 3CSYB 3TWCL 2Y2TA 3BPOC 5CIPH 3Q48A 5I6XB 4RGNC 1SYVB 2ZG3A 4JPVH 5CZXD 1A4KA 1E28B 2OQJB 2XN9B 4XRCB 1NFAA 2HFGH 2Y3AA 4ZFQA 1DCEA 3U83A 1FZKA 2LR4A 4JO8A 4K3JL 1MG3C 5KSAD 2NY0D 3V8OA 5HBBA 1PY4A 3KBHE 1SF5A 5A2CA 3QR0A 3PHAA 3CJJA 3LNIA 5DJDA 3EBGA 4GG8A 4LARL 4MA7H 1HCZA 4NQSA 2WQ8A 1YY8A 4NBZB 4H25B 1S46A 2A0LC 3MNWA 3DLQR 1T21B 4LL9A 1G7IB 5MEPB 1H8NA 3QIBA 5J1AA 3C60A 5K1NA 1NBZB 2YD5A 2EEBA 2Z9TA 3GZQA 3MLSL 4FFWC 3LHAA 3VXQB 3ZT5A 4JFZL 1YQ2A 4FMFA 3MRRA 1NM4A 4ODTH 2WLHA 3WFHA 4XTRC 5FUOH 1AGBA 1BQRA 1VF5C 2XFGB 5I8CA 3L4WA 1OM3H 3ZMNA 2XWTB 3DDFA 1W0VA 5DQJA 5C0AB 1XF3B 5F8QC 3WENA 4GMSL 4P48A 1OP5K 3DBSA 2FECL 5F88B 3OPZL 3QS3A 1DQJB 1U30A 3LPWA 2H2PC 4CILA 1I1CA 1M7UA 4AYID 5K1JA 3B2MA 3GUTB 3D8MA 3WUWB 4M5SA 2R2BB 3EJJX 3H3PH 3WHXA 4Y19D 1HEHC 5I2IA 1RUML 1U8PA 5E99L 1UA7A 1EWHA 5DJCA 3HUJA 5EZOL 5E00B 4DVBB 1SLXA 4C83B 4J3XA 2X6VA 1OAZH 2AP2A 3HC3L 4Q9RL 1E50A 3VA2C 3MUHL 5AVQB 2ISDA 4G9FB 1UXWA 4MMYA 4Y19E 1JYVA 3FU6A 3QEQA 3CXDL 2R29A 2DTSA 4AZ8A 2HJKB 2NT1A 3QUXA 4LPWA 4WHYG 3GFUA 4ODHH 3CDYA 3B5GA 3GSUA 2QSQA 3FO9B 3DURA 4LIQH 3KDMB 2NXZC 5ILTL 1N12A 3COOA 3O4OC 5FCUH 2GTWB 5G4MA 3RFRA 5ACLA 1NANI 2IH1A 3CLFL 4O5LL 2ZXEB 2FO4A 3P11L 4G59C 4XVJH 2J2ZA 3LQAL 4GBXD 4JFHE 2J6EH 4KTDL 3IETB 4XHJC 3NTCL 4HAGA 4LAQH 4OZFA 4U1NB 5DJXA 3STZA 1XMWA 2ADJA 4X5XA 2A83B 2VDKL 1CDHA 4DTGH 2NUPB 4AL8H 5ALBH 5GS0D 1YNLH 1MUJA 1ASOA 1QPPA 2L8AA 2QKIC 3OMNB 5TD4A 3PU7A 3EOAA 3F05A 1ITBB 1FRGH 1PKOA 4I3SL 1FLTX 2A73B 3D52A 3J2PA 3MYJA 1H9VA 3FU7B 4I3GA 4PJBB 4OZHB 2PXYB 4UQCA 2A6KA 4ZTOL 2WLLA 2X0WA 4KI1A 5K59E 2F5BH 3QQ9D 4JFUA 2A74C 1CDUA 1IVTA 3VXRB 4V1DE 2FBJH 1PNCA 1QNIA 5DURB 1Q94B 3OAUL 3GSXB 2P1YA 4X6FA 2ADFH 1BCIA 4X6DA 4OV5B 2VM4A 3L3OC 1SXNA 5HP5A 1INEH 1QSFD 3L7EB 3LXBA 4MDIB 4DAGH 3AABA 3KLAB 3GHBH 4OI7A 4NFDA 1PQZB 4BFOA 1SBSL 2BIHA 2NQCA 1MW2A 1VPOH 2CBPA 5E5MA 3RVTC 2GTZA 3PWNB 4M8RA 1INQA 1HH9A 2NMSA 5IQNA 4AGNA 2XTJC 4XB7A 3ZXAC 2LOEA 1QSFE 4Y7OC 3WHE1 1KULA 3V4PH 3RZCD 4NHCL 4IGBC 4E9XA 4RZCA 1FV1A 2W0LA 4MWFB 4XZ4A 4PEEA 4IOFC 4U6XB 1MRCL 1P6FA 4BZ1L 4ICXA 1T2XA 1RUKL 4JPKH 5DGQA 5J6HA 1P4IH 2FJFB 1Z5LB 3VWJA 2YSSB 4S1DC 3MLPA 4XBEL 1XXDC 1S9XA 4HS6A 1UWEL 2R1WB 5F7UA 3EYVB 4JN1H 2C9SA 4QXUH 4MJJA 3V0WL 4G6JH 5TQ2L 3M17A 3RVWD 3EO9L 4U1MB 1NLBH 2Q8AL 5BS0A 2ATKA 3JWDH 3FFCD 1K5NA 4ZMQA 1NC2D 2AVFA 2AEPL 5B1JC 2ZWSA 3N85L 1Z3GL 1ULVA 2NNRA 2NXYB 4LPXA 1GYWA 5IESL 3FFCE 4KKAC 5BZWB 4G6AC 1NCWL 2BY1A 1GW6A 3IJSB 4PWKA 2NNAB 4LCWA 5AD0B 1TZIA 3GLEA 1WHOA 3B2DC 3CN0A 3VGEA 3VYNA 5FW6A 5C0JB 2P24B 1ONQA 4WWNA 1OY3B 4ZFGL 1V27A 2OZ4L 3C12A 2H32A 3AC0A 4QI3A 4XN4A 3WTYA 1G0YR 3DX6A 5CZVH 1KCLA 4KRLB 3T8VA 1MFCH 2EADA 3LQMA 3P4OA 5TE7L 1IFGA 4PJAA 3DECA 2VLRB 3HAEH 4Y4HA 5I1JL 3V4LA 4BSVB 1OARL 4PVLA 4RA3A 3IMBA 1MFDH 4NQXA 4KUCD 3D9AL 1IEAB 2R0ZL 4XAWL 3JWNC 3MUGA 4ZS6D 5F1IB 1AHMA 3B3IB 4MVBD 5DD5L 4Z7OF 4JFYA 3QYMA 2FO8A 3IT8D 2K7PA 5LCVA 4QHLA 1FJ1A 2YOAA 2AJXH 3RA7H 2BSCA 2BSRA 1C8QA 4ZX5A 1BZDA 3BUPA 3B43A 3GJFA 1QVOA 4BH7B 1FFOA 2QQKL 3ZKMD 2DQJL 2NRDA 4L4VB 3MX0A 4XBPA 3IXAB 4Z0XB 3Q01A 3VQ2C 3H1ZA 3WV0A 2E7BA 3T65B 5KWYC 3CUPB 1G5AA 3FOLA 3DGGB 4TNFA 3U6RB 1NMAL 1HHIB 4G8EB 1PZ5A 2JKXA 5J3HC 5D7SL 1ZIAA 1WUNT 2XFXA 3MRNA 1E5YA 1F6LL 3AACA 4Y1AD 2AXJA 1ND0B 3UYPB 3VI4B 5BNXD 1W72H 4U7MA 5C70A 4JRYD 1XQ4A 1BYNA 3CG8A 2MHAB 3LDBC 2WYZA 3E6FA 5A3IC 1J1PH 3HRZA 4ELDA 2YBGA 3GMRB 4PREA 5E2VH 4H1LG 3FULA 4JRLA 4AVKA 4P57A 2CA4A 4Y1AE 1P5UB 4AEIL 5IHZA 3D85B 3FDWA 4K7PY 4B9GA 5AYQA 3K46A 4JRYE 4J4PD 1EBPA 3LPOA 3MZTA 1NSNL 4NN6C 1WBXA 5F9JB 5HI3D 2X44D 5FUZL 3MRLA 2NTSP 4RH4A 4TUKL 3ET9F 4LSPH 4AYBA 3CVIH 1TTGA 4WEBH 3O6LL 4YIQA 2L0DA 4GRLC 2SODB 4WUUA 2HG0A 3QAQA 1QFPA 1V55B 2V9UA 3V95A 1TLKA 1RHHB 5F7AA 3RDTA 5H4YA 4APQB 2G3XA 1SHWA 1FL3A 3DROA 4RZKA 4UOW1 4FG6D 3OKOB 2GCYB 4KZ0A 1UB6B 5D4HA 4Q14A 2Z92A 4GQ9H 3AG2B 3GSVA 5GSVA 2GC7C 3N9GH 4JHWL 1QTPA 4JPWH 1HZKA 4IBSA 4RWYL 1MCFA 3MUZ1 4OQTL 4NQVB 2X4NA 5MP6L 2CRIA 1X9UA 5AENA 1MCBA 4KJWD 1T6VN 4NDMB 3MLVL 1BVLB 2ADIB 5I74C 3UIYA 1U4EA 1F6AA 4UQDA 4Z7WE 1KPRB 2AITA 4AMWA 3LHPH 4AVJA 5ABDE 1DSFL 4NWTL 3NN8A 4YUEH 4XN2A 2MPAL 1NFIA 3TZVD 4AE0A 3F7KA 3IDNA 5F89B 5ADOL 1KB5B 3NJLA 4MYPA 4PGEB 2XTJB 4MZIA 3CFKB 4R90L 4YFLF 4JRWA 4FADA 2WNGA 3ZU8A 1NWOA 5ICXB 3UACA 4HJJL 2UXVA 1RZJL 3B9KD 4P23D 1CFQB 4LSVL 3DX2A 2ICES 3P73A 3ME0B 4IGBB 5BO1L 1YNTB 4DF9A 1MIEH 1Q38A 5AW3B 2CIKB 3ARSA 4P5MA 5I8KH 4JKNA 3VI3A 1MSPA 2YD6A 1E4KC 3L2LA 2GBAA 4CGUB 4EVNA 1YEEL 5JMRA 1QSZA 5DK0B 4PJDF 1WH0A 3MJ9L 2HH0L 2BHUA 1L0QA 4WFFD 2V17H 3JZYA 3UP1A 5A2IH 3O3UN 4IJ3C 3QZLA 3WG7B 1H8SA 1QEWA 2WZ0A 4A2LA 1TQTA 4RFEB 2A2QT 3MV9A 