2K78A

Solution structure of the isdc neat domain bound to zinc protoporphyrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
126
structure length
126
Chain Sequence
SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.
pubmed doi rcsb
source organism Staphylococcus aureus (strain mw2)
molecule tags Heme-binding protein
molecule keywords Iron-regulated surface determinant protein C
total genus 12
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2k78A00
2H3KA 2Z6FA 2E7DA 3VTMA 4H8QA 3VUAA 3QZOA 3S48A 2O6PA 3QZMA 3QUGA 3QZPA 3SIKA 3QUHA 3QZLA 3SZ6A 4H8PA 2MOQA 4YMPA 2ITFA 2O1AA 2ITEA 2Q7AA 3QZNA 5D1ZI 3RURA 3OVUB 3SZKC 4MYPA 4NLAA 4WJG3 5D1XE 4FC3E 2K78A 3RTLA 5D1QE
chains in the Genus database with same CATH superfamily
2BVEA 2Y7QA 3PAYA 3EDFA 3LIZH 2ZAGA 4PGJA 2KH2B 4OLWL 2MFNA 3U7AA 2VN5A 3BIBX 1KBBA 2VXTH 1FNGB 4XBEH 5LN8A 3MRQA 1DN2A 2HAZA 3CDCA 4GAAA 4YDNA 2P8MB 2XQ0A 3D39D 5F1OB 2DLFH 2N7BA 3D69A 5EBLA 3NP4A 5C6TH 5T1KD 2DQIH 2E9IA 1MF2H 3BQUA 2MTAA 3SKOB 4EXPX 4FP8H 1HL4A 3C08H 1N18A 5FHAL 2ARWA 4F58L 1L6PA 1UUSA 4HUWA 1YJDC 3Q2VA 1AD9B 2VZSA 2RCSL 3WTSA 2P5EA 4MD5B 3REVA 3O6MH 4C56E 4G8GA 4IHBA 5JDSA 4JE0A 1NFKA 1FYTD 3VFGL 5EOCL 2B9AA 1ES0A 1QLFB 5HGBB 1DP0A 4ZW6A 1WFMA 4NQCB 1BJ1H 2H8PA 1B4TA 3LNHA 4IRZA 5EC2A 3V95A 3UYRH 4Z76A 4QHMA 1R3JA 2H7WA 2HWZL 4L18A 1QSEE 3ARTA 3VNYA 3D3VD 4UT9A 4Y2DB 3KWVA 1DEEA 4OM1H 5LCVH 1IQWL 1E28B 5BQ7A 1NTDA 2ED8A 4J3BA 4GFXA 4F7PA 2HH0L 5I8KL 1WWWX 2F58L 2PPAA 5DQJB 4RQQB 3GLEA 3S4SG 2DI8A 3F7KA 1T4KB 5T1LA 3J8F7 4YVNA 3HBZA 2NDFA 4FZ8L 1IAIL 3KDMA 5DRXB 4PUBL 4EUPG 2FSEB 3S3JA 5E03A 1M6UA 5A7BA 2V5TA 1I53A 5CO1A 2KDGA 3QG6B 1YNLH 3REWA 3UTZB 1MLCB 5F7BA 3CDYA 3KM1A 4WGKA 1UZ6E 3WIHL 3MV7E 1MCFA 3RDTD 3BWUF 3R8QA 1JL8A 2Q7YB 3A23A 3TBSB 5SV3A 1UA7A 2GQHA 3L1EA 3GDCA 4HC1L 5LGYA 3U46A 4ENZA 1O7DC 1TZHB 2AJYH 4KXAA 4GMTH 4CMHC 2J2ZB 4W9GC 2D31A 3ARDA 3FQ2A 3LJ3A 4PGEA 3KLLA 2WXIA 3QO1B 2YZ1A 2DZEA 3KNBA 2CG9X 4NQXA 4N5ED 2J12B 2OCJA 1HZLA 6CGTA 3ZL4L 4HKBA 4PREB 3MLYL 4APQA 3K2KA 3U9PL 4P2RA 3HB3B 3MGOB 3BT2L 3GXNA 4KMTL 1UZGA 4N5UA 1Z9NA 1DVTA 5JQIB 2JIXB 4XGZB 5L6YH 5B1CA 4FXGC 3K6NA 4NZ8A 1SYVB 4M6NL 1KUMA 4Z7VA 4NC2B 1M7DB 1OB0A 3WKML 3LNGA 2ZOLB 4E41D 1HWWA 2WBJB 1PAMA 3GXPA 2R27A 1IIKA 3S96A 2IIJA 3Q01A 1ND0A 3W9DA 1G9EA 5I1IL 4PP1C 1HI6B 5DO2C 3RWCB 3G5VA 2YGNA 3EZ8A 4JJHA 2B77A 2NY1B 4BEIA 3NEEA 4ZDHB 5GS1B 3TS8A 4APQD 5FR3A 3QCUH 3AQDA 4OIBA 4XNBA 3CZUB 4QKXB 3P0GB 1B0RB 2C9XA 3TC9A 2DTMH 2O93L 4AWJC 5H2BA 3L4UA 1P4LB 5FF6A 2OK0H 4KXDA 3NSYA 5ACZA 3S37H 1QEWA 4NKOA 4AIOA 1IU1A 2P5WE 3OJDA 1WRFA 1VFBB 3K1KC 2B5IC 2FIRT 3U1SL 5ETUA 2ZXDA 4PWGA 5F44A 3D09A 4V11A 2DYPD 2KL6A 1AGBB 5D1ZI 3ZTEA 5E5UB 3N42B 5GZND 3BP4B 4R96A 4L3CA 4LASH 1R3HB 5D1QE 3BW9B 2EXSA 3I6LE 1GOHA 4IHOB 2XHNA 3L4TA 5KAQG 3NSFA 2M83A 3KJ6H 4QRTA 2M2DA 4X5RA 5E7BA 4Q9QH 1PVHA 3QGVA 1U3HD 1Q94B 1C8PA 1S78D 4W9FC 4KOBA 3VGAB 1UWXK 3TWCH 5JW5B 4EI0A 4QNPF 1EERB 4JHWH 4QRRA 2WUBL 5CEZD 3B43A 4RGOL 5HHNA 3QS3A 4XPFH 1R0AL 2IH1A 1F4XH 5DD6A 5AWNH 2EDEA 3FH5A 1X5IA 2B2XH 3FCGA 2XFGB 4B6ZA 4TTDC 1I9IH 1R75A 1DCLA 2WCPA 1S7QA 3E2HC 4UANA 1TOXA 2Z34A 3JUYA 5D1QB 1BPVA 4ZX3A 1TCRB 4PJ8D 4M8UA 5DD3L 3ML9A 1HVXA 3D1MC 1R3KA 1L7TL 4E5XA 2DLEA 4K7PY 1Z9PA 4DP8X 5L4IA 1CIDA 2F61A 3O2WL 4KUZH 1EAQA 3OD3A 1H9VA 4QXGH 3WSQH 5B8CB 4B97A 2IADA 3STZA 4XO8A 4JB9H 1ZHKA 2K0RA 1JZJA 3O2VH 4XMVA 3N1MC 3O2WH 1BREA 3CZGA 3QP3A 3EO9L 3GWJA 3II3A 4XP4H 1HILA 4HU2A 3SB3A 4JG0L 4I4WB 1JOIA 3HCVB 1H3GA 3PU7A 5DRXA 3D9AL 5J8OA 4K3EL 4TNGA 5DZJA 4JKWA 4S1RH 4IOFD 3U7WL 2DD8L 1ZTMA 2OI9C 1ZRUA 2YEQA 4WI5A 2D4DA 3RIFK 3AS2A 3ERXA 3LZRA 1GPOH 2DLHA 3QXTA 5AVUB 4G5ZH 4G7SB 2BSRB 2WUBH 4Q74A 2LTQC 2QLVB 1O0VA 1UQSB 3JV4B 3N43F 4F2EA 3BUDA 4M1CC 5HHPA 4MBRA 2HFEA 4MAYB 4OLEA 5HY9A 1MVYA 3TH2T 1XDTT 4Z3EA 4IS6B 4P5TC 2R0WH 4QXUL 4Y88A 4B53A 1GS7A 3Q8EA 5C9JB 1QNIA 2B15A 4AQ8C 1T7VA 3A4DA 4JHVA 4FNPA 5E1QA 5LDSA 4YH6A 2IALB 3HRZA 1AR2A 1DDHA 1IV8A 3P3SA 4FXKA 4LEXL 3GI8L 3H6AA 5LGKA 3ZRCC 4ZMAT 4LOFA 3BVWA 2VUKA 3DVIA 1AIFB 1S9YB 4Z7QF 3LPWA 3VXPA 2VSCA 3K1DA 3HR5A 2ICCA 3H4HA 3M1CA 4L9LC 5I8EA 3JZ7A 5DMGC 1XZWA 25C8H 2FLBT 4Y1AD 3FS9A 4F91B 3MRQB 3DNKA 4Z7WE 2VW4A 3KPSE 4FQHA 4L4TD 4XNZB 1GJIA 4LPCA 4Q6IC 4HQQH 5HHPB 2OMBA 2F8OA 4IEFB 1PQZA 2IXQA 5FYKU 1QLEH 1TQUA 3POCA 2J88H 1YQVH 3CFJB 1FL5A 2NW2A 2CXKA 5FUZL 1E2ZA 4P5TD 4AQ1B 3DO7B 2F8VA 2VM4A 3OKKB 35C8H 2E7LC 1ZLDA 4QRPA 3NCYP 2HUHA 3IYLW 4XP6L 4HMCA 4KX9A 3X13A 4QWWD 3V0HA 4FKKA 4KRPB 3VTTA 5DEGA 4BSJA 2VLLB 4MB3A 3VI4E 3CVIH 3APFA 2WXFA 2OMTB 3T0AA 2P43B 2YSSA 2QR0B 1YY9D 5I1LB 4D7BA 3F58H 8CGTA 4OGQC 2ZNWA 5ETUB 1N68A 3JBG7 4K5MA 1Z5YD 3TYGL 1RZFL 3IFOB 3VAEA 3OZKA 4XPHL 4I2XA 3AS1A 1PQZB 2IXQB 1YUHA 2CO7A 1U8MB 2R9HD 2CDFA 1UZ8B 2B1HH 4JN1H 4HJ0C 2JKJA 5CMAA 1S8DA 5E9DA 5F9JA 1A02N 3S36X 4N0CD 5DJCA 2J1ZA 4FTVA 2X4SB 3DYOA 3BP6B 3MO1A 3Q6FA 2VRAA 2ZXQA 4DP1X 3ZDXB 2QVTA 4IK7A 3GUTB 1DBBH 4D0BB 5TFSL 4PR5A 5C92A 1W8EA 3DETC 1J0JA 1DVUA 3FULA 1TTCA 4HUUB 4PWHA 2FQFA 3MNVA 4GMSH 1QBMH 