2K78A

Solution structure of the isdc neat domain bound to zinc protoporphyrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
126
structure length
126
Chain Sequence
SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.
pubmed doi rcsb
source organism Staphylococcus aureus (strain mw2)
molecule tags Heme-binding protein
molecule keywords Iron-regulated surface determinant protein C
total genus 12
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2k78A00
5D1ZI 2H3KA 2Z6FA 3SIKA 4WJG3 3VTMA 2MOQA 3QUGA 3QZNA 5D1XE 4H8QA 4YMPA 3SZ6A 4MYPA 2O6PA 3RURA 3S48A 3VUAA 2E7DA 3OVUB 4H8PA 5D1QE 3QUHA 2O1AA 3RTLA 2ITEA 2ITFA 3QZPA 2Q7AA 4FC3E 2K78A 3QZLA 3QZOA 3SZKC 3QZMA 4NLAA
chains in the Genus database with same CATH superfamily
2X4OB 3QJHB 1XF3B 4ZTOH 4CU7A 4DN3L 1DFBL 1AXIB 1FRGL 5CP3A 4TQEH 1F4YL 1S8DA 4HEME 1C12B 1ZE3H 1T1WA 3BLKA 4P46A 3HI1B 4HQQH 2BC4A 3T6WA 1BQHA 3MRLA 5FEBA 4X8CA 5AAWC 1LK2A 4BFIA 1CXKA 4KVCL 4P5TA 2WQXA 3V7AG 4FYRA 4JFZL 2WZPA 5L88H 5CILH 1UJ3A 4D9QE 5IR1B 4U7SA 1G1KA 1WYJA 3V0GA 2IADA 1XL6A 4J1UA 3T2LA 3K4DA 4PRHE 2VUOA 4PWKA 3U4BH 3ZRCC 2C9VA 4AGQA 2CKBB 4HIQA 3WS6A 1N2RA 5D4HA 3K71A 1YEWA 5E5UB 4OI8A 5T1DL 1EZVY 1S7RB 2YBRB 5D93B 3UG4A 4LEOA 2Y72A 4EE2A 4FNLL 2A1WH 1OO2A 1RJCA 3T0EC 1LO0H 3F04A 4CMHC 3UTPE 3U9UB 3QIWC 4TXVB 3NEOA 4JZJA 5LNDA 3MRJB 4Z7WA 3DX7A 4U1IB 4Y2OB 3Q5OA 2VTFA 3PWJA 1B6DA 5CUSL 5GSRB 2J1KA 3K5RA 5T1LA 1M9WA 2F5BH 4NDMA 4UTBH 3HZVB 3EFDL 2V9RA 1U8QB 2IPUK 2LU4A 2WN3A 2CLVA 4A2GA 1SDYA 2VL5A 1FC2D 4NNXB 43CAA 1A8JH 1I1AA 4K7PX 3B9KD 5GRWA 1XH1A 1LO4H 2CAKA 1E4WH 2O6CA 5AOMA 1YNKH 4L2LA 3WO3B 4AV4A 2F0CA 2PTVA 3BPNC 2AITA 1UD6A 3WHE0 2TRYA 4U6HA 1OP5H 2R23B 3SDAD 1W0YT 2QV2A 3V5HB 2PMZA 4QHUB 5E2JA 1DN0B 4KDTA 4BKSC 3GS0A 3VD4A 1BG9A 1T1XB 1N6QL 4HC1L 3STBA 1SDAB 1XMEB 3VD5A 3ZY7A 2F8VA 3U2IA 2ICWJ 2VLJD 3K6DA 4K3HA 3TEYA 1QSZA 1BVLA 4OT1L 3VGHA 4UQ3A 4FG2A 2G2PA 3QNFA 4KUCF 4AGLA 4OUUB 3RZCC 2YKKA 3POHA 3NZHL 2VMCA 3QUZB 2ZXBA 4XMLL 3ZN6A 1TQSA 3MGOB 3FTXA 1TTGA 2OMYA 2DLGA 1HZHL 1A1OA 1MHEA 1HHHA 1NJ9A 4OF5A 4WUUD 2QR0B 5DWPA 1RUKL 4FTVE 3SDYL 3AT9A 2J71A 4L37B 2PNDA 4ZSOA 1FNEA 3QXUA 3UH8A 3KWXA 4QGYA 4F7MB 4MRCA 2BOCB 1WITA 3MV7E 1B2WL 5C8JA 2JKWA 4K15A 3VWJB 3TO4C 4X4YA 1DSFL 3K6FA 4FP8H 1RZ8A 4C4KT 1AY1L 1PD1A 1ZA6A 3CFCL 5D5ME 5J1SC 1Z5HA 4N8VB 3O11B 1CLCA 2AJVL 4G11A 1HT6A 1D9KC 3EJTA 1EPFA 1ZT1B 2C3WA 1WICA 4OF0A 3LMJL 1HXYA 1QSFE 5L2JB 3VG0L 3UP1A 2NW2B 2WWKO 1HZHH 4H5SA 3WSQL 3H54A 5DFVC 2WOBA 5I6NA 2Y2YA 3L5XL 3DJ9A 2P52A 2R1XA 3G6DH 4NRZA 5F0PB 3BWUF 5SWSB 2Z92B 4AXWA 1MI5E 2BCKB 1P7QD 4HG4J 2NUPA 3KPNA 4WW2B 4Z8FL 1JXGA 5CIPH 4J27A 1MCWW 2CHXA 3TLRA 4UANA 5KANG 5CJ5A 4Q14A 5I0XA 3MR9B 4YGAB 3ZDXE 4N5EC 5HHVL 5J7CC 2WCSA 5L6YH 2APXA 2LHAA 3BKCH 3JV4B 3ZZSA 1AKPA 2NPLX 2H3XC 3V4UL 4WZ9A 3MNZA 2A6KB 2IH3A 2NY5C 4Q52A 3ZE1F 4HKZB 4HBCL 3KPRD 4K73A 4YDIL 2CM6A 4BFJA 2BMKA 2WTOA 3WFHA 4YHOH 1JD9A 4X7TA 3E6FB 3ZDXB 3AUWB 4AJVA 4TULL 4XMVA 4R7DA 5ACLA 4X6DA 4S0TD 1IGYB 3PDOB 3RY4A 2DM7A 1YUHA 3IKKA 4TSAH 2IPTL 1HNFA 2RR3A 2WTPA 3W5MA 3TOPA 5I1DB 1JGIA 1RHFA 2IH8A 4EDWL 5DHVB 5ADOL 5LQBH 1A6ZB 1P4BL 5FM5M 2FH8A 4PJ8D 3K8KA 3WBDA 4R96B 5ACMA 4BFKA 3IETB 4MVBC 3QVAA 1NGZB 4G6KL 2QSVA 3FQYA 2ZAIA 3KPSB 4WO0A 1AC6A 3MLYL 4EN3A 1CIUA 3HNTH 4EOWL 1E2VA 1I31A 4OIFA 5GGVL 1DUZA 2GJ6E 3AADB 3LQAH 3V4UH 1MELA 2VLKD 3FQ4A 3QIBC 4OCYL 1YC7A 2A0LC 3BFOA 5CILL 3CZFA 4B9KC 4L4VE 1JI1A 4ZW7A 5IG7A 4AJYV 2VC2L 4HGKC 3S3PA 1WAEA 2XG5A 5FUCC 4O2CA 1F2XK 1MN4A 5J56B 2K6ZA 5C07B 1M71A 3WLBA 2OR9L 4LSQH 2JV6A 5CXPA 5EC2A 5KG9A 3QR1A 5FGCE 4KK9C 2WWMC 2DLHA 4I1RA 1HYRC 4NDMB 2YC1B 3H7LA 3LKPB 5D2LA 2FO4A 1WZ1L 3QJZA 3SPGA 4MXVF 2EYRA 2ORBH 4R5TA 4KK6C 3QQNA 5TQ2H 2FSEB 1T0PB 2JXMB 3FN0H 3GZQA 4LLDB 2EH7H 1G9MC 4H0HB 1HEJC 1MWOA 3GSNB 1KLGA 1MAMH 4KPHH 4XMPL 2Y36L 5D8JL 5JOPE 5FYJE 1EZVX 3WIHA 4G1MB 2X3AA 1MWAA 3DYOA 3IMRA 2AK4A 3OZKA 1A2YA 3SDYH 1NCBL 2OZ4L 4KRMB 5BRZA 1WV7T 3L3IB 2NX5B 3OKNB 3IRZA 4MA8L 3UDWC 4APQB 4LEOB 5EU7C 4AMKL 2H0JA 4HPHA 1BBJA 3MLTA 5HVGB 2LAGB 1J05A 1BFVL 2FHFA 4G6JL 1FLRH 1G7HA 3KJ4B 2VDRL 3W9DA 5ID0A 2B59A 2XWJB 4K94L 2EXWD 2I7SA 4DQOH 2P9RA 5T1LB 1KXQA 2F53B 1JCKA 4H0LC 1X4XA 4YWGH 1ZGLA 1LP9A 1FH5L 3D39E 5D70H 5JIMA 2X53A 1M7IB 2VL5B 1CQKA 2Q76B 2R0KL 4HS8L 4UQ2B 5EULV 5I0YA 1PG7X 3KWUA 1S4IA 1DLFH 3MDJA 1CMOA 3PS6A 4ZMNA 4UNIA 4D0BB 1OF0A 2F1EA 4KI5C 3FO1B 4U0QB 2VQ1B 3QB7C 3IVKA 1RERA 3QCTL 2R23A 2DI7A 3PREA 1NKGA 1AGDA 1FO0A 4P3DB 5AW5B 3BKYH 3SCMA 5DQJB 3HNVL 3HVDA 4UTAA 3NG5A 5E8DH 3ALPA 4BV1A 1KCBA 3QPQC 2FZ3A 2NY4D 2BPBA 1P2CA 4BKLB 4TVPD 1J1OH 3FQRB 1FHNA 4PJGB 3MRMB 3GRWA 1UOKA 5DEGA 2YO3A 4LB8A 3NJFA 3SDAB 2YGPA 1D5BB 2YQ2A 4KO7A 4OGXL 4R7XA 3LSOB 4FD0A 4AC2A 3IXTB 1DQLL 2X4NA 3OB0K 4O02B 4QAMB 3E6HB 5JNYA 1CFQB 5FYLE 5IW1B 4JPVH 5KYWA 3NZSA 5KSVB 4UDUA 3QI9D 5FO8A 3B9KB 4DGYL 2F19H 2EDRA 3QS3A 5EWIH 3HI1A 2Z35A 1W16A 3NIFE 1IB5A 1OCOB 5JQIB 3VXMA 5IQ9B 4LHJB 4GMSL 3S8GB 1HAUA 2JJWA 3MRDB 5F6IC 4XVTL 4WSJA 4FXKA 1ZEAH 4KQ4H 2VQ1A 5EOCH 3ROOA 2D7OA 4ZFZB 