4KO7A 4Q89A 3DYPA 1IBYA 2Y1YA 3QJUB 2OI9C 2XNAA 2CO3A 4J3VA 3C5XA 3BMWA 2M26A 4WFFE 1MPAL 1U8HA 3ZN6A 2X6MA 3RWJB 3H7BA 5GSRA 5I1CH 4JJHA 2OL3L 5FA4A 1BPLB 3S4SB 1F45A 4AQAA 5IFHL 1UUSA 3V0DA 3KPPA 4TQEL 1F8TH 1ZMYA 3TN0D 1EGJA 3VMPA 2CIIA 4HWUA 5GZNC 5DUML 1BA9A 2I07B 3PGDA 2VMFA 3BZFA 1J9SA 1LP9B 2VRQA 3P9LA 1I9RL 3NEEA 3L7FB 4MJ2A 4QT5B 4OZIE 4IOSD 1VKXA 3NZHL 2DH3A 1WAEA 4FXGA 2C7UB 1UD5A 4XNYL 4X6BA 2VLKB 1I75A 2PO6C 2CXGA 5T1LA 2J1ZA 3H4FA 3BEWB 3QCVL 2ZOKA 4HULB 2XKUA 3VDBA 1BZQK 3NIFB 3APMA 3M07A 1Q90A 4XMKH 3WIHA 3VFVA 1F3RB 2ICEB 2MTAA 4NKQB 5E1AB 1XSIA 5F9WC 2NY5L 3B4NA 4FXLA 3WN5C 3F7PC 3BZEA 1HCVA 1WZ1H 4LL1A 4U1JB 5D72L 4HMCA 5EIIG 2F5AH 2QQNH 4ABQA 3AXHA 5IMOB 1FE8L 5JW3L 1S6NA 2E4FA 1H3PH 2AGJH 1BDYA 3L3KB 3V0AC 2E9JA 4ENED 3NGBB 1XF2A 4OUUB 1C12A 4PD4K 3W9DB 5CM1A 4AG4L 1OWWA 2HAZA 1J8HD 1A7QL 4YHZH 4L1DA 2RBLA 4M6NH 1OCWH 2EUZA 4YN3A 2GY7B 4NUJA 3GQFA 4ETQA 4M3KB 1KGCD 1LO5B 4JFWA 4WI9A 1SJVA 4M1CC 2VR5A 2NYYC 1I3VA 5IB3B 3ETSA 3NACL 4HKBA 3WMPA 1J8HE 1KJ2B 4QJ3B 3Q13A 3RUGF 5AW1B 1V3MA 1D5IL 2E6QA 3ECUA 3GZKA 1KGCE 1RLWA 1FZKB 4ES9A 1RUQL 4C4KO 1I3GL 2XQBL 3ZDYF 2Y5QA 2EIBA 4JRXB 3SBRA 4NERA 4KXBA 4KZCA 1ICTA 4GG8B 4QTIH 5I71B 5EOTA 3GC3A 1G6RH 4NQSB 1XCWA 1YY8B 1DJHA 1IB5A 3NDYE 4TSCL 3HC4L 5LBSL 3HFML 5FYKD 5GRJH 1XZ0A 2Q87A 3DARA 5J1AB 3C60B 1DN0B 4POUB 5FKAA 4XB3A 4PJ7E 2VMCA 1ACYL 3MRRB 4G1EA 3D48R 3WFHB 1B0GB 2FQFA 5H2BA 1AGBB 4AUYA 2FL5A 5FYKE 3UTPD 1RUAH 4BKTC 4I18C 2I60L 1W0VB 5DQJB 4KKLD 1Y18A 1W0WA 2XYBA 2UUDK 1OLZA 3C9NA 4NZRL 1OQXA 3MGOA 3WE6B 3APCA 4WWKD 1ID2A 4CRPA 5E94A 2ZJSL 3AM8A 3UTPE 4UV7H 3MLWL 1A1MB 2K1MA 4WO4B 1L9SA 2OXGB 3JWNH 2QADB 4GRWH 5CGYC 2BNQD 2WQVA 5I24A 4PWJA 2ADYA 4AQEA 1JSYA 2JKRM 2ZXWB 3D2UD 3FUMA 3QUMH 3HUJB 5EPMA 25C8H 1A3QA 4P49A 4P9HL 1A8JH 1UKSA 2BNQE 4AM0A 4FABL 4YC2C 3CFBB 3UTOA 1E4JA 4FFVC 2I5YH 1QLEH 2R0WL 1CD0A 4J6RH 1NFKA 3GRGA 1PD6A 4KXZI 5FKPB 2YKKA 4UIMA 2XVKA 1L0YA 3I02A 2P4AB 1XGYL 1ADQL 1BM3L 3LXCA 4F33A 1CLCA 5D1XA 2IBZX 3TJHD 1AZRA 5FYJD 1COBA 4ELKB 2KT6A 1E6OL 2IH1B 4F57L 5KN5B 1FNGB 2FO4B 3GTNA 3CN1A 3PUUA 2J2ZB 4Y2DB 5TFSH 5EBMA 5JMOC 5C0EA 3MV01 3DUSA 1UOKA 2YQGA 1N8ZA 4DKFL 2H1XA 2LFEA 3Q9PA 2ADJB 4X5XB 3WKQA 5FYJE 2YMOA 4AITA 1ML0A 1U33A 3LD8B 3IVKA 1A5FL 1MUJB 2AXFB 4PJGB 4Y5VC 3L5XL 3VVWA 1MCNA 3SE3C 3RAJL 2OR9L 3KHOA 2A6KB 1QA9A 3G5YA 4PW3A 5KVDH 3VACA 3M7FB 1RY7B 2BLFA 2R56L 1OAYH 1PZ3A 4IRZA 5D2NA 2Z65C 1K4CB 2ZSWA 4IIQA 2NDGA 3KPTA 1J48A 4NQCA 3F7QA 1NDTA 4X6FB 1CR9L 4F2FA 3FNKA 4XN8A 2Y22A 5AW0B 4FTDA 1FO0H 5M95B 4DIXA 2X1XR 3JWOC 3IU3B 3MBXH 3ULVD 5IUCA 1EEZA 3RWEB 5I0ZA 2F8IA 1T1ZB 4JFED 2FAUA 3CK0L 4U1KA 5E5MB 1LO0H 2GTZB 3VD1A 4LLDB 5B22A 4NRYB 1HH9B 3PWVA 1PZSA 1EEQA 4JX0A 4BRVA 1MWOA 1OT4A 3FMGH 4HS8L 1DVZA 5BRZB 1ZT4A 4HJTA 1U8LA 4B0MB 3ULVE 5CCKL 4GQRA 4JFEE 2X3BA 1DZ0A 1PEZA 4X4YB 4MA8L 5LWYH 4A63A 4LCCC 4AE1A 3MSPA 2WXOA 2B08A 5FB8B 2W9EH 1ERNA 3DXAA 3S97C 1Q9OA 2FLMA 4AVHA 5IQMA 5KTEH 1GJUA 1MNUL 3HNSH 4RMWA 4W4NA 1WA1X 5DD3H 1ZTXE 4HS6B 2OXHA 4WDIB 4K94L 4P5TC 1CICC 2C9VA 4FFZL 2AEQH 3IMRA 4PV8B 1N10A 5EEVA 1WZMA 2MH4A 1S7QB 3M17B 1DHKA 4KK6C 3GI9L 2P5PA 5BS0B 2ATKB 1IGJA 4JG0H 4P4KA 1K5NB 1I8UA 2MJWA 4AW7A 2EIEA 1ET7A 5CNHA 5EU3B 4D3CH 5AFAA 2A9BA 5DS8B 2YLKA 2HB0A 4FJ6A 5FOJA 4F93B 1ZLWK 1JRHL 4AOFA 4LCIH 1KEMH 4UDUA 1FNSH 2I7OA 3NAAH 2WCPA 2DWYA 2Y6SC 1IFHL 2C9AA 4BSJA 2WYIA 4BZ2H 3R1GL 4IBTA 2R27A 5E8OA 4LCWB 1F4HA 1BM7A 1TZIB 1NEZB 5JHLL 4GXVL 1OTUD 3NJNA 2YPLA 1PD0A 1CFVL 2MCG1 4Q6KA 3G3LA 4LEXL 2E46A 4TNVK 2YA0A 2EXYD 3BD4A 4L2LA 2IDUA 1FG9C 2H32B 4W9DC 35C8L 3IE4A 1S7UA 3DX6B 4X50A 1NCBH 3NCXA 2EC9T 3SYCA 5HGGS 3MACL 4QXTB 4PJAB 3CZKA 1FDLH 2PLTA 4IIZA 3VFTA 3FQUA 2NY6D 1B2WH 4HDIA 2Y7OA 2FQGA 3DTXA 4WI6A 5GRVK 3QWOA 3KPNA 3MUGB 5E8EB 1NKOA 1MCWM 3BD5A 4MDJA 5CIPA 4JFYB 1OGSA 1KUMA 2X1QA 4U3SA 1F3DJ 4DP7X 3TT1L 3SHSA 1JMXA 3QFGA 3A67H 1K2DA 3GJFB 3O2VL 1QVOB 4M8VA 3UJTH 1DEEB 4ZZKA 3P77A 3ZKND 3MX0B 4LGPB 1N2RA 3QULA 4XBPB 4F20A 4FFYH 4QRRD 4R26H 1YEWA 1ZS2A 3FOLB 4WJG3 4HWZA 1AKPA 1AI1L 3FTZA 3SDCC 3SY0A 1PZ5B 4GYBA 2X3AA 5IJKC 4CW1A 2NY1C 3BQVA 4XOCA 4YSSA 1NOLA 1C7TA 3M1OA 2XFXB 4KROB 2VDRL 4QRRE 1H3WM 2V2XB 4YK4B 1INDH 3FT1A 3VD7A 1OCRB 3HRZB 2WBJD 3ZE1B 1QFHA 2UZYA 3FCGA 4PREB 2HPOA 4DEUA 5D2LF 3CVHL 3WO4B 3C5JB 5L2KA 2C3VA 4P57B 3PIQA 5B21A 5HYJD 2PP7A 5IHZB 1NMCC 5L0QB 3ZSSA 2NZIA 2YQ2A 1PFOA 5KVGL 5E8NA 2BW5A 5F7DA 2VGLM 3ARBD 4UM8A 3FBQA 3MUY1 1GGIH 3MRLB 2OMWA 3C5ZA 3QAZC 4DP6X 4F7EB 1PD1A 1BSIA 2I32A 2R8SL 1M53A 5D7IF 4Y5XA 4OGXH 1C5BH 3FO2B 4LP8A 5F72S 1AFVH 2WSKA 5EEUA 3RDTB 1ORSB 4ZAKA 3MLRL 3L16A 1T20A 3BVWA 5HVHC 1E5AA 4M93C 1E6JL 3DROB 2E7HA 2K6ZA 