2K78A

Solution structure of the isdc neat domain bound to zinc protoporphyrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
126
structure length
126
Chain Sequence
SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein C
publication title The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.
pubmed doi rcsb
source organism Staphylococcus aureus (strain mw2)
molecule tags Heme-binding protein
total genus 12
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2k78A00
3SIKA 3SZ6A 4YMPA 5D1XE 2K78A 3RTLA 4NLAA 2H3KA 3VTMA 3QUHA 3QZPA 4MYPA 4WJG3 3QZNA 5D1QE 3QZMA 3OVUB 3S48A 5D1ZI 2Q7AA 3QUGA 2ITFA 3QZLA 4FC3E 3QZOA 2ITEA 2MOQA 2O6PA 4H8QA 4H8PA 3RURA 3SZKC 2E7DA 2O1AA 3VUAA 2Z6FA
chains in the Genus database with same CATH superfamily
1I1FA 4D0DB 1KPVB 3RTQC 4ANUA 4MNQA 5F9AC 3IDIA 1Z0NA 1I31A 4ZS7H 1FL3B 1U8PA 3IDGA 1NFAA 1EGJA 4U6XA 1LE5B 5HHNA 3SCMC 5FFGA 1OTTC 5CBAA 2VOTA 1OM3L 2KC0A 1N8ZB 5T1KB 2QDWA 2APFA 2NY6B 2XWRA 3T9WA 5ESVA 1EXGA 1HI6B 4P9HL 4FQ1L 1GGIH 5CEYA 1VFUA 2VAAB 3RDJA 1SDYA 4N0FA 3QYCA 1RJZB 4CC4A 1IL1B 1HHGB 1JZ8A 2J7LA 1RZPA 1U8LB 2CDEA 1MWAA 2X4OA 5JHDB 1UM6H 5A2KH 1NPNA 1WC7B 3HG0A 1HL5A 2JXMA 2NXZC 4FNTA 5BV7H 4JM2F 3FS9A 5FGCB 1H5BA 1OSZB 4QF1A 4W9IC 1FSKC 4AX3A 4BQBA 3WNKA 2WBXA 3QCVH 2E7LC 2N1TE 3ETBF 4RFEB 2AEPL 2XXGA 3PV6B 4XVTH 4L0YA 5LBVA 5FW7A 1J8HD 4ICXA 2X4PA 3SY0B 1E8XA 1BAGA 2LV4A 3H9SE 3HN8A 3GM8A 2BNQD 5BPPA 3L4CA 5CP3H 1NIBA 4O2EA 4JHWH 3SGDH 2H3NB 1O5PA 3ZHDA 4HJSA 1A7PL 3Q3GB 2Q87A 1TCRB 1I3RA 3D9AL 1S5HB 3STLB 5IQNA 5ISZA 1JV5A 2FE0A 3OZ9H 1NC4B 1DUZB 5KVDL 1TTAA 2DTML 4ZQKA 4LSTH 4JO3H 3FUKA 4KWUA 5E6YA 3QXWA 3UCQA 1TJHH 1WA2X 4KH9A 5E5MB 1BM3L 4AYID 4LKCB 2YMXH 4LCVA 2LAAA 1IEBA 1U8CB 4G71B 4BRJA 1DJZA 2XX1A 1AP2B 1PZ2A 2WXNA 2XVBA 5TH2B 4YMPA 2P47B 2H3XC 2MHAB 4HV8B 2IOIA 5EUKA 3ARDB 4ELMB 3CFUA 4H26B 4YHIA 3EOAB 3MBEA 4HW6A 3CFKB 3V79C 1TVHB 4LK4A 1ITCA 2F5BH 4EDXA 4Z3TA 3L45A 1VKXA 1WD8A 3MLWL 4NC1C 3BUBA 4Y5YA 1OGPA 1YYML 3K6FA 2NMSA 4KKQA 1GGBL 5E94A 1QWHA 3WTUA 5KYYB 3TCLB 1YAIA 1UCTA 2P5EE 3RVXC 2O5ZL 3N41F 3LKNB 2X40A 2COQA 2ZG3A 3DGGA 5GJSL 3ZL1A 4DT2A 1T83C 2ITDA 2ZOKB 1K3ZA 2GIXA 3KHOA 2F68X 2OZ4H 2UXTA 3ZYZA 2ILLA 4OB5H 1RFDH 1S7RA 1XR9A 3KPPA 4MXQC 4DVBB 2OMUB 1BQHA 1OSPL 2DQTL 2ZE0A 4PJ9C 2DDQL 4JVUA 2WUCH 5JXED 3G3LA 5C86A 5DT1H 4PLNC 5AW0B 3MCLH 1T0OA 4WHTB 1KFAL 5G4MA 1HTYA 3MMEB 1JTTA 2BCMA 3B7RL 3WG7B 1UC6A 2H32H 1FH5H 4OLYL 1MDAA 1FVEA 3O81A 4E42A 2Z7UA 5A2LH 5SWZE 3TBVB 4TNEA 4GO6B 5DVPA 4EXKA 4IKLA 1M7UA 2YAQA 1I9JL 1T5KA 4JHBA 3OR6A 5I17A 4QMEA 1M2OA 4DOHB 2AAVA 1EUUA 4F7PB 4H0GA 4KX7A 4U2YA 3DUSB 3JQOB 4MMZC 3QFDB 1ZTXH 1N64L 1EAJA 3E3QE 4ECNA 4WHCA 5DZLA 4MX7B 1NDGB 3OMNB 5DCCA 1R3KB 3SODB 3U6RA 2DQMA 3J8F7 3EOTH 1VCBC 1E90A 2A9MH 2FBJL 3HMXH 2GAZB 4P46B 3WDHA 1EZLA 1AYOA 1XAKA 2P5ED 2PPFA 4YDJA 4AUUA 1NWPA 1G7QB 1PFOA 3HZYA 4LSPL 4HHGA 4GT7A 1DANU 3V0GA 4GNKB 4LCUB 3GRWL 4FI7A 3PWUA 4HUUA 3BHBB 2XRAL 4M1GH 3QEGL 3TT1L 1OGTA 3N3EA 3FONB 4QHNB 3OJMB 4IBVA 2Y0SA 4F7TA 4KZEL 3BN9D 4IS6A 4FNLH 4JDTL 1CDHA 4M93B 3ZDZF 1KCRL 3C6SB 4M1DL 4FQCL 4TLTA 4PJEA 1IM3B 4PJ8A 5F8RC 3BZEA 3CWGA 3PGFH 2P42B 3MLXL 3LRLA 3VD2A 1X5KA 4K23L 5SWZD 2HKHL 3JVGA 4LVEA 5AAMA 5JW4N 4BQ6A 4O9HL 3WNMA 3LRKA 2EIZA 2LR4A 1KYAA 4X42A 2ADJB 1A3RL 2P49B 1S9VB 2Y06L 1N7ML 3FFDB 1RHHB 4Y4FC 5ILTH 3RLSA 1H3UA 2WGNB 3QUXB 4B9IA 1YNKL 5IHZA 2UZYB 5BUAA 3KPOB 4M6AA 2NY4C 4R8WH 2XXFA 2ZPKL 4B6ZA 1AZUA 1SVBA 3B9KB 4HS6B 4YXHH 1KTKE 2Z35B 4LPUA 3PGDA 2VSDA 5L88H 1BVZA 1VERA 2I32A 3C9NB 3UPCA 2Q76A 4I87A 4TF4A 4JN1L 4LCCA 1U3YA 5IJDC 2WOBA 4OV5B 5D72H 1J1XL 2VN7A 4JRYE 1O5DT 4X6BA 5KG9B 4EVNB 1DJSA 4GG6B 2QQKL 3M8OL 4P2QA 1CO1A 4JBSA 3UP1A 3MLZL 3IYLW 4Z7UA 3BUYA 4TSCL 1BZ8A 2BNRE 2VDPH 1YEHH 3J27A 4MJ2A 4ZO8A 4FYQA 4PN6A 1KCUH 2H0FA 1TXKA 3QR0A 5LCVA 5IFAH 4MAYD 3ZR5A 1CFSA 5DRZB 4BHUA 2FQGA 2GC4C 3QORB 4QKXB 5D7IA 4KKBD 3KXFE 2PTTA 4KGLA 3F12B 4NZRL 1HYSD 3SDXB 2COVD 3EF4A 3EBHA 3VX1A 4XGZA 1IGYA 4MA3A 4BFFA 2CSPA 2Y07H 2E6JA 3DUUB 4U3SA 4AIXA 3OHXC 2DTSA 3O0RH 4HF5H 1HINH 5CCGE 5DQJB 1FV1B 1HDMA 3U0TB 4Z76A 3TBTA 3F7YA 4HVBA 4MRCA 3MTRA 1OK8A 2Z0UA 3EYQC 1DQVA 4JE0A 4KHTH 4UAOC 2FT8A 2OW6A 4OGAD 2CRMA 4FERA 2A74B 2D03H 3LZQA 2IQAA 1YO4A 2ZQKA 3KPQA 1YEJH 4WV1A 1XB8A 2AFNA 2OCJA 1IFRA 1YPZE 2ZCZA 4TQEH 2JH2A 3HMWL 3RZCB 4JRYD 3VXTB 3ALPA 1MJ7H 1GS7A 2WXMA 1V27A 4LHJB 4OCRL 1A6ZA 3NQIA 3ZUCA 2B0SL 5C2BH 4UOJA 3TVMB 3X1EA 5CEXA 2GCYA 3Q6FB 3BZ4B 4LSSH 1QWNA 4QJ4B 1CDYA 1MCBA 4PS7A 4A7VA 2R69A 4N68A 2AZAA 1I7TA 4POZC 4F1ZA 3MRJA 1AHMA 1NH6A 2BNRD 4NWUL 3V0WL 5TK2A 1FFQA 3HI1B 4U4IA 3QC6X 3TV3H 1JHKL 4BKTC 1E4KC 2VDML 3MGTA 3PHQA 2J6EH 1DBKL 15C8H 1Z32X 2FSDA 3BLPX 4NI3A 2ZJSH 3P11H 2WQSA 3QXAA 4BIKA 4LOUD 4I0PB 4KO5A 1KB3A 4JFPA 3WY2A 3OJDB 4K71B 4XZUA 4ES8A 4OJFL 4QI3A 3KXFD 1XSOA 4BE5A 4RAUB 1QI3A 3RNQB 1J9QA 4R97B 5C0BB 5CWSB 2ENQA 1ZT7A 4RQQA 1KBWA 1S7SB 1IC7H 1NA8A 3R0NA 3FN0L 5I0XA 3MV9E 4OF0A 5EOTA 5FCUL 4PP1D 2R1WB 1DBML 4Y2OB 2AEQH 5J57B 4GQRA 4MJIB 4HJ1A 4OCWL 2G60L 4M6ML 2DD8L 