1DVTA 2EE2A 3LYRA 2ATPB 3QDHA 1C1EH 1M2VB 2EINB 3ABLB 5E4AA 2YUZA 5DMIL 1PLGL 1SHSA 1ZTMA 3HE7C 4HWEL 3FCTA 5CO1A 4A63A 1T1ZA 4W9LC 1LO5B 3ZDWA 1OEZW 1OW0C 2I7OA 3WFDL 1BD2D 1RZPA 2BVEA 3G6AB 3PXHA 4H8VA 4JHUA 5TGBA 2IALA 1UXWB 5C08D 2UUDH 1IT9L 4MD5A 1MFEL 5GZNA 1VEOA 4WKZB 1RK7A 4ZW8A 1LO2L 1NH6A 4PV8B 5DUMH 2NY5H 4D0CB 5MEQB 1TCRB 3B3IB 3WNJA 1BAFH 3FSAA 4LSTH 2P44B 3MNDA 2IWFA 1WISA 3TF7C 5E23A 3FQUA 4E9VA 1QSVA 5TE4L 3AITA 3RDJA 1OAJA 1NCIA 1RUPL 2MKLC 3LIZA 3BAEL 2DEWX 1I8KA 2Q7YA 4L8SA 4MA7H 3O9WA 1UB5B 5CZKA 2FEJA 3FB5A 5DMYA 1FV1B 4EIBA 4DJMA 3CLWA 2CUMA 4YL4A 4MJID 1J86A 4Y5VA 4XE0A 4QLRA 3ML8A 4NPYA 4X0KB 4HXBL 4GW4B 1Z5LB 1FFQA 5A2LH 2A77L 3QQ4B 4P5TD 3US1A 3THML 3UTQA 1CZ8H 4J5VA 4E2OA 4OQTH 2JJTA 4NQEB 3MRPA 1OAZL 2AJUL 4PB9H 4I3SL 2EADA 2BLFA 3GZOA 4R9HA 3RPKA 1HL9A 5I8EA 3ZIYA 1JNHA 3RTQC 2F7RA 2Z91B 2GC4C 3EYOA 4MLIA 1A6VL 5KG9B 1C08A 1OCWL 4NFCA 4CVWA 1RZ7L 2X4PB 2EC8A 1GYAA 4P9MH 3SBWA 1YEHH 4N0UE 4KO5A 3PV6A 2Z4QA 4KTEL 3SPIA 3TH2T 1GS6X 3L4XA 5IMKB 2D0HA 3LNEA 4GB9A 1RKRA 3OXSA 1SEQH 1H6EA 4NNPL 4V11A 5ITFA 3U1PA 2YGOA 1J1XL 1IKNC 4Z7NB 1PJWA 2FYYB 3Q8AA 4ZJ9A 2K1MA 3APCA 3CSTA 5CBAA 1IC7L 1CPUA 5HGHB 5F96L 2MSPA 3UP6A 1A47A 5EZIH 3PHQB 1PG7H 2OJ1A 2CRYA 5IQMA 2VKWA 3WIFA 3TCXA 5F88A 5C07A 3H3BC 3U1SH 3C5JB 2E9WA 1TOXA 1OGTA 2OMWB 2J20A 1BEYL 3Q2LA 5EZJA 3JXAA 4QRPA 4A38A 3GO1L 5IEKB 5AKVA 1AQMA 1GPOL 4N8CL 4NEHB 3RGHA 4XNMB 1NC2A 4DFIA 4WGWB 3Q8BA 1IM3A 3BAJA 3QNXB 4GKLA 3UTOA 1CICA 5D5MF 3UGUA 1OAYL 1J9SA 1S5IL 4FQXB 1I3RB 1FVCB 3PDGA 3VFVA 4BWUA 1ORSB 1OP5K 1MAKA 3ARFB 1CUOA 3MNZB 1V3JA 2NY4C 3CDCA 5T5NG 5E08H 4NN5C 4YSDA 2B9AA 2CDGB 3MLWL 1L6XA 1M7UA 3DRTB 3FFCA 3MLVH 4IK6A 3TFKD 1Z9SA 1YEIH 4JFYA 4EJ1C 3QDJD 4F33A 5D72H 2DMCA 4Z6AT 4GRWF 3P4NB 3QPXH 4GKNA 1MFBL 2CXGA 3UEZA 5IUCA 3IPEA 2BCKA 1M1XB 2CNYA 1EUTA 5IB5A 2DBLH 5AKTA 1M42A 5DHVH 2JCCA 4HHWA 1LQBC 5DEGB 1TJGH 5IHUH 3AS2A 4I9WE 4L3EE 2XVBA 1G4RA 3G08A 4BQBA 4MQSB 3EYFA 3QCVL 1QBML 4GSDH 4X6BA 3REWB 4YIQB 4V33A 4HKXA 1D9KD 2VLLA 2VXUH 2HXAA 4G8GB 2HLEB 2ZAHA 4N2NA 5ICZB 5C2UB 2N1TE 1U3HA 1Z9MA 4NN7B 3QRGH 4RISH 1CFBA 5EZPA 3BMVA 5GGUA 2EVIA 3LKNA 1A7OH 3HRZC 4PJ6A 4IMLA 1BQHG 1A4JB 1RMFL 3DIVA 5D96C 5GSVA 1VGEH 2F9BT 1AI1H 2NY7L 2JK5A 2WQUA 3GRBA 1T04B 2I9LA 4KJPD 1R0AL 3OF6A 3T04D 4P9HC 1DL7H 5INCA 4R7DB 4GG6E 4WNJA 1R3KA 5FUZH 2Z7WA 4W6YB 4F80A 4K5MA 3QFGA 4GBXC 3PWPA 3ZL1A 3S4SB 1OV8A 4L4TA 1L3NA 4K7FA 4FA7B 2FJUB 2H0PA 3L5WA 5CLYA 1CE1H 4Y2NA 2O5ZH 2KZWA 3UGEA 3UABA 4ZX4A 1ET5A 4NZRH 1V10A 2E8YA 4OLEA 2UZXA 4Z0BL 2CUHA 2V2XB 1HIMH 2WLIA 3MRNA 2X05A 4HWBA 2F6AA 1Q8MA 1F0LA 1NAMB 5HY9A 3N04A 5D2NC 4HGMA 4HIHB 3VYOA 3L4UA 5HYQA 2E8ZA 1T1XA 4Z3JA 1EJ6A 4GIPD 1Q9OA 5FO2A 3L3DA 4HS6B 4KKCC 3BUPA 3TO2A 4JBSA 5CAYB 2D7PA 3GSNH 4LU5H 4LARH 3P4OB 1A6UH 2C7UA 2W9EH 1WSST 5IW6B 2W5PA 4G7SB 5EZOL 3AB0B 2HFGH 3BPCB 3MFFB 4XO9A 1CGVA 2QPUA 4IRSA 2Y23A 12E8L 1NBCA 4CU8A 4IU2B 4YGVB 1RZ8B 4YDKL 3VH8B 1C5DB 1YYCA 2YEVB 3OJMB 5DQDH 2G2RA 1VDGA 4K3JL 2F1BA 1QFUL 4K4KA 1OM3L 2ED7A 5D7IA 4GXVH 2ROYA 4L4JA 3DVGB 1QMUA 4YEFA 2PTTA 1KLGB 3IMBA 3L13A 5JMRA 2DH2A 4IRJD 3X13B 2FD6H 3R0MA 1E4XL 4F8LA 5KJ4A 4N3UA 1BQSA 2YFNA 1FFNA 4RMVA 1P84J 3C8DA 4G3YH 4M1DH 3RUGF 4E68A 4YHKL 4N87A 4ABUA 1K6QH 3HFML 4W6XB 2DS4A 4JS7A 5GGQL 3EH2A 5D7EA 3D5OF 2EE6A 4YNYB 3ZRSA 1VZGA 1LDPL 4JL2A 4AQ1A 3LZFL 1X9UA 2ZOKA 2LFGA 3MSPA 1JK9A 3M8OH 4Y9CA 1WVZA 4IRSB 3L9RA 2GY5A 2JLPA 2G5UA 2F54A 1L7TH 5AAWA 3EJCA 1O7SA 3MGAA 4AZ8B 1HOEA 2J55A 3FAXA 4RGNB 1UCBL 1YNLL 1SJHB 3U2SA 2A6IA 1A64A 4NQCD 5DJZA 2F8IA 5FPIA 1GMEA 1VADA 1T21A 1Y07A 1MHPH 1OK8A 2EO7A 3Q2WA 4S1DC 2P4AB 3RB7A 4F24A 5I23A 3LHAA 1T5XA 4OFQA 3ZKMD 2VDKL 3AGWA 3UAAA 2ITCA 3N40F 3KLKA 2CR6A 5SX5H 5KTEL 3LZQA 4JFDE 3OLEA 3UIYA 3SZ6A 1ZLUK 3QARA 4E41E 5IB2B 2HFFB 3QUYA 1K6QL 1AD0B 3GLAA 3ZE2E 1A14L 2YJQA 4M1DL 1IC1A 1MVUA 3JV4A 4NN7C 1WFTA 3TXAA 3ZSTA 1F41A 1ZLSL 1N18A 4XP9H 1A9VA 4WW2F 3W9EA 3RI5F 4ONGH 3VRJA 3QZMA 1FPTL 1V5JA 3CDZA 3CZSA 5F3BB 2VMFA 5K93A 2BP3A 2BVOB 1TJIL 3FKUS 3GMRB 1INDL 3H9SA 1NGQL 5D6CA 1PZDA 3G7TA 4N86A 4QR7A 4F7CB 3JVGA 1HXMA 3BSGA 4UQCA 4G7YH 1CLOH 1F3DJ 2X4QA 1KTKE 1GZPB 3RVUD 3UZEC 1OF2A 2NRDA 3L4VA 4PRAA 3AREC 2Z65C 5DT1H 3DX3A 3FS9A 2KQNA 3TBYB 4JFPB 3SOBH 1KEGH 5BZXA 4EI5D 3LQZA 3RWEB 3ZSSA 1TG8A 3HKFA 5AENA 2WLJA 4X7DC 2HUHA 4AYSA 5CWSB 1R9FA 2HMID 1R3JB 1UWFA 2F54E 3CU7A 3CCHB 5IUSA 1NCGA 3ZT7A 2FK9A 4Z0BH 5BS0E 3VB8A 5DD1L 3BP4A 1E5BA 1USQA 3D69B 3MRQB 4R84A 4I0KA 2XZZA 5MEPB 1BJ1H 1CGUA 1T89C 3OAYK 5HYEA 2WNWA 3AGVA 2HVKA 4M7KL 1EEZB 4OF3A 3QP3A 4JKPL 3MO1B 1CT8B 4ZXBB 1NC4A 1E43A 4UZUA 1OPOA 5G4NA 1A6WL 4ZX6A 4CW1A 1DL7L 2WGNB 3N40P 2FQDA 2X4PA 3D4CA 5F9OL 3VXTB 3VD9A 3N0PB 4J3OC 5CSBA 4JKNA 4CU6A 3QO1B 3FO0H 2AVGA 3H2PA 3UZQB 1G9NC 5C6PB 5GXBB 3IFLH 3GJEB 3MRHB 1M6UA 1KTLB 5C0BD 1QACA 1NFAA 1NAKL 1JZ8A 4RBPH 4N0CC 5I16A 3QWOB 5EUOB 1G94A 2HRPL 1XEDA 3TBTB 5K9QG 1I9JL 4JMNA 1U0QA 4UOQA 2AXGB 3SOTA 1R3HA 4TVPL 2L8AA 2WWNA 3AY4A 2QLVB 1SY6H 3QH3A 3NSJA 4IOIA 4L3FA 4ZPTA 5C0CD 2R83A 1MFMA 