3ARZA 1F02I 2BVOB 4K23H 4YHPB 4D9LH 2Z92B 4IHBA 3GSVB 4EF3A 4GAYA 5T33L 2H1PH 1XGRA 4YDJB 2ZUUA 1DQIA 2GJ6B 2X4NB 3DJRA 3DX1A 4NZTL 3RY4A 4KTGA 2G30A 2X4RB 4FLRA 2WPGA 3CX5K 4JJ5A 3FAXA 1WBYB 4PJ8C 1CBVL 4OCSH 2QELA 5EUKA 1KWKA 4HBCL 3F65A 2P46B 1QRKA 4PRHA 4AXWB 5B3SB 4OLUL 4YFLI 2ZUWA 2HVBA 2J6EA 3IDNB 3PJLA 5C07A 3C6LB 5DEGB 1DVXA 1M3IA 3GO1H 4Y16A 5JIDA 1CK0H 1T66C 5I30L 1CUOA 2V3DA 4UTAA 2XBDA 1CCZA 4PJFE 1U8KA 5C6PB 1TTBA 5IQOA 3L1EA 4DWHA 1NEPA 4GJTB 4A7QA 1QLFB 3P73B 1RIHH 1JG9A 3V0EA 1CE6A 1C5CL 2K7QA 1TFPA 1T83C 5GRYA 4P5MB 3U4AA 3VI3B 2VW7A 1FNFA 3U0PA 5KANG 3IGUA 3KEHA 1UZ6E 5SV3A 4Y9CA 2DD8H 1J86A 1B2YA 1EJOH 2C26A 3WFEL 2X4TA 5DVOA 1TJMA 5IBLD 1QI3A 1DQLH 1QEWB 1Z9MA 1PFCA 2P7TA 3MGTA 2IWKA 5C8JA 2AV1A 1R3KA 2HJFA 2DEXX 5EFIA 4G6FD 4UWQB 2HMID 3BVUA 1JDCA 4KDWA 2LLGA 2XNAB 4I4WB 1BJ1H 1RZ8B 3IKCA 4QAWA 2RCSL 3OM3B 1E3XA 2VW4A 5FOBA 3E3QC 2Z31A 3B34A 5CZKA 3TO2A 3WFDH 3AFLA 4ALAC 5F3BB 1V7MH 4JQVA 5GSRB 1W8EA 1I7ZB 1PEWA 1I7RA 1KY7A 1D2PA 2OW6A 4FNLH 1LEKA 1GRWA 2XY2A 3V4PA 3KPPB 1NA8A 4JUSA 2GITA 3QO0A 1MH5A 4P9ML 2MOGA 3VGHA 2DQFB 5EORL 3BZFB 2A6DA 2R2CA 3V7AG 3P9LB 4Z7VE 1J9CT 5GJSH 4FHBD 1VKXB 3U0WL 3VGFA 2ESVD 1FYTD 3F12B 3N50A 4FXGB 5K9QI 2A99A 4WO0A 3WTWA 3PRZA 4X6BB 4IK6A 3JQOB 5LDSA 3X2QB 1TR7A 4KHXH 3GSWB 5JOEA 3TNNA 2ZICA 3JTBA 5IMMA 1BOGB 2BWQA 3PHOA 4F37K 2IGFH 2ZOKB 5D93B 1JFQL 2ESVE 1FYTE 3C08L 4N24A 2CR6A 4N1EA 3MBEC 3BZEB 4KH2A 3RWDB 1JHKL 5HD8D 1X7TA 4LPUA 2BFVH 3MCG1 1XF2B 1M1XA 1B6DA 2YGNA 1KTCA 3EYSL 3I6LD 4KXZH 2C9XA 1BQUA 1RSYA 4JLRA 3UTSA 2DWDA 1CD8A 4HKZA 5F1OB 4L1TA 2WAHA 2DIJA 5I1IL 2WBKA 4NUJB 2P80D 3ULUL 2F53E 2EE2A 2DIBA 1BGXL 3HS8A 2FLRT 3I6LE 3FUKA 4MQSB 4HG4J 4IRSA 5GPRA 1VHPA 2L7QA 4PJ6A 4FQIH 2JJSA 2NY1B 3D30A 3LNDA 3L3JA 1A2YA 3TESA 4XN7A 2V6HA 2JF1A 4DGIH 3IKKA 1IEBA 3GDBA 1VLXA 1OE1A 2J5LC 3HAEA 4TVPD 5E23A 2VDNB 4JQXA 4PJEF 3S34H 1IGCL 2APBA 2YLHA 1R5IB 3BKJL 1KIPA 5ERWB 5I1GL 2ROYA 3EKCA 4A6YL 2GPZA 5BO0D 1CQYA 5EOTB 1YEJH 3BC9A 4UQBA 3BVDB 4XC1H 3LRSA 4TVPE 2Q2EB 2PCYA 4NHUB 3KMDA 3LH9A 5I18L 1XZ0B 3QUZC 4KBPA 2ZWZA 5AVSB 2EZ0D 2QVKA 3QAZB 4WEUD 4IBYA 1BEYH 3ML8A 2HTKC 1G6VK 1OEZW 3SKJH 1DTUA 4KTEL 3NJJA 5FM4A 5H2BB 3O0LA 2ADGB 2KZBA 3OZ9L 4LPCA 5CSBA 3LEVH 5IR1A 4XZUA 5K33A 4OF7A 3D4ZA 1O0VA 1Y18B 3HG0A 2MEJB 2EDEA 1SVBA 1NC4D 1W72A 1LVEA 3A23A 3F5WB 4HF5L 1TCMA 5GQBA 1IQDA 3ZUCA 3C9NB 4FYQA 4HUKB 4X6CA 1D9KC 5DVKA 2BJMH 3MGOB 4EN3B 3DC0A 4F80A 3QFJD 2J1KA 4LASH 1MIML 3BWSA 3AS1A 2HFTA 4KQ3H 1O6SA 3K71A 1GTFA 4UB0L 3RTLA 3W39A 1JV2A 2NUTB 1Y0LA 4EBQL 2EUVA 3P2BA 3OF6D 5SX4I 5GS1A 2PYFA 3OTTA 1U95A 3QFJE 3S3JA 1QRNE 5D8JH 3PPEA 4PJ9C 3U9WA 2R1XB 3QJSB 1QPKA 2IPKA 1NGQL 3AB0B 4NN7B 4AM0B 3T0EA 1R33A 4ZUTA 1VSCA 5SWSA 3ZE0F 4D8PA 2C8NA 1VFAB 1LYQA 2AQ2A 4IRJC 4OF0A 4PVNA 2VQ4A 5JYLA 1N4XH 3ARFC 1KXQA 3FHQA 3G6JE 4UIMB 1M7XA 4FKKA 2Y7NA 4M6OH 3I02B 4EN2A 1KELL 1BPVA 1CI3M 3RGHA 1GSKA 2XZCH 1CFSB 5EU7C 4UQIM 3MLUH 4NKDA 2A9NL 1MCLA 4ZUSB 4OY9A 1DJGA 5D1XB 1X6LA 1QLRA 3ILDA 5IBTH 4MD4B 2XN9D 5A2KH 3QJZA 2UVEA 3KM2A 2EYTB 2JB6A 2W60A 1M2VB 5C0EB 4HUNB 2KERA 2D9CA 2G2PA 3DUSB 3ZTNL 1PX8A 15C8L 1N8ZB 4GKSA 1OAUH 3WJLC 2DTMH 4ODXA 4JR9H 2QTEA 4ODWB 2XN9E 3IVKB 1EAPA 5C92A 3O6FA 1NOFA 4WNSA 3L6FA 1UT1A 2DQEL 1GR7A 3IGAB 1WBZB 5EULV 5J7CC 5I1LA 1A6WH 1HJBC 4ACPA 5DEJA 1IAII 2C9RA 2P43B 5D2NB 4IIQB 4PS4L 4NQCB 4X9IA 1KYFA 3FN0H 4P2RB 3HE7C 3UZVB 4JFXA 2VDML 4Z1PA 3RWFB 3RNQA 1LE9B 3GMNA 1CDCA 3IDXH 1YUHB 4UQEA 5C0AD 3VGAC 2Q7AA 2YC1A 1WZAA 1T3FA 2WXLA 4JVWA 4NO0A 5IVZA 4QRPA 4B27A 1CXIA 4P07A 1Q0EA 3O11B 2X9WA 4ZMTA 4ONFL 3VFRA 2A77L 3HG2A 4N0RA 2BS8A 4LVNC 4IRZL 1JGLL 3BP5A 1ZT4B 2Z7ZA 1U8LB 3EGSB 4F2MB 3G5XB 1P9MC 3QHTC 1JZ5A 1H3VA 4LGRB 1KB3A 3ATFA 4B3EA 4PJXF 2ITDA 2XA8H 5CEXB 3V52L 3DXAB 2EQDA 3IF1A 1Q9OB 3UMTA 4RETB 5LGHH 1AXTH 1BYPA 3A0OA 4YJZL 2GFBA 4PJDB 3CHPA 5KYWA 2DWSA 4KK8D 2OXHB 4X8XA 3OZLA 1NEUA 2QKIA 3HZKB 4HK3N 1BZEA 4GS7C 4PJIF 1TMQA 1B90A 3DMMB 4OUOA 4P4KB 4AYFB 4DQOH 4CUCA 5C3IA 3H2WA 4MLIA 1W9XA 4BEIA 2W0FA 5HXMA 4E36A 3ZGHA 3ZTCC 1EXGA 3PQYB 4MCNA 1P7HL 2R4SL 3L3OA 4M6MH 2OM5A 4PCTA 4QF1A 2O5YL 1OOWA 2L7JA 3UDWA 1JK9A 4FZ8H 3H9SD 4B9FA 3S88H 1MAMH 4XNMA 4QTHB 2WIMA 3GYRA 5CD5D 5E8OB 2FBOJ 2O26U 5JOFA 4LOEA 2YAPA 3T2PA 3BP4B 2DAVA 3KPOB 4KMQA 3S3SA 2LV4A 1OV8A 3B2PA 3F6LA 5ABZA 1QZNA 4TQPA 4K7FB 4NENA 1YQVL 1UD6A 1KV7A 4PJCB 2GABA 4YDIH 1PLCA 3MJ7A 4OD3L 1X9QA 3H9SE 4OGYH 3VRJA 3P9WB 2ICWJ 2XZQL 4BQCA 1UXSA 1VAHA 2LT9A 3OXSA 3VXRD 2OBGA 3LH2L 2ED8A 4F7CB 3O81A 5I19H 3BEVA 1CL7H 4E2OA 3QUZB 2XICA 5C97A 3S3CB 3NZUA 4PJBE 4OJAA 4NX0A 3ZW3A 2WN2A 4KY2A 2RB8A 1WLHA 3JBG7 1ZLUK 4FQHB 2GUOB 1TZ8A 3SO5A 2CJUH 4PHXA 