2K78A

Solution structure of the isdc neat domain bound to zinc protoporphyrin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
126
structure length
126
Chain Sequence
b'SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein C
publication title The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.
pubmed doi rcsb
source organism Staphylococcus aureus (strain mw2)
molecule tags Heme-binding protein
total genus 12
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05031 NEAT Iron Transport-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2k78A00
3QZMA 3QZNA 3QZPA 3QZOA 5D1XE 3S48A 4YMPA 3QUHA 2MOQA 3SZ6A 3SIKA 2Z6FA 3SZKC 3QUGA 2E7DA 4FC3E 4H8PA 4WJG3 2O6PA 5D1QE 2H3KA 3OVUB 3RURA 2ITFA 2ITEA 2K78A 3VTMA 3VUAA 4MYPA 4NLAA 2Q7AA 2O1AA 3QZLA 5D1ZI 3RTLA 4H8QA
chains in the Genus database with same CATH superfamily
4D94A 3DKHA 5DWUL 3QWOB 1Q0XL 2AZUA 1SY6A 4BK4A 4UTAL 3BKJH 2GJZA 2YZ8A 4YGVB 2ILLA 4XMLL 3DO4A 4Q0XL 1A7OL 1KXVA 2X6UA 3HE6D 3MC0A 5FHBL 1YEDB 3MNWB 3ZTEA 2WN3A 1MJJB 2DM7A 1C5CH 3DVGB 3HC2A 3QQ3B 4NNXB 3PJSA 5AQ0A 3G6AB 5JW4N 3T09A 1HHKB 2C1PB 3DOHA 4UQAA 3UO1L 4Q6IC 1BIHA 1WZ1L 4C56E 5KSBF 4I87A 2PTTB 1TMQA 2XWXA 2J43A 2JCCF 1SJXA 4WJ5A 5E2WL 4YAQA 3VXMA 1ZLSL 2EQDA 3GSNA 4BZ1L 1JK8A 1IL1B 1J0JA 2VO5A 4KDWA 4NKDA 5E51A 3KS0H 3RIKA 3S34H 4LPWA 4WWKC 2V7HB 1P7BA 4X2UA 3HZKB 3W9EB 4ATWA 1T22B 1TUPA 1G7JA 4G42B 4HULB 1V7MH 1SOQA 2QZ5A 3PDGA 3EG9B 2R2EB 1F5WA 1OAXH 3FNKA 3TC9A 2P5WA 1XL6A 4P5KB 1G1OA 2YFOA 1QEWA 2VE6B 4Z3FA 5FWQA 5KVDE 1WC7A 4XAKE 2LFEA 2P26A 2KZ1B 2VERN 3BAEH 5MP6L 1HZLA 2Y72A 1QBML 1LMIA 4N2FA 3RPKA 1TOXA 2J88L 4YO0B 3MRPB 1DQIA 1J87A 5I0DA 2ZXCA 2AMUA 2DTML 5EZLB 2CRYA 4FLOA 1D5ZB 2J73A 1MW3A 1QBLL 3KHQA 1JZHA 3O3AB 2P8PA 5F7DA 4R6UA 3Q6FB 4NM8L 1UHVA 2PPCA 2FAUA 2Y2YA 3ARSA 4M43L 4QAMB 4YSSA 4HWZA 3GKWH 3QARA 1AZZC 4ODXB 3TT1H 3TNNA 1F4WL 1I9RL 2GTZB 1NANH 4X99A 4ELKB 3QC5X 3SJVE 1DVFC 3T6VA 1LDPH 5EC1B 4AQEA 4LAQH 4GAGH 5T3ZE 5HHME 2E74C 5T33L 5JIHA 1OM9A 3QHFH 3X13B 3KPTA 3E80A 4FFYH 1T1XA 4M3KB 4CGUB 3FHQA 4LLWB 1ORSB 3HOGA 1IC5H 5LDSA 5I1HL 4X8CA 4JFUA 5I0ZA 5I73C 3WFHB 1XD1A 3E0GA 3TBBA 2CO4A 4MB4A 5J12C 2B14A 3HG1E 3HPJA 1DUYB 4PTTA 1M1SA 3NJMA 1RZJH 3SPIA 2W0LA 4XN4A 4GFTB 4N0UE 3KBEA 1NFIB 1G84A 4HWUA 2CUHA 8PAZA 1DVXA 4L9LA 4KKQA 1HKFA 4LEEA 4OBRA 3L5XL 4B41A 1L7IH 4RH4A 4PGEA 4KMTL 2QL1A 2X9YA 3VGEA 3T0VA 5IOPA 2E7HA 2A4CA 2KMWA 2VLKD 5MEOB 2VLRD 1LEKB 1NFDF 4Z7AA 4MA8L 5E6IC 12E8H 3K2IA 2XN9E 3VD9A 4UTCA 3WXWH 4MCZA 3UAEA 4HOZA 5AAWA 2W92A 2P45B 4HC1L 1OKEA 1FVDB 4MDRA 4UZGA 2NY0C 1FYTD 5LWYH 4KHTH 1G7LB 2Q7YA 4QNPF 3IE9A 2WXLA 4K94H 3C5ZC 4UCFA 3SGDH 4OJYA 1UJ3B 4LSSH 1KFAH 3B3IB 3EW3B 3EYVA 3G5VA 2BIMA 2WXMA 3OHMB 1HHJA 2CBQA 3QEQA 5AOKA 1PG7X 1JE6A 3U2SA 3DX1A 1OE3A 3CHPA 4XN2A 3SCMD 4HFUH 4D8PB 3TZVD 1ZA3B 5SV4A 3G04A 2DV6A 4JFPB 5I17A 1N0LA 4XMKH 5HGAA 2HX9A 1DJIA 1RPKA 4LNRB 5I1CH 1XFPA 4B5EA 3TF7C 4JM2F 4AYMC 1HXYA 2J5WA 1T7VA 3F12A 5T1KD 4Y1AD 3T1WA 3SDCC 2VO8A 1AHMA 2MHAB 4JY5L 4HIXL 2ISDA 5LN8A 4QXUL 4GW1B 4PCSA 4F7EB 3VFRB 4CC0A 1KGWA 3QZBA 5BO1H 3P77B 1DN2A 1V3JA 3FTVA 1DQDH 2GG1A 1NFDA 2LAAA 3QQ4B 4L05A 3AREA 1PDKA 2AHIA 2MWCA 1KYOJ 3F58H 1EHLH 2EACA 2WTRB 4BFFA 3IF1B 3ZMNA 2DKSA 1L5GB 1SF5A 5JW5A 1BFVH 3COOA 3H9SA 3QFDB 3KDMB 1JXJA 1R75A 3NJIA 4YSUA 2WM0A 1WAAE 3N40P 1F13A 2NNXA 1OIOA 4HJTA 4JZJA 3MA9H 5DC9B 1BCIA 4HHAB 4PR5A 4XHJD 4JNXA 3LZFL 2V8MA 2W07B 4H8WC 1X44A 4IOIB 5T1MB 3QJHB 3D06A 2H6PA 2BHYA 5GS0C 4DW2L 5D4QA 5GGSY 3OGCA 4K4KA 4P99A 3TO2B 3LZQA 2V9UA 3MLWL 3RU8H 2XZAH 4JM2A 1Z9NA 3N85H 2E47A 5I9QC 1Q94A 5B1BB 2D31B 2E9WA 1J05A 4ZMYA 1V05A 3RX8A 3JBG7 5I74B 2EXSA 2P5WD 2YD1A 4UT7L 4FJYA 4G80A 3X1NA 2VN3A 1LO3H 1RHHB 3WFBL 4HH9B 5GPRA 5F88A 2EKSA 4OZGA 3CV5A 1ES0B 2HKHH 2FR4A 1UVQA 1OAQL 2EEFA 4Q9RL 1ZT7B 5E70A 3B9EA 4FG6D 5IB3A 4H1LH 4JFZL 5D71H 4CVUA 1N7MH 4NN5C 4J4PC 1ZV5A 1PX4A 3GI9H 3WFDL 1OTSC 3B8SA 3UPRA 5TQ2L 3N2JA 3VDBA 3CE1A 3AT0A 5CU9A 5GGQH 4XWGH 1TDQA 5E9AA 5JYMA 4DO4A 3NRFA 4XNUL 1KSRA 4KTYA 5HYSA 1PZ2A 2SEBA 3HBQA 2N01B 1RU9L 4HJJL 4F37K 5HPOA 1W0YT 3WKYA 1UUSA 2WNWA 3LEYH 2DQHL 2X70A 3FUMA 3C6SA 4G8FB 4TTDD 4XODA 1ZTXL 1BVKA 2CGYA 3D0LA 1JVLA 1P4LA 2H3KA 4F2MB 1I8KA 4ETQB 2OQJA 4LLYA 3CHOA 1OARL 2C9XA 3ZYOA 2NUPA 5DS1A 4EEEA 2HT2C 1E50A 5IHUH 3HVNA 2PYFA 5KYNA 4APQB 2VC2L 4JKNA 4N0CD 2ERJB 3QDGE 4JO5A 1IAMA 3D0VB 2B4CL 3MBWB 1TYRA 2XJKA 3MUGA 5EWIH 1FDLL 2ZKHH 3BO8A 1FL3B 1WFTA 3LZLA 3FTGB 4QGTA 5BMFH 5AB0A 1M05A 4KXBA 3UC0L 4F37F 1D7FA 4K7FB 3TO4B 1U8CA 2O6PA 4PG2A 2BSCA 4NN6C 4WFGE 3VGDA 1G4RA 1QAWA 2MNUA 1J8SA 4M6AA 1JVOA 4MJ6B 1E5BA 43CAB 2UYLB 3AG3B 2FX8L 3MFFB 4YDKH 1NGWB 4LP8A 1FO0H 2HJLB 2DD8H 1N0XL 3BUYB 3KL0A 2NT0A 3QAZC 2Z8WC 4XCYB 1RUQL 2IOOA 4N2IA 2A83B 3Q1SL 3WN5A 2PW2A 3MLSH 3QEQD 3WOVA 4UIKH 2CBMA 3BVWA 3DPBA 4FFYA 3QFJA 2O26U 3D51A 1NKOA 1OF2B 4ZQKB 3K6FA 3LVEA 1E2ZA 3PL6A 3VXRB 1KLGB 3EOTH 4OUUA 2FUQA 3K4AA 1TFPA 2HCZX 3L4XA 3MCKB 4JREC 3IU3A 4PJEE 1KIQB 2Z1PA 1AR1C 1IJNA 4NWTH 4YBLC 5GGVY 5JW4R 2EE2A 4S2SB 4AK2A 5ICZB 2F61A 