2CJ3A 1CLOH 3X1EA 5FWQA 5JMOC 2XTJB 4WEUD 4N26A 2UY6B 1NCNA 2R8SH 1B4JH 5DUMH 1DVZA 3NOIA 2X1XR 4WO4D 5EOTB 4ZAKB 3WIHH 2DJSA 3IDUA 2EIZB 4RIRA 4YHIB 1HH6A 1MJ8H 4I18C 3L5WA 1GC1H 2XN9E 2DQHH 2QZQA 4PJAB 3RX7A 1SYVA 4JREB 1ONQB 1BVKA 1KLUA 1ZS2A 2ED9A 3F8UB 1P84K 1L6ZA 4PUBH 2G2RA 4N8VB 1MFVA 4X6FB 1OGTA 1U8CA 4LL9A 1QSFA 3Q9PA 1PY4A 1MAJA 3MHZA 4J1UB 3LQAL 1T1WA 1PKQB 1Y6MR 3N9GH 4HCGA 4O9HL 1EJOH 3FUIA 5FDYA 1E9QA 1AR1C 3RPIB 3WNKA 3SGDI 3A21A 3EHBD 1TMQA 1ITBB 1MW1A 1RZGB 1YAZA 3L3DB 3VFNB 3ZO9A 4ZODA 4YSCA 1VZIA 2J72A 2Y23A 3CVBA 4WI4A 1FNLA 1VACB 4TLUA 4AEHL 4X99B 1IRAY 4MXVF 1E6JL 1RZ7L 1ILSA 2IEPA 4OIIH 5GGSA 3TCXA 4NRZB 3H0TB 4MQXD 3RU8H 2WN2A 4FMKA 2GITA 2XY2A 5IB5B 2B08A 3D4CA 2YPVH 1FI8C 2HXAA 3K80A 2OI9B 1PS3A 2A99A 4LSPH 3D51A 5KBKA 2WXPA 4LCIL 2P80D 4F33A 3UCRA 3T5WA 2P46B 1G6RH 2BP8A 2GUYA 1XGQB 4KVCL 2ZP9A 5MERB 3TPKA 2DWYA 4CDGC 2DQIL 2EIKB 2DLFL 4UDTB 2ATKA 2NX5A 3K6DA 2Z1PA 1DQMH 3M1BA 4K94H 5CEZE 1KDIA 3PWLA 3EJQA 4YQXL 4ZXBB 4BXSV 2WLHA 1JHLL 3MCKA 1BP3B 2XXGA 4MFHA 4YVUA 5ENWA 4TSAL 1NWOA 4AYDC 3B9KB 2HVJB 3NCFB 2NX5E 4R7VA 4YWGL 1OLZA 2YA0A 4UT6H 5BZXA 5LNEA 5IMMA 1D7FA 4PJXB 3DOIA 3QWRA 1EFQA 5L4JA 5D2NC 5KBLA 3QIBA 5C8JB 1WD8A 4MKTA 4R7NA 4IMLA 3PABB 4MYPA 1KTRL 4PJIF 1FG2A 4OZGE 4QRTB 1CBVH 1O9VA 5DFWH 4BZ1A 1JFHA 3HAEH 4MSWB 4ERSL 5CBAB 4DP9X 5JDSB 4LLYA 1LO2H 3T3PE 5AVWB 2YAPA 2GSIA 4ZUSB 4X9IA 3BC9A 4YXLH 4B96A 1BM3H 3ENEA 4X7DC 1KJMB 4BH8A 5C3LD 1CFTA 1ZD6A 3MNMA 5CP7B 2HRPL 4OJFL 3AY2A 4HWZB 1I7TA 2VISB 1VGEL 4MS6A 3MUZ1 2OW6A 3FDWA 5DQDL 2AITA 2WQSA 3Q8FA 4JY6B 4NUPA 5ABAA 3RI5K 3PWNA 3IAGC 1TFPA 5GS0D 4HLJA 1C12B 2WKLA 2Z7YA 4X42A 4DEPB 1DQDH 5E6ZA 3OXSB 4O5LH 1AO7E 2CCVA 4J8RA 4U33A 2VMDA 3FW6A 5EORH 4NQEB 3WJJC 4JQIL 2BNRE 1CE1H 2VJ0A 4R5XA 2OP4H 3FKUS 2IDQA 3L3JA 3M6DA 2R2CA 1UOVA 4P5MB 4U1HB 3TTYA 5J12C 3GMOA 5GSVA 5FYJD 2PPCA 5JXED 4NJAL 2X4OB 4JDEB 3WO4B 1YDPB 2BNUA 2J44A 3VG0L 3QYNA 1IGIL 1N0LB 3W81A 4XPBL 1K4CA 4L8BB 4GAYB 3ARGC 4LRIA 3FQTA 1KDJA 4XOCA 4CC0A 3HNVL 1ED3A 3TEXA 4NQUA 3QULB 2EIJB 4GP5B 5E9DD 1XCTB 3HC2A 1QP1A 4MAYC 4XC3H 2VZ3A 3B7UX 2VJ8A 5MENE 5DJYB 3RZCC 1YG9A 2ZPKL 2P5ED 4PV8B 5E4EB 4NFDA 3VUAA 4XHQA 3OMNB 3OL2A 4MGXA 1TCRA 4AIEA 1SXBA 2XVBA 3GMPB 2WWOA 3EOBA 4S2SB 4FA6A 1ZEAH 4NO3A 1IIIA 1MCJA 4FYQA 4HA1A 4MD4A 3P77A 4M03A 4LVOB 2BIHA 4AH2A 3T2NL 4QRRB 5KVEE 4Q9RL 4JGJA 4KUCF 5EF2A 2OR9H 1W80A 2EDKA 3QUYD 1EAJA 3SGEH 1AO7D 3BZ4B 3Q2LA 1B0IA 3L5IA 4JGUA 5I0ZA 1HZKA 1WFJA 4YDJB 1ILUA 4LLUA 2YKLH 3TJPA 3EJPA 1MCOL 2FHFA 3FN0L 4LLWA 1K9TA 2EDFA 3C6LB 3CZEA 3FQRB 4E9TA 2BHFA 3QO0A 1IL1B 3LNFA 1R3HA 4LSRH 1Y07A 1QX1A 2EEAA 2V4LA 4YIQA 4QI3A 3G6DL 5F9OH 1MCPH 2OZ4L 3IFNH 2NUTB 3MUGB 3BPOC 5ANHA 4BCYA 2VXUH 5C97A 2FB4H 3IDMA 1LK2B 1AMXA 4JHAH 3VI4A 2QKIB 5DJDA 5EEWA 1BX2A 1X4XA 4LT7A 1OAQL 5DHVH 3O3EB 2EE6A 4NLHA 5TGBB 2ZPKH 3OJDB 4UILL 5LBSL 5ACZB 4RISH 1QTSA 2XETA 4Z7QB 2YRBA 4Q89A 4Z7IA 2EH7L 3BLBA 3AQYA 1T5WB 5IIEA 2MNWA 4PJHF 5I6LA 3WV0A 4O2CB 1KFAL 5CNHA 2QQQA 2H32H 1QUPA 1FNSL 3ILDA 2VAAB 2V0AA 1FFOB 3E3QC 3KL3A 2JELH 4WJ5B 2EVIA 2ZXCA 2DLTA 1HESA 1MFAL 1WTGT 1FO0B 1NAKL 3ASWA 1D5IL 3ULVD 3ARFB 2JWYA 3RP1A 1IGMH 2P5EE 1NGXA 3DSNB 4UM8B 1SXNA 4AGNA 4L5FH 5D7IA 1LE5A 1JZGA 4K5NA 1K3ZA 4UOQA 1EH9A 1GJWA 2G0LA 1D5BB 4LIQL 4NQSA 4O5LL 5EORL 4LKCA 1NLBL 3W82A 4P23D 2B39A 1WA1X 1A6VL 2XWCA 1NPNA 2HLAB 3O6FC 5F89A 5JPMC 2FL5B 1T04A 3C60D 4L3AA 4EUPH 2DB8A 4OJFH 1T6VN 3ZTDC 4F27A 5JHDB 2BVOA 1NGPH 2K4WA 3BGAA 1AXTL 3IWUA 1JMZA 3GSWB 1MQKH 3PPEA 4R3SB 3T1FA 4M4PA 3TCLB 3WENA 1SPDA 4FG2A 5F1IA 1JP5A 4UV7H 1S5HB 4FFZA 1YC8A 4ESKA 5LXGL 3PP3H 3ZDYB 2XOTA 3D05A 1NCOA 3QQDA 5DYOB 1T5XB 1I31A 3F65A 4B95C 4G8FA 5A3IC 2F8XC 4M1CD 5DJZA 3LRKA 5JW4M 1LWJA 4PU2A 5FGCB 2A6JA 1P6AB 5E4IA 4OCXH 5C0BB 1E8XA 3FTGA 4AEEA 4BK5A 4MB4A 1S9VB 1MCQA 4Q8BA 4WUUD 3RZCB 4O51A 3T2QA 5CSGA 3D3VB 4UT6L 2ZX9A 4ZFZB 4YDIL 2OYLA 4QRSA 4P2OC 4WCYL 5ADPL 3GHBL 5EIIG 4F8LA 5EOCJ 2X89A 4BQ9A 2VT0A 3SGJC 1TDQA 4LLUB 1MI5A 5K93A 1JV5B 2VN7A 2AKRB 4LCWD 4YBQC 2G75B 2QSCL 3RYMA 4ZTPL 4M48H 1U3HA 4KNSA 3ZKND 2MOQA 2FWLB 5CJXC 5F88B 2JMRA 4LSUL 1QHOA 3HNSL 1U95B 1FL6A 4KRMB 4XCFL 1GGBH 4OLYL 2XIBA 3DK0A 2ARJB 1HHIA 3VG0H 1G0DA 3CD4A 2IV8A 2RD0A 2CJUL 4KRLB 1DEEB 1EHLH 3EHBC 3IPFA 3P4MB 2NY2D 4GINA 3MRIB 3WXVL 1NAMA 3X12A 3ULUH 1CE1L 4XN4A 3EJSA 3BPNB 2E46A 3HAEA 4AEHH 3ZHFA 5GIRA 4OLZL 1XSKA 1VJSA 2CHWA 5F0LB 5TDOA 1ITCA 3GMPA 1G7LA 4QWWC 4L3ED 1ZLSH 3RUGE 3SYAA 3IN2A 5DQDH 1QFUH 1SQ2N 5T1MB 1JK9B 1PLGH 3WEXA 3L4VA 1Q1JH 4JANA 4Y8AA 1W16A 2V6HA 2BSED 2A3TA 1MCDA 4LOUD 4ORZC 1AQMA 1MHHB 1AZZC 4ELKA 4KQ0A 2QHRH 2DIBA 1J87A 2A74B 5CCHE 1XR8A 4U7SA 1XGPA 4PRNB 3DPDA 1WAEA 5ISZB 5D1XB 1J05B 2ZIDA 1OAZL 1H3VA 2QPEB 3LNDA 1BBDH 3QEHB 4OCLC 2NXZB 5C08D 4Z77A 2NRDA 4PJEA 1X5LA 4PCTA 4OCNC 3TPUB 4F2FA 2F19L 5CZKA 5E5LA 2ICES 5DS8A 4TUKH 1VFAB 1DQQB 3VRJA 4DESA 3THML 4XH2B 3S36L 2HKFL 4R4FL 4JUSA 4WFGD 1JF6A 5D96B 2JB5L 4NOFA 3QIUC 2QSVA 2DWDB 3WXWL 3QUXB 2NZ1A 5TGBA 1UXLA 1MAMH 1TR7A 4Z7OE 4DGVH 3AT8A 3VQMA 4TSBH 1EHXA 