2K79A

Solution structure of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
63
structure length
63
Chain Sequence
b'GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain of Tyrosine-protein kinase ITK/TSK
publication title Proline Isomerization Preorganizes the Itk SH2 Domain for Binding to the Itk SH3 Domain
doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 4
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k79A00
2J05A 1T0HA 1ZUKA 1GBQA 4RTZA 1UJ0A 2YDLA 1AWXA 4J9DA 1NEGA 2SRCA 2EGEA 1FYNA 2CSQA 1K0XA 3U23A 1BK2A 2L3PA 2XMFA 2LNHB 1AD5A 1B3QA 3O5ZA 4J9CA 4HVVA 3VRYA 2KBTA 2JMCA 2J7IA 1UHCA 3NPFA 2KT8A 2MCNA 2JT4A 2EBPA 2O31A 2KNBB 1WXUA 4LN2A 3VRZA 1PWTA 4CC4B 1W70A 2FPDA 1HSQA 1T3LA 2W10A 2LCSA 2ENMA 2JXBA 1M3AA 3GBQA 1U06A 1WFWA 4GLMA 1K0SA 2DX1A 1U5SA 1RLQC 2NUZA 1I1JA 4IIOA 5IXBA 4J9GA 2BTTA 2DNUA 2BZXA 1ABQA 1UTIA 3M0UA 5FW9A 2YUPA 4LUDA 4KRTA 2J06A 3LH5A 1WI7A 3FJ5A 3NHNA 3QWXX 3VS1A 2EVRA 1EFNA 4FSSA 1W1FA 3ZL7C 2YUNA 4DEYA 2B86A 4JJCA 1I0CA 1LCKA 2EGAA 1WXTA 3EG3A 4OMQA 1QWEA 1Z9ZA 2AKKA 3A98A 1GBRA 1NM7A 2LMJA 2DJQA 4RTXA 1BBZA 1NEBA 1SRLA 2DL3A 2FG0A 2EPDA 3VS4A 3KFVA 1BB9A 2LJ3A 2RMOA 1NG2A 2ECZA 2HCKA 5I22A 4AFZC 4LE9A 3IQLA 4RTWA 2CUBA 1UECA 1AWJA 2EW3A 4J9BA 3VS7A 2O88A 2G6FX 2SEMA 1CKAA 5IH2A 5ECAA 3QWYA 1JXOA 1PNJA 4HVWA 3VS6A 2DRKA 4F17A 3SEMA 1T0JA 2HSPA 2I0NA 4X1VA 2F2WA 1FMKA 1S1NA 1UFFA 2VWFA 1E6GA 1X6GA 4JJBA 1X2QA 2OJ2A 2DM1A 2GTOA 4D8DA 1CKBA 3M0SA 1Y57A 2E5KA 3PE0A 3EG0A 2O9VA 1X6BA 2DL4A 4AFUC 4JZ4A 1ZLMA 4RTVA 2DE0X 2H8HA 2YSQA 2FRYA 3REAB 2V1QA 1GCQC 2D0NA 4ZNXA 4M4ZA 3C0CA 2A36A 2M0YA 1QWFA 1Y0MA 2LP5A 4CC2A 4F16A 1KSWA 1PRMC 2J6FA 1JQQA 3UATA 2FEIA 5IHIA 1NLPC 2LJ1A 2NWMA 3SHWA 2KRMA 4K11A 5GJVB 1H8KA 2GQIA 2DBMA 4OMOA 2K9GA 2KXCA 2HBWA 1K1ZA 4RTTA 3VS5A 3REBB 2JS0A 3PVLA 4CC3A 5L23A 1QCFA 1CSKA 2O9SA 1JO8A 1G2BA 2K79A 3M0QA 1JXMA 2KRNA 1NYFA 1UUEA 1SHGA 2LQWA 4OMPA 2F2XA 1QLYA 3H0HA 2A08A 4JPBW 1K76A 2RPNA 1M3CA 1OPLA 2DMOA 1IO6A 2AZVA 4R0KA 3EG1A 1WX6A 2L2PA 2JTEA 4Y92A 2DL5A 2EYYA 2J6KA 1ZUUA 2BZYA 4ORZA 2HEQA 3EHRA 4IIMA 3R6NA 4DEXA 1PKTA 2BZ8A 2D8JA 2CSIA 2A37A 4WCIA 2K7AA 1KFZA 1PKSA 3EG2A 2DA9A 3M0TA 1TUDA 1GCQA 3M0RA 1UGVA 1YWOA 3I5SA 2EYZA 1UE9A 2DLPA 2EYXA 1ZSGA 2D8HA 1BU1A 1SEMA 2ABLA 2GBQA 2RQWA 2X3WD 1GCPA 1MV3A 1OPKA 4J9HA 1WA7A 3TSZA 1YCSB 1YP5A 2K2MA 2P4RA 2JS2A 2RQTA 2CDTA 2AKLA 2JM8A 2MIOA 1GFCA 1YWPA 1AWOA 1TG0A 4OMLA 2ESWA 4AG1C 1SSHA 1UG1A 2M51A 4QT7A 3RBBB 4CC7A 2AZSA 2AK5A 2L0AA 1NLOC 2KE9A 4AG2C 1V1CA 1QKXA 2A28A 4Z88A 3UF4A 1M3BA 1GRIA 2L3QA 2EYWA 1VA7A 3I35A 1AZEA 2CUDA 3I5RA 2IIMA 2PNIA 3UA7A 4RTYA 2RQUA 2KGTA 2EGCA 1W6XA 1WLPB 4LUEA 2LZ6B 2RF0A 1HJDA 1U3OA 2DRMA 2VVKA 2DYBA 2YUOA 2ED0A 3NGPA 2OI3A 5IXFA 5FWCA 4E6RA 1J3TA 4AFQC 1UHFA 2EKHA 2GGRA 1ABOA 2DVJA 2PTKA 1OEBA 1B07A 1WIEA 2CT3A 2DILA 3PVQA 3EGUA 2V1RA 3TVTA 1X27A 1E7OA 3I9QA 2LQNA 2EQIA 2KYBA 2DL8A 1RUWA 2HDAA 2LJ0A 4HVUA 1RLPC 1K4US 3VS3A 3H0IA 1SHFA 5FWBA 3H0FA 3M0PA 1WXBA 1KJWA 1T3SA 2ROLA 1KIKA 5IHKA 1JEGA 2FRWA 3CQTA 4AFSC 2JW4A 1PRLC 5HCKA 2CH4A 2VKNA 1UJYA 1X69A 2DF6A 1M27C 2C0TA 2KYMA 1YN8A 4GBQA 2C0OA 2MOXA 4J9FA 5IHNA 2C0IA 3RNJA 2JMAA 1TUCA 2CH4W 2QDLA 2K6DA 4LNPA 1AVZC 1PHTA 2FPFA 2JM9A 4ESRA 1X2KA 5EC7A 3JV3A 4OMNA 1ARKA 2K3BA 2J6OA 3TSWA 1H92A 2PZ1A 1OOTA 1GFDA 2ROTA 2KR3A 4HXJA 2GNCA 1AOJA 2L3SA 4F14A 1MV0B 1M30A 2RQRA 3NMZC 1GL5A 2GTJA 4A63B 2ED1A 1QKWA 4RTUA 3VS2A 1SRMA 1NYGA 1AWWA 4EIKA 1Z9QA 1X43A 2LX7A 2KT1A 2KXDA 2OAWA 1XOVA 1AEYA 1WYXA 1JU5C 4JJDA 3THKA 4HCKA 2RNAA 2YUQA 2KEAA 3VS0A 1HD3A 4J9IA 2FO0A 4JZ3A 1WDXA 1VYUA 2RQVA 4Z89A 1H3HA 2YT6A 4D8KA 2DBKA 2RN8A 3H41A 1VYTA 3ULRB 2CREA 1SPKA 1I07A 2KRSA 2D1XA 5GJWB 2CT4A 1ZBJA 1E6HA 1RI9A 2X3XD 4OMMA 4RUGA 1ZX6A 2FPEA 3EHQA 1K9AA 2DL7A 4J9EA 1ZUYA 2W0ZA 2O2OA 2F2VA 1M8MA 1OV3A 1A0NB 1N5ZA 1YNZA 4Z8AA 2KROA 3UA6A 5I11A 1AZGB 1G83A 1VYVA 1UDLA 1MUZA
chains in the Genus database with same CATH superfamily
2L89A 4JRIA 1ZUKA 1MMAA 1GBQA 4RTZA 3EGXB 3CCEQ 2HQHA 5KYXB 4EPCA 2EQUA 2SRCA 1W2BP 1IHWA 2EGEA 1K0XA 1VOMA 2EQKA 5GAOr 1Y71A 2EWNA 2VGNA 2XMFA 3OQ5A 4C5EA 2LNHB 4M7AB 2KBTA 1WNLA 1VQ4Q 5AT1B 4FL6A 4C0DB 4FSXA 4P5NA 3S3MA 4LN2A 3LH0A 1HSQA 5GAMe 2W10A 1KC8U 1TWBA 3GPLA 1M3AA 5GMKh 5CQYA 3SWNB 1R0BG 3BDUA 1U5SA 4M75F 3LWIA 2NUZA 2P0QA 1I1JA 4IIOA 2XKOC 1ABQA 1UTIA 2R58A 3M0UA 5FW9A 2I2LA 4RCCA 1PSFA 3G7ZA 4B9WA 3HRSA 1BCOA 3FJ5A 3VS1A 2RI3A 3G6EQ 1EFNA 4DEYA 3KUFA 4JJCA 1I0CA 4C92E 2EAYA 5GAN8 1Q82U 4OMQA 1VQKT 3BW1A 5GMKj 1GBRA 3M4GA 2DJQA 1IZ6A 5LL6S 1Q81U 4UC4A 2CP5A 3RESA 1I8FA 2LJ3A 2RMOA 1NG2A 2ECZA 2HCKA 5I22A 2ZPBB 2MF2A 2CUBA 3OYLA 1UECA 1BIAA 3C95A 2JZ2A 2G6FX 2LT4A 3CCSA 3OMGA 1CKAA 2ZCFB 5IH2A 1SG5A 3EGXA 3KBGA 3CCQT 1PNJA 4HVWA 4F7UE 2DRKA 4RMOA 4F17A 3SEMA 2VWFA 1RAIB 1K9MU 2BUDA 4N0AA 4DQ2A 4M7AA 4JRKA 3TCJA 2JN0A 3PE0A 3L42A 2ZZDA 3RDVA 1VQ9A 1X6BA 4RKUE 3CD6T 2DL4A 3QZ9B 4RTVA 4KULA 1K73U 2DPPB 4X9CA 3REAB 4XTWA 1VQNA 3I56T 4M4ZA 3C0CA 3SWNA 4M7AG 4CC2A 4F16A 4QVCA 2J6FA 1JQQA 1ZBXA 1R77A 1VQLA 1HK9A 1VQ5Q 5A0DA 4DBQA 2RHXA 1M2OA 5I2MA 1D3BB 3OYBA 2K9GA 2KXCA 2A0FB 4XU2A 3QKJA 3PVLA 2LTOA 1CSKA 1LOJA 2O9SA 2RHUA 3RKYA 2K79A 1JXMA 4PJLA 2JVVA 3JRZA 3J80E 1RI0A 4OMPA 1QVFP 2HSEB 1QLYA 2A08A 4BE2A 1M3CA 5GANh 2E64A 4OP0A 3JCMd 1IO6A 3Q1JA 1VQPT 4M7DB 2NUPA 2AZVA 3M57A 2L2PA 4Y92A 3CPWP 3CCEA 1W2BA 3QSUA 2X4JA 4IIMA 1PKTA 1D1CA 3L1AA 4DOWA 1KFZA 1PKSA 3M0TA 5IN1A 3HRUA 2QA4Q 3HL8A 4MMKA 1GCQA 3M0RA 4PL6A 5GANj 2YRCA 2YHTA 3G4SQ 1M1GA 4E2FB 3I5SA 3C94A 5J3BA 3MEWA 1N8RR 2GBQA 2ABLA 4OVAA 1G3WA 3OW2P 1MV3A 3CCUQ 3HPWA 3BY7A 4ELZC 1D0ZA 4N4IA 4L59A 1AWOA 5DLOA 2PUKB 2F5KA 3CCMA 2EJ9A 3QDRB 1VQ7T 2ESWA 1SSHA 3RBBB 4QT7A 1C0MA 4A54A 1EZZB 2LX9A 2QYZA 4LDWA 1V1CA 2A28A 1M3BA 1VA7A 2CUDA 4RTYA 1QMCA 3CCRT 2DERA 3QJ6A 1QW1A 1HJDA 5LJ3f 1LVKA 3JCMb 5GMKm 4J5YA 3WVEB 3D7SB 4M7DA 3DLLA 5LJ5d 1HYOA 5D6XA 1PG5B 4IUTA 4XK8E 4E6RA 2KI7A 4RG8A 4HT9A 1EX4A 1OEBA 3H6ZA 2DIGA 2CT3A 2DILA 1M1KR 1ACMB 3TVTA 1X27A 2LQNA 2EQIA 4M7DG 2MMPA 2DL8A 2HDAA 3LX7A 5CIUA 3V8JA 4M77B 2RK2A 1M5Q1 2WACA 3CCVT 2QQ9A 