4MDJB 4U3SB 3ULSA 1BECA 5I5RA 5IB2A 3F58H 3FRPA 3IEAA 2GBVA 2IALA 2VRAA 3P77B 2AJVH 4I0KA 1D9KB 1K8IA 1LO2L 4U4BA 5B1JA 3PWUB 5I8EB 3AT0A 3ZIMA 1CLOH 3KJ6H 4DERA 5IMLA 1I1RA 2N7SA 4P99A 4ZODA 4AVIA 3OVUB 1FPTL 1AGCB 4L3FA 2X0VA 4UDTA 5L7XL 1E90A 1G6RA 2Q7NA 1M4KA 4CW1B 1I1FA 3EF7A 3FCSA 1Q9WB 2YEZB 3T0AA 2PN5A 4U1LB 3HHSA 3TV3H 3RUGB 1NIDA 1LO3H 3S6CA 5C6TL 3MJGX 2HFGL 1IBHA 1SLWA 3DV4A 1G1YA 5J1TC 3DX0A 1OZTG 2UZYB 3TURA 1I9IL 4ABUA 3MRIA 5L2KB 2C3VB 2PTTB 4L8BA 2WMPA 1JN6A 5IVXF 2YKLL 1X7QA 2GY5A 5IF0A 2E7DA 5AAWC 1TUPA 4MA7L 2WB1A 3NIGB 5HJ3B 4M1GH 2NXYD 4UNTA 1AG0A 4OFDA 1PG7W 3NSYA 1YYMH 2PMZA 2NW3A 1LE5A 2OMWB 3RKPA 3C5ZB 4NJAH 3CZJA 4J3OG 1MG2C 3BCDA 3CVBA 2NR6C 4L9LC 3IAQA 4ODTL 4ODSH 2LVEA 4XP6L 4GPVA 3PPSA 4PYHA 3UYRH 4HPHA 3DA0A 5HHPA 4HD5A 3OJDA 4HU8A 1E9PA 1D7BA 1FH5L 4ZAKB 4PRNB 5F93C 3ZL4H 1TU2B 3BHBB 2P26A 3D0LA 2DYPB 2LGNA 3QH3B 5DJAA 5A6LA 3QUMA 4UM9A 4GUQA 1BVKA 4ZSOE 4E5XA 1PAMA 4ZFZA 1IC4H 3NABH 5GGQH 1IAOB 3BQUC 1TZHA 1IM3D 4MXQD 1SY6H 1BD2A 5SWZA 2CGRL 3EGDA 1F4AA 3L4XA 2YRLA 4GAYB 1KTLA 3Q3GA 4Z78A 1CFNA 1KLUA 2YD4A 2EYRB 3S96A 5CF3A 4YSRA 5HYSG 3GS4A 3S37H 1A7NH 5D1QB 4OW6A 1TNMA 2XVLA 1SUHA 4KJPC 2ZCLH 1CF1A 4PU2A 2WLNA 1UH3A 2N1TE 2ZX7A 4QHUA 3WUWG 4X7TB 1G1CA 3BN3B 4H8UA 5JZ7C 1ZAGA 3T1WA 1KTBA 1OAZL 5C07B 1QNZH 3BW9A 2H26B 4L4VD 3ZHDA 3N06B 3MI6A 3SYOA 3II3A 2F74B 3ZDWA 4HX1A 4ODHL 2AEOA 2VZ3A 2HFFA 1ZSDA 2IPUG 3TFKD 4ELME 1MQKH 1DANT 4JHZA 1QFWI 4WW2B 4ZPVB 5FF6B 3GPEA 3ZTDC 1MHEA 2ZT9C 3EO0A 4G43B 5HHNA 2G3ZA 3B2UC 5JW4Q 4TTGA 3NRQA 4I77H 3A47A 1FHGA 4BQ9A 1AKJA 1CT8A 2X4TB 3AMLA 4QXGL 5IQ7H 4LAQL 5FYLL 4ZMXA 1WO2A 2GVYA 1FO0A 5C8JB 5GIRA 2AV1B 3MR9A 4F8OA 1R3KB 4DTGL 2COQA 5ALBL 1TYEB 2CCLA 5EA0H 3DHMA 4KK9D 4N3TA 4Y4FB 1CGSH 1FRGL 3EIFA 4JDTL 2NYKA 5FOBB 2Z31B 3K2KA 4P2QA 3RGVA 3TO2B 1IKFL 1NUGA 5DMYA 1JNLL 1OCOB 1PTZA 1F3DH 3IDYC 3IMSA 3OKYA 5IFAL 2WC7A 1I7RB 4PJHA 1NMBL 2FBJL 3KPRD 4H40A 4QOKA 3Q1SL 2GITB 3QO0B 4O4YL 2J71A 3ARPA 4QGTA 4K5PA 4PTUB 4G7VL 1INEL 1ITCA 4XOEA 4TN9A 5EUOA 3VW3H 2A6DB 2FTAA 4TQ8A 4F5CA 3MRDA 4A37A 1DBJH 3BN9C 3KPRE 5F1NB 2A9CA 3TYGL 2JCCE 4AKOA 2DQHL 3PDOA 4OCRL 5MENB 4G9DA 3DVNA 2E9BA 3TNNB 2ZNXA 5IMMB 3PHOB 3V4PL 4Z7NF 1ORQA 1DL7L 3ABMB 1F1AA 3K1KC 4TXVB 3HS0B 3CWGA 4Z7QF 3ESMA 4JPKL 1P4IL 3CXHK 5IROD 1WVZA 5JXAH 3SDXF 1OP4A 5DUBB 5M7QA 1HXYA 1M1XB 4QXUL 3WKPA 4NFBA 4BZ2A 2BNRA 3C2AH 5I16A 4JLRB 1H0DA 3I6KA 2DWDB 2EDFA 1BFTA 4HKZB 4G6KL 1NLBL 5IW3A 3A4EA 1HC1A 4PLKD 1U3HD 5C0DB 5L4JA 4I5BA 4EDWL 2BIIA 3P3UA 4WHTB 2BMKA 4OD2A 4IRSB 5GJTL 3LN5A 1LK3L 5B1BB 2VLJA 3L3JB 1A2YB 3J7HA 1A7OL 4KVCH 4WW1A 3VAEA 1IEBB 4UTCA 3DOSA 3HAEB 1XF5A 2ICWI 1U21A 3LPGA 3QJOA 3WIAA 2VOTA 2XI9A 2XQYG 1AQKL 3RIAK 1NFDE 4L8DA 1CTMA 2YPVH 5DZJA 1B9ZA 1SJEB 1V3KA 2PO6A 3QJFA 2HRPL 4XNDA 1IIKA 3CHXA 4WF7A 3BX7C 4FF9A 1IAIH 4FQ1H 3LRSB 1THAA 1CZ8L 4I89A 3NJIA 2K0RA 1SZNA 5JO5A 1YO4A 3P4NA 2YJQA 3PP3K 3CFTA 4OIFA 4L5FH 1P4BL 1TVBA 4M4PA 5LGYA 3ARDB 5D4QA 3OHXA 3KLLA 1MEXL 4FFYA 4K9EC 1TCRB 5AVZB 1UGKA 5HHMB 5BUGA 5F7EL 5G4NA 3WEOA 4P2OD 2OK0L 2K45A 5IR1B 1J1XL 2P9RA 4A7VA 2JTDA 1N18A 4DK5A 4W6XB 2PCPA 1IEHA 1A7PH 5J11C 1CLZH 1UZGA 2DPKA 5MERB 4MBOA 5A7EA 1DQDL 4X6CB 1TQBC 1V3JA 2VDLB 1B0RB 4HFWB 4N2GA 4YXLL 2VXUL 4GEJA 2Q3ZA 3WJMA 1WSST 4QNPE 2B5IB 5KW9L 2CHWA 3FSOA 2WWMD 1BF8A 2VQTA 3W39B 1YEIH 5AL0A 4AIXA 4Z7UA 1FIGL 3FZUC 3K72A 2Z91A 3NIFE 4OH2A 1HZLA 5GS1B 2PYFB 3FU5A 1U95B 4B5ZA 1ZLEA 1JTOA 1Z32X 4NC1C 4GINA 1E4HA 1F5WA 1V05A 3KDPB 2XN0A 3T0EB 4PD4J 2Z3FA 3GZPA 2WWOA 4ZUTB 4EI5C 1UACL 5KYUB 1Q0XL 1R3IL 2L7UA 1E0OB 4G7RB 4H0IA 4YDZA 5I6OA 3V79C 5DMIH 1IAIM 4Y2LA 3I2CL 3KYKH 3BSZH 2NY3C 2L04A 2WKOA 3TEUA 1HYSD 1G7LA 2QGBA 3A4FA 5T1KA 3QZPA 4PI0A 5KVFH 5FDWA 4LSPL 3CVIL 3VD9A 4MBRA 2JB6B 2W60B 3IDJA 5T1MA 3HEIB 3UOAB 5K39A 1J9QA 3ZK0A 2YHGA 4KNQA 4I18A 4GKSB 4KRPC 4OF3A 5I73C 3GIZL 4RBPH 2CDEA 3Q5TA 2Z7UA 2CBMA 3QUYB 1EAPB 5B3JF 5HI4C 3O6FB 4ZT1A 3IDIA 3S8WA 3QQ3B 2A6IB 2FQDA 4ZDHB 1ID5I 2Y4SA 4LAJH 1J18A 3RJOA 1PLAA 3QIBD 3C60D 4MB1A 4Q2ZA 5I1LB 4NT6A 4KJQC 4W9FC 3UADA 3GDCA 4S1RL 3S36X 5JDSA 4KUZL 4XXWC 1O6TA 4B41A 2CDFA 4R7DB 4JFXB 1CGVA 3QT2A 2CNZA 2H0EA 3ATAA 3FH8A 3NIDB 2XWBA 4L37A 1OP3K 3MHZA 5B1KA 2OJZH 1E43A 2VYRE 4YUEL 2YC1B 4MAUH 2J8OA 4D7BA 2MWCA 4NO0B 3AAZA 1KYOK 3M1CA 4QRPB 4KVPA 4HK3J 3O8XA 4BIKA 4QDGA 5K59F 4ZW3A 3C8HA 2R0KH 1KV3A 1RUPH 4Q97A 4XMUA 1J0YA 1V3LA 4P3CH 1RIUH 1OT2A 3KWVA 3QDAA 3SDDC 4N90D 1MIEL 2XIIA 4XN1A 2R69H 2HT4D 3HR6A 4X98B 3RHWK 3ARUA 1MJUH 4AV5A 4P46C 4MS8C 4Z3TA 1HX0A 1SOSA 4IU2B 3V6ZA 5DZLA 1MWAH 2GFBB 3Q2LA 2WV3A 3FT0A 1NPNA 3GEWB 1CVRA 1BLNA 3ZMEA 2CLZA 4PY8J 5F1SA 3THMH 4N90E 3QEQD 4JW3A 