3LMJH 4PJDE 5IHLB 3GBDA 4XB3A 3VXRE 5HGDA 1YNKL 4Y89A 1O7VA 1DQML 5JORA 2ZCKL 3ZKXB 4TS6A 3V6OE 3MFGB 4L4TE 1SN2A 5J0BA 4LCIH 3HG5A 3RX9A 3BHBA 3L1OL 3SCMC 4WQOA 3S8FB 3F58L 1TO4A 1QEXA 3FQNA 5JYLA 1FHNA 1JRHI 5GZOA 1QQDA 3MLWL 4MMYA 1IM3B 4Y1AA 2WQAA 3B2VH 1NCIA 1RZIA 4OIIL 1UD2A 4OGXH 4NNYA 1R3KB 3QUYC 1HEJC 3TV3L 2JTYA 5KJRL 2BOLA 4AXWB 2YLKA 1U8HB 2AXJA 4OD1H 1FRGH 1U95A 4LCYB 4DQOL 5F88A 4JS7A 4JPWH 3E6HA 4I48B 1QR4A 3LZQA 4K3DH 4NZFA 1CF1A 3CHSA 1RUPH 1KC5L 1EJOL 5EZJB 3PAVA 3GC3A 3HS0C 4JKNA 2HVJA 1FYHB 3ABGA 3IMRA 2AK1L 3F62A 3A6CH 2JCWA 4OW6A 1BAFH 5D8JL 5FUCC 5DGRA 1MJUH 1F8TL 5FCUH 4HDIA 4AV4A 3D6GA 2BS71 1AZCA 1U8PA 3NIGB 2ZF9A 3HNTH 1G4RA 4MNGE 1AD0B 2O6PA 4I8DA 1IT9L 3VFSB 4S1QH 3WFZA 5B7FA 5MI0C 4RMQA 2AQ1A 4R5TA 4YUEL 4K8RL 4R6UA 2NNFA 1VACA 5E4EC 3OR7A 4GMSL 3CHXA 2WNKA 3V5HB 1KIRB 1AAJA 2OMZA 3E38A 1EDHA 2CO1A 3O11B 4M7JL 4TSCL 2W1NA 1TTRA 3F7VB 5JXAH 3F3HA 3B9DA 2VB5A 4PGDA 4Q14A 3MOAL 2YHGA 2FHCA 2GCYB 4JBSA 3OG6B 2R56H 5IGXL 5J9PB 2CHZA 2CSPA 1AMYA 3S35H 2XXFA 3FO0L 5MP6L 2ZX7A 2DQFA 2OMYA 4WKZB 4IU3A 1H0DA 3LKNB 3O41B 3HR5B 1KJ2L 2O5YL 5AKVA 2EIZA 4RIRB 4P3CH 3P9WB 3EHBB 2XA8L 1HL8A 1JPGB 2P9RA 2AEWA 4K3EH 3S98A 3WGVB 4BKLA 4DTGH 2YN5A 1AQHA 1A6PA 1BVKB 2E0PA 3MROA 5I74B 3ULUF 2DYPA 2J55A 4NNPH 1U4FA 2X88A 4OCRL 1LHZA 2Y2YA 1KLGB 1OCWH 1FFOA 4R7NB 2VRKA 4ANWA 3QR1A 3B4NA 2FJUB 4BKTC 1FLTX 1N6QH 2BLFA 4Z7WA 4KC3B 2QJDA 3MOBH 1UH4A 3IVKB 1Y0LA 2W80C 4HPOL 3FL7A 2MQCA 5G4OA 3SCMD 4CVXA 2TRHA 2R15A 4FNRA 4MXVE 4QOKB 3W38A 4N2MA 3IGLA 3OB0K 3TL5A 4L9DA 3FQUB 3OKOB 4NNXB 2NPLX 4Z7UA 3T04D 3SGKC 3ZUNC 4RSVA 2QGDA 3V52H 5JIHA 3GMNA 2OL3B 1RZ8B 3MXWL 1D2PA 2X38A 2J4WL 3L7FB 2AEPH 2B7DT 4WEEA 1ASPA 4ONFL 4FCAA 1H8OA 3C5JA 4YMPA 1BF5A 4W68A 2OYPA 3DV6A 3TWCL 5HDLA 1ZS8A 7TAAA 2CD0A 3QQ4A 3GI8H 3MUY1 5AB2A 2WVTA 4G43A 1ZHNB 2W0KA 1A4BA 4D94A 5CJXA 2NY4D 1PCSA 3QG7L 3DMMD 4QHNB 3HVDA 1H6FA 3SCMA 2A4EA 3DPBA 4O02B 1X5HA 1MCCA 3K81A 4XO9A 3WIAA 1YMMA 4K23H 3PV6A 2GVYA 5IFJB 2VZ1A 1FHGA 2F54E 2W9LA 4TV3A 3WDJA 3GJFH 1CLVA 1DDTA 2ICEA 3MUJA 3TESA 1A1OA 1NIAA 3EG9B 4FQIL 5D1ZA 2QGCA 4P5RA 2XWTB 2ADJB 3U36B 4JDVB 4BFKA 2VUOA 3V6ZB 3FH7A 3I3EA 3QPKA 4L3EB 2P44B 3MJ7B 5A2FA 4LPUA 2YAOA 2ZKYA 1TU2B 1EJ8A 1ASQA 2D7OA 1OWWA 3N50A 3ZE2E 5IEKA 4G2AA 2CK2A 1LO4L 4ZPTA 3LD8B 4ORGB 2BHZA 2HYMA 4RESB 5JHLL 4GUPB 3B2MA 5I1IH 1DVYA 4ZMWA 1T0PB 4YGVA 4BD4A 5BRZB 4POZC 1SJEA 2CUHA 4FG4A 5AKTA 5BNXD 2ENQA 3H3BC 4EI5A 2FZ3A 4P04A 4O2FA 2X4SA 1PEWA 4FF9A 3LQAC 5CMAB 5F9JB 3WFDH 3BGMB 1BV8A 2H5UA 2LAGB 5L6YL 3ESPA 3HB3D 3Q06A 1AGFB 3C6LC 4N4YB 1SJVA 5C0EA 4Y2OB 4N0YH 5AZ2H 2VDOL 3W11C 2A0LD 1LE9A 2M26A 4O02H 1PZCA 3L2NA 2F53B 2QQLL 3QIWB 2EYSA 4D9QE 4Z7WF 4I5BA 3V5HA 1QFWM 4U31A 3WNOA 3UACA 1FDLL 1BEXA 2R29H 4CKQA 4HGWA 3AABA 4Q9QL 1CD0A 2WMPA 3EGDB 1BMWA 3R7QA 5CF3A 5JPNB 3IDIA 1XXDC 5F71A 4GMTL 3P1VA 1UASA 2PP9A 1OCCB 1G7HA 1MY5A 1ROCA 4YJZL 5BRPA 1RZ8A 2NY7H 5FKAA 2X05A 2NQDA 1BAFL 5D8JH 4KKBD 4XNQB 1E43A 2WQUA 4G7RB 4FA7B 4LHQB 3SDDB 5KVDE 3U6XS 4U1IB 3KHQA 3E2HB 3NPSC 2TRYA 4FFYH 1L9MA 1OP3H 2M1KA 4RRPM 3SKUD 4ILDA 3TZVB 3QORD 1VPOH 3G08A 3BPCB 4MMZA 4YDVA 5GISH 2XY1A 3KPSA 4IRSA 2BRQA 2EVFA 5FM5M 4ZMQA 3MLRH 4TN9A 4Y1TA 1HNFA 3DGCR 4XP9L 4R90L 3CQQA 2ARJA 4Y5YB 1I9RL 2UWEE 3ZE0F 3QZMA 4JFXA 3UH8A 1I7ZA 2J2ZA 1MEXH 1Z9LA 3DSFL 5E7FA 1MCWM 1L3WA 3ELQA 1VSCA 3OMZA 4JRFA 5G5DA 1NINA 1PJ9A 1A4JB 4FHJA 3ZTCC 1DDHB 3P4LA 1KWGA 4AVKA 1NIFA 3DVGB 4NXKA 1HOCB 3ESNA 1D9KA 3SKMA 2YXVA 1QI4A 5M94B 3FOMA 4X8JA 4HK0A 4IHOA 2ROYA 3HA0A 1YNKH 4KK9D 4WO4A 2PWFA 5D5MF 2Z31B 1OK8A 4NYLA 2RCSH 5J6HA 4MNHB 1CFVH 3KPQB 4XOEA 4Q2ZA 3AUWB 3FTGB 4TPRH 2GT9B 2ZKWA 1GS8A 1LQSR 4Y5YC 1QRNE 1WV7T 2AERT 3D08A 4DKAA 1YYML 3EBAA 3QR0A 3VXQA 2P5PA 4S11A 1NBZB 2OR7A 3EGXA 4LNRA 4DO6A 1IGJB 1S5IL 2H1PH 1J5OL 3O6KH 3CDZB 4O2EB 2NY5H 4X6FA 4KI5C 4XVJL 4AMXA 2GC4C 3RL1A 3QJOA 3P30L 3X3FL 1AQKH 1KLFA 5CZRA 1S7SA 4JPIB 4UM9B 1U4EA 2HPTA 1NGWB 3N44B 1OAXL 4EVNA 4Y1SA 4ZDHA 3FUDA 5GS1A 3RNQA 3DVGA 1U8OB 2OJEB 1P1ZB 3GXIA 3O8XD 1SLWA 1EK3A 2IADB 2BVYA 3EYFB 2YFNA 3QJXA 4JO1H 2BDNL 1AQDA 4HEPG 2A9AA 4NENA 1YNLL 4H40A 2VR7A 5HYIA 1WT5C 2AJXH 2NY0D 5JHDE 3OPUA 1CD1A 2VLKA 5CEYA 1F97A 4EZJA 3TF7C 2OZNA 4LGSB 3IJYB 4C57C 1AH1A 1XSJA 3D33A 2E56A 2IAAC 1JXGA 5E9DB 3CBRA 1DQLH 2HRLA 2XBDA 4HGMA 4F1ZA 2IG2L 2IF7A 4U1KA 2HZHA 3K6FA 3ZK0A 1C8QA 1JZ6A 1R3LB 4TNVF 3ZL2A 4WFHD 2IPTL 5DS2A 3RL2A 2JJTA 4RSYA 4J39A 1JTOA 1T3FA 2ZUWA 4YDLB 2LE9A 3O2DH 2X2JA 1GGBL 1NUNB 4LEEA 3ZZ1A 1OSPL 5C09D 5E8PB 5CN3A 5B1AB 4XCNA 4MJ4A 1F6AB 3FO1B 3O3EA 4W4OC 3U48A 5EUOF 2IFFL 2YPLE 1CTOA 1M2VA 3FT3B 5G55A 3RVTC 1F41A 2ZOUA 1UB5B 1Z3RA 2CJTA 4PJDF 4OH2A 1BAWA 4QLWA 1KG0A 3QCVL 4QHLB 5C2BH 4M3KB 1NCWL 5G4MA 5FOBB 3QUMA 1HTYA 2IH3B 3T6VA 3OKOA 1G84A 5A6LA 1MNUH 3BWZA 1JGDB 1A47A 1WAPA 1NM4A 1WYJA 1JYVA 3M46A 3OAZH 2B9BA 4KROD 4BKSC 1TUPA 3QRGL 3OKLA 3MBWA 4UNTA 1N4XL 5HI3D 4PJCB 3BKCH 4NC0B 3QUKB 1CU4L 2AJ3B 3NAAL 4UQ2B 5TPWL 4Z3FA 3WKPA 3MJ8B 2WANA 3UDWA 5ID1A 5EULV 1XGTA 1LTXA 2X9XA 3CUPB 4HIXH 1YY8B 3OXRB 