4OF1A 1JEGA 3CQTA 3HSBA 4Y28E 3VUZA 4EMGA 2VKNA 2K3XA 3CC2T 5FRNA 2H3JA 4HCZA 3JB9F 2DO3A 4HCCA 2C0TA 2OTJT 1YJNT 4N0AC 1BI3A 2GCXA 2QK0A 2MOXA 3MP1A 5IHNA 1Y7XA 1PHTA 2QXFA 1B34B 2FPFA 2JM9A 3CXCS 3PIPA 1X2KA 4FYWB 5EC7A 5GAOp 2QQRA 1ARKA 1WHKA 1QVGS 8AT1B 3RMQA 3NTIA 1GFDA 2O4XA 2KR3A 2NUTB 4C8QB 2GNCA 3I55Q 1AOJA 1RAFB 4J7FA 1IHVA 1UGQB 2GTJA 1VQOT 2RJDA 4A63B 2K57A 4NS5A 1X43A 2LX7A 5GAN2 3JCMe 1MGQA 2DIQA 4XTVA 1JU5C 1LJOA 3MP6A 4JJDA 3CPWA 2RNAA 2VXFA 4LDUA 2E1HA 3VS0A 3EG9A 4BB7A 2RQVA 1YCYA 3GIBA 4BUGA 2E6ZA 1I07A 4XU1A 4M77A 3JCMP 2CT4A 1E6HA 1ZX6A 2FPEA 3EHQA 3M9QA 4FU6A 3FC3A 1K9AA 2FYKA 2DL7A 1OU8A 4JDSA 3H9NA 2O2OA 1A0NB 1OV3A 3AT1B 2RHIA 4PJOA 5CR2A 4IKFA 1AZGB 2PUOB 4PNOA 2M1HA 4M77G 1VYVA 2LRQA 5L8RE 5CCAA 1YITA 2X9HA 3NTHA 3JCMc 2K5LA 2CP2A 2DKGA 2JJ9A 3LGLA 1S72T 3PTAA 3CMAT 3X26B 4PJOG 1I5OB 2X51A 1WHLA 2NUTA 3OS0A 4BI8B 1AD5A 3S3NA 4HVVA 1VUBA 3X24B 1UHCA 1ZSZC 2KT8A 4BY6B 1OULA 2ATCB 2EBPA 4E7IA 2O31A 1KC8R 1M90C 3VRZA 1PWTA 3CCLA 3HFNA 3OYNA 4A4FA 1Q7YU 2FPDA 4C8QE 1JJ2A 2JUFA 2LCSA 2JXBA 4M7AF 3JCMW 3GBQA 5KH6A 2HL5C 1M1KC 3EGDA 2R57A 5LJ5e 4GLMA 4C8QD 2DX1A 3O8VA 4QQ6A 5IXBA 4KGZB 1DJ7B 2DNUA 3M54A 2BZXA 4IUPA 2VC8A 1UGSB 1TU0B 4JUVA 2DZ9A 1VQKQ 2OTLT 1WI7A 5FRMA 3TU4K 2FZCB 1W1FA 3ZL7C 2YUNA 1Q82R 2X4YA 3EFSA 3OMCA 2EGAA 3VKIA 1Z9ZA 1Q81R 2LMJA 4Z02A 1M2VA 2FG0A 1SRLA 3VS4A 5GANf 3L2UA 4FT4A 2PQWA 3CCQQ 2XDPA 2A7YA 3URGA 5GAOq 2LT1A 3IQLA 2Y4YA 3SDZA 2L8DA 4C92B 3G71A 2RO0A 2SEMA 1N9SA 2BIVA 3QYGB 2RH2A 1TTHB 5J26A 3CC7T 4MMLA 2HSPA 2VGMA 1K9MR 1XJWB 3MHXA 1UFFA 3GOXA 1VQ6T 4VUBA 3CD6Q 2DTHA 4JJBA 3AHUA 1X2QA 3CPFA 4FM4B 4FYVB 4OMFB 2GTOA 5CKHA 4D8DA 1PCXA 3HTRA 2E5KA 2DD4A 3PNWC 1RAEB 3I56Q 5GAOm 2O9VA 4PFZA 1K73R 2D0QB 2DXBA 4JZ4A 2DTIA 2YSQA 3CC4T 2V1QA 4ELYC 3UDCA 2A36A 3OYKA 2M0YA 4QKUA 1TH7A 1KG1A 4XAXB 2E3IA 1YIJA 2NWMA 2KRMA 2DXTA 4K11A 4QVDA 2KQWA 1OX9A 4OMOA 4QQDA 2Y90A 3M56A 3OBYA 4HCBA 1FMWA 1QCFA 3GF5A 1JO8A 3M0QA 3RUXA 2QGFB 5GAN7 2VUBA 3M59A 2L3RA 3BDLA 3DKMA 2FL7A 2XDDA 1VQPQ 2XK0A 1YJ9A 4YTLA 2LQKA 2F2XA 5GMKi 1IB8A 4C5HA 5D7UA 2FVUA 3E9FA 2EKOA 5CKEA 3CCJA 3LLRA 4C92A 4LDYA 1SSFA 3R6OA 1VQMT 1WJQA 4AMCA 4E47A 1YJWA 4XTYA 3EHRA 3TQ7P 1C6VX 2K5IA 1KD1C 2XD0A 1KQ1A 3C4SA 2CSIA 4M7DF 2A37A 4PJOC 2F5TX 2P0PA 1U1SA 1KC8C 4C92G 3TREA 2DA9A 3L2WA 3CMEQ 4C92D 3QG1A 2LCLA 2EJGA 4M78B 5DLQE 5GANg 1JBMA 1RAHB 4F7UA 2LNVA 4EDUA 1MHNA 1ZQ1A 3FB9A 2VB6A 2DFUA 2D8HA 1BU1A 2RQWA 3MO8A 2Z0WA 1GCPA 1PC0A 1Q86U 1YP5A 3BE3A 4JJNK 2P4RA 4ZTJA 1VQ7Q 5KYXA 5M9OA 1VQ9T 9ATCB 1GFCA 4F7UG 1Q82C 1O9SA 1UGRB 4X34A 2PVOB 1TG0A 5GAOl 3QHSA 1JRIA 1Q81C 2H3EB 3CCRQ 2CP0A 1UG1A 5GAMg 2M51A 3V7SA 3T9NA 2KDSA 1QKXA 3RKXA 1NZ9A 1VQLT 3UA7A 1G3TA 2K4YA 2ZPEB 2RQUA 2ZPFB 2QEXA 1D09B 2RF0A 1V76A 4OB2B 3META 2DRMA 3PMIA 1U1TA 2VVKA 3FLGA 2YUOA 3FIFA 2EJFA 1K9MC 2GFAA 3OYHA 5IXFA 1K8AR 5LJ3d 1J3TA 1UHFA 3DLMA 1MMDA 2DVJA 3TEEA 1B07A 2E10A 5KYUB 2E6NA 1K73C 3OYEA 3X28B 3CCVQ 1E7OA 3I9QA 3QXEB 1RUWA 1G3YA 1MMNA 3A8OB 2QQAA 4E7LA 3CC2Q 1K4US 1ZSZB 3VS3A 1SHFA 5FWBA 2RJCA 3M0PA 1T3SA 1YJNQ 1KIKA 1VIEA 2BE9B 3BFMA 4O5VA 5HCKA 2CH4A 1N27A 2QQSA 1X69A 4M75B 3FDRA 1YN8A 4M77F 2IPOB 4M78E 5KCHA 5GAOn 2JMAA 1TUCA 1OZ3A 4M78G 4PJMA 4BDZA 4M78D 3S3OA 4J6XA 4CRIA 1QP3A 3LYIA 2D6FA 4PFPA 4PJOF 3JV3A 4OMNA 2O01E 3EFRA 4EMKB 2XG8D 2DXUA 2Y4XA 5GAMh 1NPRA 1VQ4A 4HT8A 4BACA 4XTXA 1KQSP 3QYHB 4IURA 4KUDK 3EFOB 3OY9A 2V8KA 2RI5A 2RQRA 1GL5A 3E1SA 3CCMT 3MEVA 5FU7C 4WTOB 5KYNA 3FRNA 4RG2A 5FLXE 2CZ7B 2HMAA 2OAWA 4PJJA 1D3BA 4KH1B 2EQJA 3THKA 1FXXA 4HCKA 2KEAA 3HP9A 2DTOA 2CKKA 4ZN1A 1HD3A 5GAMj 4J9IA 4ATOA 3G6EA 1VYUA 2F69A 4D8KA 3OBWA 3H41A 2RN8A 4E7HA 3ULRB 2DYIA 3E9GA 5FU6C 1TOVA 1C1AA 1SPKA 1FX7A 4A4GA 3CMEA 2COWA 5GJWB 2X3XD 8ATCB 1TUGB 3ZBDA 4DA4A 1JJ2P 1ZUYA 2W0ZA 3JB9I 4LDXA 1ZA1B 2F2VA 1M8MA 2XDBA 3E19A 3WVDB 4II1A 5HY6A 5A2QE 4LDVA 4V2SA 1S72Q 1UDLA 2MAMA 4IUVA 3CMAQ 1T0HA 3EAEA 2E70A 2WSCE 2YDLA 1AWXA 2QAZA 2HZYA 4M75E 3VYGA 3J7AF 2VASA 2PVGB 3U23A 1XQHA 2KSSA 4M75D 3RERA 4KH0B 1B3QA 1QQJA 1V29B 4J9CA 1W2BS 1WHHA 5KYWB 4PFOA 2MCNA 1Q7YR 4OGCA 2RA2A 3OYMA 1K8AC 1WXUA 3QZ5B 4CC4B 1W70A 4M7AC 1T3LA 1UB4A 1R0CB 1YHQT 4WF2A 2FZGB 1VQ5A 6AT1B 2OTLQ 2F1LA 2E12A 1RLQC 4J9GA 2E41A 5LJ3e 2YUPA 4LUDA 2VV5A 4KRTA 3SWNC 2CS7A 3UT1A 3CCVA 2DEQA 3NHNA 3QWXX 2EVRA 1JB0E 3WXMB 5C6SA 2B86A 4OB1B 1OU9A 4XQ3A 4IUUA 2HKNA 1WXTA 4NOYA 4R56A 1OQKA 4XU0A 2EIFA 3A98A 4PKCC 3EH1A 1NM7A 4KUIA 5FROA 4RTXA 4JRQA 4E7ZA 1WHMA 1NEBA 2CZ6B 2EPDA 1I4K1 4AFZC 1YI2Q 5KYYB 2CP3A 4GY5A 3CC7Q 4RTWA 1AWJA 4BI3A 2CZ0B 3VS7A 4KT0E 5DM7R 4ZGJB 1VQ6Q 2DEUA 1IREB 5GANd 5ECAA 2CYZB 3C12A 3QWYA 4HA8A 1JXOA 3A5ZB 2YLBA 3JAME 1NJIR 1PM3A 5GMKl 4X1VA 1N8RC 4C92F 1E6GA 2QA4A 2DVEA 3VYHB 2OJ2A 1XNIA 1KQSA 4J7IA 3G4SA 1CKBA 2M9UA 4XTZA 3OYJA 3M0SA 3CC4Q 3EG0A 1YITT 2MK5A 4AFUC 1Y96B 1ZLMA 2H8HA 3QBYA 1D1AA 3CCUA 3GP8A 2FHDA 2JNGA 3NFCA 1GCQC 4JRPA 4ZNXA 1Y0MA 1B34A 3UATA 2FEIA 2LC4A 4F7UF 2LJ1A 5CKFA 1KHIA 3JSCA 3CCLT 2XHCA 1H8KA 2DBMA 4Y91A 4C8QA 3VV0A 5GMKe 1M90U 4A4HA 1K1ZA 4RTTA 5L23A 4CC3A 2V8JA 2FZKB 3JCMg 2EYQA 3SB2A 1VQ8T 4ZN3A 2LQWA 1N6AA 4J6YA 2EFIA 2HKQB 1VQMQ 1WHGA 3H0HA 4C8QG 4JPBW 3JB9H 1K76A 2IG0A 1OPLA 3MJXA 5KYYA 3ASKA 3ME9A 2YRDA 1QVFS 4R0KA 3EG1A 5CO7A 1WX6A 3CMAA 2C06A 2JTEA 3MEAA 2DL5A 2EYYA 3NTKA 2IVWA 4RCBA 3UPUA 2BZYA 2PVDB 3L2QA 2M02A 3CBPA 4M7DC 5C0MA 2GFUA 4DEXA 1QVPA 2BZ8A 3OYYA 4Q5WA 3GLXA 3QPHA 4WCIA 2KY9A 3FEOA 1I81A 2K7AA 2QI2A 3QDFA 3G71T 3CPWS 1WGSA 3EG2A 4NL3A 3M58A 4FT2A 2V26A 2X4WA 4JS4A 1UE9A 4LXCA 1M9SA 5D6YA 2COZA 2HBPA 1Q86R 1ZSGA 2DAQA 3P8BB 2GF7A 4C0GA 1RACB 1M1FA 1OZ2A 3TSZA 2K2MA 4M78F 2JS2A 2RQTA 2OTLA 4BD3A 2AKLA 5HK0A 5IAYA 2MIOA 1YWPA 3OW2S 4PLLA 1W4SA 1VQLQ 4OMLA 2AT1B 2K3YA 2DZCA 3I55A 4CC7A 5J39A 2XICA 2AZSA 4NL2A 1EIFA 5GAMf 2KMTA 1D0XA 1NLOC 5CAIA 4Z88A 2D9TA 1GRIA 1YFNA 1AZEA 4JS5A 2PNIA 3JCMh 1YIJT 1I5LA 3L2ZA 4N4HA 1W6XA 1WLPB 4LUEA 2LZ6B 2JTMA 2QTVA 2QASA 3PFSA 2YLCA 3LW5E 3MEUA 1TS9A 3QJYA 2DYBA 3NGPA 1NJIC 5KE2A 2OI3A 1YI2A 4BDYA 5D6WA 4KGVB 3SFMA 1YJ9T 3L2RA 2OAUA 4AFQC 1MNDA 2MI6A 2GGRA 3JB9D 4KBMB 