3SGKC 2WP3T 4Y5VA 1KBGL 4U2YA 1CGTA 4C54A 4JG1L 3HUJE 3QUXD 4FRWA 5EU6A 2VXVH 4XGZA 2ODHA 5ISZA 5DTFA 4APXA 1J5CA 4NRXA 1DVFB 2BP8A 3L3DA 3WCYA 3WXWL 4PBVC 3QEQE 5D96C 1MRFH 2EKSA 3BAJA 1ZV5A 2FUTA 4GSRA 4PV9A 1LEIA 2P8PA 3O3EA 4L8SA 1FQ9C 3S4SG 5TF1L 2JELL 3EJZC 1K8DB 2Z0UA 2I69A 3KVDD 4TKWA 4WUKL 5JOFB 2X4PA 3BDYL 4HD9A 2N7BA 4ZJ9A 3LKQB 4YE0A 4L0YA 1A4CA 3X3FH 4NENB 5HVFB 2IBGA 3VRJB 3QXVA 1XTMA 3TVMB 1G7JA 3OXSB 2IANB 3LKNA 1FG2B 1QACA 4LCCA 3BEVB 2HVKB 5D5MA 3X12B 4AKPA 4DVRL 4FA7B 4XMKL 1ZKAA 1LWRA 1BZ8A 5E2TH 1NDGA 4FQQA 1KIRB 3WD5L 1MREH 1WZ1L 5H4ZA 1A9VA 1IC0A 4N26A 2XPYA 3ZDXB 1JF6A 5BUPA 1B4TA 4X6DE 4FLQA 1OSZA 3ULSB 1TXKA 2AGJL 1G7MA 4LCYB 5IB2B 4HALA 3FRPB 4L3EA 4LSTL 3E7JA 2IALB 5BRQA 3SBWC 1MCEA 3DX9A 1AC0A 5ESAA 5LG6A 4NC2B 4YHZL 2G9KA 5KOMC 3T3ME 5IMLB 1F2XK 4OCXH 1HNYA 2ZUQC 4GFTB 3LMJL 5T5NF 1EZSA 4FNPA 4PCKA 1PZBA 1G7HA 4UDTB 4G70B 3VWJD 4HOWA 2DQUL 1L6XA 3WDHA 1DLFH 1BQHB 3HHSB 1BXVA 4MA3A 1GJWA 1XDTT 1FFQA 4YO0B 2C3GA 5FA3B 3D4GA 5HJBA 3N1QC 1F42A 5DZAA 3DV4B 1SXCA 2F0CA 1X44A 1T0OA 2YD0A 5SX5K 2AVGA 1FSKC 3VXTB 1TETL 5BS0D 1UG9A 4KUCF 2ICWB 5ES4B 3MRIB 4LESA 2E74C 3N0AA 3EDJA 1HAUA 1R5VA 2C4XA 2WMPB 3QXDB 4JZJB 4L8BB 1U93A 4QTIL 4YHML 1MI5A 4EEEA 5IF0B 2CUHA 2H4EA 3IN0A 4HXBH 3KL0A 3LEYH 4B97A 4JG5A 2BRRH 3QORB 4D7PA 1OP5H 1S7TA 1WIUA 4KITB 5BS0E 1NUNB 3G5WA 3CV5A 4HWEH 3BZDA 2HTLD 3FFDA 1KENH 3ARGA 4LCWD 2AK4E 3MLXL 5DRWB 2HJLA 2JE8A 1UCBL 1BAFH 2P8MA 3LZRA 4GRWB 4I13B 5HHPB 5DMKB 1TQCC 4UTBH 1MHHA 3OJDB 4H0HB 1LM8V 5DA0B 2QLYA 3DBXA 3NFSL 3WFZA 4UM9B 3AGVA 4PLJD 1BVKB 3MZGB 4F37F 3D25A 4WSJA 1RJCA 3HBZA 4LCWE 1DE4A 2VABA 1WTGT 4M03A 3Q1EA 1AO7B 2QGDA 1KTLB 2VN6A 3MA9L 3Q3GB 1CFNB 1KLUB 1QLEB 4Y4HD 3FU0A 5BCAA 4QAMB 2XPZA 2IPUK 3AU0A 2A9AA 2RALA 3RVUC 2Y0SA 4Q4EA 2BZDA 2CH8A 4G5ZL 3DX8A 2W59A 3QUML 3K74B 25C8L 4L18A 3D3VA 1H5BA 1KXHA 1O9ZA 2QKSA 2WNXA 1UB5A 5FHBL 2BCKB 3BW9B 4G7SB 2A5UA 2VM3A 2VN7A 4QWWD 2ITCB 5F9OH 1N67A 1IC7H 3K6FA 3N40F 3SJVA 4J6RL 4HJUA 1KXVC 5B4MD 1ZV9A 3UERA 4D8OA 5EC2B 2PYEE 1IM9A 1ZSDB 1A02N 4RAVA 5J13C 3B9VA 4X5WA 2B77A 3UO8B 4NNPH 4P46B 5HDBB 2DMKA 3UTTB 4BRJA 1EUTA 4LOUC 3FSVA 1AKJB 4L3AA 3HE6C 4JFDD 5DU7A 4YR6A 2V9TA 2FZ3A 2VDOL 3R18A 4LSUH 1B4JH 4Y19A 1AR1D 3CFQA 1M57B 1FO0B 1TJHL 2R1YA 3V6OA 3QIUB 5E4OA 3VD3A 1RERA 3NH7H 4XVOA 4Q58C 2E56A 4NKIH 1ED3A 2VH5L 3RGVB 4JFDE 1RJYB 5AZ2H 2XV2A 5DO2D 2K6YA 4S0SD 4RQQA 4PJHB 1D6VH 2O5XL 1E5CA 3Q5OA 2AABH 1MF2H 1O7DE 3B6SA 4YHLL 4ZMNA 1E42A 1KG0A 2XV6B 4WUUD 9CGTA 4UZSA 5DYOA 2FK9A 3DVGB 5TF0A 1S5HB 5EUOB 3RDTD 2NQDA 3B83A 2B3RA 1JV5A 1DDTA 1L7TH 3ZOAA 3GNMH 3D34A 1ZVYA 2XWJB 3HCVB 4C4KT 1GJIA 3MFFB 4ZUUB 1LO0L 3W0WA 4OIBA 4W9ZA 4CVWA 4WUUE 3HG4A 1MRDH 2R59A 3F7VA 3WNKA 4G9DB 4R2GB 1WUZA 1W8NA 2YSTA 3DVNB 2GHZA 3LQAC 4EQ2A 3FMGL 5DC4B 5KVEL 1ORQB 4ZNEA 3OR6A 4V1DA 1T83A 2QBWA 3T8XA 2Y5EA 5D6DA 5LWYL 3RX9A 3KBPA 4PY8I 3UO1H 4MSWA 1NCTA 5JLZB 2W9EL 5DWPA 1TYRA 2E7MA 4DEWA 2KC0A 1XCXA 3KLKA 2WANA 4U6HA 2DW5A 5I5IA 4OZIF 1WAAF 3I85A 4XCEA 4OKVB 4N2DA 1HXYB 4PS3A 4XAKD 1IT9L 4K8RC 3BUDA 4BFIA 1GIGH 2VWEE 2BNRB 5J1SC 2XQYK 3I6KB 5DK2A 2J5WA 4GG6A 2MCPL 4H88L 1GL4B 2CBTA 1I3RA 1XIWA 2BIMA 4O2FA 4YGAB 3C8DA 3PHSA 4XAKE 1PVHA 4I5BB 4MMXA 1R17A 3WLWC 3WUZA 3I3DA 1R3JA 1PF3A 3ATEA 2BMKB 3LN5B 1T5XA 1YMHA 1NCIA 1R47A 4HJSA 1OAXL 1CF8H 4RDBA 2VLJB 1A7RL 2VR6A 1XGUA 2X41A 3NDZE 3NAAL 5TPWH 3SKMA 4JFFB 2D7NA 2C9QA 3DOSB 3K2IA 4R9HA 3CLEH 4R97B 2LVCA 1MLBA 3VX0A 1AOHA 2KMWA 3MV9D 3BWUF 1JWUB 3QEGL 1DBKL 1KMGA 1RMFL 4F27A 4KJYB 1T7ZA 4TQIA 1RKRA 1QYGH 3QJFB 4JO4L 3LH8A 1EEYA 2X9YA 2D9QB 1YJDC 2HSIA 1NEZG 3MCLL 2FX9H 4QD2E 4F58H 4F8TA 2DBLH 2C1PB 3HKZA 2DLFH 3QQDB 4N0CC 3GINA 3S9DB 2QFPA 3MV9E 3P4NB 2O61A 5LG1A 1AGDA 2ATPA 2P42B 1W80A 4OT1L 1TVBB 3MBEA 1CDYA 2CUAA 3OHXB 4ZXBC 4NNXA 5JOPD 4JN2A 3LVTA 1SMOA 5I1EL 4UT9H 1PW3A 3IBOA 5CEZH 1RZFH 1F4WH 4BWWA 4M1DH 2QDWA 2PW1A 1A6PA 4LEOB 5HYEA 3BLBA 2CO1A 1PAZA 2OAAA 3C6SA 4OZGA 4QHNA 3RNKB 2DQCH 4GI9A 2DKMA 5F97E 1BQLH 3O3DB 5T1LD 8FABA 3US9A 4POZD 4E68A 5I28A 3UJTL 2H47C 3PGFL 4P5RA 7PAZA 3BAIA 3WJMB 1GZHA 2GIXA 2E0PA 4O02L 5KSBB 2BVPA 4R26L 2W80C 4RNRA 3RVXC 1QOKA 1A6TB 1AP2A 4TM9A 4XVTH 4ZMVA 3QG6A 4MFHA 4Z7UB 1P7KA 3K72B 4YHIA 3WS3B 3MRKB 2JTYA 4YZFE 2VLMD 5AW2B 2H9GA 3VG0L 5CN3A 3FB8B 4W93A 1CDIA 4NZUL 3FU3A 4MLSA 4P0DA 4P2CG 4Q6IB 1INDL 2RMNA 1RFDL 3X1FA 4JKLA 2GK0A 6PCYA 4NOBA 3U4KA 4AT6B 4R4ND 1RPUA 5AQ0A 1U92B 2VLME 3UTQA 3GXUB 4KDVA 3A5VA 3E0GA 2X4SB 4HQQL 4MJIA 4NIYE 2CHNA 2Y1AA 4Y1TA 2E27L 3RTQA 4FYTA 1L3WA 3DSNA 4IHOB 5DZNA 5F7FA 1MJ8H 1UHVA 3I9GL 5IQ9A 3EUDA 1SY6A 4NCC1 1IFRA 3DGCR 3RWGA 2EE3A 3FQXA 3E1ZA 5T1KB 3HB3B 3NCJL 5FDWB 3X3GL 