4TS6A 5FGCB 1KB9J 1RUAH 1GOHA 1P5UB 3GI8H 4OCNC 1ED3A 1DQMH 3TYGL 4ANXA 2YLKA 1RZJH 2XNAB 5IMOA 3BUTA 3VQ2C 2QHLA 2AGJL 3FT2A 2AEQH 2Y7LA 5FV2A 4G7YL 1KXQE 1J9RA 1ZT7A 5C0FB 3MRGA 2VSCA 1WAAE 4M93B 1J5HA 2VZ3A 5L7XH 2X88A 5MEPA 5MP6L 4QRTA 5H94B 2BHUA 3K1KC 3N42B 4NQCB 4NBXB 5GS2D 5J9PB 2FWUA 3VCLB 2EIKB 4RCAA 1XB3A 4NRXB 5I74B 1ZXQA 4ZODA 3VFWA 5FYKU 4FJZA 2AK4E 4XP9L 4IRJA 2Y0SA 3STZA 2GSIA 4PRPB 3VI3E 2ZOKB 3GIVA 4TOYH 3TNMA 3OKEB 1A14H 4NHUA 3V9CA 2R0ZL 1MPAL 4M6ML 2GBAA 5AZ2L 4XAWL 5FO7B 2VIRA 1J18A 1WP6A 4MD4B 3SJVA 3TYFB 1BECA 1NCCH 2JKNA 2PYFA 5IFJB 4BEIA 5C0RH 3H2WA 3FFCD 5JW3L 1S2EA 5T3ZH 3IETA 1A65A 3CFMA 3N3EA 4UI2A 1J1XH 4AH2A 2R8SL 1JHKH 1UACH 1MCFA 4X6BB 3SDDC 3IDMB 3ULVF 2WD0A 2OZNA 1QABA 3O3DA 4L3EA 5HHXH 3KJ4C 3MNVA 4XP6L 3MXVL 2PCXA 3PGFL 4JFHD 4F2ME 3FRUB 2XTJE 6FABL 3DX8B 1VACA 1IC5H 3FB5B 4WUKL 1I7RA 5ANMB 3IJSA 4WNSA 3AWEA 3JTTB 4O9HH 3KL5A 1PIGA 2BFVL 4YC2B 1L9PA 3EFOB 5IJKA 4N8VG 2A9ML 2WYIA 5B39B 3JT0A 2BNQE 5MEOA 1O0VA 1URIA 4L4VA 5IBTL 2NY0C 3VM5A 2B0SL 2RIKA 3A22A 3EJYD 4ODUB 3BO8B 3AT0A 2BDNL 3AB0C 3HRPA 4KKAC 3TIEB 3X12A 1OANA 3QFDB 1QR1B 5CEZE 4MZ2A 1NLBL 5F3BA 2RQEA 1S9YB 1WQVT 2FATH 3JT2A 4Y8AA 1KEML 1UXWA 2XZQH 4FA6A 5AG8A 4NKOB 2P43B 1A3RH 3TNMB 3U9PL 1HWGB 4OCXH 3L17A 2Y25A 3V52L 4R7LA 3THMH 1HKFA 3C5ZA 1JWMA 4HEPG 3BCFA 3ZIMA 5A16A 2XYBA 5D4JA 1XT5A 4EXPX 3N41B 1MG2C 3MRKB 3VXQA 3LH2L 4Y2DA 5DQDL 1AHWC 3ECBB 1E7VA 3EUUA 4YDLC 2Q20A 3HC4H 3IFOB 3S96B 3JWNG 4KJQD 12E8H 2HG5B 3BAEH 4MA7L 4XCEA 3U6XS 4JDVA 4HUUB 5BRZB 2BNRE 4NUMA 5EZOH 1JTOA 3MJGX 3N43B 5TE4H 2CU9A 4PYGA 4ELDA 3NGBB 3ZGIA 3B2DC 2MCPL 4HMDA 3C5SA 4LSTL 4XVUC 4TQ8A 3VW3H 2RB8A 3WYRA 4KK8C 4YSAA 1D5MB 5ICXB 4HCRA 1WHOA 1FYHB 1AIFB 4PJXA 3SE4C 2ITDA 4M29A 1HNGA 4HF5L 2ILLA 3P02A 4KOBA 4H0IA 3SE8L 5FYLD 5D7JA 3HZKB 4KZ0A 2JELH 2R29A 2LLNA 2XQYK 4X50A 5I1JH 1QR4A 1ZEAL 2BSDA 4KQ4L 5HI4D 3VH8A 3ZE0B 3GSQB 4AEHH 1T83A 3FO1A 1T0MA 4P5MA 4D0DB 5M95B 1XF4B 3RBSA 3LN5A 1TFPA 1M6OA 1AO7E 1DBKL 5EIIA 5I1AB 2RH0A 5T3ZE 3W37A 5EU6E 3MBED 3R0NA 4ONFH 4RGMB 1AFVL 1XR9A 1A7QH 4JPVL 3BESR 4JFQA 2GJZB 1AI1L 5JIPA 5I74C 5BOJA 5D7IB 3JYBA 4JQIA 3PP4L 4JVPA 3QEQD 1GGIH 5E8OB 1K5NB 1J1OL 2R4RL 4XNMA 3T6ZA 2GEQA 2WBKA 4OAWB 4I48A 4FTVA 3NH7L 4G71B 3X3GL 2CZNA 1DSYA 2YEQA 5IMOB 1RAMA 3NSXA 3T6VA 3DSFL 3WJMB 4MMXA 3EJZD 3S5YA 4QHKI 4X6CE 3T0XA 4X5LA 5IP4A 2LV4A 2QEJA 4HPYL 5AOKA 2CPUA 3PP3H 5T5FA 1GIGL 1AS6A 4DKEH 3T77A 1XMWA 4DAGL 3LKPA 5D2LB 1OGPA 3IF1B 3L08A 1L9TA 4UV7L 2W92A 3O9WC 1E6JL 2BZ7A 5KUMA 2V7NA 2VR8A 5I8OL 4I77L 2ZG2A 1RZQA 2FJHB 4YC2C 4R2GB 4YXKH 2QKIB 4V1DD 5I2IB 3GPEA 3OVUB 3QH3B 3FB6A 2YD0A 1BCIA 1IM9D 3FU3A 4BWTA 1UWGH 1QSFD 3MOBH 1SYSA 2YD7A 4QO1B 1XH3B 1JAEA 1JPSL 4KHXH 1L6PA 3CSBA 3BVNA 3F7YA 3H7BB 4NO3A 4DGIL 1QRNE 1KGIA 3D48R 3DPBB 4L2YA 1TETL 5FF6B 1FG2A 1DQJB 1MAML 4KPHL 2R4SH 2BIHA 3ECUA 2IAMC 5EN2A 4BFNA 3OAWA 4J3UA 3KYKH 3A6BL 1MPAH 2R0ZH 4EIUA 1T5KA 3EIFA 3RX9A 5GIRB 4PP2A 1ACYL 4M8QA 4PG2C 1KIQB 4U2ZA 1AGBA 5KYYA 4KRLB 1CYXA 4Z0XA 3U9WA 43C9B 4PLJD 2CSPA 1ASOA 4ZMZA 2ENSA 2XFXB 2WCGA 2Y69B 5AW2B 1DEEB 4FHKA 4PRHA 3DVNB 5DA0B 3U7YH 1VFBB 3TURA 3DUUB 1NUNB 3S35X 5C9JA 2OR9H 4LSQL 3K2KA 3CG8A 3GZKA 1TQCC 2QFRA 5DFTA 3V7AE 4BDVB 3WU1A 3DXAE 4NO3B 2DEXX 4PW9A 2WYZA 3N55A 5B38B 1L6ZA 4DN4H 5KBKA 4LPTA 1ZS8B 2JI1A 4Y4HC 2DYPA 3GI8L 3LQZB 3RWEA 1D5XA 1GCYA 2J44A 4DZ8A 3DA0A 3LDBC 5BQ7A 2IWEA 5CR1A 4E0RB 2A9DA 4PGZA 1OQOA 4ZO6A 3PPSA 2BSED 5CR8A 4NQDD 3OBAA 3CSFA 4Y9GA 3DGCR 4DEPC 1D5ZB 5C7XH 4F7PB 4WK4B 4EZJA 4BH8B 1F58L 3U1QA 3DV4A 1QYGL 3SKNA 4ELMB 1LD9B 1HCFX 2GBVA 2ZWNA 3FQTA 4MCYB 2OMWA 4KK8D 1M56B 4NQXB 4I0CC 4Y5XC 5ALBH 1YY9D 1MHHB 1ZVNA 2K3HA 4WCYL 1A3ZA 1OCZB 2JH2A 2ETWA 4LF3B 1KPUB 3GXPA 4KGJA 4L48A 1EERB 2WPGA 4TSAL 5FDYA 1TVHB 1S9XB 3NIGE 5TE7H 1AP2A 4AZ8A 2DLFL 1JWSB 3BGMB 2RJMA 3C8HA 5KSUB 4IIQB 4HUXB 4MDIB 1FNGB 1AS7A 4FABH 1RUPH 5CGYC 2YS4A 4F3FB 5C1MB 5LCVH 1AIZA 3VSQA 1G9ML 2YD8A 1G87A 4FFZL 1BAFL 2MCMA 4U3XA 1GGCL 2Y1YA 5CKGA 3GI9H 3WXVH 4O2FA 2MHAA 3DJTA 3ZOAA 3LRGA 1SMAA 1FG9C 1YPZB 2QDWA 2LQRA 1NGPH 4RH4A 4BYHA 3MC0A 1XB8A 4XBGA 2XN9E 5GJSH 3UGXA 2X6VA 2XTSA 3EOAA 3ET9F 3PDDA 3CHPA 2MNWA 2VLRB 2AABL 3I84A 4ONHA 3D50A 1N10A 1YEEL 2CLZB 2NY0D 4HIIA 1G7LB 4A39A 4CNIA 4MAYB 4Y19A 1OSZA 4XN8A 2ARJA 2EO1A 4PGCA 3FPYA 4K94C 1RPQA 5L0QC 2CK0H 3BC9A 4MQ7A 3GJFH 4I5BB 4S0SD 2UWEF 4QOKE 4HUMB 1W72B 1BBDL 1LO3H 2A3TA 1AXTL 1SUJA 1U41A 2XVLA 2JB6A 2Y07H 1AY1H 2Z31C 3B3BA 3KPRA 4HK3N 4D0DA 2X89D 4J4PD 4OCLC 1O9ZA 1OB1B 1D9KA 3DURA 3OG6B 4FFYH 5AWNH 1WFUA 4OGYL 5HGDB 4F92B 1TCRA 1QO3A 4IOFC 1TJMA 5F7YC 5A40E 5CZRA 4OGXH 2ZCZA 5HHOE 1JZ3A 1I3GL 2IVFC 4LLYA 3I85A 5IVXE 1RHHB 4IMLB 4W6WB 2EDNA 1H3UA 5AEAA 2A4EA 1AJ7H 2NNRA 4HUKB 5JOEA 4Z23A 1N6UA 4HJEA 1SVZA 3X1FA 4XPAL 4E41D 1YLBB 1MFCL 1BGXH 3CVHB 5F3FA 1W0VB 4OJFH 1HL5A 4JG1L 2CLRB 5MI0C 4K9EH 4YSPA 5IK3A 2H47C 2DQGL 4XH2B 2F8XC 4QRPD 3KYMA 4GINA 3QNZA 1E8ZA 5C92A 1IVTA 4WEUD 4YWGL 4LQFH 5LXGH 4M7LH 3HZMB 1X7QB 2D03H 1TQWA 5IWLC 3H9SB 1AHMA 2BO0A 4W9IC 2NXYB 3DROA 2VDRH 