2MQ3A 4LGPB 4QRRE 1CLCA 1AD0B 3GZOA 2OW7A 3BGMB 3QRBA 2Y3NA 1NEZG 1QA9B 3MUZ1 5DWUH 5K9KA 5KG9A 5KAQF 1KELL 2F7OA 3N91A 1MEXL 4QYOB 4UTAH 2OXHA 5GGTH 4A2FA 1VEPA 2WBKA 4XMLH 5I18H 1A7OH 5FHBH 3ARED 4JY4A 1XV8A 2UZYA 1QQDB 1SHMA 1ECZA 2V3DA 3GT6A 2CG9X 1I3UA 2NY5C 2WQVA 3MROB 1QPKA 4UM9A 3T0EC 4A2EA 5F3HB 5ID0A 3EJQA 3H9SD 4Q97A 4GKNA 1WZ1H 2VZOA 3MJ7B 3GXTA 2GCYB 4L0ZA 1PL3A 5E2WH 2DOCA 2PO6C 4N20A 5J56B 5IW3A 1EHAA 1ZLSH 1XF1A 4MMXB 1I1AA 4BZ1H 2LU3A 2CO1A 2G30A 1ZPUA 3MNZA 5I8EA 3D2TA 1IAII 2IBZY 3A67H 3H7LA 2YC1A 4R97C 3AFLA 2WQ8A 3HAEH 1XF2A 4JMXA 4QRFA 4BYHA 1S9YA 4PP1C 3VRJB 4JM2D 2K9FB 3BE1L 4BGLA 4K5LA 5KJRL 2ROYA 3AUWB 4Q58C 3HG1A 1E28B 1JV5B 4MJ4A 2NPLX 2NXYD 2XKNB 1HSAA 5F89B 3H0TA 4N0UA 2IQAB 1OSZA 3CSYA 1NINA 4G7VL 3VNZA 3GEFA 3NFPB 2LLLA 2AXWA 3RVXC 1QATA 2YXWA 4UV7L 5ACLA 1QBMH 4M5TA 4G82A 3QIBD 4JFOA 5BZWB 2J88H 3SE3A 3VA2C 2ZG1A 1ZPLA 3AS2A 3DTXB 4AGNA 4BFIB 5CHNB 2DTMH 1DHKA 3WMPA 2Y3AA 3QHZL 3SQBA 3QCUL 1QBLH 5EOCJ 4YSAA 1NANI 3JWNH 3QEHA 2XN9A 5FUZL 1CIDA 4NM8H 4KKCD 4JVUA 4LIQE 4XN1A 1NMCB 5E0QA 3DV4B 4M43H 1B2WL 5L4FA 1QSEE 4ZZKA 4XOAA 5GQBA 4E9WA 1UD3A 3G6JE 1TZIB 1F4WH 1I9RH 3L1OL 3WJMA 3SY0B 3PWNA 5HVHC 2ITCB 4NO3A 1WAAF 4G70B 2A6KB 4XBGB 5C0NC 5T33H 4ZW5A 1G7IB 1FVCB 1QNZL 4A7UA 3VE0A 5DLLA 4N24A 5IVNA 1NUFA 2DMKA 1ECYA 4N9GA 4RGNB 4F8OA 4PV8A 5I1HH 1MCOL 1CBVL 2VN6A 2J8UB 4FZ8L 1EXUB 1FLRL 1HI6A 1YN6A 1I7TB 2NZ9C 4KRPD 4KUZL 2E8ZA 3NP4A 3ZKMD 2P5PA 2W9EH 2X4RA 5DK0B 5C09B 3CFDB 4BH8B 1K72A 3G3LA 1T66C 2MPAH 1MJ7L 1ZXQA 4E9RA 4JDZB 3LN4B 4WTZG 4XXCC 2W0FA 4MA3B 1P7QA 2ZAIA 2GT9A 2ICWA 4AQZA 4OI7A 2A5UA 4M56A 2Y7OA 4Y19A 2XYBA 4HEMA 4NXSA 1IGYB 5TTRA 1BHGA 4KMTH 2GEEA 1XSOA 3QG7L 4P2QA 3RBSA 1G7HA 3BPNC 5CKAA 4MA8H 5DZLA 1I9JL 1AQKH 1XB3A 2RB8A 1E4WL 1LWJA 3AAZA 3ROLA 4HC1H 3GQFA 1T2JA 3L3HA 2E7BA 3LKSA 4KKZA 5K9OB 4YHML 1WAAA 2WBJC 3X3GL 2ATPA 3GMRB 3D30A 4BCZA 3QIWB 5GRUL 4C56D 5A7EA 1YYLL 3FB5A 1SHWA 5D7IE 2CA3A 5DJCB 5MENA 3CPLB 4P59L 1SMAA 5D7JA 2EIDA 5AG8A 1UCBL 1V3KA 1W0VA 5CINL 5DF0A 3U0PA 5HI5D 3Q9QA 4WEMB 3QFJD 3KXFA 4FQ1L 5GGUA 2LGNA 4BFGA 3PL6D 3WV0A 3VTMA 5BVJA 3DX9A 1UFUA 2CR0A 5CZVH 3RVTD 1WFNA 4CNIB 1TVBB 3EJSA 1MCQA 2AK1H 2VM3A 4JY5H 4HIXH 1VPOH 2NYYD 5GJSL 4QXUH 4XAKD 3ARBA 1L0QA 3JQOB 2ODIA 2JH2A 4MNQA 2H32H 4MMYA 3ZDXE 5KBLA 4LVHC 4F7KA 2J55A 2WLMA 1Q0YL 4YDLB 4QHNA 4X5XB 5DFTA 1G0XA 1VF5C 2QPEB 3ARDA 1HZHH 1XMWA 4XNZC 3BMWA 4IDJL 1RXLA 1GZQA 5ICXB 3CCHB 3VFGL 3VI4B 3VXUB 3L3OC 2IG2L 1KPRB 4UM9D 5FXCH 4HJ0D 5KOMC 3CN2A 2QPDB 2XTJB 3EOYG 5C0FB 4XBMA 1FFPA 2YXFA 5T3ZD 3LZFH 3MX0A 5HHMD 5EBWB 3U9UA 1IO4C 1I1AD 3Q8CA 4FERA 4NZUL 3H2WA 3FQWB 1IEBB 3MU3A 2NTFA 4DW2H 4GUOA 1SOXA 2F0CA 4KK5C 4RGOL 4DZ8B 3M86A 1NOLA 3CZKA 3H85A 4TQIA 2QHLA 3JVFC 1SLUA 4GXUN 4F7TA 1PEZA 1WV7T 1FIGL 3AABA 4H7VA 4Q6KA 5E00A 2BMKA 4BUQA 1IAIM 1NBZA 4L3AA 3HG1D 4LSPL 4MDJA 3VO0A 4AMWA 1CDBA 2EIMB 5DJDB 4UT7H 1FL5A 1FRGL 5JPNA 3Q3GA 1FGNL 1YVLA 5HHPA 1YN7A 2GPZA 3F7QA 2WLJA 3ENEA 4X50A 4ZDHA 4F3FB 1WEJL 5CJ8A 1DN0B 2WYIA 1OAQH 4AH2B 4Q9RH 1V27A 2ZOUA 3WNKA 4UTAA 4QTFA 2XIIA 3P4OB 4JFZH 3SYAA 3VVWA 4JK0D 3P11L 1T5WA 3NCYS 4N3TA 4PCKA 2XN9D 1PFCA 1FNHA 5DVNA 4UAHA 5GRVK 1CQKA 3WFDH 5TQ2H 1GS6X 1MDTA 5T1DL 3IPBA 2EO9A 2JKNA 4QXGL 5T1LB 3GJEB 1BGXL 4EXKA 2XG4B 1IKFL 2WV3A 4HJJH 1RU9H 1WSST 2ZF8A 4CILA 4EVNA 1LK3L 2SODB 3JV4B 5BUGA 1FWXA 4CJ1A 4UUJA 1KCVL 3KWVA 1ZTXH 3IS1X 1KJ2B 1UKSA 2YK1H 5CJXC 3ULUL 5JXEA 3HAEA 4NYLA 3D3VB 3TN0B 1U21A 4J3OC 2QSCH 5KN5A 1UZ8A 4O02B 3TBTB 2WXQA 2J5LB 4AC2A 2ZP9A 3KVQA 1UXLA 2NW2B 4QRRA 1JN6B 3CD4A 2ZF9A 4ODTL 2A6DA 1C9SA 4EF3A 1Z1WA 1UWXH 2VC2H 1XAKA 3LN5B 2CBPA 1AGBA 1JUFA 3QQ9D 1P7QD 3NESA 4HWEL 2B4CH 4LE8A 4OD2A 3MA7B 4JVPA 1RZ8B 4YBHA 1FDLH 3RVUD 1S9WB 4ECNA 1UGKA 1PZAA 2QFRA 3QIUA 1MVYA 4Y19D 5SWZB 1IBYA 3CHSA 3ARVA 4HQQL 2MJWA 1OANA 4P2QD 5GSVA 3TU6A 3UZQA 5C92A 3LQAL 2EYTA 5MEQA 3PDOB 3TM6A 5BJTB 1WWBX 4MNHA 3G5XA 2HLFC 5DRZA 1NBYB 1CS6A 2YGPA 4GXVL 3P3SA 2X88A 3KPQA 4RGMC 3MV11 2ICWJ 4UQCA 3HZYA 3QZWB 2FX8H 1SEBB 3UDWC 1N0XH 5C0CB 4KAQL 3P4LA 4TUJA 5HI3C 3K46A 3Q1SH 3ZHKA 4U1HB 2G5BA 3L5IA 5MEND 1RZIB 2BSDA 5AVWB 3T0DA 4DKTA 1NA8A 4LCYB 3U46B 2K8QA 4MYWB 4IMKC 3FRPA 5I74C 3IJYB 3WENA 1S7UB 5JHMA 3NVQA 2LAGB 4UILL 1KBGL 3FO0L 3KXFD 3SDDC 4XN7A 4B9CA 3L3GB 2UXTA 2F08A 2ED6A 3S2CA 4HKBB 2C3XA 5IB1A 3IGLA 4O4YL 1IAOB 3IXAA 3VGFA 2YLHA 5D1ZA 4KMQA 4Y8AA 2V5MA 1R5IB 1EH9A 1KELH 3ARBD 3BESR 2BPBA 1JRHI 4YR6A 1MEXH 4M3HA 2HRGA 2MKWA 4K71B 1I3GL 4D9RE 3ZR5A 2XTSA 2AITA 2DKUA 3UGXA 4HJ1A 1BZ9A 4LCWB 4WFHE 4GO6B 3F00A 2R1XB 2O1AA 1I7ZA 3ARDD 3FTZA 4AVJA 3GTVA 4AG4L 2PPEA 1A6AA 4HC1A 2JNZA 2IADB 4L8SA 2PF6A 4TUKL 4PGCB 3S35L 4MQ7A 3JSSA 4NBYB 2W95A 3WIIL 4LSVL 2HFEA 1AO7B 2FYYB 4M8UA 5D7IF 1OL0A 3IGFA 2DWSA 3OKLB 1SMOA 3BUPA 1UD4A 2XC8A 4IOFC 4YHIA 1CFMA 1GMIA 1HHIA 4NJAL 3VI3E 4ZMTA 6FABL 2ZX5A 4EI6B 5EOTA 3CX5K 1MHHB 2H3NA 3K6SA 3FT9A 1KCKA 4ONOA 4WY7L 4Y88A 1G6RL 4GRWE 1A6VL 2YUWA 3EGDB 5D1XC 3BE1H 5LB1A 5KJRH 2H26A 1XGTA 4G72B 3IFPA 4WO4B 3WUZA 1MG3C 4YFDB 1ZLWH 4Q2ZB 2FT8A 1S7WA 1N2RB 1GVIA 