5GANe 3PVQA 3EGUA 2V1RA 2NLUA 2LVMA 4MDWA 2KYBA 2P84A 4BE1A 3CCJT 1QP2A 4HVUA 2LJ0A 3LWHA 4A4KA 3DB4A 2GQVA 4E7KA 3CC4A 1KJWA 4X9DA 2ROLA 1YJWT 3ZEHA 2FRWA 3OYFA 4AFSC 2JW4A 2LDMA 1UJYA 2DF6A 3ER0A 1M27C 4M77C 1KD1U 4GBQA 2G3RA 2M16A 3MPUB 3CXCP 5I2SA 2C0IA 2CH4W 4JLIA 2QDLA 1RL2A 4LNPA 1QVGP 1AVZC 1NBEB 2ZPHB 3S6WA 4JLGA 4ESRA 2K5FA 4C0FA 3CCST 2K3BA 2DXCA 3OS2A 1FWZA 3CCMQ 2PZ1A 1SF9A 1OOTA 2ROTA 2X4XA 4HXJA 4LD6A 3RMSA 2PU9B 1BI2A 3RKWA 5LJ5h 1G3SA 3NMZC 2K2VA 1Q95G 2JTFA 1VQMA 2ED1A 3VS2A 4C8QC 1SRMA 3LGFA 3HFOA 1AWWA 4EIKA 1Z9QA 2P0KA 4F04B 5HK3A 1WYXA 2M0OA 3QO3A 5DY9A 2NUPB 2E3HA 2QEXT 7AT1B 1VQKA 2E5QA 1VQNT 4L5GA 4J83A 3GNGA 1WDXA 1H3HA 3JCMX 3CBOA 1XTDA 2JOYA 3CBMA 3HHTB 2DD5A 5LJ5j 4ZGDB 1QCOA 2CREA 1Q86C 1U8RA 2HNIA 5GAN4 1FMVA 4B6MA 1ZBJA 4RUGA 2CP6A 4MZMA 3A8HB 2RHZA 2LQ8A 3CCQA 5CK9A 1YNZA 5IT9E 2YXYA 1G83A 2ZPGB 4OB0B 1MUZA 4M7AE 2J05A 3OYGA 3OB9A 1UJ0A 4J9DA 3PIOA 1NEGA 3CD6A 4M7AD 1TSFA 1FYNA 2CSQA 1X75C 1BK2A 3QUIA 4J8OA 4M78A 2L3PA 3I56A 2OTJQ 3CCET 2YRVA 3O5ZA 4LD9K 2LCCA 3VRYA 2JMCA 3VU3C 3MP8A 1YHQQ 2J7IA 2XU8A 1ZA2B 3NPFA 2EQMA 4BI4A 1D1BA 1RABB 2JT4A 3P8HA 2KNBB 3OYCA 1VQ4T 2ENMA 4EMHA 4QW2A 1U06A 1WFWA 1OX8A 2RD1A 4BY6C 3EH2A 1K0SA 2BTTA 2ZAEA 3M55A 1PSEA 1PD0A 1VQOQ 3OYDA 2J06A 1X6OA 3LH5A 2DJZA 2COYA 3RIRA 2RHYA 4FSSA 2ZGWA 2E65A 1VQPA 1N9RA 1NE8A 1LCKA 1ZHIA 2QGGA 5HKCA 3EG3A 3A1PA 1GXIE 1QWEA 2AKKA 1MMGA 3OSSC 3G6ET 2QTXA 4C8QF 2XIDA 5CVIA 1BBZA 2DL3A 1BI0A 1BB9A 1B7TA 3KFVA 1IGQA 4PJNA 4QVZA 3CXCA 4L6V5 3N5BB 4LE9A 3CMET 1MNEA 2EW3A 4J9BA 1QVGA 2O88A 1WHJA 5KYUA 3M4YA 2OX7A 1M4ZA 3VS6A 1T0JA 2E4HA 1H641 1WPYA 2I0NA 4C92C 2F2WA 1FMKA 1YITQ 1S1NA 5GAN3 1ZSZA 1IGUA 1X6GA 1HXDA 4GLKA 4AT1B 2DM1A 2HL3A 1Y57A 2QG9B 4OGEA 2O4XB 4IUQA 1OYXA 4M75A 4E7JA 2DE0X 2R5MA 1WQ7A 2FRYA 2NYSA 1BCMA 4FW1A 2D0NA 1VQ7A 1BIBA 1PD1A 3CCLQ 3VUBA 4QQGA 1QWFA 1X01A 2LP5A 5A0GA 1KSWA 1PRMC 2HQXA 5IHIA 1NLPC 3V7RA 2VYTA 2HD0A 4M75G 1M8VA 3SHWA 4ZTFA 4EMKA 3CCRA 1M90R 2KAFA 5GJVB 3OS5A 2GQIA 1VQ8Q 1WZOA 1UEBA 1LPLA 1UGPB 1K8AU 1VQ5T 2HBWA 3VS5A 3EG9B 3REBB 5CKDA 2JS0A 3EFOA 1Y07A 4M7DE 2KVQG 3QIIA 4DBFA 1G2BA 4A4EA 2KRNA 1NYFA 3JCMf 1UUEA 4MZTA 1BI1A 1IRXA 1SHGA 3M5AA 4M7DD 4J6WA 1R8OB 4C0DC 2V8IA 2RPNA 2FB7A 1RAAB 2CGHA 2DMOA 3V7CA 4FW2A 4MZPA 5I21A 4PJOB 4KGXB 4FIBA 2J6KA 3G1JA 5CKBA 3G71Q 3A8LB 4C0ZA 1ZUUA 2ZPIB 3PMTA 2A3LA 3H8ZA 3VJPA 3L2VA 4ORZA 2HEQA 3MKDA 5A0LA 4DOVA 3R6NA 2P4TA 3DB3A 2D8JA 4FYYB 2RJFA 3CC2A 2RM4A 5GAN5 2OTJA 1YJNA 2QQBA 2HQEA 1TUDA 5KE3A 1UGVA 1YWOA 1YHQA 4D6WA 2WSFE 1AT1B 2EYZA 2DLPA 2EYXA 4TVRA 3OSVA 4R55A 5GAN6 3ZFJA 1QVFA 2QA4T 1LNXA 1SEMA 2X3WD 2QDYB 4M78C 1OPKA 3G4ST 1SKUB 4J9HA 1N8RU 1WA7A 1YCSB 3RR6A 1QCNA 2CDTA 3X20B 2X35A 2JM8A 3A8GB 4ME7A 4XTUA 3JB9J 3EGDB 3CCUT 2CP7A 1VQOA 4ANJA 3HRTA 3V8LA 2RI2A 1YIJQ 3F70A 4AG1C 3OYAA 3JCMV 1RAGB 5KYWA 2AK5A 2L0AA 2KE9A 4AG2C 4E7SA 3UF4A 3E2UA 2L3QA 2EYWA 2RB6A 3I35A 3I5RA 2IIMA 5LJ5f 3JCMQ 4A53A 2KGTA 2EGCA 3OA6A 3FJPA 5LJ3g 2VXEA 1U3OA 2DK3A 5GAMd 1YJ9Q 2BKDN 2MYSA 1TXQA 2ED0A 1M2VB 3OW2A 4C5IA 1D0YA 4MDXA 5FWCA 2MWOA 4M77E 3CCJQ 2EKHA 1ABOA 2PTKA 1H3ZA 4ZGEB 1WIEA 1IXDA 4M77D 5CQXA 3JCMJ 2BE7D 4HKEA 1YJWQ 3M53A 2RK1A 4PJOE 1M1KU 1RLPC 2KK4A 3H0IA 3H0FA 4PJOD 1WXBA 5IHKA 1KQ2A 1BYMA 1PRLC 2DETA 1KD1R 3V8KA 2WSEE 1S72A 2KYMA 1G8XA 1WQWA 2C0OA 4PK4A 4J9FA 3RNJA 4OB3B 3CCSQ 2K6DA 2RJEA 1P92A 1WJRA 4M75C 1Q7YC 2AHJB 1VQ8A 1BKBA 2J6OA 3TSWA 3INZA 1H92A 4C5GA 3PGGA 1KHCA 5FU7B 3X25B 1Y96A 2L3SA 4F14A 1YBYA 4BE0A 1MV0B 1VQ9Q 1M30A 4PLIA 4EMKC 1NPPA 2MWPA 3KXTA 1QKWA 1KQSS 2CZ1B 4RTUA 5LJ3h 3I55T 1O75A 2QEXQ 1F1BB 1KK7A 1VQNQ 4FCYA 1NYGA 2KT1A 2KXDA 5KCOA 1XOVA 2XI9A 1AEYA 3SD4A 3P8DA 4XU3A 2L5QA 4O6JA 2YUQA 5FU6B 1VIFA 2YWWA 4N4GA 1G5VA 3CEYA 3UWNA 2FO0A 4JZ3A 1WJSA 4Z89A 4CI0C 2YT6A 1OI1A 3A8MB 2DBKA 1VYTA 4B9XA 1YI2T 1AHJB 5LJ5g 3OS1A 5EG2A 3HKSA 3OYIA 2KRSA 5LJ3j 1NJIU 2R5AA 2D1XA 3MCAB 1RI9A 4OMMA 2MPXC 3GNFB 3PT9A 5AYFA 4J9EA 2AIRB 4DBHA 4FYXB 3CC7A 1RADB 4F7UB 3J81E 1N5ZA 4Z8AA 4DBRA 2KROA 1VQ6A 3JB9G 2HAXA 3UA6A 5I11A 2B8AA 1JJ2S
chains in the Genus database with same CATH topology
2J05A 1T0HA 1ZUKA 1GBQA 4RTZA 1UJ0A 2YDLA 1AWXA 4J9DA 1NEGA 2SRCA 2EGEA 1FYNA 2CSQA 1K0XA 3U23A 1BK2A 2L3PA 2XMFA 2LNHB 1AD5A 1B3QA 3O5ZA 4J9CA 4HVVA 3VRYA 2KBTA 2JMCA 2J7IA 1UHCA 3NPFA 2KT8A 2MCNA 2JT4A 2EBPA 2O31A 2KNBB 1WXUA 4LN2A 3VRZA 1PWTA 4CC4B 1W70A 2FPDA 1HSQA 1T3LA 2W10A 2LCSA 2ENMA 2JXBA 1M3AA 3GBQA 1U06A 1WFWA 4GLMA 1K0SA 2DX1A 1U5SA 1RLQC 2NUZA 1I1JA 4IIOA 5IXBA 4J9GA 2BTTA 2DNUA 2BZXA 1ABQA 1UTIA 3M0UA 5FW9A 2YUPA 4LUDA 4KRTA 2J06A 3LH5A 1WI7A 3FJ5A 3NHNA 3QWXX 3VS1A 2EVRA 1EFNA 4FSSA 1W1FA 3ZL7C 2YUNA 4DEYA 2B86A 4JJCA 1I0CA 1LCKA 2EGAA 1WXTA 3EG3A 4OMQA 1QWEA 1Z9ZA 2AKKA 3A98A 1GBRA 1NM7A 2LMJA 2DJQA 4RTXA 1BBZA 1NEBA 1SRLA 2DL3A 2FG0A 2EPDA 3VS4A 3KFVA 1BB9A 2LJ3A 2RMOA 1NG2A 2ECZA 2HCKA 5I22A 4AFZC 4LE9A 3IQLA 4RTWA 2CUBA 1UECA 1AWJA 2EW3A 4J9BA 3VS7A 2O88A 2G6FX 2SEMA 1CKAA 5IH2A 5ECAA 3QWYA 1JXOA 1PNJA 4HVWA 3VS6A 2DRKA 4F17A 3SEMA 1T0JA 2HSPA 2I0NA 4X1VA 2F2WA 1FMKA 1S1NA 1UFFA 2VWFA 1E6GA 1X6GA 4JJBA 1X2QA 2OJ2A 2DM1A 2GTOA 4D8DA 1CKBA 3M0SA 1Y57A 2E5KA 3PE0A 3EG0A 2O9VA 1X6BA 2DL4A 4AFUC 4JZ4A 1ZLMA 4RTVA 2DE0X 2H8HA 2YSQA 2FRYA 3REAB 2V1QA 1GCQC 2D0NA 4ZNXA 4M4ZA 3C0CA 2A36A 2M0YA 1QWFA 1Y0MA 2LP5A 4CC2A 4F16A 1KSWA 1PRMC 2J6FA 1JQQA 3UATA 2FEIA 5IHIA 1NLPC 2LJ1A 2NWMA 3SHWA 2KRMA 4K11A 5GJVB 1H8KA 2GQIA 2DBMA 4OMOA 2K9GA 2KXCA 2HBWA 1K1ZA 4RTTA 3VS5A 3REBB 2JS0A 3PVLA 4CC3A 5L23A 1QCFA 1CSKA 2O9SA 1JO8A 1G2BA 2K79A 3M0QA 1JXMA 2KRNA 1NYFA 1UUEA 1SHGA 2LQWA 4OMPA 2F2XA 1QLYA 3H0HA 2A08A 4JPBW 1K76A 2RPNA 1M3CA 1OPLA 2DMOA 1IO6A 2AZVA 4R0KA 3EG1A 1WX6A 2L2PA 2JTEA 4Y92A 2DL5A 2EYYA 2J6KA 1ZUUA 2BZYA 4ORZA 2HEQA 3EHRA 4IIMA 3R6NA 4DEXA 1PKTA 2BZ8A 2D8JA 2CSIA 2A37A 4WCIA 2K7AA 1KFZA 1PKSA 3EG2A 2DA9A 3M0TA 1TUDA 1GCQA 3M0RA 1UGVA 1YWOA 3I5SA 2EYZA 1UE9A 2DLPA 2EYXA 1ZSGA 2D8HA 1BU1A 1SEMA 2ABLA 2GBQA 2RQWA 2X3WD 1GCPA 1MV3A 1OPKA 4J9HA 1WA7A 3TSZA 1YCSB 1YP5A 2K2MA 2P4RA 2JS2A 2RQTA 2CDTA 2AKLA 2JM8A 2MIOA 1GFCA 1YWPA 1AWOA 