2K7AA

Ensemble structures of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain of Tyrosine-protein kinase ITK/TSK
publication title Proline Isomerization Preorganizes the Itk SH2 Domain for Binding to the Itk SH3 Domain
doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 6
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k7aA00
2J6KA 1M3AA 4OMQA 2DA9A 3M0TA 2EGCA 1AEYA 2W0ZA 3NPFA 2AKLA 2K3BA 2KNBB 2KXCA 3UA6A 1H92A 1WXTA 1HJDA 2CT3A 4K11A 1QWFA 2LP5A 4CC2A 1E7OA 1QCFA 4LNPA 2JM9A 5EC7A 1RLQC 2G6FX 2KROA 2EW3A 1AZGB 4E6RA 1QLYA 5IHIA 2V1QA 3VS3A 1JQQA 2DBMA 1CSKA 2LJ0A 4J9CA 3VS0A 1I0CA 1UFFA 2YUOA 3I5RA 3VS5A 1PHTA 2NWMA 4HVUA 2KT8A 1QWEA 1JU5C 2KT1A 3RNJA 2DBKA 1AWOA 3THKA 1CKBA 2YDLA 1FYNA 4LN2A 1ZUYA 1K76A 2GNCA 3VS2A 1I1JA 1H3HA 5FWCA 4HVWA 4AFQC 1CKAA 1G83A 2FO0A 4HCKA 1I07A 2OI3A 4J9EA 2DMOA 1ZUKA 1UHFA 1VYUA 2RMOA 5HCKA 1X27A 2LNHB 2QDLA 4HXJA 3I9QA 2KR3A 2GTOA 2OJ2A 2F2VA 5I22A 2FRYA 2NUZA 2EBPA 1E6HA 2J05A 1AD5A 3IQLA 2J7IA 1SRLA 1PRLC 3H0HA 2HBWA 1TUCA 1YWOA 1GRIA 3EG0A 3QWXX 1AZEA 3FJ5A 5IHKA 1M3CA 4IIOA 4GBQA 1NM7A 3ULRB 4D8KA 1OPLA 2JS0A 5L23A 1YN8A 1MV3A 1E6GA 1PKTA 4RUGA 1T3LA 1WDXA 4RTTA 2ROTA 3VS4A 2DL8A 2LJ1A 3UF4A 3PVQA 2A36A 2L3SA 4F17A 1T3SA 1K0SA 4D8DA 1K0XA 2PTKA 1GFCA 4M4ZA 2MCNA 1JXOA 2KRMA 4OMLA 2RF0A 4AFZC 2O9VA 2LQWA 4X1VA 2JXBA 4JPBW 1AWWA 2L3QA 3M0UA 3R6NA 4RTUA 2JT4A 1QKWA 1SEMA 1UUEA 2KYMA 4CC7A 2MIOA 1U06A 1X6BA 2HCKA 2GTJA 4Y92A 1GCPA 4QT7A 4J9DA 1V1CA 3TVTA 2LX7A 2DILA 3C0CA 1WX6A 1UGVA 2RQTA 2A28A 1NYFA 1GCQC 2K7AA 2YUQA 4J9BA 2DE0X 2D1XA 2K2MA 1T0JA 2M51A 3A98A 3EGUA 1BBZA 4AFSC 2CH4W 4RTYA 1SRMA 1M3BA 1WXBA 2LQNA 2X3XD 2H8HA 1U3OA 1NLOC 4J9FA 2GGRA 2BZXA 1ABOA 3RBBB 2VWFA 3EHRA 2ED1A 4DEXA 1K1ZA 3H41A 2A08A 1BK2A 2D0NA 3SEMA 2FPFA 1AWXA 3TSZA 3I5SA 