5KBPA 4IBWA 4OIIH 2VUKA 3DUUB 1F00I 2HT3C 3AGWA 5CAYB 4QYAA 4BFGA 2ZUXA 3O6ML 2CDEB 1BWWA 2CCVA 1RU9H 3D69A 4CGTA 2WWKT 4HCRL 1RP9A 4XCYA 5IHUL 3EYOA 2D0GA 4G8IA 3TIEA 5JIIA 1R3LA 3IDIB 4I0PB 4KXAA 3TBSB 1I1AC 4K23L 1JZ7A 5EBWA 2EXSA 4IEFB 1HIML 4H8WC 4Q2ZB 1Z1WA 2H1PL 1L7IL 1JK8B 2AKRA 2E7LC 1SPDA 3P30L 3RYMA 1OAQH 1J05A 3VH8A 3O9WC 1CYGA 1JZEA 3DDGA 3KYNB 4YVUA 3W5MA 2FEDD 2XWBB 5KJ4A 4OCSL 3FT9A 3MUUA 2KPWA 3TH2T 3U7YL 5TQ0L 1P6WA 1O5PA 2UWEF 3BKYH 2CHXA 1ZWIA 4RMUA 3TA3A 1E9QA 3APNA 4LARH 1A64A 3CNKA 4PGDA 5C3TA 3VXUB 2AQQA 2VXQL 1S2EA 4P59H 3MNVB 3IPEA 1J0IA 2JKWA 3IJEA 4Z7WA 5CJOL 4B9YA 4LSRL 4FS0A 2G4GA 5F0MB 3ZO0A 4B95C 3K8LA 1G7QA 4JFZH 3WJLA 4ESKA 1A65A 4QCIB 3VRLE 4HOMA 3WIFA 2CLZB 2Q1EA 1L4IA 3BE1L 4MNGA 1ZLVK 4ODVL 2OX5B 2J7LA 1TTRA 5I0DA 3U48A 1KT2B 3T4AA 8CGTA 3QZWA 3IE9A 4N8VA 4UYQA 4XGZB 5GS2H 4G80B 3WELA 4HJIA 5ISZB 5DTFB 2PP9A 3OPZH 2AJ3A 2OMXB 2BC4B 2W65A 5T3XL 4M7LL 4JFOA 5D1XD 1WICA 3KWUA 3QWQB 1V7ML 1JUFA 4PBWD 2CHDA 2F7RA 1SJMA 2YK1L 3HE7A 1FFNB 3KLQA 4FKHA 4L48A 2MQGA 5FFLA 1LEIB 2P8PB 4YBLB 4ZO9A 2XPGA 4K2UL 5K9OB 2IBZY 4L8SB 1Z7JA 4XX1G 5D1XE 4KQ0A 4GO6B 3KW7A 1WDAA 2BIQA 1KTDA 3L5HA 3OAWA 4JEGB 5EZOH 1UT2A 2APTA 5H94A 3KR3L 4GBXC 4HUXB 3REWA 2V2TB 3RVVD 5F6IC 3HC3H 2CCWA 4DKDC 1T0PB 2XA3A 3HW7A 4Z18A 3CXDH 1G7JB 1HL4A 4WI4A 1KGYE 1D5ZA 1UJ3C 4NQCD 4RFNC 2IGFL 2AEWA 5D5MB 3V5DB 3JWOL 1QSEA 3UBHA 1NUFA 4DEPC 3CFCL 1L5GB 3I6GA 3U30C 2N59A 2QDVA 5ILTH 4NQQA 3RG1C 1NDGB 4FQQB 4AUUA 1CDJA 1N5AA 2WXFA 3CLFH 4O5LH 1JWSA 5D2NE 1O9WA 4YBQC 3LQAH 2FJSA 1AQHA 1GMEA 4KC3B 4HZLA 4KTDH 4AQ1C 3TN0A 2HLAA 3NTCH 2BFVL 4H2CA 4UNVA 4FQJL 3V4VL 3OV6A 7CGTA 2VDKH 4ZQTA 1WGVA 2XWEA 4RVBA 5ESAB 4LHUG 4PCSA 1OHQA 2VDQH 3CMGA 4TRPH 3SCMA 4A2DA 4I3SH 5BUAA 1GS8A 5DC2A 4X9HA 2YPVA 3ZRSA 4E41B 1IGTA 4WI0B 1F3JA 1G7HB 3DXAD 4M43L 4ZTOH 4FP8L 4LKXB 3RZCC 4GI8A 4K8RH 3JZ7A 4J27A 5HGDA 5IFJA 4MQXD 4OJCA 4JY4B 3S98A 2MQ0A 2YXFA 3KWXA 3MGAA 2DS4A 1SBSH 2ZXGA 4HWBL 2FX8H 3TT3H 3RWHA 1R5VB 2E8ZA 1U93B 3VWKA 1CN4A 5DD6B 1MI5B 3QXAB 4IM8A 4H26A 3GGWA 2FJGA 3RZWA 3RVWC 4Q0XL 4NHCH 3TCLA 3GTTA 4GP5B 3U1SL 3D1MC 4BZ1H 3FFDB 3ARGB 3L5IA 1RUKH 4WHYH 4DP0X 1BEYL 4LBAA 1BJ8A 5CEYB 1A7BA 1WE5A 4NKMA 1YJDH 2X40A 1MHHB 2YPLD 4XWOC 4YDKL 4DGVL 4WTXA 1MCIA 3DBXB 1UWEH 3VXPA 5HHOA 3M1BA 5J6GA 4YXKL 3RI5K 1G9MC 5I8OL 2V8LA 2B9BA 5TQ2H 2G4EA 3FTSA 4AM0Q 1EVUA 1T0MA 2NY0B 3EO9H 2OYPA 2Q8AH 5KSAB 1SRDA 3ZDZB 2YPLE 4MCYA 2WXKA 2DL9A 2B4CL 1OTTD 4NGHL 2AEPH 4N6RA 4PJ7A 1UFUA 3FTXA 4FQPA 1DSWA 5BQDA 1Z3GH 4Z3IA 1AGEA 1JCKA 4FEIA 3LVEA 1OSYA 5IESH 2K3HA 2WQSA 3SD5A 2WZAA 3QO1A 1OCCB 4WZ9A 1NCWH 5D8JL 5E24E 3QHFL 1CGYA 1H5BB 3S48A 5L9DH 1FC2D 4D0BB 4H5SA 4WV1B 5JPMA 1AGFB 3KL5A 1AIFA 5AAWA 1BFSA 4Y4KA 3EOBA 4CMMA 3GK8H 3DPDA 4HJ0C 5IHBA 3VQ1C 1WFOA 3BWZA 4N22A 3DJTA 4AQ8A 4M6OL 3Q8EA 4LSSL 4UNUA 3MLUL 4M48L 1JYWA 5TE7H 3H6JA 4L9LA 3UGXA 1ZVNA 3QRGL 1PG7X 5I1JH 3RIAF 1T04B 1OARH 4ATTA 2X2JA 2QR0B 3WSQH 2JJVA 4BHUI 2W9DL 3SO3C 1L9OA 3WHE0 1IBBA 2FZ3B 3D9AH 5L2KD 4Y19B 1SDDA 5DD5H 3VUAA 3IMTA 3MOQA 4PW9A 2PPDA 3BQUA 2FB4H 4D9QE 3DK2A 1YPZE 2YWYA 2QEJA 5B38A 1TJGL 1OO2A 5GGSA 1ED3B 1HI6A 1Z9SB 2MKLC 2QQKH 2UYLA 4JDZA 2X2IA 1HVXA 3NQIA 4R3SA 3C5ZD 2EEXA 2ZKYA 5L2KE 4OGZA 3QE5A 2D7MA 3B6SB 1UZ6F 1NMAH 3OQRA 4U0QB 3F01A 4XNAA 5HI3C 4KV5E 2IVFC 3VFMA 1O7VA 4ZI8A 4RDQG 1RLBA 3G04A 4B3VA 2R69A 1JV5B 5B7EA 4DW2H 5KYXA 3IDXL 1EQWA 2Z8WC 5JW5B 2O5NA 4JO3L 1E7VA 4H8WH 5J57B 3QB7C 1TMCB 4OCNC 4YDLB 1MWAA 3QRFM 1SXBA 3F7VB 5DJZA 3AY2A 4PP2A 1P5VA 1R1CA 4AEIH 3OR6B 4V1DB 1NSNH 5CFHA 1ZCRA 5FUZH 2WIIA 4MSWB 3QIWA 1TQSA 2FDBP 3ALPA 1AHWC 4PRHD 4U6HB 5ESQB 1AXTL 4KJWC 1ZLWH 4XCEB 5C07D 2EACA 3S5LB 1A6AA 6TAAA 2ZF8A 4LFHD 4Y16D 4LIQE 3NOIA 4BFIB 1QSFB 3QI9C 5D1ZC 3N2JA 1M7IB 5DK2B 1ZANL 4GG6B 5JHDE 1L9TA 2XG5A 4PRHE 1G9NC 4TNWK 1I3RB 1XIWB 3TZVC 1YN7B 2AS5M 2W1NA 4QR7A 2HN7B 4MMXB 1EXUA 4H20L 2G2NA 4L1BA 5DFVD 1R3JB 3FAWA 4JHWH 4RWYH 3B9KC 1MFBH 4ZUWA 4OQTH 4P23C 4BFJA 3EBHA 3RZCB 1A4BA 1WD8A 2WQUA 1WFNA 3UG3A 3MLVH 1AS8A 3RU8L 3HI6H 3K80A 4FZ8L 2Q6WA 3H4HA 1BF5A 1MAML 3DIDA 1PIFA 1DSFH 4NWTH 2AEIT 1PU0A 4WCYL 3LCYA 2MPAH 1KB9K 2X4QA 4ALAL 3ZPDA 1I4FB 4NSKB 3FOMB 3GSNA 4DPAX 1BG1A 2FJHB 5ADOH 1N6QL 1NCDL 2Z31D 1IBGH 4YDIL 2BS9A 4JUTA 4R90H 5ESVA 4NOFA 4EE2A 4HJJH 1URLA 1RZJH 2TRYA 2E6JA 2ZX8A 3QDGA 4ZS7L 5BO1H 3L1FA 4H1LH 3KD4A 3FFCB 3UG4A 2YAEA 3G7TA 1XGTA 3GJFK 1NC2B 4JN2B 4JL2A 4LE8A 5JW4N 1Q9KA 1JGVL 3FSAA 2NLJA 1YEEH 1YECL 2B3IA 1Q9LA 2Z35A 3EF4A 3WNMA 4QHNB 2AJZA 3JTSB 1S9YA 4L1SA 3NPZB 2FRGP 4DK6A 5CCJA 3QZMA 2YS4A 4KAQL 1MCPH 1TNNA 2H6UA 2MSPA 3KJ4B 3RHWF 4L4TE 3UX9B 3UBXA 1MPAH 2BVPB 2YQBA 1OF0A 5LAPA 4A7GF 2OL3H 