1TG0A 4OMLA 2ESWA 4AG1C 1SSHA 1UG1A 2M51A 4QT7A 3RBBB 4CC7A 2AZSA 2AK5A 2L0AA 1NLOC 2KE9A 4AG2C 1V1CA 1QKXA 2A28A 4Z88A 3UF4A 1M3BA 1GRIA 2L3QA 2EYWA 1VA7A 3I35A 1AZEA 2CUDA 3I5RA 2IIMA 2PNIA 3UA7A 4RTYA 2RQUA 2KGTA 2EGCA 1W6XA 1WLPB 4LUEA 2LZ6B 2RF0A 1HJDA 1U3OA 2DRMA 2VVKA 2DYBA 2YUOA 2ED0A 3NGPA 2OI3A 5IXFA 5FWCA 4E6RA 1J3TA 4AFQC 1UHFA 2EKHA 2GGRA 1ABOA 2DVJA 2PTKA 1OEBA 1B07A 1WIEA 2CT3A 2DILA 3PVQA 3EGUA 2V1RA 3TVTA 1X27A 1E7OA 3I9QA 2LQNA 2EQIA 2KYBA 2DL8A 1RUWA 2HDAA 2LJ0A 4HVUA 1RLPC 1K4US 3VS3A 3H0IA 1SHFA 5FWBA 3H0FA 3M0PA 1WXBA 1KJWA 1T3SA 2ROLA 1KIKA 5IHKA 1JEGA 2FRWA 3CQTA 4AFSC 2JW4A 1PRLC 5HCKA 2CH4A 2VKNA 1UJYA 1X69A 2DF6A 1M27C 2C0TA 2KYMA 1YN8A 4GBQA 2C0OA 2MOXA 4J9FA 5IHNA 2C0IA 3RNJA 2JMAA 1TUCA 2CH4W 2QDLA 2K6DA 4LNPA 1AVZC 1PHTA 2FPFA 2JM9A 4ESRA 1X2KA 5EC7A 3JV3A 4OMNA 1ARKA 2K3BA 2J6OA 3TSWA 1H92A 2PZ1A 1OOTA 1GFDA 2ROTA 2KR3A 4HXJA 2GNCA 1AOJA 2L3SA 4F14A 1MV0B 1M30A 2RQRA 3NMZC 1GL5A 2GTJA 4A63B 2ED1A 1QKWA 4RTUA 3VS2A 1SRMA 1NYGA 1AWWA 4EIKA 1Z9QA 1X43A 2LX7A 2KT1A 2KXDA 2OAWA 1XOVA 1AEYA 1WYXA 1JU5C 4JJDA 3THKA 4HCKA 2RNAA 2YUQA 2KEAA 3VS0A 1HD3A 4J9IA 2FO0A 4JZ3A 1WDXA 1VYUA 2RQVA 4Z89A 1H3HA 2YT6A 4D8KA 2DBKA 2RN8A 3H41A 1VYTA 3ULRB 2CREA 1SPKA 1I07A 2KRSA 2D1XA 5GJWB 2CT4A 1ZBJA 1E6HA 1RI9A 2X3XD 4OMMA 4RUGA 1ZX6A 2FPEA 3EHQA 1K9AA 2DL7A 4J9EA 1ZUYA 2W0ZA 2O2OA 2F2VA 1M8MA 1OV3A 1A0NB 1N5ZA 1YNZA 4Z8AA 2KROA 3UA6A 5I11A 1AZGB 1G83A 1VYVA 1UDLA 1MUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J05 A;  1T0H A;  1ZUK A;  1GBQ A;  4RTZ A;  1UJ0 A;  2YDL A;  1AWX A;  4J9D A;  1NEG A;  2SRC A;  2EGE A;  1FYN A;  2CSQ A;  1K0X A;  3U23 A;  1BK2 A;  2L3P A;  2XMF A;  2LNH B;  1AD5 A;  1B3Q A;  3O5Z A;  4J9C A;  4HVV A;  3VRY A;  2KBT A;  2JMC A;  2J7I A;  1UHC A;  3NPF A;  2KT8 A;  2MCN A;  2JT4 A;  2EBP A;  2O31 A;  2KNB B;  1WXU A;  4LN2 A;  3VRZ A;  1PWT A;  4CC4 B;  1W70 A;  2FPD A;  1HSQ A;  1T3L A;  2W10 A;  2LCS A;  2ENM A;  2JXB A;  1M3A A;  3GBQ A;  1U06 A;  1WFW A;  4GLM A;  1K0S A;  2DX1 A;  1U5S A;  1RLQ C;  2NUZ A;  1I1J A;  4IIO A;  5IXB A;  4J9G A;  2BTT A;  2DNU A;  2BZX A;  1ABQ A;  1UTI A;  3M0U A;  5FW9 A;  2YUP A;  4LUD A;  4KRT A;  2J06 A;  3LH5 A;  1WI7 A;  3FJ5 A;  3NHN A;  3QWX X;  3VS1 A;  2EVR A;  1EFN A;  4FSS A;  1W1F A;  3ZL7 C;  2YUN A;  4DEY A;  2B86 A;  4JJC A;  1I0C A;  1LCK A;  2EGA A;  1WXT A;  3EG3 A;  4OMQ A;  1QWE A;  1Z9Z A;  2AKK A;  3A98 A;  1GBR A;  1NM7 A;  2LMJ A;  2DJQ A;  4RTX A;  1BBZ A;  1NEB A;  1SRL A;  2DL3 A;  2FG0 A;  2EPD A;  3VS4 A;  3KFV A;  1BB9 A;  2LJ3 A;  2RMO A;  1NG2 A;  2ECZ A;  2HCK A;  5I22 A;  4AFZ C;  4LE9 A;  3IQL A;  4RTW A;  2CUB A;  1UEC A;  1AWJ A;  2EW3 A;  4J9B A;  3VS7 A;  2O88 A;  2G6F X;  2SEM A;  1CKA A;  5IH2 A;  5ECA A;  3QWY A;  1JXO A;  1PNJ A;  4HVW A;  3VS6 A;  2DRK A;  4F17 A;  3SEM A;  1T0J A;  2HSP A;  2I0N A;  4X1V A;  2F2W A;  1FMK A;  1S1N A;  1UFF A;  2VWF A;  1E6G A;  1X6G A;  4JJB A;  1X2Q A;  2OJ2 A;  2DM1 A;  2GTO A;  4D8D A;  1CKB A;  3M0S A;  1Y57 A;  2E5K A;  3PE0 A;  3EG0 A;  2O9V A;  1X6B A;  2DL4 A;  4AFU C;  4JZ4 A;  1ZLM A;  4RTV A;  2DE0 X;  2H8H A;  2YSQ A;  2FRY A;  3REA B;  2V1Q A;  1GCQ C;  2D0N A;  4ZNX A;  4M4Z A;  3C0C A;  2A36 A;  2M0Y A;  1QWF A;  1Y0M A;  2LP5 A;  4CC2 A;  4F16 A;  1KSW A;  1PRM C;  2J6F A;  1JQQ A;  3UAT A;  2FEI A;  5IHI A;  1NLP C;  2LJ1 A;  2NWM A;  3SHW A;  2KRM A;  4K11 A;  5GJV B;  1H8K A;  2GQI A;  2DBM A;  4OMO A;  2K9G A;  2KXC A;  2HBW A;  1K1Z A;  4RTT A;  3VS5 A;  3REB B;  2JS0 A;  3PVL A;  4CC3 A;  5L23 A;  1QCF A;  1CSK A;  2O9S A;  1JO8 A;  1G2B A;  2K79 A;  3M0Q A;  1JXM A;  2KRN A;  1NYF A;  1UUE A;  1SHG A;  2LQW A;  4OMP A;  2F2X A;  1QLY A;  3H0H A;  2A08 A;  4JPB W;  1K76 A;  2RPN A;  1M3C A;  1OPL A;  2DMO A;  1IO6 A;  2AZV A;  4R0K A;  3EG1 A;  1WX6 A;  2L2P A;  2JTE A;  4Y92 A;  2DL5 A;  2EYY A;  2J6K A;  1ZUU A;  2BZY A;  4ORZ A;  2HEQ A;  3EHR A;  4IIM A;  3R6N A;  4DEX A;  1PKT A;  2BZ8 A;  2D8J A;  2CSI A;  2A37 A;  4WCI A;  2K7A A;  1KFZ A;  1PKS A;  3EG2 A;  2DA9 A;  3M0T A;  1TUD A;  1GCQ A;  3M0R A;  1UGV A;  1YWO A;  3I5S A;  2EYZ A;  1UE9 A;  2DLP A;  2EYX A;  1ZSG A;  2D8H A;  1BU1 A;  1SEM A;  2ABL A;  2GBQ A;  2RQW A;  2X3W D;  1GCP A;  1MV3 A;  1OPK A;  4J9H A;  1WA7 A;  3TSZ A;  1YCS B;  1YP5 A;  2K2M A;  2P4R A;  2JS2 A;  2RQT A;  2CDT A;  2AKL A;  2JM8 A;  2MIO A;  1GFC A;  1YWP A;  1AWO A;  1TG0 A;  4OML A;  2ESW A;  4AG1 C;  1SSH A;  1UG1 A;  2M51 A;  4QT7 A;  3RBB B;  4CC7 A;  2AZS A;  2AK5 A;  2L0A A;  1NLO C;  2KE9 A;  4AG2 C;  1V1C A;  1QKX A;  2A28 A;  4Z88 A;  3UF4 A;  1M3B A;  1GRI A;  2L3Q A;  2EYW A;  1VA7 A;  3I35 A;  1AZE A;  2CUD A;  3I5R A;  2IIM A;  2PNI A;  3UA7 A;  4RTY A;  2RQU A;  2KGT A;  2EGC A;  1W6X A;  1WLP B;  4LUE A;  2LZ6 B;  2RF0 A;  1HJD A;  1U3O A;  2DRM A;  2VVK A;  2DYB A;  2YUO A;  2ED0 A;  3NGP A;  2OI3 A;  5IXF A;  5FWC A;  4E6R A;  1J3T A;  4AFQ C;  1UHF A;  2EKH A;  2GGR A;  1ABO A;  2DVJ A;  2PTK A;  1OEB A;  1B07 A;  1WIE A;  2CT3 A;  2DIL A;  3PVQ A;  3EGU A;  2V1R A;  3TVT A;  1X27 A;  1E7O A;  3I9Q A;  2LQN A;  2EQI A;  2KYB A;  2DL8 A;  1RUW A;  2HDA A;  2LJ0 A;  4HVU A;  1RLP C;  1K4U S;  3VS3 A;  3H0I A;  1SHF A;  5FWB A;  3H0F A;  3M0P A;  1WXB A;  1KJW A;  1T3S A;  2ROL A;  1KIK A;  5IHK A;  1JEG A;  2FRW A;  3CQT A;  4AFS C;  2JW4 A;  1PRL C;  5HCK A;  2CH4 A;  2VKN A;  1UJY A;  1X69 A;  2DF6 A;  1M27 C;  2C0T A;  2KYM A;  1YN8 A;  4GBQ A;  2C0O A;  2MOX A;  4J9F A;  5IHN A;  2C0I A;  3RNJ A;  2JMA A;  1TUC A;  2CH4 W;  2QDL A;  2K6D A;  4LNP A;  1AVZ C;  1PHT A;  2FPF A;  2JM9 A;  4ESR A;  1X2K A;  5EC7 A;  3JV3 A;  4OMN A;  1ARK A;  2K3B A;  2J6O A;  3TSW A;  1H92 A;  2PZ1 A;  1OOT A;  1GFD A;  2ROT A;  2KR3 A;  4HXJ A;  2GNC A;  1AOJ A;  2L3S A;  4F14 A;  1MV0 B;  1M30 A;  2RQR A;  3NMZ C;  1GL5 A;  2GTJ A;  4A63 B;  2ED1 A;  1QKW A;  4RTU A;  3VS2 A;  1SRM A;  1NYG A;  1AWW A;  4EIK A;  1Z9Q A;  1X43 A;  2LX7 A;  2KT1 A;  2KXD A;  2OAW A;  1XOV A;  1AEY A;  1WYX A;  1JU5 C;  4JJD A;  3THK A;  4HCK A;  2RNA A;  2YUQ A;  2KEA A;  3VS0 A;  1HD3 A;  4J9I A;  2FO0 A;  4JZ3 A;  1WDX A;  1VYU A;  2RQV A;  4Z89 A;  1H3H A;  2YT6 A;  4D8K A;  2DBK A;  2RN8 A;  3H41 A;  1VYT A;  3ULR B;  2CRE A;  1SPK A;  1I07 A;  2KRS A;  2D1X A;  5GJW B;  2CT4 A;  1ZBJ A;  1E6H A;  1RI9 A;  2X3X D;  4OMM A;  4RUG A;  1ZX6 A;  2FPE A;  3EHQ A;  1K9A A;  2DL7 A;  4J9E A;  1ZUY A;  2W0Z A;  2O2O A;  2F2V A;  1M8M A;  1OV3 A;  1A0N B;  1N5Z A;  1YNZ A;  4Z8A A;  2KRO A;  3UA6 A;  5I11 A;  1AZG B;  1G83 A;  1VYV A;  1UDL A;  1MUZ A; 