3FH8A 4KXZH 4G7VH 4PRIE 2A1WH 3QDGD 3QPKA 2NY6C 3CIQA 1QSZA 2YRZA 5IQNA 5FDWA 2VISB 5DWPA 1UACL 3RLSA 3ZDXF 1S7TB 2DJ4A 3QCUH 3PWVA 1SBBA 4NERA 2AZAA 4WFGD 3G08B 2BXYA 1Q1JL 4L23A 5FUZH 1YY9D 5DVOA 4ZS7L 1CR9H 1SYSB 1B2WH 3UL4A 5B3JF 5T1JA 4FL4B 2KHAA 5E6ZA 2BRQA 3L1OH 1G9ML 5IEKB 2KKQA 4YBQD 2AJYL 3DMMD 1WHOA 4GRLB 1OO2A 1UWXK 3HR5A 3T8MA 2YA0A 5IG7B 3B1UA 1H5BB 3M1OA 5JQIB 3LVTA 5HHQA 1U95B 5FM8A 1QNZH 1WG3A 5E8OB 2DQJL 4G6ML 1LE5B 3WKQA 4A6YB 2JXMB 4A55A 2ZOKA 4YPGA 4Y4FC 4HF5L 1L9RA 5LBGA 1MCOH 1CBVH 4XPAL 3VTTA 1GY2A 1JS4A 1N4XL 1SYVB 3BWAB 3VD3A 4FZ8H 5JXED 1FLRH 4YWGL 1N3NA 4JFXB 1JWUA 1AGEA 3IYLW 4NBXB 3EYOB 4P23B 3TH2T 2IAMC 1H3TA 5TJWK 1MJ7H 2Q76B 2XVKA 4QRRD 1ED3B 1QFWL 3B2XA 2CKBB 1HE8A 5L2KA 4IGBC 3M17B 1M53A 3CFKA 3ME0B 3EOAB 3UX9B 2J71A 1U8KB 1QR4A 4WUUB 5D72L 3L4TA 2DBJA 2YIHA 4GQZA 4PJFB 3QIUD 3QG7H 3WTUA 5CLZA 5KBPA 4X8JB 5CD3B 1J9TA 4F1SA 4HYTB 2GITA 2AK4B 1I9JH 2AGJL 3OXRB 3V95A 1SM3L 1VADA 4ZAKB 1E4WH 3BJ91 4R3SA 3OKYA 5FYKE 4RMSA 4BFRA 2WC7A 4WU7A 4PRHB 4YHMH 3X3GH 1CDUA 1GKOA 5D7EA 5GRUH 2Z0BA 1XB6A 4JZOB 5HHXL 2XX1A 3KDPB 1XH2A 1YYLH 2C3WA 2GSIB 3LQZA 4W9GC 5AKSA 4OM1L 2VR3A 3DX0A 2AS5M 1QFPA 3SGJC 2JMRA 1MHEB 3C5SA 5E5MB 4P59H 2P48B 2LLGA 2DLGA 2APTA 3OKDB 5CINH 2HVBA 4X0KA 3VFMB 1CDIA 1J8KA 3CBJB 4MQTB 1BFSA 3EJUA 2GJRA 5D6DA 2OYKA 5GGSB 2F74A 3KJ6H 1PVHA 3FH5A 1E3FA 3U6XS 1DCLA 4XI5D 1E8YA 4OH2A 5J1AA 1UUNA 2KL6A 1DVSA 2BOCA 2NUTA 3I85A 5GJSH 3PUCA 3QUYA 1IGCL 1RHFA 3ZSSA 2BCKB 4NUGL 2W0KA 2ARJB 3V5HA 3QA3A 5IK3A 3IDMA 3QPQC 4Z0BL 1NMCC 4FX5A 5FFOA 3LDBC 1Q0YH 4X9YA 3PHQA 4XTRC 2WWMC 5F0JB 2PP9A 5EUKB 2DM3A 2WQAA 4JPQA 4RCAA 3NPSC 2VABB 2XKUA 4ZMLA 3X11A 4V33A 4IDJH 5F6HJ 4FFZA 3WXVH 3VFGH 1BZ7A 5DHVA 1P5VA 1SVCP 1S8DA 4PRPB 5BXFA 4XZUB 2XU9A 2IG2H 1DJYA 1CGXA 4E9YA 1BLNA 1RZFL 5FPIA 4BKTC 5EOQL 4ODVL 1WA0X 3LRKA 4PWJA 1D7DA 3GINA 3MRLB 4NZUH 3H3KA 3A0OA 1FVEA 3ARGC 2DZEA 2NY4C 3IGAB 1HAUA 3PWLB 1VFBB 4KKRA 2X9WA 4NC1C 5D70L 3VVVA 3M45A 4JFTA 3PP3H 1KCUL 3T71A 2QMKA 3RFRA 3NZSA 5AYTA 1FIGH 4QHMB 3D8MA 2WQWA 2DDQL 3BSGA 4B9ZA 4ZFOA 4W4OA 4LSPH 1USZA 2DI7A 3QXDB 3QJOA 3KPRE 4I77L 2PCYA 5I19L 5ISZA 3GS4A 1FRGH 1KN4L 5DRNA 1FGNH 2Z6FA 4AGPA 4A67A 32C2B 3L3KB 1AHWA 4FXGC 4NSKB 3A3YB 1H9VA 4P2AA 1WEJH 1MELA 2VJ8A 3WKNA 3FUNA 2ZG2A 1GYCA 5AUMB 4X4YA 4MMZB 1YNLL 4HX1B 1BX2A 2L0DA 5AL0A 3SPVB 3U0TA 1D9KA 4PGDA 4HG4K 2R1YB 2EDDA 3UZEC 1BFOA 1BQRA 1NGXB 1DBAL 4QR7A 4RRPM 4QF1B 4ZOEA 4FNTA 2R0KH 4H26A 4QXGH 3FQUB 1U8PA 3MRHB 4FFVD 2EVGA 1A1NA 1BWMA 5JHDE 1BGXH 2C26A 3QH3B 3FT4A 5DQJB 1CD1B 2HP4A 1IKFH 1AE6L 3S36X 3T65B 3L5JA 1LXMA 1N59A 1LK3H 2ATKA 1KB5L 4LXFA 5E95B 4R0LB 2YUXA 1KCVH 2OJ1A 2OMYA 3FTUA 3WD5L 1KJMA 1WUZA 3VI3F 4JLRB 3ULUH 2ZIDA 3RG1C 4PJCE 1A9VA 1ZLEA 2AVGA 2BJML 3CFEB 4GRWF 4RWYL 1SN0A 4KVNL 1LEGB 3RYMA 3P4NA 4ODTH 1A5FL 3HI5L 3KCPB 5JO5A 1XX9C 2O5YL 1D7BA 2DB8A 3D33A 3CFBA 4FD0A 3WO4B 3ETSA 4HWEH 4N1CA 1DBKH 2WWOA 1AOHA 4NIYE 3KLHC 2YEQA 3GJFH 2BY0A 2APBA 4OCXL 3BZDA 1WPCA 3ZHFA 1ZA6A 2LU4A 3HE6B 4HQQH 5DJ8A 5IHHA 3C2SA 4PGBB 5CSZB 1ROCA 1R3KB 3QORA 3LQAH 2GFBB 1NCCL 1NCJA 1CFNB 2K3HA 2XTJC 4C54A 4GXVH 3VD0A 2MCG1 3X3FL 4NIKB 4UIMB 3ILQD 4ZS6C 2NDGA 1HE7A 2X4UA 1KWGA 4FQXC 3OPUA 1DSWA 1RI8A 5DI8B 1ZDSA 5GHWL 2N3JA 3EYQD 4KAQH 4QJ5B 5L6YL 3HRZA 4YQXH 1YLBB 3OKKB 3OLIA 3KWWA 3E6HA 1UOLA 2OZ4L 5AG9A 4DK5A 3VI3A 2AXGA 1JGDA 5IB5B 4X4XA 5DD5L 1YDPA 4XNYL 4PJDE 4PIBA 1WBXA 3BDBA 4UILH 1KBGH 3FO0H 2PKDA 4J3WA 3VSTA 3N6YA 2HVKA 1LEIB 4XBEL 4FA8A 1F90L 2AJVH 4KTDL 3S5YA 4L3EB 2WANA 2ZWLT 4EI5A 3LKNA 3W37A 3WNOA 4O4YH 4PRIA 3KPMA 2O61A 4YL4A 1LWHA 3RWIA 4L5FL 3U4KA 4A1RA 2AJXL 1XCTB 4Z78B 3QUYD 3WS3B 3P9LA 1U2CA 3NIGB 4XXWC 1I3GH 4WV1A 3T0AA 4NN7C 2I9TA 4QHLA 5JDJA 1ET5A 1S7VB 2YEZB 5CWSB 2HWZL 3CZEA 3PP3K 1ZLUK 1GGIL 3BAWA 2F7RA 4H8WL 4AG4H 3DBXA 3WG7B 3KH4A 2FBJL 3S35H 4S1SL 4TUKH 4QGYA 2BRRL 3WIIH 1NEPA 3MUY1 4LSVH 4QHKJ 4EN2A 1RUKH 3OR6A 3CDYA 3NP3A 2IMNA 2Z3FA 2NCEA 3RFZA 3L45A 5PAZA 2F7PA 2FJGB 1L6XA 3L9YA 4NJAH 6FABH 4UQIM 4W9LC 3MYZA 4WY7H 1G6RH 3HTLX 1A6VH 3NCYP 5D7LA 4F15B 3FHEA 4W1TA 1OE1A 1SBSL 1JZIA 3M1BB 3ZUCA 3Q2LA 4GRMB 2OSLA 5ISZD 2JIXA 4X42A 3OR7A 2X2JA 1GL4B 4B9JA 4IKNA 3F65A 3C12A 3V0FA 1BDYA 4JG5A 1UACH 2Q0ZX 3W39B 4G8EB 1JK9A 1UXWA 1Q1JH 2W94A 4I3RL 4JW3A 1D9KD 3PNWA 4ZS7H 1PCSA 3O81A 3HLAB 2EIEA 2WKLA 3FQRB 1T5XA 2PTUA 1FYTB 3AG2B 1AVAA 5D2LB 2HYMA 1G9MH 4JQVA 5T5FL 3VXTA 1V5JA 2KZBA 1FBIL 3QJFB 2AJYH 2WMPB 3A4AA 3V4PA 1T6WA 1XIWB 5FW8A 1D5RA 4ENED 2VN4A 5E4OA 2EO1A 1DSYA 4JPIB 2R23B 3N40F 4G6MH 5FA4A 3SCMB 3UAJC 4DPRA 4Z1PA 3TZVB 1G5AA 1U8HB 5E1HB 3MRFA 2X2YA 3U6XA 4XPAH 3ROOB 4WTWA 1N4XH 2X41A 3IVKB 1OGTB 4L2YA 1Q0EA 3AACA 4YWGH 1M1XB 2HTKC 1WE5A 4I48A 3AMKA 3QYNA 5T1KB 4HDIA 3WLBA 3CVCA 2OYMA 2JF1A 5EF1A 1J7VR 4NFBA 2J72A 1QFWH 3F62A 4K71C 3FKUS 5E5UB 2XNAA 5GXBB 3RTQA 5PCYA 3OKMA 3N50A 1Q90A 5D72H 3VFWA 4X80H 1KTJA 4GBXC 4D9RD 2GJZB 2X9ZA 1J48A 4KKLD 1EXHA 2JJSA 4ZUSB 2IIJA 2KZWA 4PLKD 2AGJH 2WSKA 1A6ZA 3BUQA 1KFGA 3QORD 5FGSA 2D9QB 1BZQK 1A7NL 2JQAA 4OIAA 1FLTX 3PJSB 3U9PL 4B9IA 2QDVA 