2MQ0A 4ZD3H 1I9EA 4P2OD 3D3VB 4LO9A 1A1NA 3TPUA 1V3JA 4OGYL 3WXVL 1CLOL 3O41B 5D2NE 4QRSB 4Y16A 5L4MA 2X4TB 3I2CH 2IWEA 4B97A 2ALAA 2XTJB 4QRTA 1JWMA 3LS4L 5KSAC 1JNJA 5I0DA 1RZGB 5KOMC 3WMPA 4O58L 2RJMA 3DHMA 5C0GA 1AG6A 4IGBC 4Y4HD 3ROLA 2Y7NA 5EBWA 5DEFA 2I07B 4JZJB 3WXWH 1ZKAA 3VXQB 3TEUA 1ZRUA 3ZRFC 1N6QH 1P4LA 1NGQH 1AXIB 2V9UA 2ZSWB 3OAYH 1IM9A 1S7XB 5HTSA 4DZBA 3P40A 3PDGA 5B8CC 2CLZA 3OKNB 5DUMH 1MI5D 4CU6A 1QLRA 5B1BB 1K4DB 1QW8A 4NQCA 1JOIA 2GVYA 2EVFA 4HUCA 1A7OH 3OPZH 3FQ4A 1JFQL 2NT0A 4K5MA 5CP7A 3QCTH 5K59F 5D1ZB 1QW9A 3H2QA 4P9ML 4JFXB 5IQ7L 3O8XD 4K55A 2K3HA 3V5KB 5I1CH 1C12A 4E9RA 1N2RB 1SLUA 4JDEB 3WMQA 3DOIA 4XMTA 4KMQA 4YX2H 5DRWA 4DPCX 2LFEA 2WBJA 1FDLH 1W16A 1R5VA 1XTLA 1TQTA 3KM2A 2QHRL 1WAPA 2OZNA 4FZEH 5IWLC 1F2QA 5DC0A 1RJYB 1XD1A 3MV9D 3VUAA 5JORA 2DMGA 3IKCA 2BXYA 3NJNA 1IUZA 3ZLQC 3L5WA 2C7UA 3U4BH 3JXAA 2F2HA 1J12A 4F57H 1NMAH 1JWSA 5SWSE 4IW4C 1JS4A 1MHPL 2NY1D 4XP5L 3PAVA 1UA3A 2X9YA 3KPRE 4L8BA 4YFEA 1IQWH 3HC4H 3RTQB 3UERA 4Q7DA 3NSJA 5FAAA 4M7KL 4E41A 1ASQA 1PZBA 2YKLL 5E2TH 8CGTA 2VUYA 5IVXA 3WKQA 3SCMB 3KS0J 1IGML 3HS8A 2CWRA 4U7MA 4HWNA 5D7LA 5HDLA 4G6MH 1E30A 4CMMB 4R90H 3ZTEA 3C12A 3UZVB 4B3VA 2NSMA 3EH4B 4FHKA 3FB5B 4RZCB 1NCCL 2RMNA 2DAVA 2HPOA 5LGYA 4FQQB 4TQ8A 1IQDA 4AT6A 5I1HH 5LGKA 3WS6A 2XETA 1AXSA 5F3BA 4RVBA 5E8EA 4OF3A 1RD6A 3K4ZA 4K9JA 4ZYKA 2ZYHA 4MB4A 3VVWA 4LLUB 3CFDA 5B1CA 1T0NA 2NXZB 4WFFE 4ZRGA 3EJTA 4HMEA 4U6VL 3GSQB 3LH9A 1FSKB 2NY0D 3X17A 3TTSA 1A0QL 4OLVH 1HL8A 1RIHH 3IGUA 3H7BB 4KUZH 4UTAA 4XNXL 5I1KH 2E74C 1JSYA 1KEML 3P02A 3BO8B 2CKBA 3QIUA 3QUYC 4QLRA 4TM9A 4V1DB 3WV0A 2G75A 1XGYL 4N0YH 4W4NA 1ZY9A 1FNEA 1N67A 3HNVL 3IRCA 3GJFK 5GRUH 5GQBA 1R5IA 3OKMA 3NFSL 5CR8A 4EEEA 1N5AB 1SJEA 4IOIB 5DMIL 5SWSD 1U3NA 3LZPA 4WO4A 3U1SH 3MRKB 3OKOA 5I74C 4QOKB 1E27B 3KPRD 3SY6A 4WTWA 4B5ZA 5CCKL 4NP4L 5I0YA 1PCXA 1G1CA 2G3ZA 4UV4H 5CJBA 3WFCH 4KY2A 3RWCB 2I60L 1CS6A 2E86A 2LU3A 4HIHB 5IF0A 4JFWA 4LCWB 4WO0A 1P4BL 4F58L 5D6DA 2GJZA 4H40A 4XRCA 1JUFB 5AKVA 1YEFH 4ERSH 5I1GL 4LL4A 4G82A 1I4FB 2R56L 5CZXC 1EAQA 4XMWA 2ATAA 2E6QA 3QDGA 1JVOA 2DQUL 3IB4A 5HYJA 1SNRA 4MXWL 2LQRA 5DJ6B 3FSWA 1MAMH 2IVFC 4IK7A 4PGEB 1A8JH 1TYEB 2L4OA 3QCUH 4PLJD 3SJVA 1KIPA 3TNMA 5IKCA 4WFFD 3MLVH 1Z6JT 3MJ7A 2GEQA 5D70H 4H1LA 1CD9B 5A2JH 3NTCL 4QUOA 4QNPF 1THAA 2H6PA 3IDNA 3GUTA 1IKFL 3QISA 4P5TD 2BSSB 2OULB 4JFZH 4PJIE 3C60C 2ZONA 4NNXB 1GZPB 1QYGL 2WCGA 5D7JB 2Q8BH 1FE8H 1CYGA 1IIKA 3AACA 1P1ZA 3DMMB 1CTNA 4HHWA 1IAIL 4QJ5B 2CZNA 1RZQA 3L1EA 3JTBA 2QDVA 3ZE1B 3IU3B 4RFOH 2GFBA 4PJ9B 1EPFA 3ES6A 1DBBL 1HH9B 3D85B 4K3JH 3U4EB 2X28A 1K85A 1GXEA 2AJSH 4JMXA 1IO4C 1WS8A 4NNPL 4ATWA 1HQ4B 4DCQB 3QUZA 1PTZA 2IV9A 1TVDA 2DZEA 2B9AA 1XF1A 1TYRA 3OF6D 5E7BA 2HPTA 1S7QA 1LGVA 4NENA 4LLAA 5FFLA 3WTVA 3TBWA 3BAIA 1MW3A 4G42A 1ZMYA 2N3JA 2HVBA 1J0HA 4PGBB 3FFOA 1F6LL 1NPUA 4XP9L 2VQ1B 5FXCH 3REWB 3REVA 4LEXL 4FXGC 2Z0BA 5HPMA 4PV8B 5IFHL 3N5AA 4MMZB 3TT3H 3MRNB 2FUTA 4GQ9L 3DX6B 1GYVA 1FJ1A 1LP9E 4XCFH 1YUHB 3RWEA 3WLWC 4KRMB 4RGNE 5IW1B 1ZS8B 2OI9C 2BSCA 5DR5H 3ZKMC 2A1WH 2C3XA 4Y1SA 3BD3A 3H0TA 3MV01 1TQBC 2YEZA 4B9PA 1QTYT 4X9BA 4HCGA 1L5GB 5DUPH 2WINB 5K39B 4PJBA 4HOWA 1KV7A 3KCWA 2K7PA 3EJYC 3GZOA 4ZMWA 1A64A 2E3VA 1MY5A 4FLQA 2AANA 5E8DL 1BV8A 1KTCA 3ET9F 4OZFH 3O4LE 4WWKB 1OF0A 2P4AB 3MRIA 4IHBA 43C9A 2JQMA 5HVWA 4LHQB 3GI8L 4H5SA 4TVPH 4IDLA 4C4KT 3KWWB 4YIQA 1OT1A 4N20A 2BFVL 1H9VA 4PM1A 5FC9A 1QR1A 1HHKB 3RWJB 4AXWA 4NKDB 1BOYA 2OFQA 5D5MF 2VXUL 3SBQA 4CN4A 1DUYA 1C16A 2EKSA 3RDTD 1NJ9B 2ZX6A 2ZXGA 4XXWC 3NP4A 2OTPA 3IMRA 1P7KA 4P23D 1CFVL 1DE4A 1KOAA 2XA8L 4I0CC 4MCYA 1MCOH 2VC2H 2WZPA 1S4IA 1U8JB 4Y4FB 1WFNA 4LPYA 1P6WA 2GIMA 1A7NH 4HZ1A 4YSCA 3U30B 4N3TA 5L2KD 1LDSA 1RK0B 2NY4B 5IEHA 1TTCA 4Z77B 4UQ2B 4OIIL 1HKLL 4XAKE 4IU2B 4RGND 4LAJH 3KR3L 2B3RA 4X0KA 3RKDD 4UQ9A 3X14A 1TG8A 5FGRA 4GXVH 2E9GA 2IJ0C 3GHBH 4OLEA 4H0LC 4PY8J 5EO1A 5KVFL 1GW6A 4DN4L 1DN0B 4LGRB 4ZOAA 1UUNA 1XBDA 3HPJB 4JFYA 5KVGH 3ULVL 1HSBB 4X98A 4FQIL 3B7YA 1KV3A 3CUPB 4FA6A 3AREA 1ZDSA 5LNDA 3MFFB 3O4LD 4GY4A 4M1CD 3V4PH 4GW1A 3GIVB 1E3XA 5B7EA 2O6PA 2OM5A 3N9GH 4NM8H 2Z8WC 1MZZA 4YSDA 1XVSA 1A6WL 4Z7OF 1MQKH 5AOLA 3WD5H 2VDMB 1QTPA 4P5KA 3CN0A 2P24A 5E2VH 1CTMA 4ZS7L 2P7TA 5LAXA 1KNOB 4DUVA 1RXLA 4MA8H 2X4SB 2WQRA 5AOZA 2C3WA 1R19A 4FA7B 1SQMA 3QR2A 5J6HB 3UBFA 2Q0ZX 3VFVA 1GR7A 3OHXB 5L8KB 1QFPA 5IM7A 3H7LA 4HKZA 5DHYA 2IC2A 4JX0A 1GGIL 3DIFB 3NA4A 2W0KA 1KGCE 4U1LB 5A3IC 1L0PA 5LG6A 2Z93A 3EDEA 3S9DB 2VR7A 1X9LA 4I3GA 4XAKD 5JDJA 2ZOOA 1O7SA 1UM6L 1VGEH 4AH2A 1KELH 4MB3A 3LD8B 3RVWC 1TLKA 1SGKA 2M26A 4L3EB 1ED3A 2ENSA 4PB0H 5DHVH 1DQQA 2UXFA 3QCVL 4H25B 1XHHA 2VSMB 1TPXB 1QOKA 1CE1H 4WJKB 4D7BA 3RA7H 3L2NA 4XVTL 3F6IA 3EXJA 2VLRE 4HHAB 1TDQA 2CUHA 1GZHA 3P4NB 3PWPE 4V11A 5GS0H 4JJOA 3OG6B 4RA3A 3ISWA 2EDLA 2P8LB 1YEGH 1TEFA 4JHWL 5I71C 1J9RA 4BCXA 3B7TA 4X4MA 2Y25A 3KH3A 1C1EH 2F8VA 1G7IA 3FZUD 3MLSH 3QEQA 4XVJH 4AGNA 3PJSB 4ODUB 5HHPB 5HHMB 3L9EA 2CJ3A 4IU3B 1IAKB 3OZ9L 3GSXB 4LP4A 4JFHE 1TETH 2BC4B 3NUKA 4LSTL 4JO3L 1BZ7A 