#chains in the Genus database with same CATH topology
 2L89 A;  4JRI A;  1ZUK A;  1MMA A;  1GBQ A;  4RTZ A;  3EGX B;  3CCE Q;  2HQH A;  5KYX B;  4EPC A;  2EQU A;  2SRC A;  1W2B P;  1IHW A;  2EGE A;  1K0X A;  1VOM A;  2EQK A;  5GAO r;  1Y71 A;  2EWN A;  2VGN A;  2XMF A;  3OQ5 A;  4C5E A;  2LNH B;  4M7A B;  2KBT A;  1WNL A;  1VQ4 Q;  5AT1 B;  4FL6 A;  4C0D B;  4FSX A;  4P5N A;  3S3M A;  4LN2 A;  3LH0 A;  1HSQ A;  5GAM e;  2W10 A;  1KC8 U;  1TWB A;  3GPL A;  1M3A A;  5GMK h;  5CQY A;  3SWN B;  1R0B G;  3BDU A;  1U5S A;  4M75 F;  3LWI A;  2NUZ A;  2P0Q A;  1I1J A;  4IIO A;  2XKO C;  1ABQ A;  1UTI A;  2R58 A;  3M0U A;  5FW9 A;  2I2L A;  4RCC A;  1PSF A;  3G7Z A;  4B9W A;  3HRS A;  1BCO A;  3FJ5 A;  3VS1 A;  2RI3 A;  3G6E Q;  1EFN A;  4DEY A;  3KUF A;  4JJC A;  1I0C A;  4C92 E;  2EAY A;  5GAN 8;  1Q82 U;  4OMQ A;  1VQK T;  3BW1 A;  5GMK j;  1GBR A;  3M4G A;  2DJQ A;  1IZ6 A;  5LL6 S;  1Q81 U;  4UC4 A;  2CP5 A;  3RES A;  1I8F A;  2LJ3 A;  2RMO A;  1NG2 A;  2ECZ A;  2HCK A;  5I22 A;  2ZPB B;  2MF2 A;  2CUB A;  3OYL A;  1UEC A;  1BIA A;  3C95 A;  2JZ2 A;  2G6F X;  2LT4 A;  3CCS A;  3OMG A;  1CKA A;  2ZCF B;  5IH2 A;  1SG5 A;  3EGX A;  3KBG A;  3CCQ T;  1PNJ A;  4HVW A;  4F7U E;  2DRK A;  4RMO A;  4F17 A;  3SEM A;  2VWF A;  1RAI B;  1K9M U;  2BUD A;  4N0A A;  4DQ2 A;  4M7A A;  4JRK A;  3TCJ A;  2JN0 A;  3PE0 A;  3L42 A;  2ZZD A;  3RDV A;  1VQ9 A;  1X6B A;  4RKU E;  3CD6 T;  2DL4 A;  3QZ9 B;  4RTV A;  4KUL A;  1K73 U;  2DPP B;  4X9C A;  3REA B;  4XTW A;  1VQN A;  3I56 T;  4M4Z A;  3C0C A;  3SWN A;  4M7A G;  4CC2 A;  4F16 A;  4QVC A;  2J6F A;  1JQQ A;  1ZBX A;  1R77 A;  1VQL A;  1HK9 A;  1VQ5 Q;  5A0D A;  4DBQ A;  2RHX A;  1M2O A;  5I2M A;  1D3B B;  3OYB A;  2K9G A;  2KXC A;  2A0F B;  4XU2 A;  3QKJ A;  3PVL A;  2LTO A;  1CSK A;  1LOJ A;  2O9S A;  2RHU A;  3RKY A;  2K79 A;  1JXM A;  4PJL A;  2JVV A;  3JRZ A;  3J80 E;  1RI0 A;  4OMP A;  1QVF P;  2HSE B;  1QLY A;  2A08 A;  4BE2 A;  1M3C A;  5GAN h;  2E64 A;  4OP0 A;  3JCM d;  1IO6 A;  3Q1J A;  1VQP T;  4M7D B;  2NUP A;  2AZV A;  3M57 A;  2L2P A;  4Y92 A;  3CPW P;  3CCE A;  1W2B A;  3QSU A;  2X4J A;  4IIM A;  1PKT A;  1D1C A;  3L1A A;  4DOW A;  1KFZ A;  1PKS A;  3M0T A;  5IN1 A;  3HRU A;  2QA4 Q;  3HL8 A;  4MMK A;  1GCQ A;  3M0R A;  4PL6 A;  5GAN j;  2YRC A;  2YHT A;  3G4S Q;  1M1G A;  4E2F B;  3I5S A;  3C94 A;  5J3B A;  3MEW A;  1N8R R;  2GBQ A;  2ABL A;  4OVA A;  1G3W A;  3OW2 P;  1MV3 A;  3CCU Q;  3HPW A;  3BY7 A;  4ELZ C;  1D0Z A;  4N4I A;  4L59 A;  1AWO A;  5DLO A;  2PUK B;  2F5K A;  3CCM A;  2EJ9 A;  3QDR B;  1VQ7 T;  2ESW A;  1SSH A;  3RBB B;  4QT7 A;  1C0M A;  4A54 A;  1EZZ B;  2LX9 A;  2QYZ A;  4LDW A;  1V1C A;  2A28 A;  1M3B A;  1VA7 A;  2CUD A;  4RTY A;  1QMC A;  3CCR T;  2DER A;  3QJ6 A;  1QW1 A;  1HJD A;  5LJ3 f;  1LVK A;  3JCM b;  5GMK m;  4J5Y A;  3WVE B;  3D7S B;  4M7D A;  3DLL A;  5LJ5 d;  1HYO A;  5D6X A;  1PG5 B;  4IUT A;  4XK8 E;  4E6R A;  2KI7 A;  4RG8 A;  4HT9 A;  1EX4 A;  1OEB A;  3H6Z A;  2DIG A;  2CT3 A;  2DIL A;  1M1K R;  1ACM B;  3TVT A;  1X27 A;  2LQN A;  2EQI A;  4M7D G;  2MMP A;  2DL8 A;  2HDA A;  3LX7 A;  5CIU A;  3V8J A;  4M77 B;  2RK2 A;  1M5Q 1;  2WAC A;  3CCV T;  2QQ9 A;  4OF1 A;  1JEG A;  3CQT A;  3HSB A;  4Y28 E;  3VUZ A;  4EMG A;  2VKN A;  2K3X A;  3CC2 T;  5FRN A;  2H3J A;  4HCZ A;  3JB9 F;  2DO3 A;  4HCC A;  2C0T A;  2OTJ T;  1YJN T;  4N0A C;  1BI3 A;  2GCX A;  2QK0 A;  2MOX A;  3MP1 A;  5IHN A;  1Y7X A;  1PHT A;  2QXF A;  1B34 B;  2FPF A;  2JM9 A;  3CXC S;  3PIP A;  1X2K A;  4FYW B;  5EC7 A;  5GAO p;  2QQR A;  1ARK A;  1WHK A;  1QVG S;  8AT1 B;  3RMQ A;  3NTI A;  1GFD A;  2O4X A;  2KR3 A;  2NUT B;  4C8Q B;  2GNC A;  3I55 Q;  1AOJ A;  1RAF B;  4J7F A;  1IHV A;  1UGQ B;  2GTJ A;  1VQO T;  2RJD A;  4A63 B;  2K57 A;  4NS5 A;  1X43 A;  2LX7 A;  5GAN 2;  3JCM e;  1MGQ A;  2DIQ A;  4XTV A;  1JU5 C;  1LJO A;  3MP6 A;  4JJD A;  3CPW A;  2RNA A;  2VXF A;  4LDU A;  2E1H A;  3VS0 A;  3EG9 A;  4BB7 A;  2RQV A;  1YCY A;  3GIB A;  4BUG A;  2E6Z A;  1I07 A;  4XU1 A;  4M77 A;  3JCM P;  2CT4 A;  1E6H A;  1ZX6 A;  2FPE A;  3EHQ A;  3M9Q A;  4FU6 A;  3FC3 A;  1K9A A;  2FYK A;  2DL7 A;  1OU8 A;  4JDS A;  3H9N A;  2O2O A;  1A0N B;  1OV3 A;  3AT1 B;  2RHI A;  4PJO A;  5CR2 A;  4IKF A;  1AZG B;  2PUO B;  4PNO A;  2M1H A;  4M77 G;  1VYV A;  2LRQ A;  5L8R E;  5CCA A;  1YIT A;  2X9H A;  3NTH A;  3JCM c;  2K5L A;  2CP2 A;  2DKG A;  2JJ9 A;  3LGL A;  1S72 T;  3PTA A;  3CMA T;  3X26 B;  4PJO G;  1I5O B;  2X51 A;  1WHL A;  2NUT A;  3OS0 A;  4BI8 B;  1AD5 A;  3S3N A;  4HVV A;  1VUB A;  3X24 B;  1UHC A;  1ZSZ C;  2KT8 A;  4BY6 B;  1OUL A;  2ATC B;  2EBP A;  4E7I A;  2O31 A;  1KC8 R;  1M90 C;  3VRZ A;  1PWT A;  3CCL A;  3HFN A;  3OYN A;  4A4F A;  1Q7Y U;  2FPD A;  4C8Q E;  1JJ2 A;  2JUF A;  2LCS A;  2JXB A;  4M7A F;  3JCM W;  3GBQ A;  5KH6 A;  2HL5 C;  1M1K C;  3EGD A;  2R57 A;  5LJ5 e;  4GLM A;  4C8Q D;  2DX1 A;  3O8V A;  4QQ6 A;  5IXB A;  4KGZ B;  1DJ7 B;  2DNU A;  3M54 A;  2BZX A;  4IUP A;  2VC8 A;  1UGS B;  1TU0 B;  4JUV A;  2DZ9 A;  1VQK Q;  2OTL T;  1WI7 A;  5FRM A;  3TU4 K;  2FZC B;  1W1F A;  3ZL7 C;  2YUN A;  1Q82 R;  2X4Y A;  3EFS A;  3OMC A;  2EGA A;  3VKI A;  1Z9Z A;  1Q81 R;  2LMJ A;  4Z02 A;  1M2V A;  2FG0 A;  1SRL A;  3VS4 A;  5GAN f;  3L2U A;  4FT4 A;  2PQW A;  3CCQ Q;  2XDP A;  2A7Y A;  3URG A;  5GAO q;  2LT1 A;  3IQL A;  2Y4Y A;  3SDZ A;  2L8D A;  4C92 B;  3G71 A;  2RO0 A;  2SEM