2DQGH 2BP8A 1FORH 4X7EC 4ZZKA 1QPPA 1ADQH 3V0IA 1I8LA 5EO9A 2HKFL 3RWDB 1K4DB 4YFLI 2EH8L 2FJHA 1SF5A 2VGLM 1QSFA 3GMPA 5GHWH 4J4PC 1MCBA 3MLSL 5CJ8A 1KBGL 1TZAA 3M1CA 5D5MA 4DGVL 3QFDA 3E6HA 4IHBA 1XDTT 4EPSA 4ZMQA 3NTCL 1QR1A 4W93A 1AZVA 5DJDA 1I3GH 1AD9A 4FX5A 5GGQH 3ML9A 1QZ1A 4ELKB 2Q1EA 5EDSA 2EH7L 4GRWH 5BXFA 3UC2A 4UIMA 1NMBH 1Z2KA 2W65A 4N5ED 3BT0A 1BD2E 5HGAA 3DWTA 1ICTA 1TTCA 5I0DA 5B21A 2VERN 1UURA 2A1WL 1DZ0A 3CHSA 4YHNB 5GIRA 1BYPA 4MJ6A 3VYPA 4HWBL 1RU9L 2Z8WC 1PY0A 5BS0B 2AQNA 3IU3A 1FN4B 2BM3A 3WAJA 4LLVB 3QDMA 4K3JH 3VXUA 3RWCB 2ZYHA 4F2EA 5DZPA 3ZDZB 4PRPD 5DYOB 3GBDA 3VG9C 4YIQA 4J3XA 2Z31D 4L8CA 4Q8BA 3TBWA 3TN0B 3HE6C 3S36L 4KHTH 5EO0A 3FTVA 1XBDA 1ZVSA 4Y2DC 1ZRUA 2W9EL 4JFWA 4MA1C 4M8QB 3TZVB 3ZTNL 5IB1B 1HINL 4RGOH 3SN6N 1J5CA 2CM5A 4XXDA 2P8PB 2CBPA 1UYWH 5DUJA 4NJ9L 5GS1A 1B3JA 4RAUB 3KWWB 3GSQA 2VN6A 1T2JA 3FTGB 2RAMA 1DE4B 4BZ2H 3RB5A 2H3NB 2VO8A 4MVBD 2PW1A 1HJCA 3TL5A 4GP5B 1QBLL 1Z9SB 5GRVL 2JQAA 1MCCA 2J5WA 3RURA 5FX3A 3DX9B 2XTJD 3L3HB 3O4OC 5TD4A 1MJ8L 3TBVB 4EBQL 5AZUA 4MHHI 2NR6A 1CYGA 1ETB1 2IGLA 2B2XL 3V4PL 4NBYB 4NKDA 3Q8FA 4BUHA 5J89A 3HI6L 5DI8A 4Z7QE 5C0FA 4P2QE 1A7NH 3GKWH 3VXRE 3O0RL 1XF2A 1UA3A 3BUYB 4OAWA 3EFFB 1D5ZA 1CD1B 2VZOA 4AE1A 5IQLA 3EYOB 1RMFH 2ICEB 4DCQB 1L9NA 2IFFL 3WKML 3MUGB 2DQHL 4G43B 1XWVA 4PBDA 4UIKL 3LRHA 2WZ0A 4AYBA 5EOTA 1NDGB 2VN7A 4HJSA 3SDCA 4ZMPA 2ZXWB 3JV0A 4TPRH 2APSA 3GINA 3SKJH 2FX8L 1BQHB 1OQXA 4GW1A 2ZOOA 3B7UX 5EN3A 4B9PA 1A02N 2YA0A 3DLQR 3VMNA 3VVWA 4Z1PA 2YAEA 4WUUA 5CZVH 1XAUA 3OGCA 5DDHB 3EOAB 4LLQA 3H56A 3U7YL 1MFBH 3QPXL 3HS0A 4I8DA 4Y4HD 3WSQH 1F6AA 3ARGA 2BP0B 2VLJB 2ITFA 3SE3C 5CEXA 3LMJH 3QFJB 2MHAB 4ZBJA 1EH9A 1QHQA 1U42A 4P5SA 3S3BB 1J9QA 5HDBE 1SJEA 5ILTL 4FP8L 4IMKC 4IBZA 2A73A 5HHMD 1QLFA 2CKBL 2WNKA 4JFEE 5EB9A 5BRPA 5IESH 1HESA 3P0YL 4OJEH 3C75A 3TX4A 5IEHA 3DC0A 1QO3B 2H2PC 4ZD3H 2PR4H 1U8MA 1JPSH 1BEYH 4GT0A 4I9XA 4Z0XB 3A3YB 3QULB 2AAVA 3LZLA 4JY4A 1JXKA 4HT1H 2WYHA 4ODSL 5FGBC 3NRFA 5AFAA 3B2PA 1DQQA 2DEYX 3T3MB 1Y6MR 4YXHL 4TKWA 4JHVA 4DUVA 1PL3A 1L9OA 5AB0A 2X1XR 5FKPB 4P4KB 2NNXA 4ZI8A 4O2EA 4JQVC 1WIPA 1KCRL 1JHLH 2CBQA 4ATWA 3QYNA 5AVVB 3FUKA 3MOQA 3EOTL 2WN2A 4DEPB 3Q48A 3NJHA 2XWBB 4FHJA 4WV1A 5IW3A 3RLSA 3GTNA 4L8SC 4P2CG 5DD5H 4F37K 4DAGH 5CLWA 4OCSL 1SEQL 3IDNA 1ZS8A 4OJAA 1H3XA 4LFHG 4S1RL 2JE8A 4HFUH 1E27B 4WDIA 1FNAA 5IOPB 3QZOA 3HZMA 2WSDA 3CUPA 3VUAA 4P07A 2C3XA 2VXTH 3L9RB 2CDFA 1JN6A 4AEIL 2BVPA 5IVZA 4V2BA 1E4WL 4OU3A 4XPGL 1ZA6B 4HS3A 3B9KC 5DGRA 2WAQA 5I19H 5JPMC 4U2YA 2E7LA 3V0JA 1FYTA 3EFDH 1N7ML 4QHKJ 1T3FA 3CZGA 1H3TA 2J1YA 1MCLA 2IMNA 2R69H 4PJ5A 2JFCA 1QQDA 5D1XA 1BVLB 3CVCA 2R29L 5D9SB 2BOCA 1KIRA 3FF7A 4IRSD 1HSBB 4OZIB 1A7QL 2APVA 2DIBA 5F7MC 4UT6H 5AG9A 1CBVH 2P5WE 3QO0A 1N64L 5JPMB 3ASWA 4MCZA 4DKTA 2PYFB 2P8MA 4WTWA 3MV8A 3CFIC 4ZQKB 2K4WA 5B1BB 2QADC 2YPVL 3F2LA 3QUYC 4Q2ZB 3CFJA 5IIEA 3ILEA 4PWEA 4B60A 4BZ2A 4UOW1 3PL6B 3S8FB 2B59B 1MRCL 5DQ9A 1Q94A 3TV3L 4YDLB 2GTZA 4L3EB 1XZ0B 4F93B 2N01B 5TE6H 4KO6A 1LP9B 4JFQB 4KV5E 1YPZA 2XTLA 2Q7AA 2DICA 3ETSA 3NJJA 1YY8B 4HSQA 4Y1TA 5IJKC 4XBGB 3QQ3A 4BHUI 2XWJA 4ZMWA 3T4YB 3QNYB 2VRQA 1MI5D 5J13C 4BRVA 4L3ED 4O2FB 1MW3A 2VITB 5KVDL 4FQXD 4ZTOL 3C6EA 1I1FB 4IGBA 1KV3A 5CEYA 1ZXKA 3TWCL 4NZJA 2IWGA 4W4NA 4PJHB 4EIGB 3LV3B 3G3LA 3VTTA 3P40A 4HP5A 4Z3IA 2C9AA 2LTQB 3K74B 1FJ1B 3WN5A 4NCC1 1NEZG 5DQ9B 4B0MB 4R4BB 2IBBA 4GIAA 2Q7NA 3O6KL 1R5IA 1KIRB 1ZTXL 3GZPA 4IU2A 4XVTH 5CJBA 1H8OA 3C5ZB 3CZKA 3L9YA 1I8MB 3IPFA 3QEHA 3MYJB 3QBTB 1GA2A 2YPVH 3FU7A 3QXWA 5I1DA 1KJMA 1FE8H 1G9NH 1CK0L 1MFDH 2F19L 5FHAL 2JKLA 4UT6L 1P1ZB 1SM3L 4OD1L 3RJDA 1DQLH 1CN4A 2X6AA 4G6MH 3F00A 2CKBA 5DJCB 4OF7A 3QIUB 1NIBA 1PJ9A 4JE0A 5B7MA 5SWZA 4UM8A 2FH6A 4M7LT 4Z7NE 4NWTH 5F9DC 2VYRE 1UVQA 1UM5L 4F8NA 4WU5A 2AXHA 5BOPA 1EBAA 2EDYA 2FUTA 3RZCA 3NZ8B 1E2ZA 3OC8A 4Q9RL 4CVZB 2A9MH 3ES6A 3OMNB 3F7LA 1XGYH 1QW8A 1X6LA 5CJOL 1PCXA 3ATBA 1MFVA 4O02L 1JG9A 1YEKL 2RBLA 4U7MA 4PBXA 4X9IA 1MSPA 4MMZB 4WUUE 4X9YA 2FEEI 3BZEA 1SN2A 4HFUL 2V2TB 1U3HC 2J8UA 3CXHK 3GUTB 5GGUB 4ZK8A 1JZEA 4X0NA 3VJ6B 1YG9A 3RPIA 3OKYA 3FQNB 1J5OH 1GR7A 3NIGB 3FQWA 1K3ZA 4KI5D 4LKXA 4PTUA 5TDOA 3HZ3A 3ARGC 4XC3L 3T71A 2C9PA 5D70L 3ARGD 3QUMB 3DRTA 1BM3H 3RAJL 2EXYC 3DV6B 5KBNC 2LU3A 3QEUB 4GYBA 1UM5H 1MCDA 3QRLA 2P24B 4FXLA 5I6OA 4TSBH 2FWOA 3AZUA 4D9LH 4UM8B 4WFEE 4A55A 4XHQA 5D2NE 2ZCLL 5SWQB 1FUNA 4FG6D 1SM3H 3RWFB 1ITCA 1JGVL 1UT1A 3GMPB 2W0KA 4TOYL 4JG5A 2YD6A 5LN4A 3WMPA 3IGLA 1BVOA 4Z7QF 3KEDA 2N1KA 4NN6C 1L7IH 3T4AA 4P2QA 4ZD3L 4C56D 2BCMA 2C26A 4GQPH 4DOHB 5KJRH 3HPJB 2JKIS 5DS2A 1UZ8A 1QHPA 1I9RH 1KJ3H 4RQQA 1P84K 3BQUA 1H6FA 1CFVH 2WC7A 1LWHA 4A04A 1AGEA 1FP5A 5B8CB 1SLVA 4JRWA 4FZEH 5D2NA 5I9QB 3VRJB 3X1EA 5T8IA 3X3FH 5DJ6A 4PRAB 3MX0B 3V6FA 4POYA 2Y7QB 4ZW6A 2OQJA 5ACZA 1R47A 4NZ8A 1F90H 3NOIA 2EDXA 3CN2A 2CNZA 1HKLL 1AG0A 4HIXL 3DO4A 4JREC 3HOGA 4PG9A 2ESVE 4H4NA 1CVSC 3MODL 4OBSA 4G8AC 1RUAL 2WNGA 2EYSA 5DRWA 4AL8H 3VFPB 3MV9D 4KO9A 4NLHA 2QHRH 4NOFA 3KEHA 1CL7H 1YDPB 2WXIA 4M5ZL 4YK4B 3N5AA 4H25A 