3VX0A 1AMYA 1EDQA 5CU5A 5BV7B 5HHXH 4YIQA 3LNFA 4JPVL 4WJ5B 1MJUL 4OM1H 4YAQB 3VXMB 4G6AD 3SGEH 2X42A 2ZCZA 3GSNB 1AYRA 1JK8B 2GW5A 3QPXL 3LMJL 4I1RA 4O51A 4NKDB 1PJWA 1XZ0A 1SJMA 4XR8C 4WO4C 3LKPA 4X7SL 5AW7B 5TDPA 3TBYB 2LOEA 3N42F 3NUKA 4N28A 4R7LA 3ASWA 3Q01A 2VAAA 1G7JB 4PSPA 5ECJE 3I9PA 4WWID 3L9RA 4IYKA 2XI9A 5KSUA 2UY6A 4F9LC 1KCSL 3KPRA 2RHEA 2HKFL 2P5WB 4F9PA 3KGTA 1CFSA 2CHZA 2XWRA 4EI5D 2YPVA 1QEWB 3QNFA 4PRID 5CGYD 4AX3A 1JVKA 1P4IL 1IGCH 5GRJL 5KTEL 4PJIE 2BP0A 1INEL 2UZIL 3OQRA 5CBAA 4Z0BH 2CLRA 2WAHA 4Y1TA 3QJVB 4AYGA 1TU2A 4F5CE 2B77A 2OMXB 2P8PB 5F7DB 5LNEA 4G2AA 4DP5X 1K4CB 3KVDD 1GC1C 1EVTC 4HWZB 1U41A 2X1OA 4N25A 2AQTA 4X99B 5SWSA 3FZUD 1RZFH 1AXSA 4AQEB 1BJ8A 3B9VA 5EOQH 4ODVH 4UINL 2WSDA 3B37A 4JFFE 3L7FA 2WD0A 4G43B 2D3JA 2ZKMX 1NICA 2EEDA 3C6LA 4GT7A 1SUHA 1T1XB 3UZVA 1AYOA 3ZKXC 1TNMA 1KCUH 1TYJA 2BS8A 3HJEA 4PJDF 1HILA 2EADA 2WSPA 4PM1A 2EYRA 2DDQH 2MTAA 5D7LD 5E4AA 2CGRL 4BK5C 1PIGA 2F8OA 3T6ZA 3HPJB 4M93C 1KN4H 1J8HA 3TTYA 4Y2DC 4WTZA 2JIXD 2YZ1A 1SRDA 2OCFD 3ABGA 3CH8A 3A22A 1XXDC 4L9LB 5I1JH 4NRXA 2WUBL 5HJBA 3GSQA 2XBTA 3N1MC 3GS7A 1Z5YD 4ZAKC 2JJWA 3GSXA 4PGEB 3B9DA 5IWLA 2HUEA 4BKLA 3FONA 5IOPB 2OTWA 3BFWA 2WZ6A 3CXFA 3H1ZA 1R17A 1DBAH 4PD4K 4LRIA 4MCZB 2PYEE 2P5EB 4ES8A 1NEUA 3DSNA 1EWHA 1INQA 4HXBL 4PJ9A 3C87A 2Q7YB 2DQUL 1B3JA 4GSDL 2YAMA 1JHLL 1AE6H 3EYVB 4JCWA 2E27L 3G5VB 3QUKA 2WJ5A 1JF1A 4N2AA 1HHJB 3QEQB 4PJ8C 1KB5H 3I6SA 5DUBA 3U2SB 3K7UA 1WGVA 3WJJC 3DHPA 2LTQC 4PJDA 3WD5H 4UB0L 1XBDA 1TEFA 5AAMA 3G04B 3ML9A 3AM8A 5I17B 1N0LB 2BJMH 3T1FA 4RWYH 5JOFA 1L9NA 4X9HA 4KVNH 1C16A 3D48R 1HXYB 2V5SA 2TRHA 3F12B 1FH5L 4W9JC 3WU1A 3ULVC 2GTWA 1A5FH 3HI5H 4DETA 2O5YH 2VB5A 5HTSA 3BGFC 2YQBA 2ZZUT 3RTQD 1XH3A 3FCSA 2PP7A 5F7KC 1VJSA 2H8PA 4Z7NE 2B8OT 1NFDB 4OF7A 4R4FL 3AREB 1AZVA 1PDKB 1YSOA 3U6RA 2IFGA 1U42A 1J9RA 3O6FA 1NCCH 2CR6A 5D1QC 3EXLA 1NCBL 2ADFL 3X3FH 3ZRFC 5JW5B 3G9AB 5JHBA 2V2XB 5ANME 2XQYK 3P0VL 3F83A 2HTLC 1OE2A 5GHWH 2QGEA 2K6YA 4JO1L 2QVTA 4JZJB 4POUB 5L6YH 4DEPB 5DEFA 2VW7A 4FLHA 4PR5B 3TVMA 1MW0A 2QQNL 2OZ4H 3VX1A 2H6PB 4BD4A 1KNOA 4OT1L 1KIRA 5DD5H 3NIDB 3OGCB 5DR5H 4AJVA 4XNYH 3LNGA 1TZHA 3O0LA 3U9WA 1G0YR 3AQZA 4JM2B 4QXTA 3CVBA 4OY9A 3UTTE 3ECQA 4UQBA 4XBEH 3MRCA 1F90H 1J05B 4KTDH 5EF0A 2NXYB 3KPRD 2WIMA 2JI3A 2OTUA 3BVDB 4G80B 4WUKL 2NMSA 4L5FH 1I85C 5F88B 2EKSB 3ULSA 4OZFH 4OZGB 4QTIL 5CCKL 1B6UA 1UVQB 1C5DA 1NWOA 2EXWD 1NDMA 3NIFE 2L7UA 4NHCL 5IB3B 5DZOA 3EXJA 4KU1A 4KH9A 4JFHD 4GQQA 1OT2A 2HWZH 3BWUC 3PXLA 5CCHE 4H8WH 2FBJH 4V1DE 5FF6A 3UPRB 1FFRA 5J11B 5LQBL 4E5XG 2V9RA 1AHKA 5BQ7A 2FEEI 3HE7A 2FTAA 4AUYA 5HDWA 5HYSB 2JTDA 1W8NA 1Z9MA 3MI6A 4C4KO 2SEBB 5A3ID 5KBNC 2FLBT 1ZLVH 3GHEL 1HL9A 5EN3A 2ZUQC 3QZMA 1OAUL 2X70B 2IJ0C 2BY3A 3C6SB 2JLLA 1BVKB 3D0LB 5C0EA 4JGUA 1MWOA 1P4LB 4HS3A 2F54E 1I8KB 1E90A 2VAJA 2OQJB 2XX0A 2X1QA 3QQDA 3EUDA 4KRPB 4LLYB 3MUJA 1SBSH 3SE6A 3EFDL 3KYOA 1BQUA 3WO4C 2NUPB 4XNAA 4R4BA 1MW1A 4OLZL 2J4WH 4G6FD 4MZIA 4QTHA 2GK2A 3BUIA 4K55A 5CLXA 1J8HD 1EZLA 3HFFA 5HYQB 4ILDA 1OD7A 4PW4A 3UBXA 1JV2A 1O5PA 2H2SD 3MUGB 3BRFA 3VACA 1AFVL 1QMUA 1SMDA 1A3RL 1DLFL 2VW4A 5K5YA 4G8GE 1M05B 4KOCA 4KJYA 3V10A 4JDTH 1ZVYA 1U8CB 4I3RH 3CUPA 3PXHA 4A2DA 1ADQL 4MD4A 4YX2H 3THML 3VU1A 5J1SC 3MQIA 5BCAA 4LBEA 3CPUA 3UACA 5LVEA 3AC0A 5T5FH 4PJ9D 1FBIH 3QC6X 3QXUA 4WWKA 5KVEE 4WEBL 3ATFA 1EBPA 2ESVE 2VDRB 4ZFZB 4OR1A 3DHJA 3WN5B 1WD8A 2PW2B 4BFEA 5D4IA 4YOKA 4A7GA 2XJLA 4KZEL 1T2XA 3QFJB 3RP1A 3BP7A 5IF0A 4MCNA 3PL6B 1QFWI 2MRYA 1ACYH 2EIBA 3ARFC 4XC1L 3IU3B 1AIFA 3ZE1E 2FWOB 3KYKL 4CSTA 1HEZA 4N68A 5IBLC 2B16A 2G5UA 5KSAC 3EYUL 5JLZA 4Z9KB 2IWFA 3P69A 4D0CA 1MXGA 5K9KB 5KG9B 4E9LA 1SXBA 5BS0E 4TSBH 2OXHB 4MB1A 3UTPD 3LS5L 1ASPA 1T21A 3OKNA 4KNUA 4DKFH 2EH7L 3HZMA 4JDVA 1NAMA 4JY4B 1DVFA 2UZYB 3P3UA 3V9EA 3O6FD 3WLWD 4LVEA 1A7NH 1JNNL 3TPUA 4EQ3A 5DK2A 3MCLH 4UM9B 1RD6A 3Q05A 3NJXA 5ID0B 2BHUA 1UD5A 4GKNB 5HGGS 4YXLL 4JPVH 1MJUH 4Y7MA 5HHMB 1I1AB 3TVMD 2ZOOA 3QPXH 3LMJH 4FTVE 5I8EB 3EKCA 4JRXE 2OSYA 2K8MA 1GJWA 3K4ZA 4D3CL 4NQTA 1K8IA 4X7SH 3R1GL 2Y7LA 2YC1B 4U31A 3RIFK 3ZDZF 3HPLB 1KF9B 1XF2B 3NA9L 4GLRH 4L9DA 4KQ3L 3KYMA 1S9YB 2GBAA 1YJDC 1KCSH 3S3JA 1JPTL 4HK3N 1BBJA 2HKFH 1CF8L 3H0TB 2EE6A 2NXZC 4U0QB 1OSZB 1SGKA 3O9WC 5C7ZA 4YHYB 3CSYB 4NO0A 1F86A 3GMNA 4AEIL 2ITEA 3KLKA 4FN0A 1P4IH 2QZQA 5EU6E 3E38A 3BUTA 5GRJH 1HSBA 3JV6A 4ES9A 5KTEH 4FGMA 1ANUA 3BEWA 1INEH 3C60B 2UZIH 4JFOB 5JIKA 2CLZA 5H37G 4Z7NF 1JCKA 5HD8D 3HFML 3C09C 3SQBB 3VSQA 1Q38A 3FK3A 5IMKA 3AADB 3QEHB 2XN9B 4KKBC 2PYEA 2WQXA 3RIFF 4UMGA 3UMTA 4JM4L 2DH3A 1EFXA 2LR4A 5CZXD 5F7NC 2DYSB 4KKNA 4MBOA 3WJMB 2QPSA 3PWNB 1NPNA 2IPKA 4NO3B 5C71A 5EEWA 3HE7D 4TTGA 2CK2A 4UINH 2KLTA 2UY7A 1VZIA 1HWGB 4EMZA 4ZJ9A 3RRQA 2ZX9A 3NJNA 4FMFA 4LDEB 4YPJA 4DGIL 2A9BA 5ACZB 2RR3A 4PV8B 2EEAA 4NKOB 1JZ4A 4KRLB 1CDYA 3Q9PA 1E9OB 3O4OB 1HI6B 1YN6B 3TLRA 1XGRA 2CGRH 2F53A 3WDJA 4AE0A 5IMOA 4P2YA 4ZMOA 1BJ1H 1OEZW 1MN4A 3SGKC 2X4RB 1CF1A 3UTSE 2WO4A 1A2YA 1AC6A 5AENA 3GMPA 2ZNXA 2W0FB 2QR0A 3LZNA 1P7QB 3ETTA 3N43B 2GT9B 1RJZA 