3LHAA 4RCAA 1HHJA 2PW2B 2XDHA 2YK1L 1N2RA 4HKZB 1GOGA 5EB9A 2K6ZA 4WHDA 3B5HA 3S9DB 4HIPA 4RX4A 3LZNA 2D73A 1KCVH 4HUWB 1FH5H 2PR9A 4OLUH 2CPCA 4U7MA 3ECQA 4HJ1A 1UB6B 1JWMB 3A6BH 5HGBA 3IE9A 3MRLB 1H0DB 4HOXA 4JFDB 3VMNA 5AZ2L 4Z5RB 2XN9A 4HJJH 3BO8A 1EAPA 2E4FA 2MQ0A 3L3IA 3V9EA 1N5AA 2NYYD 1HH9A 1JNHA 1FNGA 3WFDL 3NN8A 1P7KA 1SM3H 3LRSB 1U8NA 4G9FB 2BP0A 1U58B 1Y18B 2C7UB 4EDWL 3QEGH 3V0VA 5I17B 3P9LB 3BRGC 4PB0L 3QZWA 3ETBJ 5B38A 2C7FA 4CVZA 4Z0XA 3C6LD 2ZOOA 5IREA 4X6CF 1K3IA 2EIBA 1XF4A 4KNUA 3EJCA 2H6PA 4NLAA 3PJSA 4WFEE 2WXLA 1KACB 3QZBA 3UAJD 1JI2A 4Y5VB 4CC4C 2WKGA 3F7PC 3IDNA 3SOTA 4JJOA 2N0KA 1VB9A 4JLRA 1QOKA 3EYQD 2SEBB 1L7IH 1ECYA 3EW3B 3GSXA 3TP4A 1KT2A 1YEKH 4GSUA 3TO2A 1GS6X 3JWNC 4CL7A 3F04A 8FABB 4FNTA 3ARYA 2FB4L 2PCFB 4JHAL 4KRNA 3Q1SH 5BPPA 2YJQA 1RZKH 1RIHL 3L7FA 4DP0X 3VDAA 1TJHL 1BCIA 3EOAA 2B1OA 1BZ9A 1FORH 5T1DL 4FLSA 4HT1H 4NRXB 4X8XA 3RKPA 3EKCA 4NQQA 3Q3GA 4AVHA 2HA1A 1T7ZA 2E8YA 1ADWA 1I85C 4GRLD 4WI9A 5EN2A 4CVUA 5INDA 5CSZA 5GZOD 3VFUA 2PYEE 3P73A 4XO4A 1X5AA 1MAKA 4M3HA 1NC2B 4NNYB 1BYPA 1S5HA 4I85A 4Q6KA 4KITB 5DGQA 2QVMA 5BS0B 3S8WA 3KPOB 5DZPA 5IW1A 2H9GB 5D5ME 3O3AB 4ABQA 1Z6JT 1ZEAL 5FYLD 3PP3K 5HI3C 4WU5B 3W39A 3NZHH 4BFJA 2Q5BA 1NFIB 1IX2A 1DFBL 2AANA 4ZJ9A 3MRBB 2APSA 3WNIA 2PO6D 3IJYA 1UXMA 4OZ4A 5I1AB 5I15H 2P80A 1J11A 3ILPB 3QUML 4TQ8A 1AIZA 1I9EA 3VI3A 1LYQA 3KPMB 1SY6L 4U3CA 4DKFH 2Z4TA 4NUQA 3DOHA 5IHZB 1EBPA 2KDYA 3VH8B 1RZKL 3IJHA 2AP2A 2NY4C 3QIUA 1CXIA 4UNIA 4GG6E 3BWAA 2NLJB 3QPXL 1OPGH 1PD0A 4B9KC 4OKDA 5CEZL 4AQZA 2C3XA 5AZEL 2H32B 2AJVH 5GGSB 3QHZL 5EIIA 3C60A 5CZVL 5L4FA 3U82B 2EDBA 1MNNA 1ET8A 2BSDA 3SDAA 5CR1A 2X6UA 4F7TA 1SEBB 3PXJA 4OI9A 3FUFA 4K3JH 2AQSA 1KPVA 4P8QA 1IJ9A 2AQRA 4YE4L 2HTKD 2PXYC 2VWEE 4HOMA 5ISZD 2PWHA 2R0LL 2WYTA 4N9GB 2YD2A 1YJDL 4NQEA 4P3DA 3ZR6A 2O5YH 4OQ1A 3WBDA 1WVZA 2R2EB 4JPVH 1F90H 5JOPE 1AG0A 1TEYA 4TM9A 1PYWB 5J6HB 3K7UA 2LU5A 3QEGL 5EMYA 2Z64C 2I32A 1A3ZA 1LDSA 1OAKL 2NY0C 5MP6H 1J8SA 3MUHL 3O9WD 4M1DL 1QSEA 1XVSA 1UD8A 2EDTA 5FA3A 4PJDA 2DKSA 2KLTA 3R8BB 4AT6B 4KQ4L 3W9EA 3EIFA 4ZX4A 4HFUH 4X80L 3X1BA 4OD3H 5IUCA 2R23B 3Q5OA 4DW2L 5C7XH 3EDEA 4UTAL 2WBKA 3BP5A 4GPVA 1CVRA 4RRPA 1B2WH 3ZMRA 2QMKA 1WBYB 1JPEA 3BDYL 1NEPA 2E6PA 3HG1A 3QQ3B 2KQMA 4PJAE 1YNTF 6FABL 2VR8A 5CD3A 4DOHE 3BN9C 1ZT7B 5D2LF 3RURA 4FADA 3PABA 4JM4H 4LCWA 3CH1B 2JJTC 2FJGA 4L8CB 1KB5A 3L7EA 5E5RB 2EYTA 3T9WA 2X6VA 4NHCH 5ESAB 1OOWA 4MJHA 2AGJH 3QJFB 1F4YL 3P2DA 5K39A 3D52A 4N8CL 3HNTL 3OMIB 4XB7A 1A7RL 2GEQA 4OB5H 3K91A 3ULVH 4DWHA 3WS3B 3LKOB 3REWB 2A38A 2X44D 3RGVB 2MIZA 1XAKA 1TETL 2ZT9C 5E94A 5HDRA 1HNYA 4DP2X 1PMYA 5E2TH 5CINL 1OF2B 1PSKH 4DEUA 4KMQA 3GZOA 3S7GA 3ZYZA 4CC1A 2IDFA 1WC7B 4HH9A 2EXWD 4LLAA 5MHSD 1WZ1L 3AVEA 3MKKA 1GJUA 1ADQL 3NQIA 4UT9H 3SHSA 1BZDA 4KKLC 5LCVA 4WWKD 3P0YH 3EJUA 4L23A 4RAVA 3RUGF 3ZKMD 1E6JH 1YEIL 2HKAA 1NJ9B 1SFHA 1AFVH 4NRZA 3JV6B 4QF1B 1R3JB 2X70A 2ORBL 5B1KA 4YK4B 1CFQA 2ITEA 2F68X 4IOIB 4G5AA 4HIQA 1FA4A 5JHDA 2IG2H 2WSKA 3FOLB 4G1MB 5AALA 2OMXA 3QPQD 4XBGA 2XUWA 1AXSA 7FABH 1DQLL 3QHFH 1PIFA 4IMKC 3VD5A 1VEMA 1KY7A 2E75C 2YQBA 1KBGH 5HDQL 5BXFA 5DRZB 2Z8SA 3VJ6B 3WLWC 1E0OB 2HJKA 2CUAA 4JGNA 3QNXA 4JN2A 3IMUA 3HI1B 1LD9A 3VWJB 1U33A 4JFEA 3VFMB 4ACTA 3W39B 1U8OA 3MRMB 3DX0A 4XWGH 3IKCA 4KK8D 3BDBA 2ENSA 4JRXB 4AM0A 2VERA 1CD9B 4HBQA 2K3TA 2Y6TE 3AMKA 4HCFA 5JQ6H 5K1NA 4QF1A 1QYGL 3DX6A 1YCSA 2EYRB 5D4QA 5FYKL 3K2UH 1Q0XL 5TF0A 2ZSVB 2Y5EA 1KEML 1MFEH 5I6PA 4PJCE 2BIPA 1EDYA 3W0WA 4LQFH 2W60A 4LGRB 1HJBC 2NY5L 4HCIA 4WU7B 2CDEA 2FX9H 2W81C 3FCUB 3GTNA 2Z65C 4PRPB 4Y4HC 3WEAA 4N86A 5ID0B 2ZWLT 1YYMH 1Y1UA 1T1YA 1X7TA 1L0YA 3WI9A 4TPRL 1SEQL 3BAEH 3UO1H 3TYGH 3GKZA 4K07A 2VLRB 4ZZFA 5KVEL 1PG7X 3H9YA 3AY4C 3SCMB 1WIUA 3FSOA 2XG4B 3CSYA 4XNAA 5I75B 1I8IB 5BUAA 3RLSA 1G6RB 2CLRA 2WBJD 3GB7A 3WS3A 3ZT5A 4E9XA 3QI9B 3BZ4A 5KZCB 1GGCL 3NIDF 1M2VB 3FT3A 2Q76B 3HE6D 1CDGA 5H4ZA 1CFSA 4W9JC 5EU3A 5KSAC 3VI4F 43CAA 2AW2A 2CIIA 3QFDA 4HEMA 1U3JA 3MYJA 4OLYH 1E2WA 1MEXL 3Q1EA 5IJKA 4LMQE 3DARA 2GBTA 3WLBA 4H88L 4AQ8A 1CBJA 3OZ9H 5ABZA 3T1FB 1THCA 1BFVH 3DECA 4XE0A 3F5WB 4HF5H 3KPSD 4U4BA 1D9KC 1XH0A 4LP5A 3S3CB 2IWKA 4B7LA 2BCKB 1FSKC 5C0BD 1E30A 1JNHB 1BXXA 4PV9A 5HYJA 3BSHA 1F13A 3LDBC 1UM4H 2WWMD 2AXFA 2A77H 2OXGB 5CEYB 1RL1A 1ZV2A 5I18H 1U8QB 2BHUA 3UBGA 4X4MA 1XGRB 4NOBA 3T77A 2GBUA 2F5BH 4M43H 1GTNA 1N64L 3A4EA 4P46B 1L6XA 3BJLA 3GLAA 4X7TA 3SQRA 5DWPA 4GXUM 1FO0A 3L5JA 5E6IC 4PJ7A 3ULSB 1CQYA 1MCSA 4UM9D 1KPRA 1SDDB 1OQOA 4UV7L 4ONHA 2E3VA 4OZGA 1M6OB 4I3RH 3JWDL 3FHQA 3G3LA 2WC7A 5L2KA 5E8NB 3GRWL 4OZIE 3AWEA 2IPUG 4N24A 1LE9B 4UQ2A 5JQHC 2JJWA 3MRNA 1DFXA 3CXFA 4PVLA 3RIAK 2Q7AA 2LU3A 4YSPA 5GJSH 3NA9H 3H3PL 3BQUD 2ZUSA 3VB9A 2FH6A 1F3RB 1BOGA 1E4XH 1IGFH 5CUSH 1DE4B 4AYGA 3TT3H 3QUMB 3KYNA 5C0JA 2P5WB 1IC5H 4J1UA 2G30A 3HLKA 4MQ7A 1C08A 4BUHA 3NEXA 1XCXA 2VLKE 4JG0H 3IDYB 1FVDB 4LDCA 4M1GH 2VOTA 5GRYA 5IM7B 1W72A 4PJBB 1IL1A 1XX9C 4G59C 2UVFA 3E8UL 4Z7OF 3DKHA 5KTEL 1TSHA 2ENYA 3SQOL 3KM2A 4HJ0D 1GYUA 2C34A 4I3SH 4JRYE 5D7KE 