4ZUVA 2XLLA 4H8VA 2J1KA 1TJHL 1VZGA 5CGYC 3C5ZA 4YPJA 4PBDA 2YMXL 5JIIA 3VXRE 2EINB 3IPBA 3L3HB 2NUTA 1OTUD 3TFKC 4OZGA 1TTUA 4IBTA 4B9ZA 4JFQB 4NKQB 4Y19B 3W39B 2VW4A 2IANE 2ADGB 2BMKB 1QO3B 1KGCD 3PCYA 2P1YA 4JZNA 5I16A 2RAMA 1NGPH 1FF5A 1YVLA 4A2FA 4L0ZA 1CVSC 2F5BL 3QQ9D 5A2IH 4KV5F 4G8IA 4BSVB 1EFXD 4H0IA 5F1SA 4AQ1A 5KSBA 4OVVA 4OF7A 1U8IA 2OJ1A 4N2OA 5IVXF 5KSAB 2GW5A 3QDME 2XZZA 4IMKA 4PJGB 3VXUE 2LOEA 3JTTA 1A5FH 1SYVA 3KPSE 4IGBB 2I9TB 1CIUA 4GRMA 3CNKA 1QATA 2DYPA 5EEZA 1F56A 1NOFA 3SIKA 2VLRD 4CGUB 3PWPD 4JFEE 1Z5LA 1J5OH 3CFBA 2FX8H 5AB0A 1P7QA 3GJFA 5B8CB 2G2RB 4J3TA 5FYLH 4MKTA 2OZ4L 3VWKA 5C6TH 4OB5L 1MCRA 5JQ6L 5DJXA 1P6AB 2WUCL 3FU3A 3W0WE 3W5MA 3BZ5A 5ICUA 5FHBL 1LL1A 1CT8A 2BOCA 5DT1L 1IBFA 4LAQH 5K69A 4U49A 3MCLL 4Z8FH 4QIRA 1KUMA 2WLYA 4L5FH 4D8PB 5JPMC 2IWGA 2VISA 3FO9A 3B3IA 4DEUA 5L4FA 5IQLA 3CDFA 1NMBH 3VA6A 1FH5L 1L4IA 1FYTE 4LVHB 2FYYA 3VXRD 2W8CA 2J57A 3P9MA 3L9YA 4NERA 4IHOB 4NPJA 5E70A 5AVTB 1C5BH 4GFXA 2ATKA 2WPGA 2IAND 2K7QA 4F8QA 1WBXA 4AI7A 1NCWH 5C07A 2QMKA 5IIEB 1ZTXL 5F1IA 3O2WH 1XDTT 3RZWA 1TF4A 1CL7H 4PWGA 3EOTL 3PAYA 1XF4A 3RAJH 1XZ0A 1CXHA 3QDMD 4U1NB 2UUDH 4A6YB 2A9ML 3VXUD 3HMXL 3KPSD 1SXNA 1J8HA 3MKGA 4LASH 3SDCD 4CSZA 5B1AB 5B7MA 5DHDA 3FSZA 5KW9H 4D9QE 4EDWH 2DICA 3X11A 4PRNB 4LLMA 3EYVB 1E5YA 1YY8A 3FCSA 4JFED 3WHXA 1MEXH 4OFYD 4OH2A 3WNLA 2FSEA 4ZX3A 4M1GL 1QPXA 3HPLA 3QNFA 1CCZA 2ZYSA 3QNXA 1UD5A 2VLKB 5FGBC 4PTUA 4FMKA 4FLRA 1WAAE 3W0WD 1U3ZA 4PW3A 3AXHA 4FNLL 1AZCA 2RALA 4GRLD 3G6AA 4W9DC 4PJCB 2C4FT 4I2XB 5DQ9A 2XTLA 4A1RA 3T0VA 3QNZB 1GA2A 1ZSHA 3PGFL 4F7CA 3BCDA 4OIBA 2LFGA 4LHUG 4C56A 4C4UA 3BUTA 3IS1X 5E1GA 1FAKT 4B5EA 5I6NA 1OSEA 1Q9KA 3QUYB 3LY6A 3HE7A 1DR9A 2X42A 3H42H 2BY2A 2FO4B 2OMVB 2DIBA 1Z1WA 5ILTL 2ZXDA 2RD0A 5AFAA 5DO8A 2XYBA 3IDMA 4J3SA 2Z91A 1MELA 1U3HC 3BP6B 3D18B 4R8WL 4A68A 2A73B 4PD4J 2CA4A 2O5XH 2X0UA 4RRPG 4YXHL 1GYAA 5I74B 3BW9B 4QHKI 5I6LA 2A77H 4Z3GA 4QYOA 4IEFB 3FCTA 4F2FA 5L88L 4G59C 4L9LA 2XV2A 4RNRA 3RFRA 2IIJA 2EXSA 4YDZA 3FO2B 4ONFH 4AIZA 1TO4A 4FTDA 1X9UA 4Z6AT 5D72L 4CVZB 1JAEA 4J8RB 4LLQA 4MVBD 4R4FL 4D9QD 1M9SA 1BDYA 1OZTG 2FB4H 1ZT1B 3UH8A 4KOCA 4PG9A 2HFFB 1MVYA 1T4KA 5KOVC 1R3JA 4XMKH 5AVQB 2FL5B 2CK2A 2VDPL 1YEHL 3UL4A 5IFJB 5IEKB 4FI6A 1PFCA 5ERWB 4G8GB 4GIOA 3NCYS 1KCUL 3SEPA 4TSAH 5TTRA 5JIPA 5IFAL 3BOVA 2DKSA 5F6HI 3X2QB 4BK5A 1EDQA 1YNLH 3QPQD 3RPIB 4I9WE 3GXTA 4RDQG 1HSAB 1USZA 1AGFA 3FTVA 2JCCF 3ZOAA 3E8UH 5H37A 4FFVD 3LYRA 4OLXH 4ZPVA 5E4IA 2Y07L 4PJBF 3SPGA 4RBPH 4CILA 3C60B 2WYZA 3O0RL 4HF5L 1HINL 3H9YA 3QDHA 1P2CA 4JG9A 3KDMA 3L48A 1T21A 2W9DH 1CG9B 3MLTA 4OZIE 1WDAA 1A1MA 3PNWA 2NPLX 1VFOA 2A38A 2H47C 5C70A 2HTLD 4U1IA 4Z7NE 4JANB 3EFFA 4K5OA 4JDVB 2R1XA 1NDMA 4N8VG 4MHHI 3T1FA 3FB8B 3HE6C 4NM4H 4MAZA 1YEJL 2I7SA 4NUGH 4X4KA 3RVTC 4GG8A 2ATPA 3QI9A 3BD5A 3R7QA 2OCCB 2LVEA 4TQEL 4EO5A 1LM8V 2HN7B 1WICA 2FJGA 3V4VL 2Y1ZA 4O51B 1MCLA 5C2BL 1QQDA 3GMOB 1E0OB 3OKDB 4R7XA 4Y1AE 1CUOA 2YPLA 5FYKU 4FXGB 3WNPA 4M03A 3IJHA 2BSRB 3NCCB 4OAWB 2DN7A 4GB9A 5ICZB 3TV3L 1EIBA 5ACMA 3NJMA 2J6EL 3U36A 3WJJC 15C8L 5J9PA 2ZJSL 1PD1A 1SFDA 3P11L 5IB1A 4H8QA 4HJIA 1ZLUK 3I6KA 4PP2B 2QQNL 4C57C 4I9WD 5IMMB 3MOAH 4L1LA 4OCNC 5SWZA 3C87A 4IBYA 5EA0H 1BEXA 5FECB 1TQBB 4BV1A 1VACA 2CM5A 3CU1A 3QJXA 4GXUM 5I1AA 5MEPB 2G0LA 3NIDE 1IC7L 2DQGH 3SN6N 3OV6A 2PXYC 4G1EA 5F44A 2RGSA 1T7VA 1JV2A 3ULUH 3AT0A 4K8RH 2AEQL 5K33A 3QXTA 2B39A 4EN3C 1ND0A 1WE5A 2WXJA 1YEDB 2D9CA 4E0RA 1S46A 1U2YA 2BW4A 2Z8RA 3I02A 1OIOA 3OSKA 3D69B 4HUWB 2G2NA 3A4EA 4P3DB 5FYJE 2X2HA 4XX1G 1M6UA 3I2CL 4WSGA 5HGAA 3V8OA 5BUGA 2CCVA 3ARBD 3D4GA 2AKRB 3AADB 1VEOA 3KW7A 5GGUA 4DGVH 5HI4C 3HUJE 1AS6A 1G6RH 3MCYA 3F04A 1FG9C 3JT2A 3RX5A 5IHUL 3THMH 4ODVH 3WXWL 3T0EC 1P5UA 4Z3JA 5C0CB 4R0LB 1N6QL 1FNHA 4HIIB 4Y1AD 3VMNA 1NGQL 3RFZB 3TWCH 5DUML 1YQVH 1T3FB 5GS1B 3RL1A 2CALA 3NZUA 5MENB 5JMOC 2CDGB 3JTSA 5JUEH 1RK7A 1A7OL 2EYRA 1FC1A 3OPZL 4TRPH 2HRLA 2A9BA 3AU1A 1D2PA 3GSWA 3KYNB 3QCTL 4KROC 5E2WH 3OKYA 4ZTPH 1RPQA 3QB7C 3S4SG 3U6XA 1F6AA 1SQ2N 4I18A 5I1CL 3ZDYB 1SEQH 3DROB 3SOTA 1UURA 4KKZA 5ANMB 3QW9A 5EU3B 5JHDE 1R75A 3FRUB 4DP5X 3CC1A 3FOLB 5BV7B 4YX2L 4ZSOB 2DS4A 5FO2A 3NCEB 1MRCH 1FDLL 2AMGA 4MS8C 2UWEA 5FGCE 4XMLH 1EDHA 4FZEL 4RCAA 2VERN 2XBTA 3LN5A 4F7MB 5C0DA 2J8UB 2WQ8A 5FW8A 2D4FA 4QR7A 2N0MA 3LZLA 3U4BL 2IAAC 2R2EB 2EDBA 4F57L 1NMAL 3SQBA 3T8XA 3IE4A 4U6YB 1WHPA 2MMXA 1BXVA 1JN6B 2ZAIA 4IOSD 4NAQA 4RMBA 3MUY1 1L9MA 5FYJD 1IQWL 2W60B 3HC4L 4FFZA 2VITB 2UY6B 4ADGA 1QUNA 3HJ0A 1Z9PA 4R6UA 5E2TL 3HLAB 1MH5A 4BWUA 3LQZB 5E9DA 4AYFB 5A1AA 5T5FH 4KKPA 4G6ML 4TSBH 1HWHB 4MDJB 4R90L 2K4AA 4X99B 2NR6D 4OCSH 4TULH 2XHNA 4FFYA 2IFFL 4M7LH 1QKZH 3GYRA 4F27A 1M7DA 5GZOC 2WANA 2XFXA 4ENEC 5TGBB 1JIBA 1J48A 5I1HL 2IGTA 4Z3IA 2QV4A 5T1KD 2NY6D 5HYFA 2WVVA 3KXFA 5KSBF 2WNGA 3DI2B 4NT6B 4G5ZH 4WI2A 4KO9A 1EX0A 4ELME 3NRPA 4F8OA 1Z0MA 2HUEA 4NBZB 2WGXA 4YSSA 1U8KA 4ZTEA 3WGVB 4ZFZB 2J43A 5DHEA 3V7MA 1TFHA 5JHDD 3R18A 1MWAH 4G9DA 1D5ZA 4HS3A 4N90D 4OLVL 3UBXA 1RIHL 5IOKA 4KUZL 1ZGLB 5I1KL 2KDGA 