1PTZA 1F45A 1U4EA 2WUBH 4OZFA 2L8AA 2W60A 4Y19B 4OJCA 2EDMA 2NY3B 5AW5B 2JJTC 1TO4A 1WHPA 4P2QB 2N0KA 3NIFF 1YEKL 4MD5A 5BV7C 3BZFA 5IQOA 2EDNA 3LEXA 4KNSA 3ESPA 3AAZB 1MFEL 2R83A 2W5PA 4XHJC 3P0GB 3ROLB 4HXBH 3RJOA 4Y5YB 4N6QA 2AJZA 2X05A 2ATPB 3ZRSA 3U25A 4TSCL 2F68X 4LSUL 1QSFA 2DQUH 1SUJA 3LKRA 4GSDH 3FB5B 4WWKD 2JLPA 4KMLB 5L2JB 1JHLH 1ZHKA 3MLXL 4NQCA 1JYNA 2E27H 2ZXWB 5MENB 1AS8A 3D2UB 5KVGL 5D7JB 3LJ3A 2WQRA 1Y1UA 2RAMA 1W0VB 3KPSE 5JTWA 4UB0H 4DGYH 1U9KA 2MSPA 2K9UA 3KXFB 4IBSA 4PH8A 3DV6A 5BVJB 3LPWA 3TJHC 1OCWH 1Z9OA 1FH5H 5LXGL 4TV3A 1BWWA 3PV6A 5A6LA 2OI9B 5AALA 3A6BL 3RB5A 3WAJA 5ENWA 2DICA 4B97A 3KPNA 4N5EC 3ARBB 2QADC 4Z76A 4J4PA 4EI0A 1ZJAA 4KK8C 3RWFA 4MNQB 2FHFA 4B27A 4MMYB 4EXPX 4R4FH 4ZSOE 3OPZL 1IJ9A 1NCUA 2ENPA 3IAQA 4QHNB 3S88L 3T77A 2EIZA 4W9EC 3M7FB 4HS6A 4LKXA 2XETA 1P5UC 1NCBH 1A0QL 5FGCB 1DVFD 3MV01 1GGCL 3PAZA 4V1DA 4GQRA 1GYUA 1HTYA 2ADFH 3INUL 1MREL 4PLNC 4O2CA 3UBFA 4MJJA 5DEJA 1PU0A 4GMTL 4JO1H 4BK8A 4JRFA 3FTWA 5E7FA 4TTDC 2OULB 3D69B 5DUML 2VQ1B 3DLQR 3VGAC 4JFFD 4MASA 3U9UB 1YPZE 2QQNH 2AXFA 5IKCA 4X6CE 4OT1H 1ACCA 2NTFB 4UQ2B 4YEEA 4J3UA 2E3VA 1MHPL 4RIRB 2F54A 4KUCF 5IQ7L 3ZE2B 1AS7A 1FE8L 3FFCE 2BVEA 3V0AC 2BMKB 3CDZA 4R2GD 5AYQA 1NBZB 4MDJB 3BYTA 4L9LC 3ZE1F 3FT3A 1FL5B 5JPNB 3Q3GB 4WUKH 3MBXL 4NUQA 5HHPB 1YN7B 4MA7H 4NO0D 4P49A 1AANA 4P5SA 5CCKH 4PIRF 3BAKA 3E3QE 5FLUA 1RIUL 4ZDHB 4AY0A 4YLCA 5I30L 3ZKSD 4U7KA 4W9IC 5TFSL 4G8GA 2QV4A 2YBRA 2HG5A 3K91A 5CP7B 3UO8B 5ABZA 2FQDA 1WK0A 1H6TA 1A4KB 1T5WB 2NZ1A 4HKXA 4PJXE 1Z0MA 4GJTB 5INCA 2IMMA 1BP3B 1NAKL 2PYED 4PW9A 5LQBH 4IU2A 3RIAK 1IQDA 1EFXD 3U2JA 1HT6A 2A74A 2ESVA 4U1KA 5CN3A 4K7PX 4FJZA 5KANI 2H1PL 2DF3A 2XVLA 2VQTA 2X6AA 1EZUA 3GHEH 4EVNB 2OSWA 2IGFL 2PXYD 3BSHA 2VLJE 1AKPA 1WWAX 5HVGB 1OAUH 4UUJB 3EHBC 1KTLA 3EO1A 1G1CA 4U1LA 4TLUA 1MCWM 1MI5A 3EDEA 1UH2A 3Q6GL 4M9OA 3HAEB 4NYLB 4KI5C 2GIXA 2KQNA 4NDMA 3CZUB 3RB7A 2DLHA 5KN5B 1UZ8B 2F53D 2E0PA 1M7XA 1DJZA 4TRPL 1EO5A 1NCWH 1ZS2A 1TZGL 3SQRA 1HCVA 2A6DB 4JY6B 5IBUG 2I7SA 4XX1G 1PLGL 1HL8A 3CH1A 4AW4A 1AGBB 4QXWA 1JUFB 3AREC 4OD2B 5IFAL 4LP4A 1AFVH 1LO2L 2AQ2A 1A3RH 1DLFH 3QIUB 4CUCA 4G8IA 5KW9L 1V3MA 2V5TA 3ETBF 3UZQB 5GSVB 4RMQA 4JBSA 4E36A 4CDGC 2EYTB 5MEQB 2PO6A 1MCPH 3THMH 4MNHB 3G5XB 4DEPC 3IDYC 3KPQB 4FFWC 2B7DT 2V2TA 3HZYB 2PPDA 1URLA 3LIZA 4WEBH 5GS0D 1QSFD 15C8L 3GM0A 1QKZL 1IILE 2YGQA 4TUJB 4FTVA 4X5RA 1ODUA 3BW9A 4JRXA 1IBDA 2G5BB 1MUJA 1FN4A 5I71C 5B1AB 4KZEH 1DO5A 4BFJA 3FRPB 5B1CA 3MLYL 5DHXB 5BUPA 1F11A 4HZ1A 1BQHG 1QWUA 4XC1H 4ZFQA 4ZTPL 3CFQA 4TNWK 3KYKH 1BF8A 3QIBC 5IB1B 1REIA 4Z7VE 3EYUH 3IXAB 3FULA 4X7EC 4PG9A 3QULA 4DPAX 4NKQB 3OAZH 1JPEA 5D1ZB 4P57A 2FHBA 2YD3A 5BRPA 3WY2A 2BY1A 3OHXC 4RRPA 5E0FA 1OT1A 4J4PD 4YR6B 1XGZA 3VDCA 1KGIA 3S2AA 3LS5H 1D5IL 1NPJA 1OTSD 3ZL2A 5DA4A 2EH7H 5J11C 5F7HA 1UWGH 2N59A 4YNYA 1DTUA 1FP5A 1IRAY 4GMSL 4KOBA 4E41B 4P04A 1I7ZB 4JHUA 1JNNH 4V1DD 5LNGA 2XN0A 1A6AB 1CFVH 3GRGA 3ZYJA 3ZO0A 3B7YA 4ICWA 4U3XA 1T7XA 4L8SB 4TNWF 4YXLH 1HK6A 4MQ7B 4OD3L 1S9VA 4MGXA 4PS4L 1QFOA 5I76A 2HFEB 1TTGA 4N2EA 3A4EA 4GLRI 1AQHA 5JORB 4IRSB 2TAAA 2XVGA 4XMUA 1BM3L 4HZLA 4D3CH 1EANA 2V37A 5DA0B 1HCYA 3FTYA 5EOTB 3CZLA 2H3NB 2C9VA 2YA1A 3K6SB 2YUZA 3NA9H 4O2FA 1DQJA 2BCMA 2F54D 4KQ3H 2NW3A 4J23A 4XXCA 3RX5A 1QUPA 2HT2D 1BYOA 1XGUA 2H26B 1XGTB 3QK0A 3VGGA 1JPTH 5FWRA 3MREA 5D5ME 1CF8H 1S7WB 3VWJC 5D2NC 4NQEE 4AEIH 5DDHA 3ZT6A 4QRTA 1SDYA 2ZSWA 5A40E 4IW4C 3JZYA 2JKIS 3LHPL 3VG9C 5IJVA 4PG2C 3L9BA 1BFTA 3MLZL 5FDWB 1JD9A 2IWKA 4G8GD 3HFMH 4M5ZL 2V4LA 3EGXA 2WBJA 3PWVB 2G3XA 1QLFA 2QEJA 3CZSA 4KO5A 4EUPG 2VL5A 1KXQE 1GPOL 1UH3A 4UI2A 4JM4H 1KJ2L 4Y2LA 2D4FA 2GJPA 4WO0A 2EDFA 2A4EA 5F44A 2X4OB 1JZFA 3KGSA 2I60L 2ESVD 3O3BA 2GTQA 3QGVA 4BA8A 3KM1A 4P3DA 3F05A 1XR9A 4PJGE 5HHQB 3P9WB 3PL6C 5ITFA 5K59F 1YPZF 1P7HL 3ASOB 2PABA 1FFQA 4X6CF 1LYQA 1MHCA 2ZOKB 4YPGB 4KUCD 4DGIH 4TNEA 1MI5D 5IFHH 3V2AR 3F8UB 1XD0A 4KRMB 3V4LA 1N3NB 1JWUB 4LSDA 4FNQA 4OGZA 2JCWA 1AGEB 5K93A 3V5DA 1Z5HA 2CLVA 2M83A 4PWFA 5KBDA 3JT0A 1PKQE 3ULAB 3VXNA 5DUPH 4JPSA 4OFKA 3MRDA 2QLVB 5DD1L 4W6WB 5E8PA 5L2KB 1Y6KR 4LQ1A 2GUYA 3ZDXB 4RAUA 5BS0D 2EUXA 3CSBA 4ZSOA 4N2HA 1N5AA 4XRCA 5D93C 2XWZA 5B1JC 5C6WH 3L3OA 5ERWA 1YEKH 4ADGA 4UT9L 1WAPA 2GITB 4HJ0C 4XPGL 1DE4A 2E6QA 4E9XA 4JFQB 4R3SB 2PO6D 3ZGIA 1MFEH 4AMKL 4PJXF 4W81A 3SE9L 2QQLL 4WU7B 2F18A 4P2RA 1IX2A 1JNHA 2JK5A 2XWTA 5J13B 4TSCH 4LSUH 4F7CB 3ZVVA 3T9WA 4PVBA 1YECL 1AGDA 2WIIA 3LQZB 4ONFL 3EYSL 4OZ4A 4JKLA 2HFFA 3MLXH 3AITA 1YPZA 3OAZK 5G5DA 4MJHA 1DZ0A 3C5SB 4FTVD 5D96B 1AOZA 3SO5A 4GI9A 4ZFFA 1QUNA 4JRXD 2G9HA 4PP1D 2BZDA 2IH3A 4FMVA 1I8AA 1TF4A 2O6CA 1IUZA 2NLJA 7PAZA 4J3OF 4LPVA 3PWJA 3LKOA 4Y5XA 1ERNA 3FFCA 1ZV2A 1BXUA 2KS0A 5CGMA 1T2QH 4Y8DC 2AEPL 3BH9A 5BZZA 2F74B 3RVXD 4BH7A 4BA0A 1KBWA 5LXGH 4LHJB 3VUAA 4BWUA 2P8LB 5F96L 3S37L 3SE3C 4D9LL 4DTGL 5LXVA 3A6BH 2BOCB 5FA3A 2NUTB 1CB4A 2OMTA 3KL5A 3QUYB 4F93B 4FHKA 1BAGA 1AGFA 1DJGA 2E9BA 5B8CC 4Y2OA 2Q5BA 3V5HB 2DIBA 3QA3B 1E0OB 4UQ3A 1OP4A 1U92A 1YUHA 2J7LA 3IDMB 5IK3B 4DERA 5J06A 3OPZH 