1J9TA 1JDDA 4BK4A 2QSTA 3QSKB 3TPKA 2VC2H 2D31A 2ZYSA 3ZZLA 4MFHA 4PBWD 4HJUA 2WXGA 2X2HA 3ZUCA 1T20B 3NRQA 1YJDH 2CDFB 3BISA 1RCYA 1ZA3B 4S10A 4YHZH 5LUMA 4RAUA 43CAB 1HJBC 5FA3A 3CFBB 2KDYA 3IFLL 4QRAA 5IIEB 3RIAF 5C0BE 1NANH 1B2YA 4NQUA 4UWQB 2H2PD 3NIDF 1XZ0A 3ARSA 2CO6B 1XGQB 4FQ1H 4ZZFA 2BWIA 3I6KA 4P0DA 3PWVB 1G7LA 3V7MA 4YXLL 2V5TA 2ZP8A 3VI3F 4EDWH 1HH9B 2DTSA 4DK3A 5ADOH 1OE1A 3DX6A 3NJNA 3MLPA 1B4RA 2IPTH 2KLTA 3MV8B 4QRRB 3GHPA 1TVDA 4NC1C 2F18A 4LL9A 2W1NA 1ZLVH 4JJ5A 2PYEA 4YR6B 3UIZA 2XKNB 5IJDC 4MX7B 2XKUA 3HZYA 4CRPA 1NDGA 4Y7MA 4HX1A 3G5WA 4AVJA 3EH3B 3H4HA 1PD0A 1QBLH 4NO0A 4GMTL 4LPVA 1SHMA 5IHWA 4UDUB 3L4CA 3MGOA 1VENA 3KH3A 2WIIA 2WW8A 3IDYC 1UXSA 1OPGL 2KBGA 1UYWL 4HJIA 1PAMA 2XACC 3DTUB 4KX8A 5K9KB 1IE5A 2VQTA 1HINH 4LRIC 4KFZC 5DD3L 1K9TA 1FVDA 4FXGA 4HLEA 4NRYB 3CZNA 3KPSD 4KI5F 1CLOL 1UUNA 5T1MB 2DMGA 3LD8B 4M6AA 3UZVB 2WKOA 1OY3B 4WWKC 3LN4A 1S7QA 1INDH 3OKOB 5HGAB 4LLUA 1UT2A 3G08B 4XTRD 4LT7A 2IQ9L 2J5LC 3LIUA 4KJYB 4PB0L 2ZUXA 2ZOUA 5BW7C 2C1PA 1LNUA 2D3LA 1TYEB 3PAUA 5C0AB 3UPRB 2KL6A 3VFOB 2BSEA 2VUKA 1IAMA 4WHTB 4XNZB 3MLRH 5C09A 2AJYH 2CKNA 3DGDA 5LGYA 1U8MB 3FUFA 2BW4A 5F1IA 3V0EA 3CVDA 5CGBA 2B1OA 3UBXI 3MUJA 3HI5H 3WNIA 5HDQH 2NY2B 3MLXL 2VN3A 1JZGA 3IDNB 3SPCA 1F1DA 2BZCA 3MJ9A 2OTUB 3EH5B 3QDJA 4RWYH 1DVFB 5JYLA 2E4FA 1RZKH 3SD2A 2NY2D 5HHNA 2IH1B 5DXWA 3WGVB 5K5YA 4HHGA 2NX5A 5EU3B 2OYKA 2X3CA 3E2HB 1UH3A 2RACA 3L7FA 1KCUH 3RX8A 2WKOF 5I5IA 2I60H 3ZR6A 1H6TA 4H0GA 2NSQA 3CPLA 2WLKA 3RKDC 2C1PB 3BGFB 5CHNA 4L0YA 3K6SB 3OD3A 4L4VB 4M7LL 3BWAA 4TPRL 4EIZC 1PY9A 4U1HB 5K9JL 3E9TA 4DSYA 5AB2A 3SDXA 4JJHA 3M45A 1RSYA 3LPWA 4ERSH 3JTTA 1V7MH 5DLLA 1ZLUH 1N67A 5H4YA 1KBKA 4GW5B 5C7ZA 3IJYB 2DQHH 4UIKH 3KPSE 5C08E 1HOCA 4ECNA 4ZW5A 2NZIA 5KVEL 3K72A 2VLKE 3CBRA 4OGZA 1CQYA 4IOFD 4MMYA 2OMTB 4G3YL 1DDTA 3QJQB 5DO2D 3S2AA 3KLLA 3X2QB 4TLTA 4LESA 1NCWL 3O0RH 3T0ED 4Z3GA 5JUEL 4N1HB 4ZUWA 4Z95H 4DKAA 3HI6H 1MLCA 3AUVA 5BRQA 4WI4A 3CZFB 3G6JF 5J6HB 4FLHA 2HJFA 4M8UA 1FGNH 4PS3A 3IFNH 1U3ZA 4JZNA 3WN6A 1FFPB 5FAAA 2WNXA 4H88L 4QWWC 2ZXEB 5GZNC 3D30A 3NSDA 5IKCB 1P4IH 3C9NA 5DJ2B 2XWTA 5H37H 1QA9B 4JO2L 1XCTB 4ODWB 5BZWB 4NKDB 4PJAA 2DM4A 1UD3A 1NLDH 1KLFA 4NHCH 5E6IA 2YUWA 4QHMA 5LVEA 5H94A 3LJ3A 4WWPA 3V5HA 1WGVA 2J5LB 4JRFA 5BPPA 2O30A 2G9HB 4JFZH 4PJBA 1SYVA 4S2SB 5FA3B 5FA4B 4BSJA 1HHKA 3DXAA 1EFXB 2JIXB 3LNIA 2A6JA 3ISRA 3WEAA 2GUYA 1C8QA 3GBML 3EYQD 2QSCL 1YDPA 4X7FC 2ZF8A 1KN4H 2FSDA 3BVVA 3O8XA 2IANE 4RFOH 4M9PA 1I1YA 4IOIB 2R1YA 1CE1L 3FQUB 1DANT 1IM3D 1ODUA 4FFZH 1TPXB 4NO5B 1QI5A 3T0EB 3BAYA 3MCLL 3CJJA 2ZP0T 1NGXB 1ETJA 2VERA 3HG2A 5TGBB 5F9WB 1G7QA 1OCRB 5DJXB 3E2HC 2W0FA 4CN1A 4N6QA 2RHEA 3VXRA 2F58L 4OKVA 4UM9D 1DEDA 4M61A 1Q9KA 5IROC 2VCOA 3IFNL 1A7OL 4CSZA 3UYRH 1CDYA 1R46A 4M5YL 5JO5A 1DSWA 4JHZA 3LVTA 3L5WB 1JZHA 1BZQK 3JWOC 1A7RH 2FYVA 4TUUA 3S7GA 4F9PA 3SKNB 3QZBA 2GK0A 4A2EA 3QUMH 4YMPA 4LOVA 4LVNC 3TU6A 3L95B 3HE6A 3C60B 5C7XL 4G70B 5TQ0H 2V17H 2CA4A 3U7WH 1V3LA 2YOAA 4GAGH 2NYYD 1CLZL 4TL5A 4A1RA 4TVSa 1NIAA 3JVGC 4CVXB 2D03L 2DLTA 1NCDL 1OWWA 4U6YB 1WFOA 4ZFGH 1PZAA 4EKJA 2P5EE 4RSVA 1R3JA 2IOIA 3L1FA 3MRMA 4LGSB 3VD2A 3P4OA 4JCMA 3KPRB 4DPCX 1LXMA 1HU8A 2BIIA 2H3KA 4KJPC 4XNUL 1B88A 3MZTA 2VDPB 1I1RA 4UT9H 3L1EA 1NSNH 1GAFH 3AWFA 1F3JB 7PCYA 3RZCD 2YQGA 4G80A 3TVMA 1CE6A 2EDEA 5JO5B 3WL9B 2LU5A 3OMIB 4RGMC 5E2VH 2DYRB 2V2WA 3LEXA 1E8XA 4FQCH 4OTXH 1ECYA 1GHFH 2JKXA 4HXAH 4O5LL 3T3MF 3CBKB 2K0RA 4ZTPH 2EJ1A 4G8EA 1TITA 4OCRL 4WJ5B 4QRPB 3OJDA 5C0AA 1AJ7L 3UPRA 4S1QH 4ZFZA 3GYRA 3PCYA 3JZYA 2VSMB 1NFDB 2AJ3B 2N7SA 3WO4B 1UB6B 2A9CA 4K07A 1FGVL 3VXOB 1E50A 5DD6B 3S3SA 4NT6B 5HDQL 3LN4B 3PHSA 4I0PA 2R4SL 2VM4A 2X3BA 4GUCA 4GBXB 4UYQA 3W3BA 5IQ9A 3VXMB 2IF7A 2XY2A 5D7SL 1C5DA 1UTDA 1H0DA 5FCUL 4A67A 2AV7B 1BBDH 1LO3L 4H8UA 3V95A 1IAOA 4KHXL 3OAYH 1J8HA 3UROR 3GGWA 1N0XL 5E4EC 3QJTB 4XVJH 3RWGB 1R1CA 1YMHA 2X4TB 3QA3A 1A5FH 1BP3B 5I71C 1EAPA 2UWEA 2IOMA 3QXDA 2IO5A 4Z7UE 2J73A 3F62A 3IJEA 2NLJB 1LQSR 1ES0A 2H6UA 4MNQD 4E42A 3WTWA 3KPMB 4DF9A 5DRXA 3ABZA 1CJYA 3HS0C 1YEHL 5CCJA 3VE0A 1OE3A 2GW5A 3CVIH 3JWDL 3L3GA 4PJXE 1M9SA 4CDHA 2OMTA 2QDVA 4WI0A 2BRRH 2YPLA 4JGMA 1U8PA 2OJEA 1GYWA 4KOCA 2FX9H 3CHQA 2VJ0A 1N3NB 4Y7OC 1F6FB 1KXTB 1VSCA 2DQUL 2NY6D 3DUSA 5CEYB 3X1GA 3HA0A 1GJIA 4LCWD 1YMME 2CGYA 1Z3GL 5LCVL 2CE6A 4G9DB 1U2CA 1WT5A 4NQSA 5G4MA 1BQUA 2EVHA 4IRJB 3STZB 3BH9A 1TVBA 1YAIA 4O4YH 3BWAB 5EC1B 2EDOA 1RIUH 3DKHA 5DEFA 3HE7D 1NUDA 1C08B 2F15A 4LSPH 2VRKA 3NFPA 5D7KE 5EBMA 5EU7E 3AU1A 3ZHFA 3VWKA 1JPFB 4FQJH 4DHLA 5IFHH 3WNNA 4WCYH 4JZOA 5DFAA 1DLHA 3HAEH 4TNGA 1XF3A 1YY9C 1Q9WB 1HC1A 1E9PB 2FLRT 3QZWB 3VFGL 1E4JA 3ALWA 3DECA 3VE0B 5GRUH 3ARUA 5DK0A 5ICZA 3G6JE 1TVHA 5ELIA 2VE6B 1MXDA 3TBCA 1S7TB 9CGTA 3FUJA 5EDXA 4CA4A 4HGWB 4AM0Q 4B95C 1KB5L 1SN0A 5I8CA 1IILE 3EO9H 4PJDE 3HLAA 5DUML 2Y7OA 4HS6A 2FTAA 2JELL 3N1MC 2A9NH 4B50A 5HJ3B 3ILPA 3D9AH 4KXAA 1CXFA 1RP8A 3ELAT 1IBZA 4WHTA 4PJIF 2K78A 5J6GA 4GQQA 4YHPA 3ZE1B 4P5TC 4P4RA 3TS8A 2G75A 2X6CA 3DBXB 3O8XC 5JTWA 4N0FB 1C1EL 