3PGFH 3GM0A 5DXWA 5E23A 5FXCH 2AEOA 2AEQH 1IKFH 3CZJA 4R9HA 1J0YA 2V9TA 4L4JA 4PJXA 1RIUH 2PW2A 5C08A 3FMGL 4ES8A 2EKSA 3P4OA 2EE9A 4Y5YA 1JFQL 1L9QA 2QQNH 2V3DA 1FZOB 4PJ6A 1OAQH 1CDIA 5J57B 5JA9A 1GHFL 2FNBA 4WY7L 4XZUB 1X9QA 1PZ5B 4GRWE 2LFEA 2VGLM 1KYDA 4RGOH 2N59A 4ODHL 3WJLC 1S7WB 3VMPA 2AC0A 3SYPA 3BRFA 4DP5X 3Q6GL 4NO2B 3KXFA 2XWJB 4UZSA 3IXAA 2AMUA 4WW2C 3LPOA 3MMEA 4XNUL 5IB1A 2LVCA 5F7YC 2EXWC 2YSTA 5F0JB 4WRLA 4YHPB 1DLFH 1AHMA 1SFDA 3TH4T 3FTYA 1G7HB 5SV4A 3U79A 4NFCA 2GFBB 1AJ7H 3HHSA 3OKYA 1X7SA 2XZQH 4KDTA 4N6RB 2Z91B 3RTQD 4L3CB 3RE0A 4DGYH 1BBJB 2I07B 2VR4A 3MV7B 1JGUH 3QXDA 4MA8L 4F2MB 1INDH 1UFUA 1WAAF 4LP8A 1HYSC 3VFVB 5DHMC 5IJDC 2H3NA 5MEOB 2X0UA 8PAZA 3T2PA 1MDAA 1KCSH 5IVZA 4QOKA 1N5YL 1BSIA 2YUZA 2FX7L 3OGCB 5DVKA 5E9DE 1NCBH 4G83A 2WWKT 3U4AA 1ZAGA 4F2ME 4WO0A 3HG0A 4JY4B 5CJBA 5I0VA 4IBVA 4JY6A 1OTUD 3HE6A 5JHLA 4Y2DA 3B8YA 4LLDA 4ICWA 2DWXA 4HLZH 1M56B 4UZUA 1TMCB 3OKMA 4ATWA 4X6DE 4ZMLA 5E2UH 3Q2CA 4ZMZA 1UCTA 1UB6A 3MRKA 1N19A 1CK0H 2BY2A 1UJ3B 4H44C 3IE4A 1IGIH 4BDVA 4RETB 1Z66A 3DC0A 3ISYA 5DA0B 1FGVL 2DS4A 4RAUB 1YNTA 1S7VA 4HV8A 3LKRA 3MGTA 4F80A 2V17H 3FBQA 3O41A 3BE1L 2P8LA 4LOEA 2QPFA 2Q9OA 3U6XA 3H2PA 4BCZA 4DGIL 5IMLA 2FBJL 3UYOD 4IW4C 4PMFA 3T8XB 4G6KL 1SOKA 4JCLA 3V5KB 4CNIB 3MV9A 2MH4A 5BJTA 3ARBA 1U8LB 3S35L 5HYQA 3K71B 4A66A 2ZSWB 1DJIA 4IBLT 4ZXBC 4F9PC 5A2IH 4JQIA 4NGHH 2EECA 1JVLA 5E5MA 3RWDA 1CFMA 2ICEB 2EDMA 1C5DA 4QRPD 2ZUXA 2EEBA 4A38A 2PCPA 4PRPD 3WLBB 1OZTG 1BM3L 4KI5D 5GRZA 2WHVA 2BRRH 1QD0A 5C0RL 2JK5B 4WO4B 1JZ4A 1J1XL 1KXHA 1LXMA 2XVGA 4LF3A 2LU4A 1Y6NR 5BZZA 1RU9H 4K8RH 4TTDD 5BS0D 1ACYH 3AREA 5JIQA 1EEYA 4LCCA 4F92B 1LJMA 1BHGA 4J3UA 3CFBB 4DSYA 2R0ZH 1AGEB 4MX7B 2WXKA 1A1NA 1BQHB 1M42A 1SBSL 3KWTA 5KS9E 2IDSA 5IHBA 2DMGA 2PR4L 3KW8A 2JTDA 4M4RA 3B83A 1EAOA 1OIOA 4QOKE 5FV2A 2WTOA 4U6VH 2O26U 3MBXH 1HZHL 4XAKD 3UTPD 2YQ3A 3O4OC 3D4YA 4P06A 1M1SA 2DQMA 5TQ2H 3QNZB 3NA4A 4FULA 4X5LA 4RWYL 1HEZB 4Z3IA 5LCVL 4XNMB 2X2IA 2WUCH 4OD1L 3HE7C 4IBQA 3V0AC 4DEWA 1E6OH 3TV3H 4GW4A 3EO0A 1Q9LB 4LSPL 1A21A 3N40F 4OF5A 2X4PB 3MNZA 2BY0A 1HK6A 3OGOE 3O6ML 1E3XA 3X14A 3CMOL 1NUDA 1GIGL 5D93B 4GQ9H 4B5ZA 4BDVB 1USQA 3WFBH 5I30L 1QRND 4B3EA 3UPRB 1GW0A 5C6TL 3G5ZB 2K7QA 2ZCKH 4M7KH 3CU1A 3N85L 4RA0C 2Y1AA 4W4OA 5ESQA 1U9KA 2VXSH 4UM8A 4X9YA 2GKIA 5FA4A 3SODB 5CCJA 2APTA 2YAHA 4PJIB 1A22B 1T66C 3PV6B 2CDFB 1DBJH 3TO4C 3LPFA 3LXAA 4W9LC 2D31B 3QDJE 2R59A 3TBTB 1ZT1B 3JV0A 3HI6L 1MFCH 3I9GH 4DGWC 1ECZA 1OARL 3BPNC 1IC7L 2WLLA 4XN9A 3B9KC 5IIEB 4TUKL 4EI5B 2Q76A 1P7QD 2YC1A 1U8JB 2CO2A 2PTUA 1CR9L 3LEVL 2WXJA 4HSAC 4ONHB 3K2IA 2KZWA 3I3DA 3UTZA 2A6DA 3ABZA 1U8KA 3VWKC 3UYPA 1JDCA 3VD4A 4F7KA 2VLRA 3ATDA 5LWYL 3IETB 1PCXA 4GSQA 2F1AA 3SPVB 4M5YH 4B0MM 1A3RL 5I1EL 1VESA 4JDTL 3UEZA 4JFPA 4BUGA 5EA0L 3GLDA 2IBZY 1Z7JA 3MLSL 4Z95L 3KLHC 4BIKA 3HMWH 3CLWA 1R4XA 1HFUA 1KNOB 2QGBA 4NGHL 4I9XA 4JN1L 3CZNA 5ALCH 1YN7A 3I02B 3VCLA 1TQBB 3FFCA 4I88A 4U3XA 4W4NA 1JCKA 1O7DE 4OLZH 2IO5A 3EH1A 4P0DA 1WWBX 1TJIL 1YO4A 3ULUL 1E4JA 1TTFA 1ZKAA 2XWRA 1S3KH 4OF7A 4Y4FC 3QFJA 2H0EA 3G9AB 3Q8CA 3UP6A 5KYXB 3TN0B 2HN7A 4HV8B 1BM7A 5KW9L 3ZDZF 1AACA 1E42A 1CXEA 4K9EC 1ZXQA 4J2QA 4O02A 1A4AA 4Y1AB 2AXHA 3PIQB 1G7IA 1XB8A 5D1XC 3L8QA 4N0CC 1ZJBA 3VD2A 1OGAA 4UQEA 5E0FA 2AF2A 1YSOA 4KBPA 4M48L 2ICEC 4U6HA 3O6FA 4WJG3 1OP3K 4LCCC 2QV2A 3WFEL 3HMXH 1RUKL 2WWNA 2GTZA 4XX1G 3UC2A 3C6SB 4IGBB 3WNJA 4G82A 2AJSL 3DI2B 2VH5H 2XQBL 1IE4A 1N5YH 2CO6A 2IOIA 4WCYH 3NZ8B 2IBGA 4FQXA 4L1DA 5DI8A 2JQMA 1WE5A 2EDYA 1GZHA 3HZ3A 1DQQA 4BZ1L 1GGUA 2ESVD 5ID0A 2BSSA 3CXHJ 3FQWB 3KCPB 2KT6A 4ZFOB 1INDL 1SJHB 4IKNA 1N0LA 2BZDA 4OCXL 3BXNA 3QJHB 3TEZA 1DANT 4HS8H 3R18A 4M7ZB 4PJFF 4HIEB 4GKLA 5ESQB 3UBHA 4F2MA 4JRWA 3GUFA 1FL3A 5DMKA 5CHNB 4YGVB 2OMVA 3P11L 5EPMA 5I19L 4DPAX 3F05A 2FR4A 3B3IB 4YNYA 4XNYL 4JRXD 2GJ6A 1O5PA 3DJTA 4GRLB 4BQCA 1ESOA 4YPJA 1QSFD 4NM4H 1GYAA 3P9MB 4LLQB 3VRLF 3SBPA 4XNUH 3KPRA 1BLNA 5EZOH 4AZUA 3Q6GH 2E7CA 1JAEA 5JIPA 2QHLA 4YHLL 4PGZA 4CJ0A 4WTZA 4G11A 2UYLB 1QWHA 2BSEA 2YQGA 4L1HA 3FU9A 3RWFB 1GPOL 1KJMA 1MFDL 4JANB 4EXKA 5DRWB 5T3ZH 3RTQC 2OMYB 3O81A 5ESAA 4I48A 2ATPB 5HYJB 1IAIM 4O58H 5GZNC 5B3NA 1QSZA 1D5IH 1LWRA 4EN3C 4PRAA 3X12B 3RB5A 1ZV5A 1CO1A 1M4KA 3VXTB 3AFLA 4TVSa 4IOFC 1XZ0B 2XICA 1T5WA 4ZW8A 4PFEA 1A1MB 5H4YA 1W0WA 3ZMNA 2IWEA 2QBWA 3PWJB 4XCEB 43C9A 4J3OD 5HI4C 3ZRFC 4FQ1H 5D2NA 1FFNA 2WSPA 4QXGL 3M17A 4HCRA 3WSQL 3L17A 2CRZA 4IQHA 5DJ6B 1WAAE 2C9AA 1GY2A 2AV1A 1HYRC 1EO7A 2LQRA 4S1DC 4GLRH 3U7YL 3CHRA 3VQLA 2NX5B 2VIRB 1OALA 1ZK5A 3BVNA 2PYED 3OJVC 4N2GA 2D0GA 1MFDH 3BISA 3RA7H 1A4CA 3LS5L 1I9IL 5ECGA 5ICYB 1QG3A 3FO9A 5IMOB 4E9VA 1MREL 2R0KL 3G6DH 1F4XL 3LQZB 5ILTH 3UJIL 1XH2A 2DWTA 4U1SB 1T20B 2K6YA 3OX8B 3SKJL 4IMKA 2LABA 1LP9B 4LP4A 5EZOL 1MH5B 4D3CL 2W8CA 3FRPB 5IKCA 1KXTB 1BYOA 2WZPD 1NL0H 3L7EB 1JUFB 4L8CA 2W0LA 2CZNA 5KYYB 4MD4B 3STLA 3UC0H 3V0DA 4GQPH 1RZIB 4U1GC 2HT3D 1RK1A 4M43L 5D2LA 4RFEA 3HI1A 1JD7A 4JN2B 1AHKA 4P4RB 3ARXA 4HS8L 4Z0XB 1CGSL 1TVHA 5ITFA 2D2CC 5EHFA 1G7JA 1RJYB 