3G6DL 3PHQB 3V55A 3S88H 3OQ3B 4CVZB 3D4CA 5J57B 1UM5L 4PJ6A 1A0QH 3ZU8A 2ZG3A 2LU5A 4XN8A 1A4BA 1ADQA 1WA1X 1MREH 1QFUL 3INUH 1BZ7B 2IQ9L 1QZNA 1P5VB 5DHVB 4CMMA 1S8DB 5C0ND 3K3QA 1ID5I 2ZXEB 2ZE0A 3OJ2C 5LN4A 5BXFB 5B7FA 5KANG 1YNKL 4GMTH 4X7FC 4U1GB 4AKPA 1DZBA 1TQVA 2FH8A 2QVIA 4BQCA 1TETL 5DUMH 2MCPL 3BIKA 2XLLA 3V79C 2VLJA 2VXTH 2NNAA 4YSQA 2BIOA 4R9HA 2CK0L 3Q0HA 4NC2B 5A2KH 1TCMA 2NZ9D 5TH2B 1L6ZA 4PWGA 3EJYC 1MHPH 4OB5L 2E8YA 2CWRA 5IQ7H 1E4KA 1FE8H 2FATL 1XSKA 1T5KA 5DEGB 3QQ9C 4XO3A 5F7WC 4JGNA 4HJIA 4M6OL 5E1GA 5ISZB 5IJBC 5M94B 5DRNB 1KEML 3MBXH 4Z7VF 3W5NA 2MEJB 3V6ZA 4XVUD 4B60A 1RIUH 5I30H 2EIJB 5TFSH 2I85A 3VQMA 1GC1L 4X4YB 4KITB 1TSRA 3G7TA 3MJ8A 1BX2B 3RHWF 1BA9A 3TCLA 2CO2A 3U0TB 4ANVA 1IBGL 1D9KB 2WBJD 4PGDB 4XT1C 4XWOD 4JM0A 5JHLL 1V3LA 5IJDC 3MV9E 4OIBA 5ESAA 4K5NA 4U33A 3VM7A 1JGVL 1JJUA 3F7VA 4H26B 5K1NA 3DOSA 3SO3C 2J1WA 4FNLL 1U8PB 4HJGA 1A1NB 1BOYA 3OXSA 3UTQA 4IHOA 4EE2A 3FT4B 4FQHA 1CDJA 2H1PH 3BAXA 3IDNA 1O9VA 1WA2X 4MRBA 3U2IA 1GOFA 3SDDA 1ZHNA 1N59B 1H3UA 2ATKB 2CKBL 2IGFH 5TQ0L 2OMYB 5LCVA 3LNDA 3U83A 1PZUB 2YKKA 3N5AA 1GAFL 1KJMB 3Q6GH 3PFUA 4F8QA 4XMXA 4DUVA 3BUBA 1EDYA 1JZ2A 1ZHLA 3P4NB 5D5MF 1U93A 3R7RA 1TZGH 4XNMA 5FM4A 4NT6A 1PLGH 1JHTA 4TL5A 3L6FA 4Y9GA 3CFBB 3EH2A 3B7SA 4N4YB 5IFAH 4P07A 1PY0A 5AW0B 1LO2H 4JRLA 1KGCE 5KW9H 4N2MA 3ARDC 3MRBA 5IJKC 1CIUA 1UEYA 2R8SH 4XB8A 5DJ8B 1M9WA 1ZT4A 5A6MA 2BIHA 3KZ8A 4QRSB 3QORB 3Q2VA 4LMQI 5C1MB 1NMBL 5G4NA 1WWWX 1CXEA 2IBGA 1YMHA 5I6XC 4NUJA 1CGSL 2X4UB 5FV1L 4ACPA 1CFQB 1BXVA 4HP5A 3LRLA 1EZSA 4P2RD 3T8XA 1JWMA 1QKZH 2C3VA 1I3VA 3HRZB 3W56A 2R0LL 4WIQA 4CVWA 3KWWB 3E6HB 3LEVH 5D1XA 5E7BA 1JHKL 3VI3B 4PJGF 2AXGB 1JGDB 1WBYA 4X4XB 2HLEB 4MJ2A 1EERB 3ULVL 1YDPB 1Q4NX 3MLYH 4GRWB 1WBXB 4ZD3L 3FFCD 2VMCA 2HRHA 3T5WA 2HVKB 3OLGA 4ZTPH 3QCVL 3LKNB 5K9QI 2PWGA 3DK2A 4PRIB 4KJQC 3KPMB 3VFPA 1MCCA 1P6WA 1EGJH 4HKJA 4HLZG 3QRLA 3RWIB 1RULH 1XCQA 2O61B 4WHDA 3WO3B 1QHOA 4KGJA 4L1HA 1YY9C 2EP6A 2CDEB 1T83C 4K5PA 3RUGA 4GH7B 1D5IH 5E9NA 4WV1B 2Q3AA 5AVTB 3S3PA 4QHLB 1RJCA 1MJ8L 4IIZA 1KXQA 2VDLL 3QAQA 4LKCA 3AXHA 4GMSH 4YBQC 4OQTH 3FXIC 4GQ9L 4NC0B 4FXLA 4NQXA 4FULA 3UMNA 3DMMC 3KW8A 3RWGA 5I6PA 1A6UL 3DBXB 3MZGB 4U6VL 1QSVA 3BPOC 2GAZA 1X5GA 3H7BB 1BW8A 4U6HB 2MMXA 1NUGA 3WJLA 3ZZSA 1XGYL 4Y4FA 3OR6B 4OGYL 2MFNA 2DIAA 2WCPA 4PJGA 1RPQA 3NK4A 1N8OE 1JF6A 3RFZB 4YMPA 2WCSA 4DT2A 1FYHB 2WLYA 2YMXL 1BM3H 2VLJD 2WINA 4J3OD 2I32A 3MJWA 2YUVA 2PCPA 2IAMA 3WIAA 4Z6AT 2BVQA 3GLDA 4MKTA 1JGUH 5D7LB 4IGBA 3HG5A 3F7RA 3QE5A 4BJLA 4XZ4A 1HOEA 2HSIA 2VDPB 4QEGA 1SVBA 1T6BX 3VG0H 2OSLB 4K9JA 3FO9A 2JIXB 3FCUB 3OR7B 4HGKC 3LHPH 5E6SB 4QRUA 5J6HA 4QYAA 1JZ5A 5FAAA 2ZSVA 3II2A 4PYGA 2WXGA 2E6JA 4M5ZH 2CGZA 3ECBB 5E2JA 4LCCC 4JE0A 4M6ML 3L54A 2JKLA 3DHMA 1GPOH 1D5BB 1DP0A 1VSCA 2W1NA 4LLUA 3FHAA 1KJ2H 4HWNA 1NC2A 3SGJA 5I5IA 3RWEA 1T5XB 4MQSB 2ICEC 3E1F1 3L4CA 5HGHA 3VXTB 1ASOA 5EU5A 1P9MA 1S4IA 5CEZE 4KY2A 3QCTL 4KNTA 3V4PB 3T2NL 3QQNA 4FTDA 3AVEA 2OCCB 4W9DC 4TQHA 4N8UA 1AD9A 5D8JL 5C0AA 5FA4B 4LPXA 3SDDD 4QJ3B 3DOIA 4D2NA 1MCJA 2DPKA 4CMHB 4XI5C 4AK1A 4LFHG 2OJZL 3MRFB 1KV3A 4P9HC 2FWSA 2AXHA 2NTSP 5DZJA 3E9TA 4I48B 1Q9OA 5L0QB 2E86A 2WLZA 1NOFA 3EYFA 3FQXA 4HDIB 3VMOA 2UUDH 5DJAB 2P49B 3WLBB 3WNPA 4IBYA 4Z7QE 2XNAB 5DD1H 3RTQB 3OKMB 2Z91A 4XX1E 4EIZC 3VFWB 1M4KA 3PGFH 1H3PL 3FT1A 1MRDL 1WISA 2XWEA 5JR1L 2NX5A 3DRTA 1DFBL 4UT9H 1A6ZB 1GGYA 1T1WA 1DO6A 5LGJA 4AMKH 2OCJA 3SE9H 1FCCA 2X3AA 1K5WA 1UFGA 5I0VA 3TOPA 3ARGA 1IGIH 2N56A 4ZNCD 4YIQB 1YECH 4HUUA 3R06A 2ADGA 3VXQB 1T0PB 1YZZA 2H0JA 3EYSH 4HSAC 4IOFD 4ONFH 1JYVA 1IC7L 2YLKA 1A6WL 5EBGA 4BRJA 4PS7A 5EU4A 4O51B 2VRKA 3PWPE 1CL7L 1XZ0B 4QO1A 5D1XD 4B96A 2G9KA 3LKPB 2ZXQA 4R26L 1ONQA 3H56A 2XN1A 3QP3A 1TIUA 2DEWX 1S2EA 2VAAB 4HMCA 3TJEL 2F8XC 3L9RB 1UYWL 2UY6B 2AEPH 1MFCL 1J0YA 4UM8A 3KPRB 1U8JA 3H9YA 2NY7L 2NY6D 3A6OA 2E7LA 2IDQA 1CFSB 1WWCA 5F96H 3S37H 1DYZA 4D9LH 4NZRL 5FR3A 1I4FA 1A9EA 4NQED 2X53A 1SVZA 5IHZA 3A4DA 1RY7B 3UZEA 1FZOA 2QGDA 3NFNA 2RJMA 4AIXA 2CDGA 5CBAB 1SOKA 2CLRB 3OTTA 5H37A 2JWYA 5TE7L 1ETZA 1TU2B 2YAHA 4OKVA 3CXDL 3FOMA 1CTMA 4FFVC 2DI9A 1MOEA 1UM5H 1S5HA 3MV9A 3QDME 2DTSA 3ILPA 1QFUH 4L3CB 3VYPA 2IQ9H 4X7CC 4X6DA 4B9PA 2I7OA 1MZZA 4Z18A 3ZKND 4XPFL 1A9BA 1X5YA 5SWSB 1YNKH 4FZEL 4XNBA 1AXSB 4PP2A 3BZEA 1TETH 3I84A 2R4SL 5A2AA 4AQ1C 2MCPH 3MLVL 4Y4FD 3L7FB 1SN2A 4ANXA 4FC3E 2CK0H 4A38A 4GIAA 3C6LB 5IT2L 3UZVB 3SBQA 3QT2A 4OB5H 3QUML 1AZUA 1PFOA 1ET8A 4OCMC 1B0RA 1DVQA 2IAMD 5KVFE 1S3KL 1IC1A 5JQ6L 2FATH 2EDQA 2V6HA 1MNNA 2EYRB 1I8IA 2WK2A 3CFNA 4IGBD 3GGWA 4WNQA 4M6OH 3FN9A 4G6KL 2OKMA 4G6FB 2GC4C 1KEMH 1J8HB 4ORGA 3VFNA 4OGAC 3QJZA 2O6FA 5H2BB 3NDYE 2D7OA 4CSPA 4EN3C 2NY1B 5CS7A 4NRXB 1NFAA 3GSQB 4FP8H 1GC1H 4Y5VC 3BQUA 3Q48A 3GSXB 4HW6A 3RL2A 2X89A 4BKLB 1IBGH 2OTWB 4HIIA 4HGWB 5JHLH 4AYDC 3QZLA 5DUJA 4UBDC 5DFVC 1JGVH 2BNQB 1INQB 1NC2D 3CVDA 4PJ9B 4OFDA 3IRZA 4KTGA 1L9PA 1E2WA 1JFHA 1NSNL 5I26A 2G5RA 4OSUL 5F7EL 5L8LB 2BNUA 1NIDA 5T5NG 4ELMB 4IRJA 1P2CA 3QUKB 1JF1B 1FH2A 4NM4L 4FE9A 2CKBH 5DUBB 4ADIA 2DEXX 