3A21A 4LOFA 1VSCA 5D7EA 2YD7A 4RAVB 3CZFA 3EZJB 5DVMA 1OCRB 2GJ6A 3AABA 2RACA 4P2OA 5ABAA 1FZOB 4F37K 1AJ7L 3HS0C 4N0YL 2H3KA 2E7MA 3RU8H 4RIRB 1NKRA 1MF2H 5GRUL 5I71B 4IIQC 5HHOB 3RBGA 5KJ4A 1EK3A 3U1SL 3U9UB 4JO1H 3VG9B 3UG4A 4W6YB 4BELD 2VZVA 4GUCA 4UV4L 3Q43A 3BZFB 4H0HB 1VZHA 3WFCL 1E5BA 2VR4A 4IRSA 1OGSA 3VFRB 5FEBA 4E2OA 2EP6A 2HRGA 7FABH 1HEZB 2QKSA 3AS2A 3GSNA 3D07A 3VFWA 2VL5A 4NFDA 3UGUA 1MI5A 1NC4D 4P4RA 4ERSL 1YEFL 2H32B 3CFNA 3F64A 4K3DL 3N6YA 4LHUB 3ZDXF 5EOQH 3G5VA 2XU9A 2A6KA 3NCMA 4NO2B 4TUOB 3UDWC 1XGQA 2NNFA 3T6ZA 3UC2A 4YDKH 5IHHA 4ZFFB 3ZO0A 2EKJA 3HG2A 3P2TA 4AVIA 1MAML 1XL6A 1AC0A 3O8XA 3SD5A 4Y2LA 1U91A 4BFOA 3QCUL 1H9DA 2HKFH 2YPVH 2YA0A 3VTAA 3ARDD 4L0PB 4DOHE 1YUKB 2F1AA 4MD4A 3MLVL 1PGRB 3PHSA 5D70L 1J8KA 2X3CA 2XQYK 3QJZA 5HXMA 1E9OB 5KEZA 1KBKA 4AM0B 1BD2E 5A16B 4FNUA 4L4VA 3K1KC 1FO0A 1L6ZA 4JFZL 2FATH 4UT6A 3AY4A 1JNNH 2Q8BL 2XG5A 3QUKB 1RZ8A 3S96B 3GM0A 3IJEA 3PLYA 3IJSA 4GFTB 2UYLB 1FE8L 2WMPB 3WIHA 3AS1A 1A14H 1VFBA 1OT2A 3OLEA 2V17H 3HTLX 3QEUA 4DK5A 2CR0A 3ARGC 1QTSA 2YAFA 2DLIA 5HJBA 1AIFA 1JYWA 4RFOL 4AKPA 4K3JL 4V33A 3HLKA 3EG9A 1FFTB 4JPIB 3CSYA 5C09A 2IALB 2VDQH 5C9JB 2AJSL 3GXFA 4AM0Q 3KWTA 2NY2B 1N0LA 2ITCB 4WJ5B 1BJ8A 1JK8B 1PNCA 2VN3A 4PUBH 3T2PA 5J6GA 3TA3C 5JPMB 2G9KA 1X5MA 2MSPA 3MROA 5F9JB 4NQXB 4Z3FA 4GAGL 2LAGB 3NSXA 5IJKA 4PJXB 2V2XA 3FSAA 2PP7A 5TF1H 5FM5O 4O2CA 1Q9WB 1LD9A 3EOBB 2ICWJ 3MRHA 4JHUA 5G4NA 1DDTA 5F7LB 1SXSA 4IDJH 5IOPB 1KBBA 2DIAA 2ZYIA 1GS8A 3KYMA 1L0YA 4LDLB 2VT0A 4N24A 2H0JA 3TT3L 5EFIB 1M53A 1I7UA 4XCFL 3U7AA 2K9UA 4F9PC 32C2A 5DR5L 3P9WB 2OXGA 5DJ8A 4ZQTA 2A1WL 4N8UA 2YD2A 4N8VB 4KUCD 1Y1UA 2XOTA 2VM3A 3N06B 4EI6B 5DUPL 4X7FC 3B8SA 3O2VH 3BKMH 1UG9A 3DTXA 1Y18B 3ZSTA 4QRPB 3GZQA 1UXSB 3H9HB 1JK9A 1KJ2H 3M17A 2V5SA 3TIDA 5SWSA 4LOEA 4WHDA 1MHCA 1ZLDA 5IROC 3SKJH 5K1JA 2R4SH 3QG7H 4GG6E 4JLRB 2CQVA 1INDH 2F18A 4TVPL 3EW3B 1BGXH 2X1XR 4N1CA 4N22A 5I8CB 3LXBA 4Q6IC 1WZKA 2R9HD 1HXMA 3NEOA 3RPKA 3A4DA 5KN5B 3P9LB 1RJLB 1HL4A 2ENPA 5DA0B 3VM5A 5IBTH 4MQSB 1XMEB 1MG2C 1SMAA 1IM3D 3SDAB 4JN2A 1T1YA 3V0VB 4Z7VA 3P30H 1IBDA 2OX5A 3SDXE 2LU5A 3V5HA 1MCOL 4XHQA 2VC2L 5JPNC 5CMAA 1MREH 3UAJA 4CMHC 3F6LA 3B2UD 1A7NL 5ICYA 3ATEA 3VE0A 2FH8A 3MV8B 1U3HB 4HFWA 4WEMB 4KTGA 3UYPA 2A6IB 1XXFC 1KN4H 3L3GA 3IN2A 3TP4A 1U95A 1JZFA 5LKNA 1EEYB 3QUXD 3S2CA 4PV9A 5HGDA 3LNFA 4RMWA 4BKSC 5LN8A 1BM7A 1QFWI 2EDNA 2R15A 3B9KD 5IB4A 1AD0B 1SXBA 3GHBL 3LKPB 3EO9H 5IW6B 4HKXA 4GI6A 4JUSA 5G2NA 3RUGB 5JW5A 2JK5B 3JV6A 4IM8A 5KVGL 4ZUSB 4GUPA 1UH4A 4J6RL 5D1XC 2PYFA 2R27A 3L5XH 2Q86B 1XH3B 4OZFG 4TNWK 4HKBB 2PMZA 3V4PL 4UYPA 1A4AA 2OMYB 1Q94B 2AV1B 2VDRH 3N9GL 5DJZA 4Y5XA 5AEAA 1GGCH 3OF6A 1MQKL 3LSOA 3WD5L 1GYCA 5E2VL 4OD2B 3N1QC 3MRRB 4YNYA 4ZO7A 4A04A 4MA8L 2DWTA 1ADQH 2Y5TB 2X2IA 3H4FA 5ABZA 3RTLA 4TNGA 1EZSA 3S4SB 3UBHA 1OLZA 3QORD 1B0RA 1IGJB 5DK0B 1UB5A 1XF5B 3UYRH 2CDFA 1FNLA 1S8DA 1R0AH 1BCIA 5C0BE 5I76A 1ZK5A 3UMTA 5F0LB 4QHUA 2P5PA 3M1CA 1THCA 3JYBA 4UUJA 5GGVY 3IJYA 3IXTB 4NKMB 5FOBA 1JHLH 2NYYD 1HAUA 1CICC 1FL5B 3HFML 5C0RH 5SWQB 5EH1A 1VGEL 3T8MA 4MJIE 2VSKB 3HE6B 1MCCA 3EO0A 1KELL 3UADA 3D3VE 3GSOA 3WDJA 2YZ8A 2J73A 2FJHB 3K5RA 5CU5A 4U4BA 4PJIA 4ACTA 2YSSA 1MXGA 3IXAB 4PB0L 4DO6A 3HZMA 1Z66A 1CE1L 1OWRM 1M1XA 3RA7L 1PF3A 2GJPA 2V2WB 4D0CB 2B7DT 5GS0L 1KBGH 4L8DA 2DH3A 5FHAH 3RZCD 1QSFA 1YEGL 4DGYH 4J2QA 5JLZA 1SBSH 4J3OF 4R96A 5J3HC 2F7PA 2X2YA 3NFPB 4N0CD 4Y0GA 1C1EL 3TVMD 1H8LA 1TMQA 3RJQB 3MLSL 2C1OB 3MBWB 1S7WB 2YUVA 3IU4H 3R19A 3WAJA 4O2FB 1ZXKA 4Y88A 4EZKA 4XMUA 1KULA 1CQYA 2IXQB 2VGLM 2DOCA 1MJJA 3FPYA 3NPZB 1C7SA 2D0HA 1TETL 3HB3C 3IFOB 3VJ6A 1KIRB 2TAAA 5J1TC 5AD0B 1NGXA 3FT2A 4P23A 4I0PD 2D7QA 4DH2A 3NCWA 1BZOA 4N6RB 1K3IA 2V37A 3LVTA 2EEAA 5C3IA 4M02A 5FO7A 2PXYB 5GIRA 4U6HA 3MRLB 5L2KA 1F00I 5C0BD 1IV8A 3A0OA 4QT5B 4QDGA 3L3KB 3TF7C 2X9ZA 3ZDWA 4EN3B 1LP9A 1F3RB 3WNIA 3EO1A 3S2AA 5DD6A 2J2ZB 1NGPL 4JJ5A 1UUSA 2CO6B 1V7NH 5LO7A 2JSFA 2WP3T 4MJID 1URLA 3VYPA 2YRPA 4FQHA 3DVGA 2GPZA 3D3VD 5ITFB 3N42B 3VFSA 1A5FL 4XNQB 3RVUD 2H2PC 2R2CA 4LU5H 4MWFB 3I6SA 3P4OA 1ZSDA 3D6GA 3B8YA 4QRQA 1FFPA 2XTJD 5IV2A 4XP4H 5JDSA 3SZKC 3G08B 4K2UH 3P77A 3T0EB 3QARA 3S3SA 3QSKB 3BGMB 3PDOA 4GAYA 2CU9A 3GXMA 1J5OL 3K6SB 2FX8L 4G72B 2MKWA 2Y1VA 5CZVH 5FYLL 3FK3A 4NNYB 5KVDE 2EE0A 4LVNC 1I9RH 5C6TL 2BS71 5JOPE 1USQA 4NQEB 2HVJA 3CHSA 4MQ7B 4O02A 3BEWA 4NZUH 4PG2A 4PCKA 3N1FC 2F6AA 3NZ8B 2YBGA 4KROB 5H4ZA 4MMXC 3WN5A 2IADB 4LAQL 5CM1A 2XUWA 4M5SA 4MJHA 1PQZA 2D2OA 5ICXB 4Z8FL 3D25B 3X13A 3H3KA 4L5FL 2HJFB 3TU6A 3ZKNC 2OK0H 3LKSB 1UB6A 1A3LH 1NMBL 2OL3B 4J3XA 5D1ZD 2L7EA 3VSUA 2PNDA 1G7HB 2LVCA 1AR2A 2DW5A 4NO5B 2KERA 5DJCB 1G9MH 1LE9A 4ORGB 1C5BL 2QJDA 4JQVA 1MLBB 4PY7A 1FQ9C 1GW0A 1VHPA 5JXEC 3QRFM 1UQSA 4TXVB 4R4NC 1CDCA 1UGKA 2CG9X 1MVUA 3BESR 2YGVA 4V1DE 1F1GA 1NCWL 1F45A 4HKJB 3TN0C 1CXLA 1NLBH 3C8KA 3E6HB 3O2WL 1YPZF 4PJAB 1ETB1 4G9FA 5TD4A 5AAWC 4QO1A 3L5IA 1BIHA 1CL7L 3PWLB 1JF1B 5IVZB 2XQYA 3RAJL 2EXTA 4H8WC 4S0SD 4G11A 4LASL 4BZ1A 1ACYH 5KW9L 2R8SH 2YMTA 3DX1A 2C3VA 4ONHB 