3MLVH 4CU8A 4NQSB 1EXHA 3MRMA 1E3ZA 1UM4L 1XV8A 2GY5A 3ZHNA 3TEYA 3UIZA 2W07A 5C70A 2FL5A 1A5FH 3C8DA 3H9SE 3HHMA 4G8IA 4J4PA 5HGGS 2AJZB 4JCWA 2OK0L 3ARGD 1RUKH 1CUOA 4W9DC 3BKYL 1JGVH 4U1MB 2YMXL 4XC3L 3O45A 2A1WH 5GRXG 1H3PL 4NUJB 3VRIB 4DCQA 2V2WB 2WZPA 4X4XB 1M3JA 4PP2B 4BELD 1PX3A 2X41A 4Y4KB 1HXKA 4I18A 4MWFA 3IMBA 2IAMC 3MNVB 3BSGA 4NPYB 1JHTB 4XXWC 5EOQL 5CHNA 1K4DB 2FEEI 1BD2E 1U2CA 5AL0A 4EZMA 4ZSOA 4Q9BA 4JREC 5GJTL 3GBNL 1PD1A 2MCPH 3PWPB 5I73B 3QHTC 3TIEB 1DEDA 1HSBA 1CDUA 2LTQB 4QHKI 3VH8G 3MV9D 5DJ2B 1DVSA 2NMSA 3M1OA 5DTFB 3ARBD 4N22A 2Y7MA 4F1SA 3NCEB 3T0BA 1CN4A 4OM0L 1GAFL 3LKQA 2NY6D 3TOPA 4AVIA 4OZIF 5EU7C 1NKRA 3DVNB 1TQTA 5KYWA 2IH3A 4KGJA 4M62L 5GSRB 1MI5D 5ALCL 1JD9A 4TVPH 1RMFH 1NCGA 4RFNB 4ABVA 5HYSG 2BPBA 3N06B 3GMRB 3FSZA 1G1KA 2SEBA 1FFPB 1S7UB 4FZEL 4ZUSA 4HD5A 1BWMA 4ONGH 2FBRA 4GYBA 5AOJA 4WW1B 5I1EH 3FO1A 1A7QH 4LQFL 1XGYL 5EDSA 4JG5A 4P2QD 3UJTH 1FVCA 1O75A 3P77B 1FZMB 3PQYA 4AL8L 15C8L 1NAMB 1L5GA 5CD3B 1CBVL 4K9JA 1F58H 1CLZH 1BFSA 4XMUA 4DK6A 1JRHL 1WHPA 4LEOB 2JCCF 3ECBB 1KTJA 1N59A 1TVBB 2CH8A 1VCAA 3R19A 3RTQB 3V9FA 5T3XE 4HIIB 4HEPA 1FVEB 3DRQB 1X6LA 3CFCH 5JLZA 1VLXA 4EPSA 4QHUB 5F7UA 1XH3B 1ZE3C 4ZUWB 2DQTH 2V3FA 4H1LG 1OP4A 3U2SA 4YHKL 1BVNT 2QDVA 4ODVH 2MPAL 2X6AA 4KV5E 2P47B 4MCMA 4G9DA 5AVZB 2ZP8A 2X12A 3GQFA 4XBGB 3KLSA 3DETD 4ODBD 1XCTA 4G70B 4HKZA 4Z6AT 3M8OL 3WN5A 1BOGB 1UWGL 3I6GA 2IDTA 2VC2B 3CMOH 1NBVL 4KXZH 5D7SH 2BVPA 4JJ5A 3ZDWA 4ONOA 5C07A 2QSQA 3GJFB 1QRNA 4X7FC 5DMIH 3VGHA 1F2QA 1G9NL 1PG7H 2BXZA 3D2TA 3KLQA 3MRHB 3QS2A 4JFED 4Y19A 4YK4C 1YMMD 1WA2X 2IPUK 3ABLB 3GTTA 1QWNA 2CBOA 2XU9A 3BAWA 2WW8A 1K4DA 4DK5A 4NQDA 4NWTL 1M2OA 3QZLA 1BQ5A 4P23A 5INCB 4CDHA 2BO0A 1UWGH 2EADA 1EJFA 1PSKL 4LPXA 4CVZB 1L0QA 5TQ2L 5IMOA 5KSBA 4WWOA 3V0VB 3OHXB 3CX5J 4L2YA 1F18A 1QSFB 4BFGA 3BVUA 3HUJE 2IH8A 5EEYA 3EF4A 2AXFB 1JXFA 1UOKA 4PHZA 1M53A 4XAKE 3RFRA 1HQRA 4YHKH 4GEIA 4P2RD 4OB5L 5DJ6A 4WI2A 4E0RB 2C26A 1OT2A 4N8CH 4YDJA 5D93C 5LAXA 1CE6B 3V6FA 2XYBA 2X9YA 1A65A 3GIZH 3QISA 3QEQB 3ARFD 3S34L 1FLRH 3KCWA 2PW1B 2WVUA 5HHOE 2XX0A 3D50A 2QFPA 3ME0A 2X4TB 2VDNH 4GW4B 1RK1B 3FQYA 1CLZL 2LLLA 3E0GA 5C0CA 4KX7A 2EDWA 4UB0L 3IJEB 3PHOB 3QIBB 5C7XL 4PJ9C 4UTAH 3AG1B 1WSST 5TF1H 1ZOXA 2ZUQC 5DT1H 2W92A 4JNXA 4X8GA 3ZL1A 1T0OA 3OKDA 4C59B 4U49A 1PZ2A 5EIQA 4YLQT 1OB1A 3G6JA 5CSZB 5JZ7D 4NQED 1DTUA 1RMFL 3HRZC 3L3GB 1CDBA 3H9HA 3INUH 1QFOA 2NNAA 1PYWA 4ZW7A 4AGLA 1QRKA 2WINA 2CNYA 4JZJB 3F64A 2V7HA 1QKZH 2IDUA 1AY1H 5E8OA 4M7LT 4GXVL 3D18A 1WUNT 2XKNA 3EYOB 1NMCC 4I7ZC 4WNJA 4GH7B 1SN0A 3CZKA 1J9CT 1HNGA 2CM5A 4NERA 4QYAA 1RHFA 4O4YH 3GBNH 2XX1A 1KB5L 4FNLH 1G1CA 2VDPH 5JW4Q 3HG1D 1ZWIB 3ZSSA 2VSKB 5I0XA 2YUXA 1OPGL 3WO3B 2BVPB 4CVWA 2ZJSH 5F7DA 1LO3L 5HDBE 5FO8A 2PWDA 1C1EL 1RPQA 2J88L 3NZ8A 2AABL 3PJSB 4FQXB 3MBEC 1H3PH 2Q86B 3TBVA 4XVUD 2IQ9H 2YARA 3QIUB 5HXMA 3D25B 3Q5TA 5DC9B 3MRCA 4WSGA 1ZGLA 1U42A 4R97B 1KCKA 5C0DB 1J8HB 1CICC 3V10A 1I8KA 1AQ8A 3C5ZA 4C58B 4M6MH 1C5CL 2VR9A 1CIUA 4G7YL 4U1GB 1TVHB 5ITFB 4UNUA 1EVTC 5IQ7L 2DWEB 4NCC1 4PJ8A 5FDWB 4FAAB 1ID5I 3MLUH 4UIKL 3WE6A 1TTAA 4BFRA 3IS0X 3L95B 2UWEB 2VLJD 1W72L 3PLYA 4D0BA 3UC0L 5JOFA 2IGFH 1YN6B 3N41B 4XP5H 5IW1B 1QO3B 1SXZA 2PPDA 2DI7A 1NL0L 2PF6A 4UTBA 1HX0A 3QC6X 1NFDF 1NC2A 3CX5K 4MJID 4GP8B 4KO6A 3LN9A 4EAEA 2J73A 3VO0A 6TAAA 5FGBC 2A7BA 3M45A 4M93C 2EUZA 3KL5A 4PS4L 3IDYC 3UJIH 3WIFA 5H35B 1ZA3B 1U3HC 3MV9E 5ICYA 3Q8AA 1JYNA 4NAMA 3CC5B 5D7IF 5SWZD 4OAWA 2YAQA 4WTQA 1P7QA 3D0LB 4WFFD 4PJ9D 1LMKA 1QLRA 2Z91A 4MAZA 1CYWA 4URTB 4GG6F 3IGKA 3PWPE 1ETB1 1DSFH 4XP4L 2WXRA 2YEVB 2NY3B 3LOWA 4JGMA 3KYAA 4NS0A 4NSKA 1YEWA 4PLJC 3D4ZA 4NZRL 3WCYA 2DIJA 2YPLB 4FRWA 5DD5H 3QDGE 3BKML 2QPDB 3VGAC 3T3PB 4M61B 3T4YA 4G3YL 4RBPH 4JLRB 2DIAA 3MRDB 3NIGF 1G43A 4LU5H 4FI7A 5HGHA 5EU6D 4MDJB 2YPKB 3TCTA 4IKLA 2FGWH 1P5UB 2NQ3A 5D7HA 4P4KB 3OAWA 1MG2C 4OLVL 4DP7X 1EO8L 3WAKA 5AW9B 2X42A 1QNZH 5D1ZD 1UEMA 2ZCLH 3PS6A 3TO4A 5FYKD 4O58L 5SWZA 1UKQA 3W0WD 3GNML 4KZEH 1RSYA 1YYLH 2AJZA 1QAWA 2EO9A 3H3PH 3BO8B 2VAJA 4P9HC 4KUCD 3SN6N 4ZXBA 1NOFA 3EYFA 5GGTA 3CVHL 1FJ1B 5SWSA 2K7PA 4DQAA 4OLUL 3L5WB 5DF0A 4AGPA 1KCVL 1OGAD 2G3NA 5C09A 3JWDH 2PTVA 4WI7A 5FYJE 1ZPLA 3AROA 2YK1H 4P4RA 1K8DA 3FXIC 3EGDA 2WJ7A 2R51A 2VL5B 2JJVA 4HS3A 2BNRD 1N2RB 3HC4H 3VQ1C 3AU1B 4ACPA 5KVGE 1C08B 2I9TB 4ZQKA 4QYOA 3P11H 5I19H 4A37A 3BEVB 4KFMA 3EGXB 3TO4D 1S7RB 4YBQD 1LK3H 2DQFB 3D2UA 1I75A 3N91A 3KCPA 4EIGB 5IKCB 2A77L 5DK3A 2ADIB 4JKLA 5HI5D 3U1SH 1UT1A 2A9NH 2AVGA 3B9EA 4LGPB 4K8RD 1YMMB 4L1SA 5EIVA 3L3DA 1QBBA 3BZ5A 3CNKA 3TM6A 2J5WA 3IJHB 1UCBH 5EV7A 4NI3A 3WMSA 4HUVA 3APNA 1JZ2A 4PJBF 1JI1A 4XOBA 1V7NL 3WHXA 3KBHE 4G72B 3RVXD 4U6YA 3QCUL 5E2VL 5KANI 3V8CA 3WE1A 4ENEC 2H0PA 4S1SL 4AQAA 1QVOB 2BCMA 3AS0A 1XF5A 3CPLA 3KPRD 2IGTA 1EDQA 2ZYIA 4YL4A 4W9KC 5IHUH 4F57H 1T2QL 4EMZA 4NT6A 2NNXA 3UP1A 5C71A 2YGQA 3H2WA 4BQBA 1XL6A 4ZNCD 4LOUC 1E50A 1FO0H 3WL9A 1YEFH 2NTFB 2GAZA 4QRQA 4U1NA 4MMZB 3VE0A 3WMQA 5BS0A 2FD6H 4J3TA 2X4UA 4U0RC 2DAVA 2ZYHA 5ENWB 1J5IA 3TA3A 4QD2E 