5TQ0H 4MZ3A 4ODHL 3T0WA 1AC0A 1QO3A 4BHUI 4PJDB 1GAFH 4AJYV 1F0LA 4XCNA 4QKTA 4ZMNA 4OD1L 2FCBA 1ZK9A 1JDAA 1TJIL 5HHNA 3OZKA 4H8QA 5K9QG 1C16B 4Y9CA 2GIMA 2R2CA 4EDWL 5GIRA 2GTWB 3WAKA 4NZDA 3DC0A 3QPQD 3DO7B 1WCQA 2VT0A 2DQCL 4I9WE 5GS1C 2CD0A 4L8BB 5K33A 5HYJA 1G5GA 1RLBA 4XTRD 5LAPA 5T3XE 1ZCRA 4IRZL 4BQBA 5BV7L 2CHXA 3FCSB 2BVPB 2AQNA 3BH8A 1RMFL 1T7WA 1XDTT 3GSNL 1E6JH 3K0YA 5MI0B 1WT5C 3U6RB 2RACA 1XF5A 5J9PA 2NX5D 1CE6A 1EHKB 3O6FB 2D7TL 1NMBH 3BD3A 4P3CL 3UABA 3I3DA 2Y2TA 2C3GA 2EINB 3QW9A 4U1GC 2IDFA 3T6XA 2VITA 3AG1B 4QHPA 3WSQH 4BQ6A 3BT2L 1U58B 1CGSH 1RP9A 4L4TE 4FABH 3ARGD 4YVNA 2NY4D 1EEYA 4ADJA 2XKSA 1TTAA 3IGUA 3B8YA 1G87A 2W81C 5DEFB 3ZTJG 4N86A 1EK3A 2R0LH 3TVMB 4PS8A 2O30A 4YE0A 3MRGA 1JHKH 1DVTA 1KNOB 4PRBA 1KIRB 3ULVH 3BP4A 1X6NA 2QDWA 3PABA 4ZZFA 2APSA 1EAPA 4WDIA 4QXTB 4AUJA 4ZD3H 4NLHA 1WLHA 5D7HA 1XHHA 3MRCB 2V5RA 4MA1B 1GJUA 2O5XL 3L95A 3QCVH 1AHWC 1JXFA 3QRFM 5F7YC 3L5WA 4WHYH 1GA2A 3T4AA 5FUOL 5C3TA 4Z7QF 1E2VA 2BIPA 3ULSB 1QFHA 2QVKA 1NGZA 1QD0A 3A47A 4QT5B 4RFEA 5I82A 9CGTA 3BD4A 4QD2E 3O4LA 1NDMB 5EO0A 3L2NA 3RWHA 3IRCA 3WIHH 2VDKL 1MJ8H 3GMMB 5GRZA 3PLYA 3OX8A 4NZJA 1BOGB 2UX6A 4GQ9H 4P48A 4UT9A 4AYID 1RAMA 3MV9D 3Q43A 4RDQG 3QUXA 1A6UH 2PN5A 2XWDA 4ENEC 5FF6B 1NUNB 4U6VH 4LRNL 2Z9TA 1AQDA 3UAJA 2X5PA 5BQ7B 3HE7B 4NZFA 4ZO6A 1XGYH 5FC9A 4L4VA 2Y7SA 4OGYH 4J8RA 4YDVA 3D09A 3P2BA 5HHOA 2YMXH 3GLAA 1FZKA 2B20A 3B9KB 2HKAA 3DVFA 1KZYA 4KKAD 2VCOA 5C0EB 4J8QA 3N1FC 2ZCLL 4HS3B 2QELA 3MBEA 3QQDB 5DVPA 4F80A 4PJ5E 3ESOA 3KYOB 3OAYH 5D7SL 1H8SA 4N3UA 4TVSa 4H0HB 2VR5A 2HLAA 2J6EA 5ELIA 4GBXA 4R4BB 3KLHD 1E27A 4FKKA 1YYCA 5DMGC 2G4EA 2ENSA 2K3TA 4PLKC 5KYWA 4WSKA 3UBXB 3S5LB 4X6BA 4CSZA 4JKPL 1KGCD 3BUDA 3ZLQC 3BIBX 3BQUD 3ZPDA 3QDAA 4KJYB 4LCIL 3TBWA 4PJBF 2X89D 4ALAC 1KPVA 4M6MH 2GY5A 3HB3D 3CUPB 4L1DA 3IJEA 3QQXA 4MD4B 3CC5A 4LPYA 4G6AC 4GP8B 3QDJE 2WWKT 1X5XA 4YHNA 2C8NA 3AWFA 1DCEA 1CXIA 3IPFA 1BQ5A 4WWKB 3QCTH 1CUOA 4MD0A 1M71B 4PGZA 3T2NH 3DURA 3LS4L 1AAJA 4YSTA 1U3NA 1ZVHA 3SOTA 1B2YA 2FVNA 5AOMA 3CLWA 1EX0A 3V6FA 4IRJD 3ZQXA 1I8MA 3NK3A 3HHSA 1G7PA 2A38A 5D8JH 4YXHL 4F9LA 1OPOA 1A7BA 2VXVL 3UEQA 2YWYA 2B59A 2IVFC 5EC2A 1C8QA 3QWRA 5DD6A 4EI5C 3WI9A 3BP7B 5IF0B 4E9QA 3QJUB 4P5TA 5CGYC 3BKYL 2V5YA 4M8VA 4N2KA 4PHXA 1BQHA 2GHZA 1X5MA 1AIFB 4AUUA 3D07A 1MCDA 1BMWA 1VDGA 4NPKA 5JLZB 1MH5A 2TSBA 4OIFA 2QVFB 5DD0L 5HYJD 4Z7UE 5EF3A 5DC0A 2E4FA 1V54B 1GY1A 1A8ZA 3ARYA 3WKML 1TENA 2XPYA 4JGMA 2B9AA 3EO0A 4PJBA 1H3PH 4I2XE 3MMEA 1T21B 4HEPG 3OKNB 4Q4IA 7CGTA 4EDXA 5C7XL 4DP9X 5JR1H 1QOKA 1S7QA 3HZMB 4JDVB 1FAKT 1FNGA 1NAMB 5E8EA 1FL6A 2ALWA 1DVFB 3FZUC 1ROWA 3FSOA 3AWEA 3N3EA 3TEUA 1J0ZA 4UU9A 3TPUB 3B5GA 5DK2B 5LKNA 1PAZA 2KLSA 3ML8A 4YSEA 2NR6C 5EOCL 1OLZA 3VFSA 1GGTA 1ZGLM 3CU7A 1A6WH 2E59A 5I73B 1EO7A 1CL7H 1KACB 2YR3A 3QNXA 4R26H 1K8IB 5J12B 3B4NA 5F1OB 2GI0A 3TJEH 2O5NA 3KBFA 2C5DC 4PJHE 3KYMB 3APFA 4R2GB 1KXTA 1MFCH 3QI9C 3QZNA 3FS9A 4R7DA 1VKXB 1BBJB 2NY7H 1JF5A 4NZRH 4NO0B 3FU7A 2QPUA 3GMNB 3MV7E 5HDQL 2BWDA 1HSBB 3JV6B 3P73B 1MPAL 4Y0GA 5E6IB 5CF3A 3BEWB 3FL7A 2CLZB 2PLTA 4B95C 5TE7H 1I82A 4QRPE 1G4MA 2BSSB 1X5LA 3O4LD 2EJ1A 4NWUL 4F2EA 1CC3A 1KMGA 1F1AA 3IPEA 4AL8C 5IMKB 3CXDH 3ZIMA 3V6BR 4JQVC 3HVDA 3MPCA 4AC4A 4EUPA 2PYEB 4QLWA 2ZP0T 2J44A 3C5ZB 2NNFA 3QUXD 1EFXB 2P8MA 3GZQA 1R33A 5CR1A 4XPFH 5H94B 2VOTA 3FMGL 4FZEH 4IIQC 2YARA 1QBAA 5CEZD 3WJJA 1O7VA 2IPKB 2HRLA 4GG8A 1MFBL 1WICA 2R4SH 4CMHC 4L4VD 3MLVH 5IQ9A 3BAYA 2UY7B 3SDYL 1JERA 3ZDZB 2A4ZA 5IT2H 1IM9A 5L0QC 1MCIA 3K6OA 3QUMH 1FAIL 1IE4A 4OFIA 3DJ9A 2AANA 3MJ9H 4ZXBA 5JQ6H 3APMA 3MBED 2ZXGA 1T7YA 2F53B 4YSCA 5IMOB 4G6KH 4NENA 4U7MA 2HVJA 3D39B 5FYKU 3GMPB 2X2HA 4I88A 4MB3A 2QR0B 4DN4L 5JNYA 2X12A 1RJZB 2JJSC 4L37A 5D1QA 4OZFB 2W60B 4HU8A 2VDRL 4NQVA 2K78A 1OCRB 3U4BL 4AVKA 4YHZL 4MD5B 5CUSL 4BXVA 3BZFB 1OP5H 3PREA 3HEIB 1GCYA 3LEXB 2UWEE 3SEPA 3AS0A 4DOHB 3FF7A 1GTNA 1GZPA 3GSRA 4OJDH 2AJZB 5L88H 4MTMA 5EO9B 5FO9B 3SDXA 4H20L 4OVUA 1QSFB 3DVNA 1NSNH 3BFOA 3LKRB 3US0A 4OSUH 5F7EH 2VXQA 4DVRL 1ZHKB 4NQCB 5EU3A 1LQBC 3SKJL 4ODUA 1QI3A 1J1OL 5KVDL 4K15A 4H25A 4NM4H 4ZOCA 3PWPD 4ODHH 2R59A 4RBPK 4YXKL 4I8DA 3U48A 3K0WA 1SY6H 3WTTA 4OD1H 4BKSC 2ZYHA 3WNJA 2I24N 1NM4A 1TJIH 4P5TD 1OGPA 1XCXA 1GR7A 3P1VA 4R5VA 2DL9A 1BVLA 4C55A 4AEFA 4EDWH 5I1IL 5GISL 4FXTA 3PV6B 2EXWC 4LLMA 2DQCH 5ENWB 1X9LA 1F6AA 1OOWA 1EV2E 3KPNB 4IRZH 5BV7H 4DGVL 1VFAA 1F3RB 4NN5B 3FO2A 4Z76B 4GPVA 4OF8A 2XG5A 4FG2A 4O00A 1VCAA 4ZW7A 3RWFB 3GPEA 5T3ZL 1NJ9A 1RMFH 1HJCA 5DMKA 5C9JB 1JOIA 3GSNH 1U8LA 4TLKA 4DO5A 2IDCA 4G8AC 4I0PA 5IREA 4XGZA 2I07A 3T77B 2EIZB 2D7TH 4HS6B 4LKXB 4P3CH 1UKTA 3T3ME 4V1DB 4G1EB 4I18C 1CGYA 3RZWA 3BT2H 3RNQA 4O2CB 3QSKB 2UXFA 2Q7NA 1LNUA 1SXAA 3R4DA 4J1UA 2W91A 1THCA 4N85A 3ZT5A 3BAJA 1I3RA 2YPLB 4U6TA 3WNNA 1AZBA 1V55B 1IEAA 1GW0A 1M6UA 2NYKA 3LZRA 3O41A 3K6DA 3OV6A 4PFEA 2AXFB 4WW2F 1PZBA 5EORL 5IKCB 5BVPL 3ZE0E 4HUCA 4U1NA 1F2XK 3FUIA 2P24A 2PPAA 4B9GA 3HBPA 3ZJAA 1KPUA 4PS3A 4YSDA 4U1MA 2E9GA 5FUCC 2F54B 5JIIA 1IMHC 4PJ5A 3PFQA 3NCCB 1BVNT 1X5IA 5FS5A 