4QOKE 3AT9A 4EDWL 3RTQD 2B4CH 2FJFA 3VCLB 4MYPA 4PREA 4X5PA 3QYMA 3BH9B 5FS5A 1MEXL 5IW6A 1EEZA 2HX7A 5FFOA 3SCMD 4PJFB 2HXAA 4LCWE 2J21A 3UC0H 5JOPD 4AGLA 3H2WA 2FT7A 2YXMA 3KDPB 1OP3K 1XX9C 1V8HA 4OD3H 1VRSA 3KH4A 3GB7B 1JF6A 4P4KB 2WLLA 2WD0A 1BZQK 3A5VA 1I3UA 4UT9H 4V2BA 4G3YH 4YDVB 4R5VA 2HLEB 3PP3K 4NC1E 5ID1B 1VIWA 1W9XA 3QO0A 4FI8A 1AHWB 2NXZD 1QFWH 1VFAA 4F33A 3EJQA 1CF1A 2XIBA 1CYWA 3N2JA 2Q3AA 1NFDB 5L4IA 5DLMH 2FWOA 3H42L 2TRHA 3HS0B 2W1NA 3FNKA 1JXFA 4IIQB 4GMSH 1R1CA 4V1DD 4YSEA 1FN4B 4UANA 4UAHA 1K8DB 4UDTA 2O5XL 2CMRH 1NUDA 4H8WL 2OSXA 2A77L 3ZE1E 3FFCB 1NM9A 5JZ7C 1IVLA 3VD9A 3NIGB 5HJGA 3LPPA 2VLRA 3S5LA 4ONFL 3PWPA 3GFUA 2CIKA 3ZVVA 4QOKD 4NCDA 2VJXA 4BH7B 5B3SB 2FB4L 3T0XA 3LV3A 1JGDA 4DW2H 2HB0A 3WMSA 1NSNH 4XMKL 4LCWD 2Z31B 3FU7B 5F88A 3B1TA 2AJXH 5GSVA 4TSAL 4AYSA 1JMXA 1T5XB 1SLWA 3FRPG 3L1GA 1WBYB 3MO1B 5GRWA 1YNLL 1RZKH 5ESAA 3ROOB 3MOBH 4HCFA 3G5WA 4YZWA 3E8UL 4OLXL 2R7EA 1ZLSH 1AHKA 3MA7B 3HEIB 4X6DB 5E6IC 1F41A 5I18H 5KWYC 2IANA 4H1LH 1UACH 3D39E 3TEYA 3K91A 4AVHA 2W9DL 3PABA 1YAZA 4GH7B 2AQPA 1JPFB 1T6WA 4X6FB 5D7JD 3ULUC 2DIEA 4K8RC 5C08B 3CVDA 4KKBC 4OZFB 1QRNB 3DMMD 5IJBC 4IKJA 4PJ7B 1IEAB 3VXUA 1T1WB 5KBPA 1SMOA 4AGMA 1IGIH 1GIGH 1HHHB 4MXQD 4NM4L 2QR0A 3LN9A 4CJ1A 3TA3B 5T1LA 4PJ9D 1RJCA 3QHFH 3D85D 1HIMH 2BVYA 1Q9LA 5DFVC 1XCXA 1LO5B 2H4EA 3PL6C 1NAMA 4OFYA 1VADB 4XC3H 2VAJA 3LN4B 3ZMEA 2OP4H 4F7EB 3VGDA 2EACA 3U82B 5I6OA 1CLYL 4QXTB 2F19H 2H41A 4MTMA 1T0MB 3W0WA 2MNWA 4YSAA 3ZZLA 2F54B 2VC2B 4FKEA 4YHKH 3MZTA 3LNHA 3F7VB 3PY9A 4A7TA 1JPST 3EIFA 5BVJA 1ZA3B 1QVOA 5CLZA 4ONOA 3BVUA 1NEPA 4BJLA 3O45A 5MEQB 3FTGA 4NYLA 3CN3A 3I9PA 4LNRA 4EKJA 4A7GA 3MJ8B 4XPTH 3MOAL 4GIPD 5AKRA 5EA0L 2G4EA 2L7JA 3RWDA 5INCB 3BT0A 3WFZA 5EZLB 1JTPA 3DIDA 4UINH 4IBZA 2G2PA 3UAFA 3DNKA 2DQGL 3OXSA 4LSRH 1A6AA 1OGAA 1BVLB 1NFIA 3ZE2B 2ZCKH 4R5TA 3ULUL 2OMWA 4K8RL 1ACCA 2HT4C 3U46A 3ZW3A 2QKIB 5D71H 1T04A 5T8IA 3EFOA 1W8OA 2B14A 1FNAA 2ESVB 3HN5A 3H56A 4EXPX 4OQ1A 3GTNA 3V4PB 2GTZA 4EI5A 3NIFB 1QFHA 4DJMA 3ETBJ 4WWKD 4PGDA 3C6EA 3LQAH 6FABH 4DGVL 1CIDA 5BRPA 1G6RL 1A4JA 3DTDA 5LUMA 3THML 4ODVL 4AZ8B 3PP4H 4PP1C 1T89A 3QWOB 4ZMYA 3SOBH 3Q5TA 2FZ3A 5JPNB 4LPWA 3TWCL 1YQVL 4X8JA 3IGAA 1WAAA 1N59A 3PHOB 2XWBA 4N0RA 4TMPA 1NGZB 3QQ4B 1ICTA 4N2EA 1MHEB 1U93B 3WFBH 5JUEL 4TRPL 3I9AA 1LO2H 4XNMA 4PWIA 2PCPB 2FIRT 3BQUC 5E2WL 2JI1A 3M46A 1S9YA 4Y4FD 4ZTPL 1UZ8A 2KZ1B 2KZWA 4PJIF 4Y4HC 1SEQL 3ECVA 4LSVH 1RULH 2NY4D 1ZHNA 3V0EA 5GSRB 4KU1A 2YAMA 3LIZA 3RJOA 5F7DA 5DK2A 5B38A 3BVWA 3O3AB 4FTVA 1XB6A 1A4BA 1MRCL 1UD6A 4WFHE 4XMLL 5DHVB 3GMLA 4L3EE 1D5MA 5IMOA 3A6OA 3TWYA 4JPSA 3WBDA 2R59A 4EIUA 1JNLH 2XA3A 1KXTA 1H5BC 1A4KB 2W9EL 4PR5B 1G0YR 4JY6B 2VIRB 5EO0A 3PJNA 5SV4A 3SGJC 2F8IA 3KMDA 1GJIA 1NFKA 4MJ6B 1LQSR 1Q1JH 4ANXA 5AG8A 3KGUA 5C0IB 3WEXA 4R7DB 4JCLA 2IH9A 4S2SA 1I9IH 1FFOB 1E28B 3GWJA 3NN8B 2AQ2A 5D4IA 1DYZA 2XWDA 5IR1A 5DD0H 5T5FL 1KDJA 4DZ8A 2W92A 2VTFA 1NEZA 2O6FA 2P80A 4TSBL 1J0JA 4OCSL 4TULL 1U58B 5EEVA 2APWA 2CLRA 1LP9F 3D09A 3QBTB 4M7LL 3F7QA 1QKZL 3MRPB 1IGTA 5DD5H 3DURB 2WTPA 4MB1A 4ZDHA 4AYDC 5D2NC 4KRPC 1PZCA 2ZCHH 5GRVK 3MRGB 5CHNA 5L0QC 3P73A 3W5NA 1CICB 1HEJC 2IPKA 3PFUA 4G5ZL 4Y19E 3Q8EA 1RSFA 1NPJA 3L4VA 4P3WA 1UH2A 2VR3A 2YHGA 3ARFC 5FF6B 1SEBB 3WJMA 1NGWB 3AAZB 5I23A 4YGVB 1JG9A 1MWAL 4K7FA 3RY6C 3SPHA 3UZQA 1FVDB 1RIVH 3MBEC 3QDAA 2AXJA 4JFFB 2GY7B 1S3KH 5CFHA 2G9HB 4MBOA 1LWJA 2KH2B 4PJGE 4LL9A 4L3ED 3FQTB 4YLCA 2RH0A 4OFPA 5D4JA 1YMMB 4KJPC 3VI3A 3V9EA 4XMVA 3RU8L 4Y5YC 5DURB 3QZPA 1MF2L 3Q8CA 3B2DC 3PFQA 2WWKT 3MRMB 3ARBA 2PUQT 4BFJA 3MGOA 2EE3A 3IFPA 1G1OA 4JO1L 1LWHA 3OM3B 2NY0C 4EMZA 4H20H 4I7ZC 1UOLA 4KHXL 2DWXA 3HB3B 4MCNA 5IJVB 3B3BA 1E4WH 2BSBA 4JQIH 3D0LB 3MV11 3L4XA 4XCYB 7FABL 5HHMD 3DVIA 3LZFH 2Z8SA 3WELA 1J0YA 1X44A 1TTFA 2DM3A 3B2XA 4ICWA 3B9AA 4O5LH 2G3MA 3BVXA 5EOQL 1HZHH 2NW3B 4YDKL 4HPYH 2Z4QA 1ZIAA 4NKIH 2AZUA 1EHXA 4LNVA 4NUMA 4JGMA 3FSOA 4Y19D 2HKFL 2YPVL 4CN1A 3OKKB 5EIQA 3QZBA 4W9ZA 1QABA 1H19A 5JHLL 2WXLA 2N56A 1O6VA 1MFCH 5AVSB 2GBTA 1AO7B 5KSAD 4F5CE 2FATL 4S1QH 2LABA 5B3JE 4PEEA 1JNNL 1JL8A 3NRQA 4IGBD 4HC1A 4CVWA 4AOFA 1BQRA 1A14L 3VXOB 5IMKB 5LB1A 1QLFA 4LVNB 2V17L 2V7NB 4OKVB 3LH8A 1XQ4A 2CNZA 1V54B 2H1XA 2VLJA 4K73A 3TIEA 3V6ZA 4C54A 1D6EA 1TFPA 4N2GA 3OTTA 3UYOD 5IMLB 2VDQL 5BZXA 2GG1A 3ZIYA 2A6JA 3F84A 5DZAA 4HJ0C 1KTLB 3HUJA 4PUBL 2YQ3A 3MN8A 3FRPB 4P5TC 5GS2D 2VLKE 1BVNT 2YAOA 4H4NA 1FL3A 2NR6A 5PAZA 3OXRB 2IGLA 4LLDB 3W2DH 5CU9A 2GEEA 2BWDA 4LSQH 4PJCE 4I2XE 2R2HB 3H9SB 2V3FA 2ZP8A 1SOQA 5F1KC 3EYOB 3VW3H 5TF1L 1N8ZA 4UM8A 2WLMA 5T1KA 5DMJB 5E00B 3TCTA 4ELKA 2W0FA 1CFNB 5JR1H 5K9OB 2HSIA 4X8CA 1A3ZA 2AEIT 1MOEA 5DEJA 2AP2A 3ZHLA 3TN0B 3QYNA 3L4YA 3IRZA 5IUCA 1CGYA 2J6WA 1WIPA 4OSUH 1OHZA 1TEGA 2G3XA 4DEPC 2X6UA 1OD7A 1U8LA 5CCHE 3VMOA 5AAMC 2ZSVA 1DN2A 4LPXA 3GEFA 3S5YA 5JHDA 2KLSA 5GGTA 3RHWF 2DQFB 3V5DB 2MEJB 1AOHA 3IAGC 2DWEB 1FVCB 3QXUA 3VGHA 3EDJA 4FC3E 3D4CA 4XE0A 3BKML 3BI9X 3EJRA 2YUXA 4J4PD 4RFEA 3LRSB 3U0WH 4NRYB 2BIHA 3PV6A 2FJUB 1KJ2L 4ZXBB 3SY0A 2EDOA 