4FQHB 4CMMB 4BE6A 2J6EA 3QNFA 4KTEH 1S9WA 4CW1A 1RPUA 4MJ2A 5J6SA 3C8KB 3LKSA 2DM4A 3SO3C 1LM8V 5T3ZE 1H8SA 4P9HL 5C08B 3PXHA 5CIPA 3DPBB 1JERA 3CV5A 4HWUA 3CK0H 1RZJC 4JZOB 1IVTA 4BHUI 5FYKH 1XTLA 1XF1A 3HFMH 1OAXH 4KTDL 4I5BB 5B3JF 2C3GA 1RAMA 1DZ0A 2F53A 1JN6A 4IU3B 2DQCH 5F93C 1UD3A 3IDIB 4N68A 4UBDD 2DKMA 5B39G 5DS1A 1CURA 5D1QC 1P7QB 1E67A 1FL3B 3D0LA 1ZSDB 2H6PB 5KSBB 1O5DT 1OP5H 1E4WL 4P49A 1BQKA 4MYWB 4JFDE 4L29A 1GZPA 3BEVA 1QUNA 2QTEA 2WWKO 1G1OA 2DPKA 5E5MB 2A9CA 3UPCA 4U6XB 2YGOA 4B5EA 3NFNB 4ZMXA 2OJZH 1PW3A 2RMNA 1QPPA 4R7XA 5EEZA 4N2DA 1I9JH 4G6AC 4OTXL 4Z1PA 2ORBH 1NCCH 1LEGA 1CGTA 5C3IA 1PL3A 5GS0L 5C09B 2BNQE 1SJEB 2ILLA 2B59B 1H8NA 5H8DA 3UYRL 4MNGB 1OEZW 4WI0B 1J9RA 4D7PA 3KG5A 4NCDA 3VFGH 3GPSA 4G9DB 4KJWD 4LRNH 1ZANL 4JFXB 3T4AC 4YSAA 3C5ZB 1KEGH 4B41A 3ARGA 3IF1B 3AG4B 2E4TA 5CFHA 1UCBL 1NEZB 3EJYC 4DPCX 2Z93B 3JV5A 1UQSA 4J8QA 2W65A 3KBFA 1XIWB 5IF0B 3VFRB 4R7DB 1DLHB 1O9ZA 3L9RA 1CS6A 2GBAA 1JF1B 2WO4A 2ISDA 4WEBL 4YDLC 4NDMA 4JQXC 4M56A 3U0PB 3HZVB 4GBXA 1A66A 3U9UB 1DJWA 1F1AA 3TBWA 5C0NC 5E1IA 1M7IB 4OV6F 4G1EB 1BVLA 1Z1WA 4YO0B 3GYRA 2GG1A 5E8DH 5JIMA 4TQPA 1V3MA 2ESVB 3HHSB 1FDLH 2I27N 4OV5B 3SKNA 2RA1A 1OD9A 2VLLA 4HH9B 5IQ9A 2X9ZA 4A2FA 2BNQD 4HALA 1ZHLB 4O02L 3P4NB 3QORA 3L3GA 1RP8A 2VM9A 4X6CB 3HBPA 1E90A 1BZ8A 1HCVA 4KQ4H 2DTSA 3T8VA 5DO8A 3IXAB 2J1YA 1U2HA 3TNNA 3T2LA 2W65B 1WFUA 4XPGH 5BV7L 1TTUA 1S9VA 3CLFH 2K45A 1E28A 5I1JH 2PXYB 3RWGA 1T1XA 1ZJAA 3DUUB 3CVCA 4M7LL 5DQJA 4LPYA 5GGQH 2XPZA 2EUVA 1I3GL 1D6EA 1ZIAA 1K8IA 4YBHA 4N9OB 4WWNA 3SDXA 3K0YA 4AG4H 1XB3A 2RFXB 3LHPH 1UA6H 3HS0B 2CA4A 3GF8A 4NZRH 3TVMD 4C56B 3QEQA 4PQXA 2ZCHH 1DSFL 2YBGA 4U1MA 3UTPE 3VRIA 2WLJA 3MOQA 3W9EB 4JFEB 2QELA 3KJ4C 2BIMA 3NVQA 5D7JC 5DZLA 3JWOH 1R5WA 3F12B 2NNRA 4N2OA 5FUOH 2NY3C 2ZOWA 3N44F 5E2UL 5EBMB 3NJFA 4JO3H 4PRIA 3ZO0A 3JT0A 4JY4A 4M00A 1E2VA 5E70A 4O2EA 2AK4D 1TQSA 4WW2A 2GCYA 1SYSB 4EJ1C 5IOKA 1LK3L 3ET9F 3X2QB 4APQB 5I1HL 3A4AA 4XN2A 1C16B 1TXKA 3U0TB 3TYFB 5DFVC 4LLMA 3H3KA 4N2NA 3W0WE 4WWKA 2A5UA 5BO0D 1KWKA 1FWXA 5D4HA 5KWYC 3LD8C 2OQJB 5IVXA 4ECNA 3NK4A 3K6IA 2DMKA 1JGUL 4MA8H 4PY7A 2X70B 5CFAA 2BS8A 2RQEA 3H56A 2B20A 4KJQD 5CZXC 5E8OB 1JN6B 3AT0A 1FZKA 3UG3A 2CDGA 2V5RA 2HKHH 3QI9A 2MNJB 5I28A 4HSQA 5A2JH 1WA0X 1NBYA 1NDGB 1HI6A 3RWCA 1DO5A 4QNPE 4X7SL 1WCBA 1ND0B 5C1MB 3V52L 3APCA 4OAWB 4Z3GA 2QGEA 2Y2TA 3AT9A 2EABA 4HT1L 3LVEA 2PCPB 3QUHA 1T4KA 3KPTA 5TJWK 4PJ5E 4GRMA 1GR7A 4GRWF 2GJZA 3MRFB 4ODHH 1IMHC 3TU6A 3FQUA 2BJMH 2UXGA 3RVVC 3DV4B 4NWUH 4F5CE 3SBWA 4H4NA 1RULL 3L2LA 2Q8AH 2FIKA 1KJ3L 2B4CH 1OAJA 3NACL 2BY3A 2VUYA 3PREA 3QUXC 1SVZA 3OC8A 5K39B 3PFUA 4QRQB 3OLIA 2D3NA 4MJIE 1IKFL 1WJ3A 5E6YA 2BMKA 4L37A 1W15A 2JKIS 5KSAD 1RP9A 4AH2B 1TYJA 3LN5A 3UZVB 5FDWA 1ZDQA 4UU9B 4GXVH 3U4EB 3CAFA 2G3ZA 1QKZL 1BGXH 2YD8A 2F18A 5FLUA 2CHDA 1TTGA 3RAJH 3SQOH 1AVAA 1FIGH 4EE2A 4ENED 3DJZA 3EXJA 2YPVA 4Z0BL 4Q58C 3S37X 4AOFA 4QIRA 4UZGA 1MJ7H 3ROOA 2C1OB 5DSCA 1IFHH 3GKWH 2APFA 1QHQA 3AC0A 5B1JC 4GG8A 4AQEA 2PCFA 2O61A 3AB0B 2Q7NA 3SO3B 3WTTA 1AP2A 4AIZB 3MOAH 4M5SA 5FK9A 5C0AE 2Q20A 1CJYA 4NIKB 3N43B 2NY6B 2EDJA 4B0MB 5DJ2A 3CSTA 4AENA 3N2JA 1A0QH 1QLEB 2BNRA 1EQWA 1TZAA 5HYSA 2BNQA 2CXGA 3ES6A 3ZE2B 2G4GA 3NJLA 4J23A 2I9TA 1N0XH 1D5ZA 2J8UE 3PDOB 5DHDA 5TE4H 4LSTL 3ASOB 3TZVC 3G5VB 2XPGA 4I18B 3ULUE 2XPYA 2JNZA 4M6ML 4XC1H 4GKZB 1A3LH 4ZFOL 1UH3A 4X4XA 4N1CA 3KLAB 4G6FD 5IEHA 1KJ2B 3TA3C 1Q9OA 3DX1A 1O7SA 2FECI 3OKEB 1FG9C 5FCUL 3RY6A 4C54A 2XNAA 1KGWA 1PZAA 2X87A 5KJ7E 5L9DL 4XPTL 1IVLA 5HJDA 2XKSA 3U4BL 4LKCB 2CCLA 3B7YA 3SKOA 2V33A 3QQNA 4R7LA 2VLJE 1A1OB 1XT5A 4GUCA 1M05A 2DQDH 5SWZB 4DQOH 4OR1A 4DKEL 4PVMA 4FQJL 5KVMC 5AEAA 3AWFA 5EC1B 1BWWA 2YAFA 4HF5L 2X4QA 3NPZB 4O4YL 1KXQE 4HIIA 2P49B 4Z3HA 3GRWA 2WAHA 1DJHA 2EO7A 3ETBF 3QZPA 3S4SB 3NTCL 3MODL 1R24A 4BK5C 4JFVA 1NBVH 4WK0B 5F70A 2ITFA 2VLMD 3VQ2C 1C9SA 3QZNA 1NGQH 3OKLB 4TULL 2Z8VC 3INUL 4A1RA 5C0IA 1MRDH 3INOA 5C7ZA 1E9OA 1UGNA 1INEH 1UOLA 4UINL 4G6AD 3MTRA 2CLRB 3MRPB 4OF3A 2JKLA 5DJYA 4PLNC 4ZO9A 5KVDH 4FXTA 5DEFA 1WC7A 4APXA 3FPXA 4TVUA 5AB9A 4ZFZA 5E00B 4A7TA 4Y9FA 4NRXA 3H42H 3ARSA 4FHBD 4AYID 4DGVL 3HPJA 3MRGB 1OP9A 1HCZA 3SKNB 3WKNA 3IU3B 3NFPA 2ALAA 2JIXD 1OANA 3D3VE 1RFDL 5E6SB 4ZUUA 2X7LB 1PY9A 4NQDB 5A2CA 5IJCC 4IKIA 1J1PL 4GI8A 1GGTA 4ZMOA 3U9UA 2BC4A 4P46C 5AW6B 5IBUB 1RZJH 2OS7A 2CLVA 4MWFB 3QUYA 4W9HC 3NPSB 4XMKH 2F8IA 2WY3B 1OAZH 2YUVA 3DUHA 4H13C 5FGBA 4RNRB 1AQKL 1NCHA 1RZJL 3POHA 3WN5B 3JXAA 3PWNB 4C8XA 5CLYA 5KOVC 3I84A 1CF8H 2JJUA 3CHOA 5C07D 3VTAA 1ASOA 1IUZA 1TNNA 4MMXA 4JZNB 1N26A 3L9YA 2VLRD 3CBKB 5DRZA 3TT1H 4C4BA 3VX1A 1K85A 1LE5B 2ZX8A 1MN4A 3LKNA 3PGCA 3O9WB 4UAOC 2N4IA 5HPMB 2L7EA 2R1YA 4GSDH 4PYHA 2Y22A 3OHXC 1T1ZA 2YQ2A 4UMGA 4UCFA 3E6FB 3GSUA 3PWVA 1GTFA 5BVPL 2AK4E 4LPTA 1PG7L 1EEZB 2B59A 1VZGA 3CHQA 4N8UA 1G7JB 1RJYA 4J12A 4EEEA 3VD9A 3T6XA 4E9LA 4TULH 3ZZQA 2Z8WC 4WNQB 3FRPA 4YPGB 5HHVL 1L5GB 3M8OH 4KTYA 1D5ZB 3PDOA 3V0WL 3NH7H 2VQ1A 2HJFB 4J3OC 3GUTA 3NYKA 3VFUB 4DHLA 1FFRA 5EN2B 1NIEA 4WW1A 2X1PA 