3TO2B 3AU1B 4IHOB 1ACZA 1KELH 3FOMA 3ULUD 1YYML 3BEVA 2VLJE 1CBJA 25C8L 2Q3XA 3K8LA 3VXNA 1UJ3B 3CVHL 5I1LB 1UWXK 3HHRB 4GRLC 1TVBB 1CICB 2DYPD 1A4AA 3DX1A 3SO5A 2BVPB 4BZ1H 1NC2D 3LZNA 3MO1A 4QUOA 4XC1H 2CGRH 5E6UB 1XGRB 1FZOA 2XUWA 1PF3A 1A8ZA 3IJ9A 4OLVL 4RIRA 4ZFOL 1GKOA 1DEEA 2DN7A 2K3TA 2XPGA 3I74A 5FUOL 5IHLB 5E5LA 3BP4B 3QUZC 3FFOA 3Q3GB 2O61B 5KJRL 4GKZB 3NBNA 1NGZA 1DVQA 1K3IA 3DIDA 3V52H 4MZRA 3PAYA 1DTUA 5AW8B 3K6SA 1OAXL 2E27L 4HIJA 2NR6C 3TASA 1LEKA 4ZOBA 5CF3A 5D1QD 4AENB 2WTRA 4OFIA 1FG2B 4WENB 5A2BA 3QRBA 2MQ3A 4D9LL 2MH4A 5FOBA 1E30A 5FIEA 3O2DA 2EE9A 4JFYB 3HE6B 4PS8A 1BF5A 4POZD 1DLFL 5GS3A 4Z7QB 2B0SH 2OXHB 1NC2B 4CDGC 5KS9B 4NYLA 5E99L 4JO1L 4Z7AA 3F12A 5EBWA 5JA8B 2IIJA 4FNQA 1IM9B 4B97A 3FF8A 3V0WH 3CGTA 2WP3O 2BFVH 1YY8A 3MMEB 4KK5C 2OFQA 1J5OL 4DQOL 3KBFA 1ND0A 4D8PB 4LCWB 3RI5K 5FFLA 3O6MH 2OL3A 3MUGA 4G43A 4ZPVA 4GG6B 1IC4L 5LAXB 3BD5A 4XCYB 5HHXL 4P59H 3DSFH 2ZUQC 3S34H 4AMKH 2WGXA 3KL0A 4F15C 3O4LE 1UD5A 3D08A 3LXUX 4TUJA 2AJZA 2A4ZA 1ZMYA 1BLIA 4Q9RH 2NUTB 3R7QA 4H8HA 4QCIB 4IOSD 1GGIL 4I3RL 2BS9A 3F5WB 3PU7A 4U1JA 4WI8A 5T5FH 2WBJA 2JSFA 4LLQB 3BIAX 5FUOH 4X2UA 5HHQA 2Z7UA 3KGSA 4H5SB 1W2KT 5JYMA 1N26A 3C2SA 1U8HB 5TQ2L 3EDJA 3A24A 1DQTA 2OSYA 4ONFL 2VLME 2ITCB 1T20A 5BV7C 4OW6A 3VI4A 1IFGA 1QRNA 1ZE3C 3KBPA 4YLCA 1MFDL 1QNZH 5ANMA 4YSUA 5EOCJ 1UB5A 3ZTDC 5K9KA 3ULUC 3GSRB 2KYIA 5ENWB 4WW1A 1S7VB 1X9QA 4OGQC 3O6KH 4PGBA 4Q56A 3X14B 7PAZA 2AFNA 3UTSA 2FHBA 2WLYA 1WC7A 3FCSA 4KRNA 5KBPA 5C0CB 3SCMB 1NEZB 1HAWA 1QA9A 5E00B 1HYSC 1WCBB 4Y5YB 2QVTA 5TK4A 2DQJH 3U0TA 4PHZA 4MMXC 4ACTA 2Q10A 5IGXH 1QWNA 1QX1A 2J4WL 4WFGE 4DH2A 2UVFA 2A9NL 2DQDL 3GLEA 3WCYA 4IEFA 5KVDH 3WTYA 4PIBA 4OCYH 2QQLL 1MDAA 3B2VH 4EUPH 2AEWA 5HBBA 3HTLX 2DL2A 3DI2B 4PJBF 4JK0D 3X12B 3GT6A 2P8PA 1P4LB 3K81A 1JNLL 3R4DA 4JGUA 5TFSL 3WE6B 5TTRA 3RBGA 3IDGB 4X7SH 4PJFA 3ETBF 4LO9A 4OIIL 2NT1A 3H9SE 4R96A 4DP8X 4NO0D 1YHPA 4R90L 3DVGA 2SEBA 1WEJH 2EDBA 5F0MB 2R1YB 2ISDA 4HCRH 2OS7A 3RG1C 1MRCH 3VI4F 2X4NB 5J6SA 5HDBF 3CMGA 4ZS7H 4LSPL 4JKMA 1U33A 3QDGA 4GKSB 4UB0H 4WEBH 5J4MA 4LGRB 3VI4B 2G3NA 4O4YL 3QI9A 1A3RL 4L9LA 4UQDA 1N64H 15C8H 1BXUA 4D94A 1O9VA 1H15B 5CU5A 1SLWA 2WXPA 1SHXA 3EF4A 3KDMB 3NQKA 3L16A 1J0IA 3B2MA 3QHTC 3QIUC 4NP4H 2C7FA 3VFRB 1KGUA 4PV8A 1Z3GH 2HVKB 2DM3A 2UXGA 4HBCH 4Z7IA 4M7KH 2VXSL 3FRPA 5F1NB 4L4VD 4P2AA 5J3HD 5DMGC 4MA1B 4Z18A 2V9QA 5JDSB 3T0EE 3VA2C 1CGWA 1BMZA 5EUOA 5KZCB 3QAZC 5IBUB 4L8SB 4ADIA 1QUPA 2N59A 1U4EA 2ADYA 1N9PA 4QRUA 3IFOA 3S96A 5DRNA 2OTUA 3DDFA 1UUSA 1S3KL 4M62L 5I17A 1U58B 2HG0A 5GZND 4S1RH 1D6VH 4RMQA 2A38A 2HKHL 4JM2C 5JW4N 1COBA 2XSKA 1A5FL 1EEYB 5DD5L 3ULVH 1EJ8A 5AD0B 3C6SA 4N9GA 4FA8A 5JOPD 4HLZG 2NXYD 3QUXA 3CDZB 3E3QE 5T3ZL 5E9DB 5A2JH 3E8VA 3VFMA 3O11A 5ESAB 1EX0A 2HJLA 3ARDA 5C0RL 4UT7L 5L4MA 2XRAL 1JUFB 3DOSB 5GRJH 1F02I 1BLNA 5EEWA 1D7CA 5F1NA 2XN9B 4Q6IC 3IU3B 1IUZA 5KZCD 3BWUC 3JSSA 3DBXA 1I53A 4H2AA 4N20A 4AV0A 2WXQA 2K4AA 1H15A 1QFWL 4ZUSB 2EXSA 3IDUA 3Q6GH 4PAZA 2ZQKA 1MIEH 3HG3A 2F53A 1PBYA 5D1ZB 3LKRB 4U6VH 4I48B 1GTFA 2Y1ZA 1KLUB 1PQZB 2V2TA 1NL0L 1KC5H 2KS0A 2W9LA 4AT6A 4W4OA 4YBQD 2X1OA 3H8NA 3MNVB 2IWKA 1PFOA 3I9PA 2G2NA 2X4QB 4GEIA 2EC9T 2GCYB 4JFUA 1X9LA 3ATEA 3BKJH 4BSWA 1QI4A 3SHSA 4AH2B 4Z7UF 3FTSA 4JAMB 4OFYD 1B9ZA 4ZG1A 5E95B 3AREA 3DTXA 1OLZA 5GZOC 1FVDB 4FXGB 4F7TB 1B0RB 3LB6D 5IQOA 4MD4A 2DQEH 2FGWL 2NLJA 3LB6C 3Q0HA 1XX9C 2ADGB 2YPKA 3PG2A 1CLZH 4APQA 2GI0A 2IGFL 2G60H 4MAYA 3CSGA 1SDDA 4PJHF 4Y19B 4OLWH 4UNUA 4U6XB 4LVOC 2ZWSA 4U1MA 1H8SA 5HJBA 3E1ZA 3D69A 1KGCE 5D1ZD 5KVGE 1F11B 1JNNH 9PCYA 1LE9B 4TVUA 4WI0B 3MGTA 3BPCA 3MFFA 1BZ8A 1K2DB 4HK0A 1MNUH 3P11H 4PJGE 3FH7A 2KQMA 1JL8A 3O3BB 3SE9H 4AYFB 5K9QI 5MENA 2DWTA 1OSZB 1U8IB 3Q7JA 3TNNA 4AK2A 3WEMA 4E9WA 1WFMA 2B1HH 4G2AA 4M5YH 1BWWA 4M6OH 4LLUB 1TQBB 4C4BA 4KK6D 4E9QA 2CIKB 2DJMA 3OR7A 4DWHA 2KMWA 5C71A 5ID1A 1XQ4A 5FYJH 4ES9A 4PJEE 4Z7WB 4S1DD 1FL6A 1G6VK 1K8DB 4AQZA 3TT1L 1A6WH 1GY2A 3VI3A 5E7BA 5AVRB 3N91A 4JRYD 5EBMB 1CU4H 2BY3A 3ISWA 4HOMA 4HWZA 2C9RA 3C12A 4I87A 3WIIL 4Y2DB 1CGTA 5B1JC 1UKSA 2OMXB 5MHSE 3KXFE 4C54A 1WEJL 3CD4A 2LVEA 3JWDC 3T4AC 1PG7W 5E6ZA 3EW3B 4AQEA 1WAAA 4CN4A 2D31B 2VISA 3MV9E 2VMEA 5KBMA 2KT6A 1PX3A 4KH9A 1MCNA 5FK9A 4HMEA 1NFIB 5CCGE 1XR8A 1SRDA 1YN7A 1KTLA 4JB9H 1F13A 3KYMB 4N90E 4QYAA 1KEGL 4DN3H 2XWXA 7TAAA 4OD3H 4MNHB 1Q1PA 5DO8A 1CCZA 3ESUF 2O6PA 3WIHL 1YN6B 2OV0A 8PAZA 4JN2A 1FFRA 4G9FA 2GPZA 4WWKB 4KXDA 3FUIA 5T1KD 3SY0B 3DX2A 5JPNA 4NQEA 2LT9A 4AYMC 3WENA 5J3HC 4DO6A 5E6YA 4NS0A 1UKQA 2P8LB 2DB8A 2OTWA 4P9HH 5E24E 3IGFA 3VFTB 2XN9D 1FGNL 5JR1L 4KAQH 4F3FA 3QK0A 1T21B 4FEMA 1S7XA 3OX8A 4HWBH 4A2DA 1MRFH 3IDMA 1QLRB 2MNJB 3F6IA 4UBDC 5KANI 1BPVA 1SOKA 1FIGH 2OXGA 5DVMA 1PAZA 1ID2A 4AX3A 3QFJA 5BO0D 4GQ9H 3A67L 4YZFE 5DD6A 1CDUA 5C07E 1E9OB 5ESVB 5IJVA 2W65B 3ZKQD 1Q9OB 1T6BX 1KENL 2VZTA 4IJ3C 5BV7B 2ARWA 3I75B 4G42B 2PWGA 4XAKE 5AVSB 5JLZA 1C9SA 4OD2B 1PZSA 1IKFL 2CRZA 4KZDL 4Y4KD 3LXAA 5DZLA 3OJDB 1H5BA 1BAWA 1KBGH 1X5ZA 2BVTA 4JRYE 4YDVB 1KZYA 4AY0A 2WLIB 3MRNB 