3QG6B 1LEGB 5IFHH 1P7KB 2H8PA 3CXHJ 1G4MA 1I7UA 2H9GB 2HP4A 3TV3L 1IBZA 2WK2A 4UOW0 3JV0A 2J8UF 4K3EH 3MC0A 5DUMH 1OP9A 4X2UA 3BWUC 3TBWA 3O2DL 3UTSD 2GSIA 3DYOA 3QNFA 1HSAB 2GK0B 5IK3A 3DO7A 4Q9CA 4N5ED 5DHMC 3RGBA 3VCLA 5LAXA 4UTBA 3NZHH 1RK0A 3IFPA 5E9NA 3UTQB 2G9HA 4XNYH 4XI5C 4DCQA 5PCYA 3RTQB 3QFDB 2XXGA 3NA9L 1AQMA 4IRSD 4M1GL 3UTSE 4HZ1A 4UINL 2XZZA 3ZZ1A 3D4YA 4JDEA 1A1NA 2IFFL 4X0KB 3FQXB 1VENA 1QMUA 1S7RA 1YEDA 1EDQA 3BGFB 4WFED 4WI2A 4YFEA 2NY5H 4LEBA 5DDHB 3FQTA 2VE6A 5D72H 4QIRA 4ODSL 1EHAA 2GSGA 1FL6A 1AMXA 3D69B 3VFUB 3EDKA 1HT6A 1FE8H 5JW3H 1AY1L 2UZXB 2CO6B 4Y1AB 3G6JF 4WFEE 1LNUA 4XCYB 2WAQA 3W81A 4JRYB 1R3LB 3NABL 2YAOA 4ZD3L 1A7QH 2ERJB 4RA0C 5D7JA 1S7VA 3HHRB 2HRGA 2OSLA 4UT7L 4BK5C 5L6YL 4FNUA 5C0FA 2AMGA 1OM9A 1G9MH 2HX7A 1ZGLM 1LK2A 1FVEA 1D5IH 2JH2A 3KPQB 5AB0A 4GSQA 1RUQH 1I3GH 2HZHA 3PAUA 3TEWA 3FL7A 4X6EA 1FZOA 1VERA 3C87A 2LQRA 1R3HB 1ZWIB 3CN4A 3QUKA 4YOKA 4UU9B 2WN3A 4Z95L 4A39A 2NY4C 2CAKA 4I7ZC 1T6WA 2IH3B 2ZX9A 4KKLC 5J56B 5F7YC 3WNNA 4TSCH 1AXIB 1DQTA 3LV3A 4J3OF 5EG6C 5B8CA 2GK2A 3HC4H 5LBSH 3Q0HA 3HFMH 2PWEA 4ISVA 1Z9NA 1HXMB 4WWKC 4Z7WB 1HKLL 2MRYA 1WFJA 5JUEL 5BV7C 2A38A 4U4IA 2Y36L 1G7QB 3ISYA 3T0ED 3N04A 2W94A 3VSQA 3WIFB 5SWSD 3NSFA 1IL1B 3GBML 5ENWA 3K5RA 1DBML 4KK5D 2I60H 3T4AB 3DETD 3L3GA 1U42A 4PJFA 5DJ0B 3RBSA 3SOTA 3T0EE 1HWGB 2XSKA 5SWSE 2F1BA 4JFOB 4POYA 2ZJSH 2DIAA 2WLMA 1JUFB 3MLWH 4XXWA 1KXQE 1YZZA 4XTRD 1ZE3C 1PDKA 4P23B 2OMYB 4WY7L 2JWYA 2KDGA 4ONHA 1WTLA 3SQOH 2OULB 5E6UB 3TJHC 1RK7A 4HIXH 5HI5D 3TBBA 3VW3L 3SDYH 3N0PB 3Q6GL 2AQRA 5C3LD 2WXGA 2DEWX 4U1HB 2H2PD 1DBJL 2WINA 3VXSA 4FABH 4HK0A 2R0WH 4DESA 1KPVA 2MQCA 5KANI 2WHVA 5EO9A 1D5ZB 5JXEC 4N2OA 3S35X 1QSEB 1XGYH 1C1EH 3SEPA 1ADQH 1BM3H 1I3UA 3GKWL 1XZWA 3FO0L 1V7NH 1EO7A 1N5AB 2WM0A 3KNBA 4DOHE 1U8MA 4MCZB 4N2BA 1JWSB 3ZL1A 4HIHA 4NO0D 4TULL 4OZIB 2BSTA 2J25A 4QRPD 4AV4A 4LP5A 4WI5A 4WNQB 3TN0B 7FABL 1KYOJ 1HILA 1SVZA 1NBYA 4DKFH 4FZEL 3NIDE 4LKCA 2X05A 4MD0A 3TBYB 3QWRA 4A7SA 1AD0A 1SHMA 1UENA 2EO7A 3C2AL 1FORL 1TIUA 3DJZA 5F0PB 2WUBL 1A5FH 3NT0A 4NIKB 1QBLL 3SCMB 3L5XH 4QRPE 3CFJA 4CL7A 1JZJA 2OR9H 3LZFL 3EYUL 4PJBF 2F19H 5DYFA 1F3JB 5GGVY 5I66B 4FQXA 2R56H 2VZ1A 1T03H 3LEXA 1V8HA 4AQZA 4XHJD 4NKOA 1PX4A 5IFJB 1W6WA 3HBPA 5E03A 1IJ9A 1HINL 3UP6A 1EZUA 4TUJB 4K5OA 5IJVA 2Y7QA 1LHZA 5L8JB 1ZOXA 2I9TA 2VXSH 1GMIA 4UT9A 4YH6A 1KWGA 3CK0H 2AXWA 1UA6L 3RWHB 2YPVL 3HAEG 3VWKB 5ALCH 4OM1L 4IBZA 4LOVA 1AE6L 2F53A 4OLZH 5E9DE 1IAIL 5T5FH 3CDGB 3GGWB 1UD2A 5B1AB 4FXKB 5IT2L 2FEEI 5CCKH 3MRMA 3TCLB 1J8HB 3F7YB 2EILB 4LBEB 4MA8H 1IILE 4J8RB 4B96A 5JIMA 3FH7A 4RGOL 4ZPTB 2OSWA 3OAYK 1R0AH 3RVTD 1JGUL 2V4LA 4NKMB 4IKLA 1BV8A 1MNUH 1TEGA 1YYLL 3TNMB 4XP1H 4X4XB 3VTTA 4YXHL 2GIMA 3UEZA 5HHOB 4FFZH 1GKOA 3SBWA 4CADB 1IUZA 1A7PL 1GS6X 1CLZL 4EMZA 5DJYB 2BS71 1FZMA 5DWUH 1KLGB 4JREB 4IKKA 4MCYB 4ZW7A 4K5MA 4N6RB 4PJ7B 4WI3A 3P3RA 4KOCA 5TH2A 1LMIA 4BV1A 4MQTB 1JRHH 2L4OA 2Z4QB 3E2HC 2XVGA 4XMPH 3N44B 3QO1B 1IFHH 4PRDB 3FT3A 3FONA 3R1GH 4JHAL 4L0ZA 1HL8A 2NY6C 4X8JA 4P5KB 1JWMB 4GXVH 5JHLH 5JPMB 4H5SB 4RISL 3AT8A 1AIFB 3KYMA 3CSPA 1CFVH 4FD0A 4Y4KB 3QCUH 4CMMB 4LEXH 3N6YA 3B1TA 4WEMB 1EBAA 2EDWA 2WW8A 2WUCH 3HZYA 4KKAD 1MCWW 3BCFA 3BSZL 3KYKL 2X1OA 4N4YB 1DFXA 5IMKB 3FTYA 4KY1H 1CIUA 4FL4B 4JGUA 3MACH 4LF3A 1PLBA 1QRNA 2JXMB 5KVFL 1K5WA 1VZGA 1XF4B 3ENEA 3H9HA 2BNQB 5KYYA 4NZJA 4PVMA 4XNQA 1NPUA 1SDDB 1AC6A 2CJTA 3TH3T 2ZYRA 2HUHA 5CCHE 2AQTA 3LNEA 3TT1H 1ZJAA 4I2XA 3RILA 4BUHA 2YN3A 1TZGL 2Y23A 3O2VH 2WBJC 2VL5A 1F0LA 3VFWA 4R3SB 1HQ4B 4DN3L 2EICA 5DEFA 1ETZA 2F8XC 5AW5B 3SKUD 2A6JA 3AWFA 2IMNA 1YYCA 3EFFB 5CJXC 3FQ4A 4UUJA 1S7XB 3ARBC 3D06A 5D7LE 1E27B 3BPCA 3B37A 3G04B 4PMFA 2VDLL 2VDRH 4FERA 1LO4L 1EZVY 2PWDA 4UM9D 4PY7A 5KYXB 3ECBA 3VI4F 3GHEL 3QCTH 4MAUL 4PTTB 2KZ1B 3JWNE 1MWAB 1OGPA 1BD2D 4ZX4A 5E4AA 1JHTB 3F7LA 5SWZD 4V2CB 4I1RA 3VU1A 2JSFA 2H3XC 1P5VB 3DVFA 5J3HD 3ULAB 2P8LA 4J39A 1RUPL 5J12B 1HK6A 5KVGH 3HC0B 4NI6A 1BD2E 3BUYB 2AAAA 2WIIB 2IPTH 5SWZE 1OCZB 1NCCL 1OB1B 2X4OB 3QIWB 5G55A 1E3ZA 2R8SH 4LLMB 2QMJA 3BIAX 6FABL 3HE6A 5CSGA 1EO8H 4DKEH 3BH9A 2C5DC 4BCYA 1S9WA 1MXDA 4N85A 1F6FB 3U46A 1ILSA 3H9YA 3THML 1VADA 1HE8A 1J8SA 3NFNB 2KH2B 3A21A 2WVSA 3BGMA 2IFGA 2VXVL 4JFEB 2NX5A 4CVXA 2BSEA 3I6SA 2RQEA 4MJ6A 3QRLA 1EXUB 1RPKA 4U31A 4PGBA 4RRPG 4JMNA 2GC4C 3UFIA 5DK3A 1YRKA 4NZTH 2ZXAA 2K4AA 4HPYL 2A9DA 1QABA 1AKJD 1GYVA 4LCUA 5A2AA 4WQOA 2Q6WB 1GHFH 3RY6C 4DP2X 2ZPKH 3ROLB 2D03H 3TJPA 5IOPA 3UIZA 5KVDE 1I31A 2X4QB 3EYFB 3T1FA 2GEEA 1ZLUH 2YRZA 3GSNB 3IN2A 2WXIA 1A3ZA 1T89C 4P2QD 1BQKA 2WLYA 3RGVD 5IBLC 4B7LA 1I1YB 4N2IA 1M7DA 1JPFB 1VACA 5I30H 2CLVA 1VFUA 3FB6A 