5BO1H 2Y36L 3VFSA 5GISL 2EIDA 3W5NA 4JG1L 4YSDA 1U91B 1A5FL 2XN0A 3V4PB 3OV6A 5GGVH 1WITA 4Y2DD 3MLPA 5CBEB 1DJSA 5KOMC 2LLGA 1I8IA 5DUJA 2GTZB 3HKZA 5T1JA 2Z31C 1AGEA 4MX7A 2C3HA 5DU7A 4HHAB 4LCUB 1XB6A 2A9ML 1UB5A 5I73C 2ZP0T 3NZUA 4FQXD 3FTUA 1F58L 4I1RA 1GGYA 1A1MA 3ULVL 2NY7L 4WTXA 2YRZA 4FFWD 4J4PD 3RWEA 5K59F 2ESVA 3RKDC 4PJFE 5CJQH 4LLWB 1Q9WA 3UBXI 2JKRM 5GGTL 3CH1A 3UJTL 4M9PA 1MLBA 1XGYH 2JKWA 3KWWB 3O4LB 4L4TB 3ROLA 2WNXA 4WENB 1TQWA 4MA7L 1VADB 1MQKL 2CRMA 3ESOA 5LJYH 4FZEH 2HT3C 3SDAC 5FWRA 1E5YA 1NGPL 4QDGA 4R2GB 4X6BA 3JTSB 1A0QL 4JRXA 1DQIA 2ZWNA 4AM0B 1E3FA 4JKMA 3T08A 5B21A 3GZKA 4N0YL 4ZOAA 5ILTL 4M62H 3ARBB 4PYGA 5AAMC 4HFUL 4LVOC 1KFGA 4L4VB 3T09A 2O5XH 4RX4D 1QPKA 1FP5A 1KNOA 2A83A 3RA7L 4Z7OB 1NC4B 4GRMB 1P84J 5GGUA 1VHPA 1OK0A 2C9VA 2IANE 2PLTA 3IF1A 3PNWA 3WEBA 2EVHA 3JVGC 1KMGA 5IWLC 3ZR5A 3U4KA 1F90L 1G7PA 3VU1A 4GAYA 3V4PH 4HUXB 1JZIA 2R7EB 4P2QE 4RFEB 2DWDA 4ODTL 4YHOH 5T3XD 3TO2B 4GLRI 4MKMA 3SPHA 5KVFL 1WBZA 4TOYH 3O3BB 1LO4H 4QRUB 2LOEA 2X1OA 2R2HA 2I60L 1XXFC 1ZT4A 2BZ7A 1RURH 4QRFA 3SJVD 3RGVD 5D7LE 3VGBA 1J5HA 1OXYA 2O6CA 2W9DL 4L3FA 1IQDA 1KYFA 3CXDL 4B9JA 4F9PA 1OV8A 4FKEA 1JGVL 3OAYK 3DJRA 4N2CA 2WYIA 1UVQA 3LH9A 4LLMB 2OMNA 1SDYA 1QZ1A 3RPIA 1DVQA 2ZOKB 3C09C 3DMMA 1C16A 5J5EA 2UX7A 3QXUA 3ZE1E 3A5VA 4G6FB 5DI8B 2Y2WA 4TRPH 5T3XL 5J11C 3GMLA 5DUPL 2QR0A 2YSSB 1ID2A 4MNQB 1Z5HA 1MCOH 1U36A 1XH3A 4HWZA 4ZUWA 3U2SB 1I8LA 3H54A 3VXUE 2Y1VA 1WISA 5JHAA 3ABKB 3DIVA 3GXMA 4ZMNA 4Q52A 1OSYA 1UWXH 4GIAA 4Z18A 1HXYA 1CG9A 4WV1A 2VCOA 2O1AA 1CGWA 2HCZX 4H0GA 1BD2D 1IBYA 2XIDA 2ZUVA 4N0FA 1YECL 2LLNA 3KLDA 3TN0A 3L54A 3BYYA 5E2WH 3EH3B 4BK8A 1MJJB 2WKOF 1V55B 3NG5A 1OOAA 1AS6A 1ET7A 3CTTA 3KPSB 1F00I 1P5UC 1H5BC 4PI2A 5EU6A 3U9WA 1U3HB 4AGQA 3MACH 4UTBL 4F7MB 1FFPA 5DRWA 3VVWA 1BPLB 2AZAA 4H8QA 4QTIH 2DH3A 3FU8A 4BRVA 3FT0A 4N2AA 2W95A 5IOPA 1UD4A 4P48A 5FGCE 1RIHH 3FB6B 4JFUA 2X09A 1A6UH 1NSNH 1BLIA 1HDMA 1OT4A 3OWEA 3VXSD 4NT6B 3P2TA 3IPEA 5F7WC 1ZE3H 2D7PA 2JKTM 5K9JH 2OMTA 4P46D 4HPYL 1A7PH 3BFOA 3H85A 3ZQXA 1AI1L 2Y5QA 4ALAL 4PJHB 3V4UH 4IS6A 4NZUL 4Y5VA 3CSFA 2PABA 2OQJA 2DDQH 1G4MA 4N87A 5L7XH 1S3KL 1YY9C 1D7BA 2X1WL 1GMEA 3DX4A 1TJIH 4P3CL 5ALBH 5SX5K 3FO2B 2YD9A 3FCSB 4PLOB 3O0LA 1ACZA 4N2HA 4DH2A 2H32A 4YS4A 3JTBA 5ESVA 2GT9A 3C12A 3P69A 2A6KB 3QB7C 4KO9A 4X99A 3SE4C 3OXSA 3GEFA 5FK9B 5BJTB 1J0KA 3ZUCA 4EKJA 4EDWH 1P69B 5JR1H 1NCAL 1XBDA 2AK4B 3D2UD 3IVKA 2F74B 2MWCA 4AK2A 2YD7A 3VXSA 2H3KA 1ETA1 4BGDA 4FI6A 1WH0A 1SN5A 1DZBA 1W8OA 3ROOB 2OSXA 3S2CA 3S2AA 1TKWB 2EE3A 4ERSH 5L2KD 2R7EA 4NENB 2WQXA 3LV3B 1AHWB 2ED7A 4F9LC 5TK4A 4R4ND 1CXFA 5B7EA 2Y0SA 3AACA 5E8DL 4L05A 1OTUC 3PF2A 5F1NA 4UMSA 2XV0A 4YHIA 5C0FB 1C7SA 5TD4A 3LH2L 4XMTA 4JVUA 3UTTD 1T83C 1N3NA 1NC4A 1L0PA 2GYSA 4K7PL 4PGCA 3QJUB 5DJCB 1CTMA 4L4VA 3QCTL 5CGYC 5DC2A 3AY4A 3HBGA 4FQQA 3VFPB 5F2FA 2IH1B 5DD6B 2XQBH 3BKCL 4U6XA 3CFKA 3T3ME 3ZKXC 4W93A 1QUNB 3DRTA 1NDMA 2YD4A 5L0QC 2GAZB 4U1NB 1ZWIA 3WFCH 3ZYIA 2Z7UA 3O6LL 4M7KL 4U05A 5TE7L 5JZ7C 2WV3A 4U0QB 4H2CA 1JE6A 5I24A 1BMGA 2BWQA 3KPQA 5IUSA 5I74C 1P5UA 4PHXA 3QUZC 3KYOA 2YO3A 2EEXA 4LCCB 4WUKH 1P4IL 2A4CA 4U3SB 3BYTA 1GIGH 1D5XB 1PLCA 2WO3B 3SDYL 3FUJA 5HHXH 1KEGL 4RMBA 1F6AA 2XWEA 5F72S 4X50A 1I4FB 2XG5B 3QORC 5BMFH 2ZXGA 1P53A 4CILA 4MJ6B 3UDWC 3L1OH 5CU9A 4RMUA 3TH3T 5GS0H 3TURA 4YSEA 1D5MA 2WUCL 1N7MH 3NJNA 2W0PA 4PGBB 5SWSE 1JV2A 4LSVH 2ITCB 2ROXA 2XSKA 4AI7A 5LBVA 2Z93A 1IM9D 1MIEL 1RZGA 1TQCB 3O4LD 3F6JA 3FYIB 3L4CA 1YQ2A 3UBXB 3B2XA 1H3XA 3LQAH 1IGYB 5MENB 5EA0H 2NY2B 2IMMA 5BZDA 5SWZE 5B3JE 1JJUA 5LWYH 1KELH 3AU1A 3QFGA 1GGIH 5AVVB 5HHNB 1U8LA 5KSAA 2ZCZA 3K71A 3BZEA 4CNIA 3WOVA 3S36H 1KYOK 5K69A 3Q0HA 3LH2H 2WZAA 2CO3A 2EH8H 5IV2B 1PAZA 5AG9A 3MRRB 3H9SA 2BDNH 1KXVC 5D7JA 1U93B 1G9MH 2N7AA 1BD2A 1CE6A 1A14H 1PX4A 3KS0J 3Q8BA 1CB4A 3I9GL 1T80A 1LD9B 1UJ3C 1WHOA 1QBML 1B88A 2I9LA 5C0RH 1F11A 3JT2A 5JHMA 1DBKL 1OCRB 1GGIL 1DBJL 1DBBL 3SE9H 4IJ3B 3W11D 4OJYA 4YSOA 1M7UA 3P30H 3KVPA 2YJLA 2FSDA 4OQTL 2EXYD 2J8UB 3DVFA 1J8HA 2CUIA 2XQYA 4C56D 1IGTB 5F6HI 2E5EA 1OCOB 5ESVB 2VXSL 3TEUA 3L13A 4X6DF 3SY0B 1VFBA 4GKOA 1JZ3A 3MJGX 4Y16C 4AE0A 1HINH 2W38A 4LSVL 3ZDZB 1GCYA 1IC4H 2JJSC 5T8IA 4I9WE 3QXVA 1C12A 4FI8A 1XHHA 2ZONA 1N7ML 2BSTA 3FN9A 4G6KH 1SMDA 3BUYA 2YFOA 5I1DB 1LO5A 4OGYH 1KYOJ 1HIMH 4QHNA 3US1A 2G4EA 2GEEA 5A40E 5GRUL 4KKNA 1XR9B 5DJAA 2X1QA 3HIZA 3LY6A 3PAZA 4OZGB 4BINA 1EWHA 1LDPH 4K73A 2WIMA 1HS6A 4GO9A 5TTRA 5I5JA 4PJEF 4S0HA 1NCTA 5IESL 4IBZA 2DMBA 1D5XA 2C4FT 1DUYB 2KERA 1XTMA 4N85A 4U3SA 3WTWA 3R1GH 3HTLX 4KNTA 3GIVB 2BWIA 4JO4H 2H2PD 3VYNA 3U0PA 4I77H 1HDMB 2OXGA 1MFBH 5C8JA 4JFWA 1AOZA 3UZEC 4AUUA 4GS7C 1FL5B 4RQQA 3K3QA 5IY5B 3C2AL 4I0PB 2Q0ZX 2L7UA 4F7PB 4PWIA 3SDDC 3KYMB 4FS0A 3GBLA 2Y3AA 3ECBA 1ZLVK 4LEOA 4JPSA 2A9NL 3MCKB 3Q43A 4MA1B 4ANKA 1N70A 5FS5A 1N8ZB 5I8EB 3VDBA 3I9AA 4ZD3H 3BAIA 4WUUE 3HE6C 1ACYL 5LLIC 2X3CA 4NQCE 5K9KA 1H6UA 5HHMB 3O9WC 5DZ9A 1HL5A 5FGRA 3ZT6A 3MNWB 5LXGH 4KKLD 3UAJC 3WY1A 4UQ3B 3U46B 2DBLH 2XT1B 2HT2D 1PIGA 4LEXH 3BP