A;  1N9S A;  2BIV A;  3QYG B;  2RH2 A;  1TTH B;  5J26 A;  3CC7 T;  4MML A;  2HSP A;  2VGM A;  1K9M R;  1XJW B;  3MHX A;  1UFF A;  3GOX A;  1VQ6 T;  4VUB A;  3CD6 Q;  2DTH A;  4JJB A;  3AHU A;  1X2Q A;  3CPF A;  4FM4 B;  4FYV B;  4OMF B;  2GTO A;  5CKH A;  4D8D A;  1PCX A;  3HTR A;  2E5K A;  2DD4 A;  3PNW C;  1RAE B;  3I56 Q;  5GAO m;  2O9V A;  4PFZ A;  1K73 R;  2D0Q B;  2DXB A;  4JZ4 A;  2DTI A;  2YSQ A;  3CC4 T;  2V1Q A;  4ELY C;  3UDC A;  2A36 A;  3OYK A;  2M0Y A;  4QKU A;  1TH7 A;  1KG1 A;  4XAX B;  2E3I A;  1YIJ A;  2NWM A;  2KRM A;  2DXT A;  4K11 A;  4QVD A;  2KQW A;  1OX9 A;  4OMO A;  4QQD A;  2Y90 A;  3M56 A;  3OBY A;  4HCB A;  1FMW A;  1QCF A;  3GF5 A;  1JO8 A;  3M0Q A;  3RUX A;  2QGF B;  5GAN 7;  2VUB A;  3M59 A;  2L3R A;  3BDL A;  3DKM A;  2FL7 A;  2XDD A;  1VQP Q;  2XK0 A;  1YJ9 A;  4YTL A;  2LQK A;  2F2X A;  5GMK i;  1IB8 A;  4C5H A;  5D7U A;  2FVU A;  3E9F A;  2EKO A;  5CKE A;  3CCJ A;  3LLR A;  4C92 A;  4LDY A;  1SSF A;  3R6O A;  1VQM T;  1WJQ A;  4AMC A;  4E47 A;  1YJW A;  4XTY A;  3EHR A;  3TQ7 P;  1C6V X;  2K5I A;  1KD1 C;  2XD0 A;  1KQ1 A;  3C4S A;  2CSI A;  4M7D F;  2A37 A;  4PJO C;  2F5T X;  2P0P A;  1U1S A;  1KC8 C;  4C92 G;  3TRE A;  2DA9 A;  3L2W A;  3CME Q;  4C92 D;  3QG1 A;  2LCL A;  2EJG A;  4M78 B;  5DLQ E;  5GAN g;  1JBM A;  1RAH B;  4F7U A;  2LNV A;  4EDU A;  1MHN A;  1ZQ1 A;  3FB9 A;  2VB6 A;  2DFU A;  2D8H A;  1BU1 A;  2RQW A;  3MO8 A;  2Z0W A;  1GCP A;  1PC0 A;  1Q86 U;  1YP5 A;  3BE3 A;  4JJN K;  2P4R A;  4ZTJ A;  1VQ7 Q;  5KYX A;  5M9O A;  1VQ9 T;  9ATC B;  1GFC A;  4F7U G;  1Q82 C;  1O9S A;  1UGR B;  4X34 A;  2PVO B;  1TG0 A;  5GAO l;  3QHS A;  1JRI A;  1Q81 C;  2H3E B;  3CCR Q;  2CP0 A;  1UG1 A;  5GAM g;  2M51 A;  3V7S A;  3T9N A;  2KDS A;  1QKX A;  3RKX A;  1NZ9 A;  1VQL T;  3UA7 A;  1G3T A;  2K4Y A;  2ZPE B;  2RQU A;  2ZPF B;  2QEX A;  1D09 B;  2RF0 A;  1V76 A;  4OB2 B;  3MET A;  2DRM A;  3PMI A;  1U1T A;  2VVK A;  3FLG A;  2YUO A;  3FIF A;  2EJF A;  1K9M C;  2GFA A;  3OYH A;  5IXF A;  1K8A R;  5LJ3 d;  1J3T A;  1UHF A;  3DLM A;  1MMD A;  2DVJ A;  3TEE A;  1B07 A;  2E10 A;  5KYU B;  2E6N A;  1K73 C;  3OYE A;  3X28 B;  3CCV Q;  1E7O A;  3I9Q A;  3QXE B;  1RUW A;  1G3Y A;  1MMN A;  3A8O B;  2QQA A;  4E7L A;  3CC2 Q;  1K4U S;  1ZSZ B;  3VS3 A;  1SHF A;  5FWB A;  2RJC A;  3M0P A;  1T3S A;  1YJN Q;  1KIK A;  1VIE A;  2BE9 B;  3BFM A;  4O5V A;  5HCK A;  2CH4 A;  1N27 A;  2QQS A;  1X69 A;  4M75 B;  3FDR A;  1YN8 A;  4M77 F;  2IPO B;  4M78 E;  5KCH A;  5GAO n;  2JMA A;  1TUC A;  1OZ3 A;  4M78 G;  4PJM A;  4BDZ A;  4M78 D;  3S3O A;  4J6X A;  4CRI A;  1QP3 A;  3LYI A;  2D6F A;  4PFP A;  4PJO F;  3JV3 A;  4OMN A;  2O01 E;  3EFR A;  4EMK B;  2XG8 D;  2DXU A;  2Y4X A;  5GAM h;  1NPR A;  1VQ4 A;  4HT8 A;  4BAC A;  4XTX A;  1KQS P;  3QYH B;  4IUR A;  4KUD K;  3EFO B;  3OY9 A;  2V8K A;  2RI5 A;  2RQR A;  1GL5 A;  3E1S A;  3CCM T;  3MEV A;  5FU7 C;  4WTO B;  5KYN A;  3FRN A;  4RG2 A;  5FLX E;  2CZ7 B;  2HMA A;  2OAW A;  4PJJ A;  1D3B A;  4KH1 B;  2EQJ A;  3THK A;  1FXX A;  4HCK A;  2KEA A;  3HP9 A;  2DTO A;  2CKK A;  4ZN1 A;  1HD3 A;  5GAM j;  4J9I A;  4ATO A;  3G6E A;  1VYU A;  2F69 A;  4D8K A;  3OBW A;  3H41 A;  2RN8 A;  4E7H A;  3ULR B;  2DYI A;  3E9G A;  5FU6 C;  1TOV A;  1C1A A;  1SPK A;  1FX7 A;  4A4G A;  3CME A;  2COW A;  5GJW B;  2X3X D;  8ATC B;  1TUG B;  3ZBD A;  4DA4 A;  1JJ2 P;  1ZUY A;  2W0Z A;  3JB9 I;  4LDX A;  1ZA1 B;  2F2V A;  1M8M A;  2XDB A;  3E19 A;  3WVD B;  4II1 A;  5HY6 A;  5A2Q E;  4LDV A;  4V2S A;  1S72 Q;  1UDL A;  2MAM A;  4IUV A;  3CMA Q;  1T0H A;  3EAE A;  2E70 A;  2WSC E;  2YDL A;  1AWX A;  2QAZ A;  2HZY A;  4M75 E;  3VYG A;  3J7A F;  2VAS A;  2PVG B;  3U23 A;  1XQH A;  2KSS A;  4M75 D;  3RER A;  4KH0 B;  1B3Q A;  1QQJ A;  1V29 B;  4J9C A;  1W2B S;  1WHH A;  5KYW B;  4PFO A;  2MCN A;  1Q7Y R;  4OGC A;  2RA2 A;  3OYM A;  1K8A C;  1WXU A;  3QZ5 B;  4CC4 B;  1W70 A;  4M7A C;  1T3L A;  1UB4 A;  1R0C B;  1YHQ T;  4WF2 A;  2FZG B;  1VQ5 A;  6AT1 B;  2OTL Q;  2F1L A;  2E12 A;  1RLQ C;  4J9G A;  2E41 A;  5LJ3 e;  2YUP A;  4LUD A;  2VV5 A;  4KRT A;  3SWN C;  2CS7 A;  3UT1 A;  3CCV A;  2DEQ A;  3NHN A;  3QWX X;  2EVR A;  1JB0 E;  3WXM B;  5C6S A;  2B86 A;  4OB1 B;  1OU9 A;  4XQ3 A;  4IUU A;  2HKN A;  1WXT A;  4NOY A;  4R56 A;  1OQK A;  4XU0 A;  2EIF A;  3A98 A;  4PKC C;  3EH1 A;  1NM7 A;  4KUI A;  5FRO A;  4RTX A;  4JRQ A;  4E7Z A;  1WHM A;  1NEB A;  2CZ6 B;  2EPD A;  1I4K 1;  4AFZ C;  1YI2 Q;  5KYY B;  2CP3 A;  4GY5 A;  3CC7 Q;  4RTW A;  1AWJ A;  4BI3 A;  2CZ0 B;  3VS7 A;  4KT0 E;  5DM7 R;  4ZGJ B;  1VQ6 Q;  2DEU A;  1IRE B;  5GAN d;  5ECA A;  2CYZ B;  3C12 A;  3QWY A;  4HA8 A;  1JXO A;  3A5Z B;  2YLB A;  3JAM E;  1NJI R;  1PM3 A;  5GMK l;  4X1V A;  1N8R C;  4C92 F;  1E6G A;  2QA4 A;  2DVE A;  3VYH B;  2OJ2 A;  1XNI A;  1KQS A;  4J7I A;  3G4S A;  1CKB A;  2M9U A;  4XTZ A;  3OYJ A;  3M0S A;  3CC4 Q;  3EG0 A;  1YIT T;  2MK5 A;  4AFU C;  1Y96 B;  1ZLM A;  2H8H A;  3QBY A;  1D1A A;  3CCU A;  3GP8 A;  2FHD A;  2JNG A;  3NFC A;  1GCQ C;  4JRP A;  4ZNX A;  1Y0M A;  1B34 A;  3UAT A;  2FEI A;  2LC4 A;  4F7U F;  2LJ1 A;  5CKF A;  1KHI A;  3JSC A;  3CCL T;  2XHC A;  1H8K A;  2DBM A;  4Y91 A;  4C8Q A;  3VV0 A;  5GMK e;  1M90 U;  4A4H A;  1K1Z A;  4RTT A;  5L23 A;  4CC3 A;  2V8J A;  2FZK B;  3JCM g;  2EYQ A;  3SB2 A;  1VQ8 T;  4ZN3 A;  2LQW A;  1N6A A;  4J6Y A;  2EFI A;  2HKQ B;  1VQM Q;  1WHG A;  3H0H A;  4C8Q G;  4JPB W;  3JB9 H;  1K76 A;  2IG0 A;  1OPL A;  3MJX A;  5KYY A;  3ASK A;  3ME9 A;  2YRD A;  1QVF S;  4R0K A;  3EG1 A;  5CO7 A;  1WX6 A;  3CMA A;  2C06 A;  2JTE A;  3MEA A;  2DL5 A;  2EYY A;  3NTK A;  2IVW A;  4RCB A;  3UPU A;  2BZY A;  2PVD B;  3L2Q A;  2M02 A;  3CBP A;  4M7D C;  5C0M A;  2GFU A;  4DEX A;  1QVP A;  2BZ8 A;  3OYY A;  4Q5W A;  3GLX A;  3QPH A;  4WCI A;  2KY9 A;  3FEO A;  1I81 A;  2K7A A;  2QI2 A;  3QDF A;  3G71 T;  3CPW S;  1WGS A;  3EG2 A;  4NL3 A;  3M58 A;  4FT2 A;  2V26 A;  2X4W A;  4JS4 A;  1UE9 A;  4LXC A;  1M9S A;  5D6Y A;  2COZ A;  2HBP