1T03H 2ZXWB 1IC1A 3SKJL 1BIIB 4GXUN 5DK3A 3QG7L 4PRIB 1X5ZA 1C7TA 3C5XA 1Q8MA 5EC2B 4M4RB 1INDL 2H3NA 4NLAA 2HP4A 3C5JB 5FK9A 5HD8C 2ZAHA 1BGXL 5F7NC 3VXMB 4LDCA 1YN6B 3Q3GA 3RIFK 2PLTA 2YLKA 4QD2E 1ETA1 1S5HA 3STLA 3TONA 4G8GE 2H45A 4P2RA 4JKMA 2VLKD 4Z7WB 1NC4A 3IF1B 4LXFA 3JSSA 1MLCB 2R29A 1JXGA 3G6JB 3NCYP 3ZKSD 5IBTL 5HYIA 4FXKA 5C7XH 4JNXA 2VN6A 2JCWA 2F7RA 3BGAA 4JG5A 3P30L 1A8ZA 2EJ1A 4XBPA 2C7FA 1UASA 4NQSB 2HFGH 3SE4A 3VO0A 3KGSA 3T0DA 5TH2A 3HZVB 1MREL 4NN5C 1JGIA 1MFMA 2E9IA 2XZQH 2WKGA 4WTZG 1MKFA 5G55A 4ELMA 4UMSA 4ZMXA 4KKNA 3QUYD 5F7UA 1MNNA 3S88H 2VMDA 3EOAA 4QGYA 1TQUA 2K70A 1KN4L 3CFKA 5K1NA 4LKXB 3SKMB 4FJ6A 4ZI8A 3NEEA 3CC5A 3UCRA 5CEZH 3B83A 2J72A 3VVVA 4XN1A 3F7PC 2WCPA 4HK3N 5DZOA 4Z78A 5DGRA 4B27A 1Q4NX 1X4YA 3ME0B 3OHMB 1KLUA 4F8PA 2VMEA 1M42A 4JL2A 3EO9L 3H53A 5KYYA 4TNWF 2G5BA 1LQBC 1TU2B 3JVFC 2YD1A 1SJMA 3E2HC 4QHLA 4M62H 3L5XL 2MQGA 4RAHA 2QTEA 2ZOKA 3S97C 4JFDB 4TPRH 1JZGA 1VENA 4RMTA 5EUOB 2J5LC 5M7QA 2VDRL 4JW3A 4DVBA 2OMUA 3WOVA 4FJZA 5HVFB 1GGCL 5D7HA 4WDIB 1L3NA 3CPLA 3RKDC 1P7HL 3V2AR 4BCZA 4BUHA 4BA0A 2QQQA 3W82A 4G8GD 4WHTA 4IRJA 4AJYV 1ADQL 5C0EA 2PWGA 3JV4B 5CIPH 2Y1AA 2UXGA 3R7RA 4R4BB 3O2DH 4QHKJ 4HEME 5DJ2B 2CJTA 5E6IB 1W6LA 5DI8B 3TV8A 3UYRL 3TBVA 3MRCA 1CLVA 1D3CA 4A67A 1R0AL 4XB3A 5H37H 5IB2B 2L0DA 4MD0B 1SPDA 2DQ6A 2A6DB 3C60D 1C08B 1JHLL 5KVFE 1TYJA 3DUSA 4UOZA 1Q9OB 5C0RL 1QFUH 1I8KB 2AJVL 3QFDA 5EN2A 2YZ1A 1WUNT 2FNBA 3ULVE 2J1XA 4M3KB 5EIIG 1NDGA 1R3KA 2VL4A 1G9NH 1G9HA 5DS1A 3CDZA 1JE6A 1YNTB 1T66C 4N5EC 3H2PA 3DV4B 3PL6B 2GAZA 1CR9H 5F6HJ 1AGDB 4PGZA 5BZDA 1NCUA 1G6RB 2BZDA 2IPUK 4B0MB 1WAAF 1KBGL 2EDDA 5FHAL 4DUXA 3E0GA 2NX5B 4DGYL 1CGVA 3NACL 1SBSL 2Z34A 4X83A 1D5XB 5ELIA 5C0CE 6PCYA 3IU4L 1KJVB 1U8OB 4QHNA 2X70B 1OO2A 3PG2A 2AMUA 1PLAA 1YEKH 4UQCA 1AC6A 1JHTB 4ZPTA 2CHZA 5MENE 3S36X 2N7AA 2BSTB 1WIOA 1IM3A 1DVZA 1RVFH 3DVNB 2XPGB 2WNWA 4WW2F 2W9LA 4DGIH 3WLWD 4CC1A 1PL3A 3O11B 3UJTH 3RIKA 4W4OC 2IDQA 3ZKMD 3ZDYE 4BFEA 2QT6A 3U2IA 2OTWA 2ZOLB 5A2AA 5ANME 3FOMB 3IDYB 1NBYB 1OD9A 1R34A 4ZSOE 3MNWB 5IVNA 3CMGA 3T3MB 3KL5A 2W94A 1OTSC 4PW4A 3BMVA 4W81A 1G9MC 2FIKB 1XTMA 3FFDA 4Q89A 3ULSB 1HZLA 1U30A 1V7NL 2FD6L 3K4DA 2BFGA 3KPOA 5IB3A 3G5YB 2J8UE 4KMTH 2VXVH 2FQFA 3TO4A 4N2KA 3B9KA 4G8FB 3ULVD 1AQKH 1UXWB 4HS6A 4W9KC 1HKFA 4OCMC 1NBQA 2A3TA 5KYXB 2DQHH 3DHPA 3Q8BA 3ARRA 2YD3A 3VGGA 1L9PA 4A2EA 1AANA 2DQJH 3C9NA 4LU5L 1ZLEA 1WISA 4XP4L 3VRJB 4K2UL 4GJTB 3S35H 5KG9A 1IMHC 4Z7QB 2B4CC 4MNQB 3IDIB 5CZVL 2D3JA 3GRBA 5EZJB 2IMMA 1I9RL 1U8PB 3IDGB 5IQ9B 2A9NH 2PP8A 4U6XB 5C0CD 1G4RA 4NZUL 2HLFC 2X4RB 4U0RC 3MYJB 4YPGB 4NO0B 3ZGIA 5F7KC 1S9KC 3BQUB 1UWXK 2VZSA 1URZA 4FADA 3ZZQA 4ETYA 1KCSH 3IN0A 5MEND 3N0AA 2C9PA 3SKUD 4R7LA 1QZ1A 1KJMA 2OK0L 3O3UN 4A2DA 3BP7B 4F7KA 4OZIF 1A3LL 4MAUH 5AYTA 1R5WB 3WS6C 4P2AA 2BSEA 1WFIA 4X2UA 4Z7NF 2X4OB 5EMYA 2CDEB 1MWAB 4D2NA 1FHNA 1EZUA 4L29A 5I6PA 1W2KT 1G9ML 5FA3B 2JXMB 1FV1A 1Q0EA 3U0TA 4M61A 3OPUA 3GLDA 4POYA 1DFXA 1H5BB 2FTAA 4QF1B 5CBEA 3SKNA 2JWYA 3UMNA 4MD5A 4FYTA 2OV0A 1NLBL 4CJ0A 5ADOH 4G80B 4EKXA 4I77H 2ZOUA 2VABA 5GXBB 2GJJA 3MODH 5HHOE 2X6VA 5DFWH 1EEUA 2LU4A 3H3PH 2DV6A 2ARJQ 1ACYL 2R8SL 4PWHA 5GGRY 1JZ6A 5D2LA 2B4CL 3BFWA 3MX0A 3VXTA 2WSPA 4I5BA 2WXHA 1I3RB 2FQEA 1DQJA 1EZVX 3TVMA 3MACH 3Q6FA 5ISZB 3DIVA 4JRWA 2V9QA 4ZQKB 3UC0L 4KRPB 1CK0H 1T1ZA 3IGLA 3TF4A 3ZTCC 1HNFA 4FFYH 2YUWA 3Q0HA 1CBVH 1CD1A 4UZUA 4OD3L 2V8MA 5CN2A 4XH2A 5A3ID 2VN4A 3NPSC 4NGHH 4I0PA 3NIDF 1PAZA 3ARFB 3IPEA 3G04A 5CN3A 1VEPA 3DX8B 4UT9L 3BAJA 3G5ZB 4G3YL 5ACLA 2XWXA 1SUHA 4JFOA 4A7SA 1RZKC 3VWJC 2A5UA 3HC0B 4RAUA 4YHIB 3MBEB 4JQXA 3RNQA 1R46A 4TUKH 1HK6A 5HVGB 4EZMA 1QFWL 1ZTXE 3IK2A 1NINA 4UIKH 3RVWD 4EDXB 3VFPA 1J9TA 4NO3A 5IESH 5DLML 4KO6A 4L1HA 4AJVA 4MNGE 1RERA 4J2XA 4Y5YB 5DRXB 4ZFOL 5DSCB 3T6WA 1P7BA 4Y2OA 5CD3B 1ZEAH 4GMSL 3EKCA 2GK2A 1KYOJ 3FCUB 4E9YA 3G5XA 2PPCA 2Y4SA 3CLEL 4FNPA 5JW4R 2CMRL 3DECA 3HUJF 3FUEA 4NPKA 1BZEA 4JAMA 5EU6B 5JIHA 1E3ZA 5DFAA 3ECUA 3PXHA 5HHOD 2ITDB 1CLCA 1I1CA 2VDQB 5INDA 4PVBA 4OQTA 4FG6C 5T1MB 1S7RB 2E5EA 1J0IA 3X1NA 5K9KB 3ZKXC 3V6FA 3GMMA 2I07A 4KY1H 4JZJA 2VE6A 4DW2L 4GRWH 4TNVK 4OZHB 2KLRA 4W68A 4MA1C 5F3FA 3VXQA 1NSNL 4QLWA 1PZ3A 3AITA 2ZSWA 5CGYD 3C2SA 1S7XA 3GMNA 3GLZA 2JKXA 3GSNH 3QUZC 4K3EH 1HVXA 2LLLA 2YA2A 3BXNB 4J27A 2EEBA 4PJXE 2E7HA 5KBLA 2AJXL 1K4DA 1JVKA 1ID5I 1HCVA 3ASOB 4LHUD 5BOJA 1FVEB 2ENYA 5FYJU 1UD2A 3NBNA 2QGEA 2EUVA 3AVEA 1RZKL 5D1ZA 3MOBL 3ZT5A 4JFXA 4N1HB 5KBDA 3S36H 1RIUH 2JMRA 4M7LT 4MVBC 5I8KH 2W81C 1NKGA 2APBA 4JDEA 1UD4A 5KBMA 1ZLSL 5KANI 2VDOH 2MCPH 3B2MA 3NJKA 4J7RA 3AFLA 1WZ1H 4NN6C 5JW4Q 5I18L 1BW8A 4ZUTA 1UACL 4HLEA 4FQXC 4X9YA 2J8OA 2QVIA 3F85A 5FCSH 2W95A 1RJYA 2JFCA 1E4JA 4D94A 4QRPE 1IT9H 1KJ2B 4AK1A 4L23A 3Q8FA 4N2FA 3R8QA 1AQ8A 4JPWL 1RUKH 3FKUS 4YDJB 1A22B 4XCNB 3HZYB 4KK6C 4B9GA 2JNZA 1IGIL 1GIGL 4S1DD 1UKSA 1U8MB 4ANKA 3RTQA 3ZYIA 2RQ8A 1NIAA 3E38A 3QHFL 1E43A 1F4WH 3TBCA 4F24A 5KTEH 2OMNA 1JMZA 1OGTB 3LQAC 4HWUA 2X3BA 4XC3L 3IGFA 1G7MA 2NY2D 5LN4A 1IILE 3SCMA 4M9PA 2OP4L 