3JV3A 1KFZA 2ENMA 1VA7A 1YP5A 3NHNA 4RTZA 3H0FA 1H8KA 5GJWB 2JS2A 1PNJA 2KEAA 2BTTA 4OMOA 2RQVA 1W1FA 1BU1A 4J9IA 4F16A 1UECA 1GBQA 2DJQA 2J6FA 2GBQA 2YT6A 2CSIA 3REAB 2ROLA 4FSSA 2K6DA 4JJCA 4JJBA 1SHGA 2OAWA 3EG1A 2LMJA 2ABLA 2D8JA 2EYXA 2I0NA 1HD3A 2CUBA 2C0IA 4RTVA 1PKSA 2DF6A 2KRNA 2L3PA 2KBTA 1OEBA 5GJVB 1ZX6A 2CSQA 1WI7A 1UJYA 2DVJA 1Y57A 1UDLA 2RPNA 2CUDA 3H0IA 2C0OA 4HVVA 1X6GA 1UTIA 1U5SA 2DRMA 1SSHA 2RQWA 1NYGA 2X3WD 1X2KA 4LE9A 5IHNA 5IXBA 1K4US 2EPDA 1VYTA 4RTXA 3UATA 1X69A 4GLMA 3VS6A 1UJ0A 1ZUUA 2EKHA 1WIEA 2DL7A 2HSPA 2A37A 2IIMA 2KYBA 2O88A 4JJDA 1LCKA 2C0TA 2FRWA 1SHFA 2F2XA 2AZSA 2KGTA 1SPKA 2P4RA 2VKNA 1NG2A 2JTEA 1W6XA 1OV3A 1RLPC 4LUEA 1B07A 2DL3A 3SHWA 2D8HA 5ECAA 5IH2A 2CH4A 2LZ6B 1GFDA 4WCIA 4CC3A 1WLPB 1XOVA 2DNUA 3NMZC 5IXFA 4IIMA 3M0RA 1MV0B 2LCSA 3U23A 1WFWA 2J6OA 2FG0A 1ZBJA 1ABQA 1IO6A 3TSWA 2ECZA 4ESRA 2F2WA 2EQIA 2CREA 1EFNA 2ESWA 3PE0A 3M0PA 2EGAA 4OMPA 1X43A 3KFVA 1TG0A 3O5ZA 1OPKA 2J06A 2FPEA 2BZ8A 2O9SA 5FW9A 4J9HA 2DX1A 1K9AA 1M8MA 1JXMA 2CT4A 1RUWA 1ZSGA 4A63B 1TUDA 1NEBA 2YSQA 2YUNA 2K79A 1WXUA 4JZ3A 5I11A 1PRMC 3QWYA 1A0NB 2XMFA 1GL5A 1M27C 1ZLMA 2JMCA 4RTWA 1NLPC 2HDAA 3VS1A 1WYXA 2DYBA 2EYZA 1AVZC 2PNIA 3M0QA 3ZL7C 4Z88A 3VS7A 2KRSA 2W10A 3PVLA 2B86A 2KE9A 2EYWA 1BB9A 4ORZA 4Z89A 3EG3A 2DL5A 2SRCA 1S1NA 3VRZA 2AK5A 2JM8A 1QKXA 1YWPA 1T0HA 3M0SA 1NEGA 1W70A 4ZNXA 1GBRA 1Y0MA 2LJ3A 2O31A 4DEYA 1AOJA 1GCQA 3UA7A 1RI9A 1Z9ZA 2GQIA 1YNZA 2EVRA 4CC4B 1UE9A 1UHCA 4LUDA 1ARKA 4JZ4A 2V1RA 3NGPA 1FMKA 2JMAA 2EGEA 2RQRA 3LH5A 1KJWA 2KXDA 4J9GA 2HEQA 1J3TA 2YUPA 1JEGA 3VRYA 2EYYA 3CQTA 2ED0A 1HSQA 5FWBA 1VYVA 4OMMA 1MUZA 4F14A 1KSWA 1YCSB 2MOXA 1OOTA 2DL4A 2L0AA 3EHQA 4OMNA 1UG1A 4KRTA 2CDTA 1WA7A 2E5KA 3I35A 1PWTA 2RNAA 2PZ1A 2RQUA 2DLPA 2SEMA 1KIKA 2RN8A 4R0KA 2JW4A 4AFUC 1N5ZA 2K9GA 3REBB 1X2QA 3GBQA 2L2PA 4AG1C 2O2OA 4Z8AA 4EIKA 4AG2C 1G2BA 1B3QA 1M30A 2DRKA 2FEIA 2VVKA 3EG2A 2AZVA 1Z9QA 1AWJA 1JO8A 2FPDA 2DM1A 2AKKA 2BZYA 2M0YA