A;  1Q86 R;  1ZSG A;  2DAQ A;  3P8B B;  2GF7 A;  4C0G A;  1RAC B;  1M1F A;  1OZ2 A;  3TSZ A;  2K2M A;  4M78 F;  2JS2 A;  2RQT A;  2OTL A;  4BD3 A;  2AKL A;  5HK0 A;  5IAY A;  2MIO A;  1YWP A;  3OW2 S;  4PLL A;  1W4S A;  1VQL Q;  4OML A;  2AT1 B;  2K3Y A;  2DZC A;  3I55 A;  4CC7 A;  5J39 A;  2XIC A;  2AZS A;  4NL2 A;  1EIF A;  5GAM f;  2KMT A;  1D0X A;  1NLO C;  5CAI A;  4Z88 A;  2D9T A;  1GRI A;  1YFN A;  1AZE A;  4JS5 A;  2PNI A;  3JCM h;  1YIJ T;  1I5L A;  3L2Z A;  4N4H A;  1W6X A;  1WLP B;  4LUE A;  2LZ6 B;  2JTM A;  2QTV A;  2QAS A;  3PFS A;  2YLC A;  3LW5 E;  3MEU A;  1TS9 A;  3QJY A;  2DYB A;  3NGP A;  1NJI C;  5KE2 A;  2OI3 A;  1YI2 A;  4BDY A;  5D6W A;  4KGV B;  3SFM A;  1YJ9 T;  3L2R A;  2OAU A;  4AFQ C;  1MND A;  2MI6 A;  2GGR A;  3JB9 D;  4KBM B;  5GAN e;  3PVQ A;  3EGU A;  2V1R A;  2NLU A;  2LVM A;  4MDW A;  2KYB A;  2P84 A;  4BE1 A;  3CCJ T;  1QP2 A;  4HVU A;  2LJ0 A;  3LWH A;  4A4K A;  3DB4 A;  2GQV A;  4E7K A;  3CC4 A;  1KJW A;  4X9D A;  2ROL A;  1YJW T;  3ZEH A;  2FRW A;  3OYF A;  4AFS C;  2JW4 A;  2LDM A;  1UJY A;  2DF6 A;  3ER0 A;  1M27 C;  4M77 C;  1KD1 U;  4GBQ A;  2G3R A;  2M16 A;  3MPU B;  3CXC P;  5I2S A;  2C0I A;  2CH4 W;  4JLI A;  2QDL A;  1RL2 A;  4LNP A;  1QVG P;  1AVZ C;  1NBE B;  2ZPH B;  3S6W A;  4JLG A;  4ESR A;  2K5F A;  4C0F A;  3CCS T;  2K3B A;  2DXC A;  3OS2 A;  1FWZ A;  3CCM Q;  2PZ1 A;  1SF9 A;  1OOT A;  2ROT A;  2X4X A;  4HXJ A;  4LD6 A;  3RMS A;  2PU9 B;  1BI2 A;  3RKW A;  5LJ5 h;  1G3S A;  3NMZ C;  2K2V A;  1Q95 G;  2JTF A;  1VQM A;  2ED1 A;  3VS2 A;  4C8Q C;  1SRM A;  3LGF A;  3HFO A;  1AWW A;  4EIK A;  1Z9Q A;  2P0K A;  4F04 B;  5HK3 A;  1WYX A;  2M0O A;  3QO3 A;  5DY9 A;  2NUP B;  2E3H A;  2QEX T;  7AT1 B;  1VQK A;  2E5Q A;  1VQN T;  4L5G A;  4J83 A;  3GNG A;  1WDX A;  1H3H A;  3JCM X;  3CBO A;  1XTD A;  2JOY A;  3CBM A;  3HHT B;  2DD5 A;  5LJ5 j;  4ZGD B;  1QCO A;  2CRE A;  1Q86 C;  1U8R A;  2HNI A;  5GAN 4;  1FMV A;  4B6M A;  1ZBJ A;  4RUG A;  2CP6 A;  4MZM A;  3A8H B;  2RHZ A;  2LQ8 A;  3CCQ A;  5CK9 A;  1YNZ A;  5IT9 E;  2YXY A;  1G83 A;  2ZPG B;  4OB0 B;  1MUZ A;  4M7A E;  2J05 A;  3OYG A;  3OB9 A;  1UJ0 A;  4J9D A;  3PIO A;  1NEG A;  3CD6 A;  4M7A D;  1TSF A;  1FYN A;  2CSQ A;  1X75 C;  1BK2 A;  3QUI A;  4J8O A;  4M78 A;  2L3P A;  3I56 A;  2OTJ Q;  3CCE T;  2YRV A;  3O5Z A;  4LD9 K;  2LCC A;  3VRY A;  2JMC A;  3VU3 C;  3MP8 A;  1YHQ Q;  2J7I A;  2XU8 A;  1ZA2 B;  3NPF A;  2EQM A;  4BI4 A;  1D1B A;  1RAB B;  2JT4 A;  3P8H A;  2KNB B;  3OYC A;  1VQ4 T;  2ENM A;  4EMH A;  4QW2 A;  1U06 A;  1WFW A;  1OX8 A;  2RD1 A;  4BY6 C;  3EH2 A;  1K0S A;  2BTT A;  2ZAE A;  3M55 A;  1PSE A;  1PD0 A;  1VQO Q;  3OYD A;  2J06 A;  1X6O A;  3LH5 A;  2DJZ A;  2COY A;  3RIR A;  2RHY A;  4FSS A;  2ZGW A;  2E65 A;  1VQP A;  1N9R A;  1NE8 A;  1LCK A;  1ZHI A;  2QGG A;  5HKC A;  3EG3 A;  3A1P A;  1GXI E;  1QWE A;  2AKK A;  1MMG A;  3OSS C;  3G6E T;  2QTX A;  4C8Q F;  2XID A;  5CVI A;  1BBZ A;  2DL3 A;  1BI0 A;  1BB9 A;  1B7T A;  3KFV A;  1IGQ A;  4PJN A;  4QVZ A;  3CXC A;  4L6V 5;  3N5B B;  4LE9 A;  3CME T;  1MNE A;  2EW3 A;  4J9B A;  1QVG A;  2O88 A;  1WHJ A;  5KYU A;  3M4Y A;  2OX7 A;  1M4Z A;  3VS6 A;  1T0J A;  2E4H A;  1H64 1;  1WPY A;  2I0N A;  4C92 C;  2F2W A;  1FMK A;  1YIT Q;  1S1N A;  5GAN 3;  1ZSZ A;  1IGU A;  1X6G A;  1HXD A;  4GLK A;  4AT1 B;  2DM1 A;  2HL3 A;  1Y57 A;  2QG9 B;  4OGE A;  2O4X B;  4IUQ A;  1OYX A;  4M75 A;  4E7J A;  2DE0 X;  2R5M A;  1WQ7 A;  2FRY A;  2NYS A;  1BCM A;  4FW1 A;  2D0N A;  1VQ7 A;  1BIB A;  1PD1 A;  3CCL Q;  3VUB A;  4QQG A;  1QWF A;  1X01 A;  2LP5 A;  5A0G A;  1KSW A;  1PRM C;  2HQX A;  5IHI A;  1NLP C;  3V7R A;  2VYT A;  2HD0 A;  4M75 G;  1M8V A;  3SHW A;  4ZTF A;  4EMK A;  3CCR A;  1M90 R;  2KAF A;  5GJV B;  3OS5 A;  2GQI A;  1VQ8 Q;  1WZO A;  1UEB A;  1LPL A;  1UGP B;  1K8A U;  1VQ5 T;  2HBW A;  3VS5 A;  3EG9 B;  3REB B;  5CKD A;  2JS0 A;  3EFO A;  1Y07 A;  4M7D E;  2KVQ G;  3QII A;  4DBF A;  1G2B A;  4A4E A;  2KRN A;  1NYF A;  3JCM f;  1UUE A;  4MZT A;  1BI1 A;  1IRX A;  1SHG A;  3M5A A;  4M7D D;  4J6W A;  1R8O B;  4C0D C;  2V8I A;  2RPN A;  2FB7 A;  1RAA B;  2CGH A;  2DMO A;  3V7C A;  4FW2 A;  4MZP A;  5I21 A;  4PJO B;  4KGX B;  4FIB A;  2J6K A;  3G1J A;  5CKB A;  3G71 Q;  3A8L B;  4C0Z A;  1ZUU A;  2ZPI B;  3PMT A;  2A3L A;  3H8Z A;  3VJP A;  3L2V A;  4ORZ A;  2HEQ A;  3MKD A;  5A0L A;  4DOV A;  3R6N A;  2P4T A;  3DB3 A;  2D8J A;  4FYY B;  2RJF A;  3CC2 A;  2RM4 A;  5GAN 5;  2OTJ A;  1YJN A;  2QQB A;  2HQE A;  1TUD A;  5KE3 A;  1UGV A;  1YWO A;  1YHQ A;  4D6W A;  2WSF E;  1AT1 B;  2EYZ A;  2DLP A;  2EYX A;  4TVR A;  3OSV A;  4R55 A;  5GAN 6;  3ZFJ A;  1QVF A;  2QA4 T;  1LNX A;  1SEM A;  2X3W D;  2QDY B;  4M78 C;  1OPK A;  3G4S T;  1SKU B;  4J9H A;  1N8R U;  1WA7 A;  1YCS B;  3RR6 A;  1QCN A;  2CDT A;  3X20 B;  2X35 A;  2JM8 A;  3A8G B;  4ME7 A;  4XTU A;  3JB9 J;  3EGD B;  3CCU T;  2CP7 A;  1VQO A;  4ANJ A;  3HRT A;  3V8L A;  2RI2 A;  1YIJ Q;  3F70 A;  4AG1 C;  3OYA A;  3JCM V;  1RAG B;  5KYW A;  2AK5 A;  2L0A A;  2KE9 A;  4AG2 C;  4E7S A;  3UF4 A;  3E2U A;  2L3Q A;  2EYW A;  2RB6 A;  3I35 A;  3I5R A;  2IIM A;  5LJ5 f;  3JCM Q;  4A53 A;  2KGT A;  2EGC A;  3OA6 A;  3FJP A;  5LJ3 g;  2VXE A;  1U3O A;  2DK3 A;  5GAM d;  1YJ9 Q;  2BKD N;  2MYS A;  1TXQ A;  2ED0 A;  1M2V B;  3OW2 A;  4C5I A;  1D0Y A;  4MDX A;  5FWC A;  2MWO A;  4M77 E;  3CCJ Q;  2EKH A;  1ABO A;  2PTK A;  1H3Z A;  4ZGE B;  1WIE A;  1IXD A;  4M77 D;  5CQX A;  3JCM J;  2BE7 D;  4HKE A;  1YJW Q;  3M53 A;  2RK1 A;  4PJO E;  1M1K U;  1RLP C;  2KK4 A;  3H0I A;  3H0F A;  4PJO D;  1WXB A;  5IHK A;  1KQ2 A;  1BYM A;  1PRL C;  2DET A;  1KD1 R;  3V8K A;  2WSE E;  1S72 A;  2KYM A;  1G8X A;  1WQW A;  2C0O A;  4PK4 A;  4J9F A;  3RNJ A;  4OB3 B;  3CCS Q;  2K6D A;  2RJE A;  1P92 A;  1WJR A;  4M75 C;  1Q7Y C;  2AHJ B;  1VQ8 A;  1BKB A;  2J6O A;  3TSW A;  3INZ A;  1H92 A;  4C5G A;  3PGG A;  1KHC A;  5FU7 B;  3X25 B;  1Y96 A;  2L3S A;  4F14 A;  1YBY A;  4BE0 A;  1MV0 B;  1VQ9 Q;  1M30 A;  4PLI A;  4EMK C;  1NPP A;  2MWP A;  3KXT A;  1QKW A;  1KQS S;  2CZ1 B;  4RTU A;  5LJ3 h;  3I55 T;  1O75 A;  2QEX Q;  1F1B B;  1KK7 A;  1VQN Q;  4FCY A;  1NYG A;  2KT1 A;  2KXD A;  5KCO A;  1XOV A;  2XI9 A;  1AEY A;  3SD4 A;  3P8D A;  4XU3 A;  2L5Q A;  4O6J A;  2YUQ A;  5FU6 B;  1VIF A;  2YWW A;  4N4G A;  1G5V A;  3CEY A;  3UWN A;  2FO0 A;  4JZ3 A;  1WJS A;  4Z89 A;  4CI0 C;  2YT6 A;  1OI1 A;  3A8M B;  2DBK A;  1VYT A;  4B9X A;  1YI2 T;  1AHJ B;  5LJ5 g;  3OS1 A;  5EG2 A;  3HKS A;  3OYI A;  2KRS A;  5LJ3 j;  1NJI U;  2R5A A;  2D1X A;  3MCA B;  1RI9 A;  4OMM A;  2MPX C;  3GNF B;  3PT9 A;  5AYF A;  4J9E A;  2AIR B;  4DBH A;  4FYX B;  3CC7 A;  1RAD B;  4F7U B;  3J81 E;  1N5Z A;  4Z8A A;  4DBR A;  2KRO A;  1VQ6 A;  3JB9 G;  2HAX A;  3UA6 A;  5I11 A;  2B8A A;  1JJ2 S; 