5BRZB 4WW2C 4F7TB 1BSIA 4YE4H 5HYEA 1BX2A 1KLGB 3UZVA 2F19L 2HTLC 1LO0H 2YGOA 3EH1A 4PJEB 1OE3A 4KRNA 4ELMF 4PJ8B 3VNZA 1R3IH 1JWUA 3X1GA 3BZEB 4XN9A 1F1DA 2UZXA 4APQC 4YHKL 3CIAA 4NS0A 3CX5K 4NHUA 2J56A 3NJLA 5KVEH 1ORSA 4DEPB 1F4XH 3E6FB 4M6OL 3WIIH 4PRAA 3KLSA 1BMWA 2EIZB 5AWNH 4XPTL 1Z9SB 3IVKB 2BP5M 3MV8E 3C8HA 3GSQA 1LEGB 4OGZA 5EIIB 3MA9H 1CFQB 1P4UA 2WJ7A 3VSVA 5IHZB 4UINL 2E7LA 4H1LG 1Q72H 3NJIA 3PPSA 3L8QA 4X5RA 1KBVA 3B6SB 5TDNA 3EJUA 4LSRL 3QXDA 4XX1E 4N2DA 3BO8A 4V1DA 1U42A 1FCGA 2ZCKL 1OZUA 4IBLT 3PGDB 3CVHH 3RUGE 5D71L 4YSUA 2AXFA 1CDBA 2Q76B 4QRPD 3FU6A 3FQWA 3VI4A 3F00A 3J7HA 1BPVA 1N5AA 1NMCC 1UWFA 5C3TA 2CXGA 2ED9A 1O6SB 1B4LA 2QVTA 2VDRB 3MRKA 3B9EA 3LQAL 4N28A 6FABL 2MNJB 4Z7UB 5C0JB 3BUYB 4U1JA 1N4XH 2Y7OA 3RWCA 2L04A 2VR8A 4GMTH 5I1DB 5EEUA 3PP4L 4G7QB 1WSST 2E56A 4XNBA 4LCWA 1CFSB 4IOFC 1ANUA 3SOBL 2BH0A 2AEOA 3FB6B 5D7IB 1I4FA 4UQ3A 4NN5B 4YDIH 5LGHH 4F92B 4ISVB 3SDAD 4QTHB 1I7ZA 3WFBL 4MA3B 5DJ6A 4KUCF 4XT1C 4PGEA 1OCZB 4U3SB 1JNHA 2M1KA 3TS8A 2WUBH 3W1ZA 3F7YB 3MV8D 1U3HD 4LSVL 5J12C 4AENB 2BINA 1E6JH 1IJ9A 1ZLUH 4AEFA 1NCHA 4WW1B 3SBRA 3DVFA 4IIZA 1EXUA 3EHBC 4KDTC 4YEEA 2WWMC 2BSSA 5KS9A 1DVXA 1NEUA 3E2HB 4NNXA 4W6XB 4MLIA 3S37X 2R1YB 2IQAB 1JNLL 1T83A 4HUMB 5CILH 2J5LB 1U9KA 1H0DA 4KI5E 2HFTA 3QDJB 3IU3A 1Q1JL 3JWNH 4RWHA 5IG7A 4PJ9A 3D85A 1A6ZB 3U4EA 1DQMH 5TPWH 3OMIB 1GHFH 1KDIA 1I9IL 3P3TA 2HAZA 5DJYA 5CEXB 3APFA 2H7WA 4JDZA 2H1PH 5ECJE 2IGFL 3MXVL 3HG5A 3PHAA 3B37A 2AXWA 2Z65C 5DD0L 1ZGLP 5B3NA 2NQCA 3QZWG 4FL4C 1FG2B 5CNHA 5AQ0A 3U83A 2VKWA 2BHFA 4JFPB 1PX8A 2ZUVA 4Y7MA 3ESNA 3HC2A 4PGBA 3K5SA 3ABZA 4YDMA 5DD5L 2JE8A 3L4ZA 4NFCA 2ZCHL 1JPTH 2WV3A 1NIEA 2C9QA 3CFJB 2IMNA 5I0WA 4MMZA 3D51A 1GGUA 3OD3A 2GTWA 3FHAA 3DX6A 4Z5RB 2Y2WA 4GEJA 4NEHB 3U25A 1YUHA 3NJFA 4HCIA 5IW1A 1U8HA 1ZS8A 5EOTB 2E27H 2FX9H 4U05A 4AUJA 1LO3H 5AW8B 4HMDA 1TT6A 1RIVL 4I13B 1U8NB 3HE6D 1ZHLA 1KCLA 1S3KL 1L5GA 1DCLA 1I8LC 4QXGH 3VX0A 4GG6F 2WINA 3FAWA 3GGWB 5K39A 2P5WA 5AALA 5M94B 4C4BA 3RVTD 4AGPA 5BQ7B 1IFGA 1RUMH 3QG6B 2PWHA 4JVPA 4BQCA 1BZ9B 1PVHA 5EBLA 5LBGA 4X5LA 4GP4B 3T0EE 3D30A 3SE8H 1QA9A 4B60A 4GOSA 1B0IA 2DL9A 4KI5D 5DEFB 3WEOA 2BSDA 3CBKB 3FQ1A 2FEDD 4NC2B 4FE9A 5FGSA 4H20L 1P4LB 4NQEE 4DZBB 3P3UA 1IM9B 4DGWC 1HHKA 2APTA 3RWJA 3SDXF 4JQIL 2HWZH 2RQEA 1MW0A 3VWKC 3MC0A 4GI8A 1CZ8H 5LG1A 1F1AA 4NQCB 4RX4D 3LNEA 5JOFA 1TR7A 3MV7B 3QIBC 3LZFL 4NQVB 3R8BB 4X4ZA 1NJ9A 1DJGA 1E2VA 2HRHA 4YE0A 4O5LL 4XMPH 2VQ4A 4KFZC 2FNWA 4XI5D 1MFEH 2AK1H 1HZHL 1QP1A 4HPYL 3WCYA 1GAFH 5IP4A 4Y4FA 4NKIL 4NB7A 5E2JA 5DRWB 2PXYD 1KC5H 2AC0A 2CCWA 4ZW6A 1RK0A 4TL4A 2WBJB 4Z77A 4LEOB 2XN9A 4EN3D 2V3EA 2C26A 1ZV9A 4TVUA 4IU2A 3K80A 5JORB 5CJQH 3IKCB 3GXDA 2ZNWA 4LCIH 2B08A 4PJAE 4XN7A 1ZANH 1MFCL 2C7UB 3EDDA 2C3HA 2W07A 2K3TA 2F5AH 4S1QL 4TQHA 1DN0A 1TTRA 4KOBA 1HSBA 2IO5A 3QJSB 1U41A 1B90A 4E41B 5GRYA 3CUPA 4GSDH 4KVCH 4BSJA 3T0ED 1SY6A 2YRZA 2ZUUA 3MFFA 3ARDC 4U0RB 2DPKA 3GIVA 1J10A 1S3RA 1MWOA 4HFUH 4RMVA 2PN5A 4PJFE 2CGZA 1ML0A 4NQED 5MHSE 4O02H 2HT2C 2BRRH 2X6BA 4HAKA 3L3OC 1IQDB 5ADPH 4KROD 3NSFA 1KNOA 3W2DL 3FYIB 4FDWA 4WWNA 2BS9A 1AXSB 2X4SA 4M7JH 4JVWA 4LSQL 5FV1L 2ZX9A 1BQ5A 3OVUB 5T1JA 5C0AA 1O9ZA 4JUTA 3VW3L 1PLBA 3V6OC 5DJAB 5HYQA 2ZP9A 3OHXA 4Y9BA 2EEDA 1VAHA 5JR1L 3AXLB 3IAPA 2E7CA 3P4MB 4MS8D 1KJ3H 5B39G 3BYTA 1NFDE 1SJVA 3FYEB 2HX8A 4ZFOB 2WXGA 3EADA 5T3ZH 3RQ3A 4OSUL 4PCSA 3PE9A 4W9HC 4HWZA 2CLVA 1C9SA 1L9RA 3HE7C 4AYMC 5B22A 4PJ5B 4DO4A 3Q06A 1JFHA 1RZIA 1S2EA 4Q6YA 4M00A 4J8QA 1ONQB 1SJHA 3RPBA 3D7PA 1R5IB 3OKMB 4L3EA 4P3CH 1LNUA 1WFOA 2XSKA 1CE6A 3FFCE 1SJEB 3BUQA 4H25A 4LBEB 3KPNA 3I50H 4XVSH 3NIGE 4WO4B 2E6PA 3U0WL 1IJNA 4BFGA 2ICCA 4GP8B 4HHAA 4HMCA 4BZ1H 3P4NA 4NPYB 2XNAA 3S37H 1T03L 1DVFC 4BK4A 5EORH 4K5NA 1T20B 2P8LA 1YZZA 4XNZC 5AW5B 3RGHA 5LHDA 3INUL 4AV0A 3RG1C 3P3SA 3W3BA 1HCYA 5IF0B 1E4KA 3CLWA 2PWFA 5AW6B 2XWJA 5GZOD 4ILDA 1JBJA 4ENED 4HWBH 4WZ9A 1FZJB 3NPSB 3Q9QA 1AR1C 2F15A 1NGYB 5HHPA 3RGBA 1MRFH 3MRQA 3BKYH 5MHSD 4JY4A 3K8KA 4IU3A 1WCBA 3LX9A 2OYPA 3D4YA 3VWJB 2BC4A 2V5TA 2HT3C 1JI1A 4WI0A 5KYUB 2XV3A 3EJJX 4P4KD 3HCVB 2IDSA 5C7XL 1QR4A 1KTBA 1UZGA 3GSRA 3O4OC 4P46C 3OC8A 4IK6A 4DP7X 1KIPB 4OJCA 3FMGH 5IKCB 3DPBA 2HFGL 3L3HA 1OHQA 4H1LB 3O3DA 2ZKHH 3ZX1A 2KQNA 4JFQA 3UJJH 4X6DE 3W39A 2XZQL 2H6PB 2BMKA 1QO3A 2VDLH 3S88L 2HLAB 1XF2B 1DO5A 4B3EA 5K5YA 3I6GB 1A3QA 3BN3B 1XEDA 2MNUA 5CEZL 1XIWC 3S34H 2IDTA 1MAKA 1P1ZB 5I5RA 3WEAA 1FYTB 5C08E 2CKNA 3ESUF 1GZQB 4DWHA 1QRNE 2WZ6A 4PJ7E 4PJGA 3O0LA 3ARXA 1G9NC 3ZKXB 4TVPE 3FFCD 3CSFA 3SYAA 2L7UA 2D31A 3AC0A 3QO1A 3GXUB 4YVNA 5FM5M 3IDXH 4M62L 4XPHH 2JJWA 5CGTA 2PYEA 4KK9C 1PPIA 3IWUA 3KD4A 5H35B 3QUZB 1HXYB 3ZHKA 1GJWA 4TPRL 5B8CA 2G2RA 4MFHA 5EV7A 4NENB 3R06B 1AZNA 1WLHA 5E5RB 1KGJA 2KYIA 2F54E 2Z31D 2YD4A 4J1UA 1BYOA 4UI2A 5TFSH 3REVB 1H3WM 5F72S 5C0FA 5FKPA 3SBWC 5DYOB 3RWIB 3MJ9A 4DAGL 4TS6A 3O2DL 4NJ9H 4KK8D 1F58H 2BIIA 5E03A 3ZE0B 4WU5B 5JIKA 2Y7MA 4FQXB 3GMQB 3RWEB 7PCYA 2BNUB 1T80A 5IWLA 4IHOA 4ZK8A 1BXUA 4XCEB 3VFUB 3VI4F 4UNTA 3H0TB 2WN3A 3N43B 