1AAJA 1DDHB 2GEQA 2HMIC 4JL1A 1I8KA 4QOKD 1TEFA 3TV8A 1BLIA 1C5CH 1VRSA 3LKSB 3L17A 3KM1A 3QDMA 4N5UA 1G1OA 4P2QE 2F08A 2XN2A 4PJHE 1MREL 4GO8A 5JW4R 5KVEE 4PRPA 1C16B 4JPIA 4QOKE 3Q8CA 3BPNC 3OZKA 2WWNA 1BEXA 3ZKQD 3WFEH 2EVGA 1R46A 3MRPA 1T0NB 3BH8B 2X4UA 5I15L 5E8PA 5DZVA 3ZHNA 1ZS8B 2NSQA 5HY9B 2RCSH 3BGAA 3UBXB 4AYDC 4FNRA 1QFWL 5F6HJ 3RIFF 3UABA 2BY2A 1BIIB 32C2A 1RURH 2B1OA 1KJ3L 2YUZA 4MQ7A 4M00A 1I7UB 5MI0C 1DLFL 5KSUA 2X3CA 1HDMA 3OGOE 4XO4A 3L48A 1UEYA 3T0WA 3ZE2E 4BZ1A 1KGIA 2BNRD 5EORH 3TF7C 4G3YL 5EN3A 1BQHG 1LP9F 3FO1A 3DO7B 5HD8C 1I8MA 1DUZB 3VCLB 3U0WH 5LAXB 1NZRA 2AZAA 1TZAA 3NZSA 2G9HB 4YPJA 4DCQB 2HX8A 1XMEB 1XTLA 4NI3A 4YVNA 2BNRE 5HHQA 3L81A 2VLJD 2YEQA 1A1NB 1U3NA 2J57A 3NIFF 1JFQH 3RL2A 3RWCB 4HWEL 4QRRB 1EFQA 3FQTB 1F18A 1KENL 1MVUA 4K3GA 4WTQA 2E9IA 2VE6B 3SDXA 3VE0B 1JI1A 3IPBA 5I9QB 3QUGA 3D87B 1BAFL 4AH2A 1FL6B 1QZ1A 4NN5C 4YE4L 1JHKH 4EQ3A 1R24A 2YOCA 5CD3A 2PO6D 2XVBA 3HTLX 3V6FA 1IO4C 2YFNA 3IFLL 1LNUB 4W68A 4J7RA 5HYFA 2DWEB 3EYSH 3NQKA 1ASQA 2R9HC 3AWGA 3JVGA 3WN6A 4X8CA 4OCWL 5BPPA 3IWVA 4K9EL 4QXVA 5I1IH 2N3JA 2ZYIA 5D7JB 1NJ9B 3KGSA 4JO1H 1JZ2A 1S7VB 1WS7A 1XGPA 3ULUH 2OSLB 1D7FA 3MROA 5E6IA 5C0FB 2OZ4A 5JHMA 4YGVB 2VSMB 1VEMA 1A4JB 5FGRA 3QQNA 4TPRL 5E6SB 2Y69B 3CMOL 1LWHA 4PBDA 1T6BX 1LK2B 5JPNC 1FVEB 5C9JA 3STLA 4QRTA 3OKEA 4NZDA 4ZSOA 3TH4T 1JIBA 2EH8L 5TTRA 3T4YA 4S11A 1IGCH 4A2FA 3QUKB 4PRBB 3BKJH 5D7KD 5I1GH 3AT9A 4A6YH 4M1CD 4U0RC 5CS7A 4DT2A 4OFYA 2ITFA 2V3FA 1BWMA 2APVA 5DRZA 2PCXA 3C09C 5B8CB 3LV3B 1JBJA 4GXFA 2P5EE 3K1DA 4KX9A 1RZGA 4ISVB 3W57A 5I18H 2CMRL 3IWUA 5D7KE 5L8LB 5C1MB 2J20A 4HUWA 4G83A 3LSOB 2W0PA 4JJOA 2EYSA 3SE4A 1TSHA 1Z9LA 4F1SA 4MHHG 2BIOA 2BWIA 2YGPA 3CFMA 1NIFA 1YEFL 2BOBB 4WKZA 2QFRA 2YBRA 1EX0A 5ENWB 5BVPL 5FO7A 4TUOB 4HBQA 4PJFB 1I1AA 3CHOA 5INDB 4XR8C 3T77A 4HF5H 3VXNA 2WLIA 1LD9A 3F00A 1UQSB 4XMZA 3DV6A 5A2LH 4GKOA 4QRFA 5AZ2L 1WD9A 5T1KD 3SE9L 1UVQA 2IBBA 2WBWB 3O9WA 1U91A 2AABL 2BM3A 4YLBA 5BZDA 4TF4A 3ILEA 2YZ1A 1BG9A 1F58L 2OYKA 2YMTA 4ONHB 5I6XC 3IRPX 3TWYA 4EBQH 5D70L 2YRBA 3RI5F 4LLQB 4W4OC 3HUJF 1EANA 1X4XA 3GNML 2WQWA 3SGEH 4XHQA 1M56B 3II1A 2WINB 4OD1H 1J0KA 4LXFA 3HN8A 3ARXA 2WGNB 4HK0B 1OF2B 1I8LA 2VR7A 3Q6FB 5CGYD 5CR1A 4BELD 3ETBF 3IGLA 2X70A 3ARVA 5EC1A 3AU1A 2FGWL 4S1SH 2DKUA 4G6FB 4J3OC 1AZZC 3S3BB 4F91B 4P8QA 2QTVA 2XT1B 1GOGA 3AW5A 3WY2A 3OKDA 3H85A 3T04D 3EZ8A 2YMXL 4AZUA 3WI9A 4Z7VB 4KWUA 4UBDC 2XOTA 1QPXA 5JQIB 3BFWA 4HIHB 4D94A 3QA3A 3VNZA 4OQTA 5AOIA 1VCAA 1ZPUA 4L4JA 4Y9FA 4WAFA 3NJHA 2ETWA 1U2CA 1HILB 2ARWA 3BPNB 1NBYB 4M3JA 15C8H 3FQRA 5DVLA 3O8XD 3ZTNH 4LKCB 1HH6B 1AD0B 3GHPA 1ZJBA 4Y89A 3Q7JA 4QTFA 3OJMB 3MRQA 4PJGF 3O41A 2AQ1A 3LNGA 2IOMA 3CFJB 2ESVB 4X99B 1FYTB 1ZEAH 2OMVA 3CE1A 3Q2WA 2DQEH 5E4EB 4C59B 5CP7A 2Z8VC 2Y5TA 1FVDA 1XR8A 1NDMA 2XACC 3HLKA 3LEXB 2E76C 4L0PB 4NKOB 3G5VB 4PS4H 4X80H 4OJDH 1CF8L 3P0YL 5MI0B 3PP3H 4Z3GA 4H1LA 2N1KA 4N9GA 2CBQA 1H6FA 4PRAB 3NSCA 3TBTA 5EZPA 3WIIL 5T3XE 5IJVB 2FX7H 3GD1C 5EU6D 2I9TB 4J1UB 4M62H 4R7NA 4YWGL 2GJZA 3T0XA 4BSWA 5LB1A 3MNMA 5ISZD 1GYAA 2X6CA 3GIVB 3BVNB 4ONFH 2A77H 2F53B 4XVUD 4WK2B 2FX9L 4F58L 4O58L 4GO9A 1Z3RA 2DBLL 3R06A 4FNQA 2WXPA 3PDDA 3LRHA 3R8BB 1AQ8A 5EU6E 2ZSVB 1LGVA 3MRMB 5CLZA 3TLRA 1YSOA 3AROA 5ISZE 1IGFL 3VVVA 1EHXA 2PNDA 4J23A 2B59A 2VDPB 4HYTB 3V52H 1W2KT 4BKLA 1DBBL 1T7XA 4RAHA 4DP4X 1K4DB 3NK4A 5CEZL 2OL3A 2H0FA 1N70A 3PGCA 1ZGLA 4LLVA 1QUPA 1GZQA 4ONGH 5F6HI 3KH3A 4JMXA 2BVQA 3BFOA 4HJ1A 1FZMB 4KRMB 4PCYA 4RIRA 1B9KA 1OGAA 3N1FC 2VR8A 4BWUA 4U1SA 1KTRL 2H6PA 3IDUA 4HHAA 4DH2A 1T4WA 3L54A 4G11A 2WQAA 3IAPA 3QDJE 3QR1A 2PXYC 4JM4L 1X5YA 1XCTB 2DJSA 2CM5A 3MJ8A 1U8IB 3STBA 5CKGA 5TH2B 1SEBB 1KCWA 3VA6A 3BIKB 4GOSA 5IW1A 3SPIA 2R4SH 5D5ME 2O5YH 3CH1A 4HAFA 2EIZA 3H0TB 3FONB 4GLRI 4X5LA 4L3ED 2BIPA 3LXUX 1O5DT 1NAMH 3HG1A 1OSPH 4XCCL 1MAKA 3MTRA 2EAEA 3KYMB 4KX8A 2VLLA 4G8FA 5EBGA 3MKKA 1TVHA 1F90L 4FMKA 2ZWNA 4U49A 4CKQA 3BP6B 4BA0A 1AS6A 2XZQH 2OP4H 4L3EE 2K8QA 5HDQL 1NC4B 2AI0L 4FCHA 4IBVA 3VFSB 3LH2H 4C56E 5C0GB 1CTOA 1HWWA 4LF3B 4ZFOB 1QRNB 4PJAF 3H8NA 3MA7A 1QBML 1N3NA 4OIIL 3H9HB 5I6LA 2J55A 5E1QA 2YUXA 4DGUA 5KYYB 2Q76B 1UFGA 4DZBA 1CMOA 5FFOA 4NFCA 4X0NA 1MI5D 1KZQA 3DPBA 2L7EA 4I88A 5DVNA 2VIRA 1OP3H 4UQ2A 4HHWA 5C0CA 2Q20A 3RP1A 5IBUB 3VFWB 1A3LL 4NQTA 1LO2H 1ETZB 2ZONA 2IQ9L 3P9MB 3UAJC 4N0YL 3SQBB 4MMZB 3ARGD 1FPTH 4I85A 1OAQL 3BO8B 2NXYC 4AGPA 5L7XH 3SGDI 2Q86B 1BMZA 5IJDC 2A4CA 2FHFA 5LBSA 1DJZA 4JFQA 1D6EB 3BPCB 3DHUA 1BFVH 2X5PA 4LRNL 4MZRA 5C6TH 1YN6A 3GXNA 3GXPA 1FLRL 4PY7B 3O3BA 3ECBB 1NGWA 1P1ZA 1NGXA 1YC7A 5J9PB 4MJ5A 3BKYL 2E8YA 1I9IH 4GAJL 3ZE1F 1AACA 3IJHB 4LNRA 1ZHLA 3IS0X 3SDCD