#chains in the Genus database with same CATH homology
 2J05 A;  1T0H A;  1ZUK A;  1GBQ A;  4RTZ A;  1UJ0 A;  2YDL A;  1AWX A;  4J9D A;  1NEG A;  2SRC A;  2EGE A;  1FYN A;  2CSQ A;  1K0X A;  3U23 A;  1BK2 A;  2L3P A;  2XMF A;  2LNH B;  1AD5 A;  1B3Q A;  3O5Z A;  4J9C A;  4HVV A;  3VRY A;  2KBT A;  2JMC A;  2J7I A;  1UHC A;  3NPF A;  2KT8 A;  2MCN A;  2JT4 A;  2EBP A;  2O31 A;  2KNB B;  1WXU A;  4LN2 A;  3VRZ A;  1PWT A;  4CC4 B;  1W70 A;  2FPD A;  1HSQ A;  1T3L A;  2W10 A;  2LCS A;  2ENM A;  2JXB A;  1M3A A;  3GBQ A;  1U06 A;  1WFW A;  4GLM A;  1K0S A;  2DX1 A;  1U5S A;  1RLQ C;  2NUZ A;  1I1J A;  4IIO A;  5IXB A;  4J9G A;  2BTT A;  2DNU A;  2BZX A;  1ABQ A;  1UTI A;  3M0U A;  5FW9 A;  2YUP A;  4LUD A;  4KRT A;  2J06 A;  3LH5 A;  1WI7 A;  3FJ5 A;  3NHN A;  3QWX X;  3VS1 A;  2EVR A;  1EFN A;  4FSS A;  1W1F A;  3ZL7 C;  2YUN A;  4DEY A;  2B86 A;  4JJC A;  1I0C A;  1LCK A;  2EGA A;  1WXT A;  3EG3 A;  4OMQ A;  1QWE A;  1Z9Z A;  2AKK A;  3A98 A;  1GBR A;  1NM7 A;  2LMJ A;  2DJQ A;  4RTX A;  1BBZ A;  1NEB A;  1SRL A;  2DL3 A;  2FG0 A;  2EPD A;  3VS4 A;  3KFV A;  1BB9 A;  2LJ3 A;  2RMO A;  1NG2 A;  2ECZ A;  2HCK A;  5I22 A;  4AFZ C;  4LE9 A;  3IQL A;  4RTW A;  2CUB A;  1UEC A;  1AWJ A;  2EW3 A;  4J9B A;  3VS7 A;  2O88 A;  2G6F X;  2SEM A;  1CKA A;  5IH2 A;  5ECA A;  3QWY A;  1JXO A;  1PNJ A;  4HVW A;  3VS6 A;  2DRK A;  4F17 A;  3SEM A;  1T0J A;  2HSP A;  2I0N A;  4X1V A;  2F2W A;  1FMK A;  1S1N A;  1UFF A;  2VWF A;  1E6G A;  1X6G A;  4JJB A;  1X2Q A;  2OJ2 A;  2DM1 A;  2GTO A;  4D8D A;  1CKB A;  3M0S A;  1Y57 A;  2E5K A;  3PE0 A;  3EG0 A;  2O9V A;  1X6B A;  2DL4 A;  4AFU C;  4JZ4 A;  1ZLM A;  4RTV A;  2DE0 X;  2H8H A;  2YSQ A;  2FRY A;  3REA B;  2V1Q A;  1GCQ C;  2D0N A;  4ZNX A;  4M4Z A;  3C0C A;  2A36 A;  2M0Y A;  1QWF A;  1Y0M A;  2LP5 A;  4CC2 A;  4F16 A;  1KSW A;  1PRM C;  2J6F A;  1JQQ A;  3UAT A;  2FEI A;  5IHI A;  1NLP C;  2LJ1 A;  2NWM A;  3SHW A;  2KRM A;  4K11 A;  5GJV B;  1H8K A;  2GQI A;  2DBM A;  4OMO A;  2K9G A;  2KXC A;  2HBW A;  1K1Z A;  4RTT A;  3VS5 A;  3REB B;  2JS0 A;  3PVL A;  4CC3 A;  5L23 A;  1QCF A;  1CSK A;  2O9S A;  1JO8 A;  1G2B A;  2K79 A;  3M0Q A;  1JXM A;  2KRN A;  1NYF A;  1UUE A;  1SHG A;  2LQW A;  4OMP A;  2F2X A;  1QLY A;  3H0H A;  2A08 A;  4JPB W;  1K76 A;  2RPN A;  1M3C A;  1OPL A;  2DMO A;  1IO6 A;  2AZV A;  4R0K A;  3EG1 A;  1WX6 A;  2L2P A;  2JTE A;  4Y92 A;  2DL5 A;  2EYY A;  2J6K A;  1ZUU A;  2BZY A;  4ORZ A;  2HEQ A;  3EHR A;  4IIM A;  3R6N A;  4DEX A;  1PKT A;  2BZ8 A;  2D8J A;  2CSI A;  2A37 A;  4WCI A;  2K7A A;  1KFZ A;  1PKS A;  3EG2 A;  2DA9 A;  3M0T A;  1TUD A;  1GCQ A;  3M0R A;  1UGV A;  1YWO A;  3I5S A;  2EYZ A;  1UE9 A;  2DLP A;  2EYX A;  1ZSG A;  2D8H A;  1BU1 A;  1SEM A;  2ABL A;  2GBQ A;  2RQW A;  2X3W D;  1GCP A;  1MV3 A;  1OPK A;  4J9H A;  1WA7 A;  3TSZ A;  1YCS B;  1YP5 A;  2K2M A;  2P4R A;  2JS2 A;  2RQT A;  2CDT A;  2AKL A;  2JM8 A;  2MIO A;  1GFC A;  1YWP A;  1AWO A;  1TG0 A;  4OML A;  2ESW A;  4AG1 C;  1SSH A;  1UG1 A;  2M51 A;  4QT7 A;  3RBB B;  4CC7 A;  2AZS A;  2AK5 A;  2L0A A;  1NLO C;  2KE9 A;  4AG2 C;  1V1C A;  1QKX A;  2A28 A;  4Z88 A;  3UF4 A;  1M3B A;  1GRI A;  2L3Q A;  2EYW A;  1VA7 A;  3I35 A;  1AZE A;  2CUD A;  3I5R A;  2IIM A;  2PNI A;  3UA7 A;  4RTY A;  2RQU A;  2KGT A;  2EGC A;  1W6X A;  1WLP B;  4LUE A;  2LZ6 B;  2RF0 A;  1HJD A;  1U3O A;  2DRM A;  2VVK A;  2DYB A;  2YUO A;  2ED0 A;  3NGP A;  2OI3 A;  5IXF A;  5FWC A;  4E6R A;  1J3T A;  4AFQ C;  1UHF A;  2EKH A;  2GGR A;  1ABO A;  2DVJ A;  2PTK A;  1OEB A;  1B07 A;  1WIE A;  2CT3 A;  2DIL A;  3PVQ A;  3EGU A;  2V1R A;  3TVT A;  1X27 A;  1E7O A;  3I9Q A;  2LQN A;  2EQI A;  2KYB A;  2DL8 A;  1RUW A;  2HDA A;  2LJ0 A;  4HVU A;  1RLP C;  1K4U S;  3VS3 A;  3H0I A;  1SHF A;  5FWB A;  3H0F A;  3M0P A;  1WXB A;  1KJW A;  1T3S A;  2ROL A;  1KIK A;  5IHK A;  1JEG A;  2FRW A;  3CQT A;  4AFS C;  2JW4 A;  1PRL C;  5HCK A;  2CH4 A;  2VKN A;  1UJY A;  1X69 A;  2DF6 A;  1M27 C;  2C0T A;  2KYM A;  1YN8 A;  4GBQ A;  2C0O A;  2MOX A;  4J9F A;  5IHN A;  2C0I A;  3RNJ A;  2JMA A;  1TUC A;  2CH4 W;  2QDL A;  2K6D A;  4LNP A;  1AVZ C;  1PHT A;  2FPF A;  2JM9 A;  4ESR A;  1X2K A;  5EC7 A;  3JV3 A;  4OMN A;  1ARK A;  2K3B A;  2J6O A;  3TSW A;  1H92 A;  2PZ1 A;  1OOT A;  1GFD A;  2ROT A;  2KR3 A;  4HXJ A;  2GNC A;  1AOJ A;  2L3S A;  4F14 A;  1MV0 B;  1M30 A;  2RQR A;  3NMZ C;  1GL5 A;  2GTJ A;  4A63 B;  2ED1 A;  1QKW A;  4RTU A;  3VS2 A;  1SRM A;  1NYG A;  1AWW A;  4EIK A;  1Z9Q A;  1X43 A;  2LX7 A;  2KT1 A;  2KXD A;  2OAW A;  1XOV A;  1AEY A;  1WYX A;  1JU5 C;  4JJD A;  3THK A;  4HCK A;  2RNA A;  2YUQ A;  2KEA A;  3VS0 A;  1HD3 A;  4J9I A;  2FO0 A;  4JZ3 A;  1WDX A;  1VYU A;  2RQV A;  4Z89 A;  1H3H A;  2YT6 A;  4D8K A;  2DBK A;  2RN8 A;  3H41 A;  1VYT A;  3ULR B;  2CRE A;  1SPK A;  1I07 A;  2KRS A;  2D1X A;  5GJW B;  2CT4 A;  1ZBJ A;  1E6H A;  1RI9 A;  2X3X D;  4OMM A;  4RUG A;  1ZX6 A;  2FPE A;  3EHQ A;  1K9A A;  2DL7 A;  4J9E A;  1ZUY A;  2W0Z A;  2O2O A;  2F2V A;  1M8M A;  1OV3 A;  1A0N B;  1N5Z A;  1YNZ A;  4Z8A A;  2KRO A;  3UA6 A;  5I11 A;  1AZG B;  1G83 A;  1VYV A;  1UDL A;  1MUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...