chains in the Genus database with same CATH superfamily
2DXTA 3PTAA 4OMQA 3URGA 1VUBA 2DA9A 1D0YA 1BCMA 2RM4A 4JDSA 2OTJA 3TU4K 2EGCA 3CC4T 1AEYA 2W0ZA 2L89A 1YIJA 2K3BA 1D3BA 3UA6A 5GAN2 4M75D 4BDYA 2LP5A 4LNPA 1VQ6T 3DKMA 1RLQC 3AT1B 2KROA 4M78D 2EW3A 2AHJB 2MAMA 3JB9H 1QLYA 2ZAEA 3V8JA 3L2RA 3L2WA 1I5OB 1Q81C 2V1QA 1AHJB 1Q86U 1JQQA 2JTFA 3RKXA 3J80E 1VIEA 4M7AF 5CKBA 5GMKh 1UFFA 4BE2A 2NLUA 1I4K1 1Y96B 4N0AA 1G3SA 3QXEB 2VGMA 5GANe 1S72T 2KT1A 2CZ1B 3EH1A 3NTHA 1FX7A 1K76A 2X4YA 5FWCA 1VQOQ 4J7IA 1IREB 3CCLQ 1KHCA 4VUBA 3RUXA 1KQSS 3CBOA 4C5EA 2K3XA 5KCOA 2DMOA 3EG9A 1G8XA 1UGRB 4OB3B 1X27A 3X26B 2GTOA 3UPUA 5FU6B 2V8IA 2EBPA 3TREA 3BDUA 1NJIU 2OTJT 2J7IA 3ME9A 3H0HA 4J83A 3MP6A 1YWOA 3FJ5A 4GBQA 5GAMg 4F04B 2JS0A 1K8AR 1MV3A 1T3LA 4RTTA 3VS4A 1VQMQ 1KQ1A 2A36A 3QKJA 1T3SA 2LX9A 4JS4A 3CCSA 1K0XA 2PTKA 5KH6A 1GFCA 4M4ZA 3CCMA 4IUUA 3HFOA 2DIGA 2RF0A 2X51A 4AFZC 1DJ7B 2LQWA 5CK9A 4KGVB 2X4WA 4KH1B 1OX8A 4B6MA 4LD9K 1WNLA 4RTUA 2JT4A 3MEUA 1QVGA 2RI3A 5J39A 3EFSA 4DBHA 2HCKA 4Y92A 3DLLA 4PFPA 1BIBA 5CQYA 4QQGA 1ZA1B 1IXDA 2A28A 2M0OA 1GCQC 2K7AA 4J9BA 1IZ6A 4QQDA 4AFSC 2RH2A 4M75B 2YLBA 1QP3A 2X35A 4X9DA 1Q7YR 1NLOC 1ABOA 2VWFA 4ANJA 3UDCA 2P0KA 1XNIA 2DD4A 1YJWA 2FPFA 3A8OB 2F5TX 1B34B 3JV3A 4L59A 1KFZA 3HP9A 5LJ5h 3JSCA 3OYHA 2F5KA 4BI4A 2YRCA 4M77C 4F16A 2DJQA 3JCMg 3M55A 1VQPQ 2LT1A 2CSIA 2KSSA 1BIAA 2CYZB 3CCST 2EWNA 2ROLA 4FSSA 2K6DA 2RO0A 2IG0A 3CCMT 3H8ZA 3M58A 3CCQQ 3EG1A 4FIBA 2EJGA 5GAOp 3QSUA 4F7UB 2C0IA 3PT9A 1WJSA 5L8RE 3JB9F 2KRNA 4PJOA 1KK7A 5KYWB 3EFRA 1HXDA 2VC8A 1UDLA 2RPNA 3A5ZB 3RKYA 1K9MR 1ZA2B 1Q82R 1UTIA 3QHSA 3EAEA 2RQWA 