3APDA 5TGBB 2EVFA 4NP4L 2O5XH 3CDZB 1K8DA 1RFDL 5TK2A 1JPFA 3VJ6A 3FT3B 3DRQA 3QEUA 4TL4A 5FUOH 4FQQB 1QPPA 5E4EC 1CVRA 1ZIBA 3BP6B 4N8VB 3L1FA 5IWLC 4NN6B 3MRQA 2N7SA 4IJTA 4Z7UF 1P84J 3DX4A 4G8GB 2YBRB 1WS8A 1UA3A 2HG5B 1FGVL 4QCIA 2VDKH 1EDHA 3RKDD 5GGRA 3BGAA 1Y07A 4OVVA 5E1IA 4HKXB 3QAZB 1UG9A 3N9GL 5INCB 2F7IA 3QDJA 1PG7L 1WTGT 2DQEL 4IU2B 3LXBA 1IQDB 2WY3B 4PYHA 3U4EA 2ESVB 4U1KB 4B3VA 3RX7A 3AGWA 2XTLA 1DEEB 1E5ZA 3K2MC 2WNXA 2NQCA 4OCSL 5EU7E 4G1MA 3ARFA 3ZMRA 4JREB 1A7PL 4JKMA 1U3HA 1AR1B 1KTLB 3EO1B 1S78C 2HFGL 1IM9D 4UZSA 3ILEA 1MI5B 2CPCA 4MS8C 5KSAA 2ZCLH 1MCRA 4Y9EA 4ZXBD 2R29A 4PJHF 5EBMA 5D7SH 4Q9BA 1E7UA 1ZAGA 2JQMA 3LD8C 2DQMA 3TA3C 2JB6A 4OV5A 1DQML 4I9WD 2J1KA 1IVLA 4KVCL 1MAKA 5T3XD 3CH1B 1KYOK 1A02N 1URZA 4GINA 1DQTA 3VWKC 3J27A 2R56L 3O6FC 4JKPH 1WIUA 5D1QD 5DZPA 4JJOA 3TNMA 3WLWC 4G8IB 1I75A 4LCIH 4U6YB 3R4RA 3T0EB 1PPIA 1TG8A 4GW4A 4LMQE 1ILUA 2HTLD 1KLUA 2CRZA 2K70A 2PO6B 3BISA 5I1LB 1E4XL 3M8OL 4QIRA 3TVMC 2V2TB 4M4RA 1RERA 3RNKB 1KULA 4UV4L 2DN7A 3LS4H 2UV3A 3POCA 2PMZA 4R97B 2EEBA 1YEGL 4FTVB 2VDNB 4FI7A 4ZFGL 3FQ1A 1G7QA 1WIOA 4JRXB 2OMZA 4R7NA 3CVHA 2ZAGA 1MUJB 4YXHH 1WCBA 3MUHL 3Q1EA 5CKGA 2VXVH 2VR6A 5JMOC 2ADJA 4HUMB 5TDOA 5MEPA 3O9WA 4PJHA 1FNAA 3QUMA 4OCNC 5SX5K 5C0RL 1ASQA 1F11B 2P52A 3BKYH 2FD6L 3V0EA 2PWHA 2EDOA 3ZR6A 4UDUA 3ABLB 2CMRL 1HOCA 4AM0Q 2E4TA 4OJAA 3DJTA 2YMOA 1EEZB 3CG8A 4WI6A 3RY4A 3O8XD 3LXUX 4XNXL 4D7PA 1E3ZA 3HN5A 4H8PA 4PG9B 4WKZA 5HJ3A 3QULB 5DD0H 5HD8C 3E1ZA 5L7XL 2B1AH 1A14L 1JGLL 2AQPA 1BPLB 4P57B 1DBBL 1WP6A 4ZMXA 1MAMH 4EZJA 5B38B 4KKPA 1L0PA 3HRPA 4PLOB 5CZXC 5C7XH 3UTOA 3CFTA 4X7DC 2FO8A 1TFHA 1FQ9C 3JYBA 4YNYB 4DKEL 4I0PD 5HVHB 1YRKA 4DWHA 1PKOA 4HFWA 1JCVA 1MCBA 3MTRA 5CBEA 2BSTA 2UWEF 1I7UA 3HUJE 2MOQA 3MJGX 4MVBD 1F1DA 3HHRB 1A65A 5EOCH 2FRGP 3FU8A 2JKRM 1S9VB 3B3BA 2Z8VC 3HLKA 5I76B 3EF4A 4Y1AA 5CMAB 1R3LB 3EH4B 3UJTL 3VQ1C 3BRGC 2ZP8A 3DX7A 3O6KL 3DUSA 3DDGA 3GMQA 1UA6H 4HZLB 4JVWA 2VN5A 3WTXA 5BW7C 3SGKA 4M6NL 5K69A 4BFBD 3QDHA 1I1RA 3BOVA 3N41F 2DJMA 4O2FB 1SXCA 4EIUA 1DQJB 5D2NE 1IAKA 2NW3B 4PJ5D 2WBXA 4OBSA 4ZUUA 1LO5A 3K2UL 1XGUB 2AEQL 1KTKE 4P5MB 3FPYA 1A1MA 3CIAA 3EF7A 3MREB 4QY8A 2ARWA 5B7MA 5CN2A 4NQUA 1Y1DA 1IQWL 2JJTA 1R34A 5DDHB 5I1DA 2YN5A 3VH8A 5KYYA 3BPNB 3EFFA 1UC6A 3F2LA 1O9WA 4L2LA 2RCSL 5HDQH 4PB9H 3MV8B 3GSWA 3MRIA 1MPAH 4IRZA 5IJVB 5HGDA 5AB9A 1OP3K 1KJ3L 3FH7A 4BZ2L 2BVOA 1BG9A 3MGOA 1NCGA 4NWUH 2FX7L 3EGXB 3WTVA 2WBJB 1HL5A 1FF5A 2H1LM 2VXUL 4ZUWA 1QLFB 4AXWA 2WYHA 2GBTA 1FSKB 2CPUA 4ODWA 2R0WL 2YRBA 4GAYB 3T3MF 3NA4A 1RURL 3MODL 3QDJD 3NRQA 2I25N 4HUKB 3FMGH 3QFGA 3Q44A 3SBWC 4GIOA 3TYGL 4YHPA 3JZ7A 4UDTA 5IV2A 1MFBH 5DS2A 2A9DA 3O3BB 2MPVA 3SDYH 2P42B 2WP3T 4YGVA 2EILB 4LP5A 4P3DB 1VB9A 1XR9B 5EBLA 4R96A 5ITFB 3JWOL 3ARFD 1MJJA 3ZE0F 1U3HD 5JOEA 5IBLD 3UCQA 5KSAD 2G0KA 4K5MA 5F97E 3L17A 2OL3A 4FYTA 1J9CT 3AY4C 3CZNA 3V5DB 2BX5A 3OJVC 1LVEA 2CLVB 1X7TA 4FQ2L 4LVHB 5HXMA 4HAKA 1T7ZA 2PETA 1JXGA 1JZGA 3VXNB 4M1GL 3L13A 3E8VA 4DN4H 3MRDB 5KSBA 3AU0A 5E8PB 4FG0A 4ZUTA 2JCCA 3W11D 4KQ0A 4AEHL 3ZDWA 1P5UA 2CXKA 2IPUG 3H53A 4RAUB 4MLIA 4XNZB 1CTNA 3L1EA 4G42A 4TNVK 2IAAC 2VDRH 2KH2B 3A6CL 3DETD 3IK2A 4XOCA 4XRCB 3WHE0 1PEWA 1CMOA 3U4BH 4A7SA 1SLWA 3L3OB 2YMTA 5ERWB 2XFGB 4YHZH 4K9EH 3PQYA 5CUSH 3DIFB 2P43B 2JKJA 1DE4B 1U91A 5FFLA 2ZXAA 2RBLA 4MHHI 2WWNA 1TCRA 3WN6A 1CLVA 3J7HA 5BQDA 1BD2A 4P2RB 1JNHB 2JK5B 2XWTB 5GRVL 4H20H 3PHSA 4G59C 1AGDB 2WIIB 4S11A 5DRXA 5A6IA 4DVRH 2Y69B 4P9HL 4UNIA 1R5WA 2HFFB 3SKJH 5KVDH 1J1OH 1MFUA 2WVSA 2X7LB 4ZFFB 1P4BL 1QUNB 1EA9C 1F4XL 4R2GC 4YXKH 5ABAA 4KI5F 3O2WL 4PWIA 4R7VA 5AOLA 3OC5A 2NLJB 4TNVF 1PLCA 3PWJB 3LKOB 4JRYA 2NXZD 3FFCB 3O9WD 4NUMA 3A23A 1RIHL 2XUWA 4QOKB 1G1YA 3BH9B 3HMWL 1PNDA 3V9CA 2RALA 4LIQL 4BH7B 3DX2A 3I9IA 1YMME 3L4YA 5I1IH 4J3SA 4YL9A 5GISH 3US9A 1AY1L 4PSRA 3X13A 4FQJL 2OMTB 5IMLA 4DGVH 5A2BA 4G9DA 1RZ7L 1AGFB 1I9EA 1TQCB 5HI4D 2QKSA 4Y2OB 1ORSA 3POHA 4KKBD 4MYPA 2WGXA 1YUHB 1U92B 3ELQA 3K80A 4WVRA 5DO8A 5T3ZH 2VWEE 4TUUA 3ZTCC 1OWRM 4FHBD 1I9IL 3HJ0A 4PJ7F 1G1KA 5DJ6A 4V2BA 1UTDA 1Q8MA 4DP1X 2R9HD 3L2MA 4DEUA 2OV0A 3RA7L 4JX0A 1FCGA 4G5ZL 4CMMB 3QRGL 5E56A 3GZKA 2PXYC 1T20A 3N0AA 2NQDA 3BIKB 2GYSA 4OIIL 5F8RC 2JFCA 2N7BA 3DJRA 4N0YL 4JUTA 5BVPH 5T5NF 3K1KC 4UTBA 4PUBH 2P80A 5BRZE 3QISA 1OV8A 3NZHL 3KL3A 2QT6A 2R7EA 5DJ0A 4Z77A 1G7LA 2FLRT 3BPLB 1DJXA 1RFDH 3V5KB 3CU1A 4CBZA 4U3CA 3M1CA 5SX4H 1INDL 2CALA 3VAEA 5IEHA 2YS4A 4B53A 2ZPKH 3AB0C 1MWAA 3NEXA 1CT8A 3FAWA 3JWDC 5IQLA 2KDYA 5DMJB 3V6ZB 1HYSC 3O45B 3PE9A 1JFQL 3EDKA 2IGTA 4PJ7A 4QI3A 5CNHA 1FIEA 3TV8A 4L18A 2QMJA 4RGNE 3MJ8B 1FGVH 1AKJA 4OTXL 4RGMB 4JO2L 3TCLB 1CFBA 2UZPA 2RMNA 2YFNA 3WFZA 2MIZA 2ZICA 2WNGA 3CJJA 3N9GH 5E8NA 1FNLA 1PG7H 5ESAB 5KOVC 3TA4D 1UB6A 2L3BA 5AYUL 3I9AA 3DOSB 3UG4A 3MLUL 2ED9A 1JWSB 3HUJF 4GSRA 1SLXA 4HJGB 2BNRE 3OXSB 3UTQB 4IHOB 1PAMA 4FQHB 3UADA 3IDNB 1RJLA 3MRKA 4I7ZC 3K8LA 3SDDB 1ZHNB 2B5IC 2V17L 4M1DL 3WL9A 1A7PH 3S8GB 3QIBA 3TJHD 1OY3B 2HFGH 3FU3A 4J7RA 1YAZA 2EEXA 4NQSA 3DXAA 4HIPA 2XZCL 3B2MA 4LFHD 4NRYA