3MKGA 2VISB 4ODHH 4F58H 4F7KA 3OKEA 3A21A 1C16B 2F7PA 5GHWL 3LIZH 8CGTA 2WB1A 1U91A 4G7RB 5HHPB 5FA4A 2HKFH 2MCAA 5AZEH 3DSNB 4KKCD 5F6IB 3KLAB 1JYVA 3CX5K 3UL4A 1MRDL 4JG0L 1E8YA 4HWUA 2F2HA 3O2VL 3PIQA 3HS8A 4N0UA 3BZEB 4C8XA 1B0WA 5F7KC 5TDPB 2V5MA 5L2KD 3D34A 1OSYA 2VR9A 2CR3A 4Y0GA 1REIA 3BKJL 4UV4H 2KI6A 5ITFB 3QZNA 4KKPA 4IOSA 3VFTA 5GS1C 5J13B 3EGDA 4EI0A 2QKIA 5F89B 2NY1B 5D1QC 4J6RL 5HHQB 5KVGH 1RSFA 1CDCA 3DRQA 5AYUH 2X7LA 3HI5L 4E9YA 2CLRA 3DX4A 2OA9A 3ZKXC 2Z8RA 3CC5A 3BJLA 5LBSA 2PO6A 2K8MA 5AVXB 1EVUA 1YEJL 2CD0A 3BIKA 2HN7A 4NIKB 4OZ4B 1E4XH 4PSRA 1JGDB 1QFWH 3UBHA 2V8LA 3QDGE 3D85B 3RUGA 1QPXA 5FWRA 4ENED 2B1AH 2VXQA 3EYSH 2NOYA 1HZKA 3BVWA 3P73B 4UM9A 2BNUB 5HYJB 3UCRA 5EORH 4DTGH 3WDJA 4IBUA 2FWSA 4XC1L 1MI5B 5A6MA 3IKCB 2P80D 3ZMRA 2YXVA 1P4LA 3GNMH 3VGBA 4KTGA 1S7SB 1JYWA 4MB3A 2YPVA 4NNPH 1LHZA 3GSOA 4J3SA 1PZ2A 3GSNL 1YEEH 3B6SA 1YYMH 4PJ7E 4BBWA 1M6OB 4XOCA 1MCRA 2XV3A 4U3HA 4QF1B 1MJJA 4UQ3B 1S3KH 2D7MA 4M62H 5K69A 3PGCA 4AG4L 5CGMA 4NM4H 2XWRA 3JV6A 1ITBB 3S37L 3UO1L 2G3MA 1Q0EA 3KH4A 5HD8D 3I6LE 3ME0A 5FYKL 4B5ZA 1P5VA 3WXVL 2FX7L 3EYFB 4XT1C 5HYJE 3RVWD 4FN0A 1GGCH 1EXUA 4FNUA 1AIFA 2VQ4A 4J6IA 4PJXB 4UMGA 2WAHA 2WZ5A 4JRXB 1G9MH 1Z5LA 4K7FB 1X7QA 3P54A 2V7HA 4XBEH 3DXAD 3BN9C 3LKQB 4FQQB 5ANME 5DJ2A 5E8NA 4MKTA 4FABL 4FTVD 4NP4L 3EJRA 4OVVA 3WLWD 3CIAA 1P6WA 4LP8A 5GRUL 1T6WA 1Q90A 1U30A 3M88A 3OKKA 1CZ8L 5L9DL 2OLDA 4EVNB 5DC4B 4QHPA 3PV6B 5I17B 1ZVSB 3K2UH 3FRPB 1ZT4B 2X4TA 2DWYA 3KNBA 3UPCA 1QBAA 3IK2A 5CMAA 1QYGH 1MXGA 1B4TA 4PJ9A 2JK5B 1HI6A 2DV6A 5FLUA 4G9FE 2CO2A 1OKEA 5EUKB 1VZIA 4L3CB 1TJGL 4PGDA 4Q89A 5IHUL 2PN5A 3HR5B 3C5ZD 1AANA 1BJ1J 1QRKA 1XVSA 3ZX1A 3CSYA 3HUJB 3IJHB 1E27A 3B2VL 4PVMA 4JRXA 5IOPA 1S3RA 4EO5A 4L8DA 4EI5A 4N24A 5ECGA 4H1LB 4IIZA 4EQ3A 1MCKA 4ODTH 2N7AA 2HRLA 2KDGA 3IT8D 3FB7B 1XB6A 1QFOA 1A4KA 3D39A 4HW6A 1WWCA 1TKWA 3AACA 1S9VB 3NPZB 5LN8A 4KXCA 5BOZG 1B0GA 3MV9A 1CI5A 3ARDD 1TXKA 4P3CH 8FABA 5DMIH 4E9TA 1NQBA 2R1WB 3HMXA 5I6XB 2W59A 5CD3B 1BLNB 2D7TL 3KXFA 4MMZA 4J3VA 3TIEA 4UQ9A 3FO9A 3R4RA 3QCUH 1W0WB 5DEFB 4PWIA 1HYSD 2VW7A 3DVFA 3ZYIA 2TAAA 2RCSL 4LSRL 1JPEA 2ZPKL 2J3SA 1LE5B 3NVQA 2FJGB 3L7EB 4B9IA 2E7LC 5D7SH 1YQVH 2NQCA 1THCA 1MWAH 1WA0X 3GXUB 4UAHA 4YJZL 5I2IA 1GH7A 4PRHD 4GG6F 3M1BB 3IJHA 5F88B 4CNIB 1J12A 3A6OA 3PNWA 4BGDA 4GW1B 2YD1A 2L0DA 4JQIH 3LS4L 3QIWA 4XBPA 1NCUA 2CIIB 4MJ5B 4ALAC 3GSRA 5LCVA 3ZU8A 3S3JA 1GSKA 2VDKB 4H25B 1RVFH 2BY0A 3T2PA 4GSRA 3WDIA 3ESMA 5C0DB 2VLJA 3K2MC 4RZKA 5IK3B 1XF2B 4R4FL 3TA3B 4P2RB 3W5NA 1IC4H 5J06A 1ED3B 4P4KC 5C0CA 2P7TB 1CFTA 3O6ML 1U8KA 3J8F7 4J8RB 3VCLA 4ENEC 1EWHA 1GAFL 5PAZA 3EGDB 3RWJA 4K2UH 4LOEA 2DW5A 4MCYA 4YSCA 3DVIA 4WW1B 3NCXA 5HI3D 1TMCB 4S1SH 5LDSA 1K8DA 3JWNE 5DK2B 3FYEB 3D52A 5J11C 3K91A 4D9RE 2IANB 4AQ8A 6PCYA 5CJXA 4DKEL 2GJ6A 4M4PA 4YE4H 4I0PB 3RTQD 3ZW3A 5E94A 2V37A 3LRSB 4HPYH 4Q4EA 1AQKH 3GSWA 1BFVH 3A6CH 4G6JH 1NCJA 4A37A 2XQYA 1XZWA 2X12A 1AOHA 1CG9B 3VXPA 3HBQA 3KLAA 5J11B 4I7ZC 2D0FA 4AVIA 2PYEB 2DWDB 1OAXH 2E27H 1BFSA 3NH7H 3QORA 1HHGB 4OQTL 2ZOLB 4JFED 2ZKHH 3FH5A 5PCYA 2LFEA 1JI2A 5IQNA 1F3RB 3IBEA 1BAGA 1JMXA 1U8KB 3ELQA 3BW9A 4KI1A 4B53A 4LKCA 2W9DH 3LEVL 1MLCB 4CUCA 1DBJH 1M2OA 3FN0L 3P3TA 4F8OA 4IBYA 4NJAL 2EP6A 4XN5A 3VXRD 4BQ8A 4WLCA 1KGJA 2X7LB 4MJ6B 3FTYA 4NAMA 5DJ0B 4MXQD 3LOWA 3FBKA 5KN5B 1T66C 3QIBB 4PI2A 4ZT1A 5HDBB 2Z91A 1KXTA 2EYTA 4TUOA 5MERB 2A7BA 2K45A 2J8UB 2BFGA 1KELL 5FECA 2FQGA 4RFOL 1LGVA 4NI3A 4MDIA 3ZQXA 3ZE2B 2ZOWA 5L4FA 2ZONA 4LEXL 4GLRI 4Y4FC 4Z3HA 3F12B 4N8PA 3FRPG 5FM4A 1NC4B 3U82B 4HWEH 5TE6L 1HXMB 1PLGH 1VFMA 3CXHJ 4JFDB 2DIEA 3K6OA 3B5TA 2VR3A 3SGEI 3CLFL 3D0AA 2UWEE 5IF0B 5BV7H 1U92A 4QCIA 4RFEA 4TTDD 5GJTL 3IWVA 2EEBA 3ATDA 3MRJA 4BIKA 4JFPA 2ICCA 3D3VA 3LAFA 4J3WA 4R7VA 3RNKB 1IGIL 1R6VA 4MSWA 1IJNA 3HHSA 3MOAL 1P4IL 2ZWZA 4XMTA 3PAZA 3KNBB 3FCBA 4YSTA 4RGNE 3VFGH 2CO3A 5E0FA 1WIOA 4IM8A 5KSVA 1QUNA 2BSTA 3T8VA 3C6SB 4N9GB 3WY1A 1A3LH 3M07A 1E9OA 3TIDA 1EHKB 5IJVB 3WHXB 1VGKB 2FQFA 3HC0A 1R24A 1KGXA 3DSNA 1IIIA 3WD5H 3FSWA 4M1GH 1IRAY 4MQXC 4U1NA 2F8OA 4HUNB 4Z95L 4Y9BA 5HVFB 4M48H 3MRBB 1R4XA 5DUBB 5E9DE 3DO7B 5C09B 4FQQA 2OYPA 5EEVA 1KCKA 2FATL 1GXEA 4U05A 2BVQA 1HEZB 3BEVB 2N4IA 3FFDB 1OCCB 5F7EH 3QG7L 4FXKB 2Q86A 3IDIB 4NQDA 4PLKC 2H32A 5GGRA 3Q2CA 3C6LB 2VDNB 4IMKA 1XGZA 5KYXA 5FKAA 5IBTH 1N4XL 4PP2B 4JGJA 5F3HB 3EOTH 5KYUB 4L3AA 4N25A 1IEAB 5HTSA 2HMIC 3FU7B 2BWDA 2YFOA 1EHNA 5CGTA 5BXFB 3H2QA 2UZPA 4LSVL 3CSPA 3OGCB 2WKLA 2D0GA 3V4VA 3WIAA 2C1OA 4TV3A 1LP9F 1OAQH 4XP6H 1WPCA 3UTSE 1WTGT 4K23H 4XN4A 4UM9B 3I50H 1G7JB 1CDHA 3QNYA 4H20H 1OAKH 4F7TA 3TN0D 4F20A 4BKTC 3T65A 2DQCL 1QNIA 5EFIB 4XO5A 3VI4E 1IL1A 1BZ7A 5ABZA 2YAPA 3HG5A 3DX6B 5AZ2H 3SGEH 4LHUB 4ZW3A 3GMQA 4P3WA 2OK0H 3PJSA 3HAEA 3GWJA 5E5RB 4JFFE 5F7AA 2NX5D 3ARPA 4Z7WE 1NWOA 1WLHA 5E6IC 1MFUA 3BH8A 2VZ1A 1R3LB 1TEGA 1FZJB 3PWUB 5GS0H 4QRRE 3CZJA 1PZ3A 4YBLC 3SPJA 4LNRB 1EFXD 2JIXD 5HHME 5J12B 5BUAA 1BX2B 4ZTPL 4W9EC 3LNHA 2AV7A 3CCHA 3IJEB 3EJJX 3O4LA 2R59A 3EDDA 5FS5A 3AXLB 2C5DC 5D2LF 