4BDVB 4GKOA 1NCBH 3ZE2E 4UOQA 5F9DC 3WHE1 1QFUL 4G7YL 4Z3HA 1Y6NR 5IIEA 4ORZC 5KVGE 4FLOA 2V0AA 8PAZA 3ILPA 4Y4KC 1G9NL 9CGTA 3K0YA 3QORC 5C08D 4F5CA 2ESVE 3HG1A 4U1NA 1QRND 3AMKA 4WKXA 2OAAA 1OPGH 3NIFE 4QTIH 4HLJA 43C9B 2X2JA 1CR9L 1GS6X 4UOW0 3UTTB 4TVPD 4H5SB 4HGWB 3LZNA 1IRAY 2K4WA 3TA3D 4YIQB 5D55A 5EN3A 1B3IA 1QR1B 2VZ1A 4APXB 3QZWB 5DMKA 2BOBA 1KPRB 3QWNA 3IDUA 4AG4H 1DQLH 1OWWA 4APQB 3RIAK 5CF3A 4NBYB 1COBA 4LEBA 1C16B 4BA8A 2JB5H 4WLCA 2VLKA 1YEKL 3MR9B 1E50A 1P7KB 5ETUB 3NCFB 2F54D 3ENEA 2A74C 4MCYB 1GOHA 3US9A 1QX1A 4H88H 5LDSA 2W59A 2P9RA 1RVFL 1F6FB 5BS0A 1CWVA 5FKAA 3C5SB 4DGIL 1Z9MA 3UJTL 5I19H 3QUGA 2J88H 4HEPG 5IEHB 3U0PA 5E6UB 3FTSA 3B7UX 1ZVSB 5AW7B 5H37G 2CBMA 3QUYA 1HESA 2WWNA 4DK3A 3ZE1F 4X0KB 4MDIA 4PJ6A 1FRGH 2OMVA 4XBEH 2QL1A 1IAOA 3CQQA 3CBRA 3ZRSA 1HWGB 1Z3GH 4L1BA 5EO1B 1NMCB 3RVVC 2HX9A 3D18A 3SDYH 3BP6A 3TBYB 3VXPB 3CSBA 2VXVL 4KMTL 2EUWA 5IROD 1AQKL 2P44B 2JKRM 1CI5A 4X98B 4BFBD 3PUUA 2OJEB 3NQKA 2DQHL 1MCFA 4IEFA 3VNYA 2ESVD 2JELL 2DQJL 1B2WH 2UY7B 4GW1B 4PRBB 3FO2A 4LSDA 2MRYA 4LBAA 4NWTH 3AG1B 3S35L 3GBDA 4QKTA 2O30A 5EEYA 5KUMA 1DBJH 3F62A 1IU1A 1MXDA 3KVDD 2P7TB 5LAXB 1SRDA 2A9NL 5IHWA 3EYSH 5EU7E 4NKOA 3X12B 1C8QA 4QAMB 5IEKA 4UZGA 1SXZA 4G8GA 2XKNB 5FUCC 1CFMA 2EIMB 5DHYB 1KCSL 3RVUC 1TEYA 2BHUA 2NZ9D 3RPIA 5AYUH 1A9EB 4O00A 5J12B 1HSAA 4FXTA 4MAUL 4N85A 3MQIA 2Q1EA 3EHBB 4NZ8A 4JO2H 3UTSE 1GSMA 1T6BX 3C60A 3FUNA 4XPGH 2A83B 1PYWA 1OK0A 2IWKA 1QLEH 3LIZH 3VB8A 3QC5X 3V9CA 3LZOA 4JFFE 4GO8A 1ED3B 2K9FB 4JHVA 2X0VA 3G6DH 2JQZA 4CVXB 2NY7H 2N4IA 3TH3T 1YMME 1W0WA 4JANA 5ADOL 4I77L 1NQBA 2QVMA 3N1MC 1BFOB 3ALXA 5FM8A 2H6UA 5DGQA 3MODL 5GS0D 3FB8A 4G7VH 4L3FA 4UCFA 5FYLE 3H3PL 3ATAA 2F8XC 2IWFA 2X09A 1E65A 5SX5H 3GC3A 4FL4B 5CXPA 3FO1A 1BA9A 2WLZA 4PYGA 5F71A 3GBNH 2H0EA 3CZKA 5I9QB 3T6VA 4B9JA 3D2UB 3GMOA 5HHQA 2QSTA 1B6DA 3MACL 5GZNC 1UYWH 1AQMA 1TVBA 4FXGA 1A9BA 4JZOB 1BZ7B 4IRSC 5GGRB 1CK0L 2BSRA 4OAWA 3QFJA 3J07A 4FFYL 1CBVL 2AXGA 3V0HA 4KKRA 5B39B 1ETZA 4NZDA 2CHDA 1M6OA 1DVTA 4NGHL 2O61B 4OZGB 4BINA 2KL6A 4J3OG 4HEMA 1CICD 3AS0A 4E68A 4BEIA 1XCQA 3PWVB 2EIJB 1E5ZA 4JZNB 5I16B 4TUKL 2J4WH 1L9NA 4KTDH 4N5UA 5LLIC 4M56A 4UIKL 2BIPA 3DSNB 4QRRA 4G8IB 5MEPA 2N1KA 2OA9A 3CAFA 5IESL 1PS3A 4AQ1B 5KSBB 3M86A 5GISH 3C09C 4TL5A 1WZAA 4WI7A 4M29A 4JFFD 1AKJB 1AO7E 1ZEAL 3VFNB 1SYVB 1BXXA 4O4YH 1XT5A 5J06A 4FKKA 1WZMA 4J39A 4GRMB 3ZGHA 1DZ0A 4GIAA 4EOWH 1YMMD 1CC3A 3D69A 5DUBB 4WUKH 5I1EH 2CHXA 5DURD 5E0FA 2OQJB 4AYEC 1DHKA 1ZJBA 4XNYH 4WGVB 5J3HD 1Z5LB 1EHLL 3CFBB 1UWGH 2WQWA 5JMRA 5FYLD 3WE6B 2KQMA 1NAKH 2GBAA 2YC1B 2AKRA 3VWKB 5BVPH 2PWEA 3QIBB 4TNVF 1V3MA 5DJXB 2NZ1A 4L9DA 4KY1L 4L4TB 3HB3D 2QVFB 4PS8A 1RLBA 5F7WC 2PCXA 1ECZA 2H6OA 3WDIA 5C0CA 3K6IA 4HIIA 3L6FB 2GJRA 1OPOA 4OZ4A 4NUJA 5E95B 3ZUNC 3HI5H 3GSNL 4K3EL 3T65B 4TYUA 3FO9B 3B3IB 1T3FA 3DHJA 1DVUA 4N8PA 2CDGA 3BVVA 2AQRA 2EIBA 1GJUA 1ZLWK 3HRZC 2EDRA 1S7TA 1B0GA 3KYNA 4I3RH 5HDWA 4ODTH 1KB9K 3D48R 5A2BA 4NRXB 3A3YB 2ATKB 4YO0A 3H1ZA 1RIUL 4PQXA 5I8KL 1OP3H 3FL7A 3S36L 3ZDXB 3DROA 1MJUH 3CQFA 1WBXB 3NZSA 2VDOL 2MCPL 2IG2H 3FOLA 1WZ1L 5C07B 5FLVA 2ZX7A 3IDJB 1KXQE 2EO7A 5DDHB 4RA0C 3PP3H 2H2PD 4BCYA 2WTRA 4Z3EA 2BCKB 3PWNA 1KXVA 1XZ0B 3Q48A 1AO7D 1IT9L 3TGXA 1C5DA 3WS3A 3BWUC 3VXNA 1RUKL 2QPFA 1A47A 1G0DA 2R2EA 1KPUB 4Y2DC 3OAYK 1WFTA 2X0WA 1J05A 4LLMB 1YY8B 5AVZB 1YJDH 3FCSB 4XC1H 4PRIE 1OAKH 2W60A 1L0QA 4DP2X 4HSCX 1F4WL 5KTEL 2UY6A 2FHCA 3L3OB 1LK2B 3TC9A 3VQMA 3T3PB 3VXME 5D6CA 3HPLB 3LEYH 4FFWC 2ICWI 3HLAA 4EAEA 12E8H 1M7IA 2ICEC 5JIMA 3VACA 3LQZA 3BIKB 2XWCA 1PX3A 4Z7WE 3ZKND 4AY0A 1RL1A 3G6AB 3L9RA 3G6JE 4CRPA 1CFTA 1LO0L 5D7JC 1R3IL 4F7CB 1OAXH 3H9SD 3DMMC 5F96H 3IBOA 2X9XA 3ALWA 3BEVB 3AQXA 4XN2A 1AGEA 3FBKA 4PCTA 4C56B 4DETA 3CV5A 5KVEL 1MFDL 4PWFA 1XSKA 1YHPA 3WIIL 3HE7B 4NDMA 5AWNL 3QZOA 4R4ND 4RISH 2WWKO 4PJGF 3TN0D 3IE9A 3UAJC 3RURA 2HFEA 3MA9L 3IDMB 2Z91B 3Q44A 4GKNA 5FB8A 4MSWB 1AZRA 1Q72L 1ZGLA 4QRAA 1SYSB 3HOGA 4RAVA 5SX4I 1FFRA 4QYOB 1FZOA 4AMXA 2CO7A 3FCTB 1DVFB 1QNZH 1NBZA 3CVHL 4RNRB 2B59A 1L7IH 4XNZB 3HR5B 3GBMH 1N68A 3P2DA 4ZXBD 1D5IH 2D7MA 2OCFD 2OZ4A 3FF8A 3UJIH 5AB1A 1R9FA 2K0RA 4JFDE 4PG9B 3U9UA 5EDSA 1AR1B 4JB9H 1T4KB 3JWNC 3K8MA 4PRID 4YBLC 5EUOE 1X9QA 1BD2B 3ESVF 3VXMD 2X4NB 3B9VA 3VFRA 4E9VA 1J5CA 4GMTL 1JGVH 4NXKA 4L8CA 1FNFA 3O4OB 5CIPB 1OARH 1J8SA 4NLHA 3BDYH 2YJQA 5HJDA 1PU0A 1Z2KA 4TUOA 5J4MA 1VB9A 4YDIL 5IT2H 5LGHL 3MZGB 5J13C 3RWGB 4HXAH 1A1OA 4X4YB 2F58H 4ZFFA 5KJRH 1UADC 4WWKC 1QPPA 3DXAB 4NZTH 3OMAB 2KBGA 1L6PA 3SQOH 1ZHBB 1X5AA 1ZVNA 1XIWB 2K6WA 2WUBL 4RMRA 1T21B 2ZWZA 2BRQA 3MLTB 3ULUE 3PXLA 4HD5A 4M8QB 1A1MB 2JQAA 3PNWB 5FLUA 2J1ZA 1E6JL 1F42A 1H8NA 1E9OA 1ZAGA 2Y24A 4U1IB 5F1NA 5JZ7D 5EOCH 4AM0A 1NDMB 4KXCA 1H6UA 3A6CH 3HBZA 1ODUA 3OWEA 4B0MM 2FECI 3S96A 3QNYA 3KEHA 3T4AC 2UYLA 4HYTB 4LLVB 2W0LA 1NC2B 3AW5A 4YXKH 2JB6A 5CILL 1VCAA 3QI9B 4EI0A 2CH8A 5ACZB 2VUOA 2DQCH 4XODA 4KPHH 3D34A 2FJGB 1K6QH 5E23A 3U30C 1U6AH 4ZO9A 1DQML 2NQDA 2NX5E 5TPWL 1GHFL 4PJCF 1QQDB 4JFDD 1XZWA 2OMXA 3NA9H 5AB2A