4HD9A 3C6LA 3KPPA 2NW2A 3EAKA 4HKJA 3ZUNC 4Q0XL 1UENA 3RGVC 4MASA 3REVB 4XNUH 2XXFA 1LM8V 2Z0UA 3BAWA 3O45B 5D1XC 4EDXA 3GS4A 5FYLL 1Z1WA 1N4XH 5A6IA 1G6RL 1NCDH 2DTMH 4OIBA 3D4YA 3EOBA 2FO1A 2GTQA 2P1YA 5IW6A 3P69A 4J3OH 2WZPD 1FYTB 2D3JA 2WXJA 5KSBE 2WUBL 2ZJSL 1KG0B 1TZHA 2O26U 2PWEA 3FU0A 4LNRA 4X8XA 3T08A 4MJ4A 2YGVA 1DJWA 2AQ3A 4LP5A 3MRLB 1LO4L 1KN2L 1I1AC 1KJ2B 4P2OB 3HN8A 4FG4A 4M7JH 2AXFA 1A7RL 2BY2A 1AR1D 1IQWH 5E8PA 5LQBL 3PJSB 3OX8B 4AOFA 3CFJB 4FFWC 2AXWA 1HQRA 2ZSVB 3VRLE 4NQVA 4WNQB 3MACL 4H1LH 4W70A 2N3JA 1LO0L 1PLAA 1JZ7A 2XXMB 1UADC 4IGBC 2JF1A 2WUBH 4AIXA 1CLYL 3HS0B 5GZOA 1H5BB 5C08A 4WWOA 3ULUH 3LSOA 2EUZA 2FR4B 1UWXH 5I6KA 5D7HA 4XPFL 1I8IB 1TIUA 5C0IB 2WLNA 4X80L 2DBJA 2XTJC 5JW4R 3HG1A 2Y3AA 5L88L 1S5HB 3C09C 4PUBL 3CXDL 1NAML 1XSOA 3W39A 1ZLWK 1ROCA 1V8HA 2DIJA 1H8LA 4ZMAT 4FQPA 4L37A 4OFYA 3NACL 2WWMD 3P3SA 2Y7MA 1CL7L 3RNKA 5JHDA 1F4YH 4R8WL 4TQEL 3K6IA 5D7JC 3VQ1C 3ARGB 4AL8L 1DFBH 1MCOL 4PJDA 4WFFD 5EHFA 3L5XH 3V6BR 5I1KH 3CMOL 3K7UA 3K1DA 4ZMLA 2X6UA 3E7JA 2JTYA 3KJ6L 4XNAA 3DV4B 1ZT7B 2JB5L 3BUQA 1KULA 3QXAB 4YH6A 5AW3B 4JY5H 2XV2A 3K0WA 3DUHA 1O9WA 1FI8C 1YEDA 4TUKH 5AAMA 3ULVD 3E80A 4EI5C 1CS6A 2VDMB 2P48B 2APBA 1TU2B 4AIZB 2OK0L 1T5WB 2FE0A 1B2WH 4G7VL 1F3JA 3FUDA 3ZT6A 1EO8H 2YAMA 3BSZH 5E2WL 3GMNB 4ALAL 1QUNB 4MXWH 4YFLF 5IQ7L 2HWZL 3SD5A 1X5AA 2C3VB 3P4MA 4RWHA 4IBVA 1RULH 3DARA 4PRDB 4X6FB 3TEUA 4GEJA 3IS1X 1XCTA 4ODWA 2KLSA 4XP4H 2OMUB 3FT3B 2W60B 4L5FL 3P9MB 4EUPA 4AQEB 4A6YA 2O1AA 3FQXB 3VDCA 4XMLH 5E6IB 4J3TA 4I9WD 5KVEH 1AQKL 3WTUA 4ZOCA 2VDLH 4RGND 3WKYA 1JVKA 4JM4L 4X83A 2ZCKL 3IYLW 2MQ0A 2YKLL 4TSBL 1P0SE 4MMXB 1SF3A 4XMZA 4UZGA 1FZKB 4P2RD 1ZV9A 1T2QH 1AG6A 5BO1L 2Q87A 1MCHA 1AZNA 4GUPA 3Q05A 2VDKH 1YEDB 3VQMA 4FL4C 5HGHA 5F7UA 2OX5A 2DWDA 4PN6A 1NAMA 5KW9L 1LYQA 1KCSH 1T0NA 1VESA 2UY6B 5KSAA 2ZX5A 3U6XA 1S7UB 3OZ9H 1IAIL 2WINB 4XNYL 2AVFA 3NFPB 4HC1A 4Z7UA 1ET7A 5E94B 4LSUH 2ED9A 2I60L 3QEQB 4YFDB 4IU3B 5CGYD 5SX4H 3VWKC 3I3DA 2M83A 4YHYC 2PYEE 3A4FA 1JE6A 1RL1A 3TT3L 2Y6SD 3TFKC 4LVEA 4RAHA 1HH6A 1RZKL 4JM2A 4A2FA 3ZE2F 1CGXA 1XTLA 4NWTL 5AKRA 1BG1A 2C4FU 2EIZA 2Q8AH 2AJXL 3HG0A 1SXSA 1SOXA 4GFXA 5IROA 2V7NB 2IH9A 3F5WA 3PQYA 4FFYL 4ZQKA 4DKDC 4GRLB 2BHFA 2IQAA 4N1EA 4RRPM 3UTTB 1A3QA 4RDQF 4GUPB 5SX5K 4PG2A 1UWYA 2PCFA 2YD9A 1E3FA 2FIRT 3ARDB 2RCSH 5C0BA 4XCEB 2H26A 3GXTA 4PHXA 3OWEA 4F57H 5CSGA 4LRNH 5JHLA 4EZKA 2DQFA 5BZDA 2BP8B 3U4BL 3ECBA 1R3IL 4KVNL 1ZLVK 4PRID 3L5JA 4UILH 4XWGL 4XXCA 2AABH 5CKAA 2BSBA 5KVFE 3CPLB 4ODXB 5IV2A 3NA4A 1FL3B 3MRIA 4PCSA 1MCIA 4OZGA 5LLIC 1DVFA 2LR4A 3H3KA 5DD3H 4G8IB 1TEFA 2PR9A 3UERA 1DJGA 5J57B 1KDJA 3PJLA 4F1SA 2ESVA 1ZHNB 4JFXA 4R2GD 2IALB 3KCPA 5KS9E 3WMSA 1QFWI 1GYCA 3GMMA 1KBWA 3OQRA 2IAAC 3V6OE 1UC6A 4NZUH 4YN3A 3B2UD 4JAMA 1QVOA 1A6TA 2EQDA 2IAMB 4A7VA 1II4E 3LKSA 4NJAH 1Z0MA 2WBWB 4MAUL 3ZO9A 1B4JL 1AZZC 5DVOA 1DBJL 1W8EA 2XG4B 5CBEA 3LRKA 2NTFA 4RMBA 3TV3H 1T7XA 1DN2A 1I3VA 4KGLA 4RNRA 1UM6H 1N68A 5ALBL 1AMYA 4OY9A 4U7KA 4PR5B 1D6EB 3B7YA 4FQ1L 5FUZL 1NBYA 3BPNB 1GJUA 4U49A 4NYLB 4QLWA 2NT0A 2PKDA 2ZP9A 3PUCA 3Q1SL 5IMMB 4JCLA 2NY7H 1W0WA 1VGEL 3M17B 4HZ1A 2E7DA 5FDWB 1JERA 3A6CL 3SB3A 2EKJA 3JQOB 1ZWIB 3KW8A 3UTTD 4PJFF 5IVOA 1OF2B 1U8JB 2HB0A 3KCPB 3OKMB 3NCMA 2X4OA 4YHZL 1KGCD 5KVFH 2FX7H 4N0YL 1FL5B 1BXXA 1PX8A 4S1SL 4XCFL 2Z4QB 5SV3A 3PGDB 5GRVK 4ZS6C 3S37H 2QMKA 1Y18B 5CSZA 4PCTA 1EEYA 4QIRA 4PH8A 2D7NA 4QMEA 3V4PB 3FDWA 2O93L 1LILA 3P9LB 4CC4A 5AYQA 3BVDB 3PL6D 1G7HB 4KVPA 4NSKB 1KTDB 1B4LA 1HHJB 4C58B 1CURA 1R34A 2WBJC 2YMXH 4HIXH 1VF5C 3EGXA 4FQHB 1TR7A 4LCVA 4OF8A 1JXFA 3ARZA 1FFNB 4LMQI 4DFHA 3U36B 4OI9A 5SV4A 1MCEA 1A22B 1U3JA 3MUHL 3X3FL 2ZUWA 4OLYH 2F7OA 2XZAH 1W9XA 4LLWB 4P2OD 1S7VA 2PP7A 1L5GB 1G7PB 5AVQB 4RAVB 4P2OC 4L8BA 1CFVL 2GBTA 2X2IA 3OKKB 3SGDI 2B1AL 3EYSL 4HT1L 4MYPA 1YQVL 3RWIA 1PFCA 1CDIA 1TETH 5T1MA 1IM3B 3QNXA 4WFFE 2ZOLA 5DUPL 1BVNP 3DMMD 5IVZB 5LG6A 5AL8A 1BQLH 4PJEF 4M00A 4URTB 3L4WA 2KH2B 5A7BA 1TLMA 1JGLH 1NBVH 4DGWC 4PJ9C 3QWOA 3U2SB 2CQVA 3LVEA 1PNCA 1T7WA 5ETUB 2D7TH 3IB4A 5FM5O 4U1JB 4HCGA 1CFSA 1BJMA 1D5XB 1MVYA 3AQDA 4IS6B 5CZXC 5I8OH 3RDTA 3EHBB 1S7TA 1IC7H 3J27A 1W8NA 3VWJC 3S2CA 1TFHA 2X28A 2HYMA 2X0WA 2YN5A 1SJXA 1Z9LA 4KZCA 1J11A 1YCSA 4RLDA 1NPUA 1PDKB 1Z0NA 1L0YA 2PXYC 4H8PA 1CTOA 1HN1A 1KJ2H 2WSPA 1TQTA 4H13C 4PRDA 4X6FA 1BQRA 1BVKB 1ILUA 2D3NA 5CP3H 5C9JB 2Q9OA 3DRQB 2WYTA 4PLOB 1M1SA 3GSVA 2EZ0C 4CBPA 2EIZB 3LN9A 4GH7B 4O2CB 1CFMA 5AZEL 2CBMA 3RIFF 3BIKB 3CFKA 3OMZA 3QWRA 5CJOH 3APDA 3MJ7B 3FT4A 2YHGA 5FM8A 4XX1G 4N28A 4H1LG 3BZ5A 1Z7JA 5E00A 3PQYB 2BY1A 1EV2E 4LHUD 4J4PA 3RVVD 3EOYG 2H6PA 3L5IA 1A6VH 3CU1A 3U4AA 4FNTA 3RGVA 4ABQA 3NUKA 1HS6A 3IU4L 4M8VA 2DLIA 2OW6A 1NZRA 2FQEA 2I9LB 4X7CC 5DSCA 4ZXBC 2VDOH 2O5YH 3UAJD 3GGWB 4LXFA 5F9WC 4MNGA 1KENH 3KXFD 2AJ3A 3TH4T 4OD1H 3EDFA 1CTMA 4X4XB 7CGTA 5TDPA 4Z7VB 3MA9L 2VDML 4H26A 5EIQA 2YAFA 4HIJB 3Q1SH 2P5WA 5L0QB 4UQEA 2XQ0A 2CMRH 1X3DA 3QEQA 4XGZA 5SWSE 1TO4A 3UTZA 1MRFL 4Z7VF 1IIKA 5DMKB 2H32B 2PW2B 4JY6A 5GGRB 3PL6C 3K46A 1F4