1NYGA 2X9HA 2X3WD 3GIBA 3M4GA 3CC7T 2DEQA 4MDXA 2VXFA 1SSFA 1UJ0A 1U1SA 1D1AA 1G5VA 4BUGA 5GAMe 1YJWT 4PLIA 4HCZA 1YJ9Q 1SHFA 2KGTA 5CCAA 2CP6A 4C92C 2XHCA 2RHIA 7AT1B 4PJOE 3HSBA 4EMKC 2CZ7B 4M77A 3V7SA 2K4YA 4C8QA 1GFDA 2LZ6B 3OYIA 2KVQG 1H641 2I2LA 4WCIA 1Q81U 1UB4A 2H3EB 4DBQA 5LJ3d 3NMZC 5IXFA 4IIMA 3M0RA 5KYXA 1WJQA 3EGDB 2J6OA 3PMTA 1ABQA 1EX4A 4ESRA 4IUQA 2NUPA 2XK0A 2EQIA 3ASKA 4J7FA 3TQ7P 2QAZA 5DLOA 1X43A 2CP3A 3KFVA 3O5ZA 1OX9A 2DEUA 2B8AA 4JRIA 1JB0E 2O9SA 4PK4A 4HA8A 2DIQA 4IUTA 1H3ZA 5KYNA 2CT4A 2VV5A 3EFOA 4F7UG 1QVFP 1TUDA 4A4FA 2YSQA 3G7ZA 2YUNA 2K79A 1WXUA 3GLXA 3TCJA 8ATCB 2XMFA 1MMAA 3OW2P 1TSFA 4M7DC 1NLPC 2HDAA 4L5GA 3OSSC 1PD0A 1M4ZA 1WYXA 3M0QA 2RB6A 3FEOA 2MWOA 4WF2A 3X20B 5D6YA 2KE9A 4A4EA 1MMDA 2EYWA 1BB9A 4Z89A 3BDLA 1M8VA 3OYLA 2LQ8A 2ZPGB 3OB9A 1VIFA 2AK5A 3VU3C 2OTLQ 2DERA 1Q86C 1Y0MA 5GAOm 3M57A 1X6OA 3HRTA 4DEYA 1AOJA 3QDFA 1Z9ZA 1YNZA 1UEBA 1QVFA 1UE9A 4FT2A 2FZCB 4MZTA 4JZ4A 5AT1B 5KE3A 3NGPA 1FMKA 2JMAA 3LH5A 1WJRA 3QUIA 4M7AD 2RJEA 4J8OA 2LC4A 3OW2A 2ED0A 3CMET 1KQSA 5FWBA 4F14A 1WGSA 4PJLA 1OOTA 2KDSA 3EHQA 4N4HA 1OZ3A 4KRTA 1VQ4A 3Q1JA 1WHHA 2K5FA 1WA7A 1M1KC 1NE8A 1YFNA 2MMPA 2RQUA 1YITA 2JUFA 2QASA 3GNFB 2DZ9A 3M53A 1D1BA 5GAN3 5GMKi 3GBQA 4KH0B 3CD6Q 2HQXA 4JRKA 2L2PA 4JUVA 4AG1C 1BKBA 1TH7A 4Z8AA 1Y96A 4EIKA 2E6ZA 3LGLA 4XTXA 1B3QA 1XJWB 5GMKl 1C0MA 3EG2A 2VGNA 1Z9QA 1K73R 1D09B 4V2SA 1JO8A 3RKWA 2AKKA 2BZYA 1PSFA 2M0YA 3OYEA 1M3AA 5FROA 2HBPA 3OYKA 3JCMP 3C4SA 4A54A 3NPFA 3CCRA 2KNBB 3LW5E 2AIRB 4P5NA 1HJDA 3PGGA 2BIVA 3KUFA 4M78C 4PL6A 2DXBA 3QYHB 2PUOB 3ZFJA 4FYVB 1VQLQ 4B9XA 1VQKT 5IHIA 3OYNA 2DKGA 2XU8A 2QG9B 4M77B 3LYIA 2LJ0A 3VYGA 2CP5A 3JCMJ 1OU8A 3CCVQ 4BY6C 3I5RA 3VS5A 1JU5C 3RNJA 1WQWA 2L5QA 1VQ4T 3THKA 3MEWA 1TWBA 2EAYA 3HFNA 1FYNA 2LCCA 4LN2A 2DXUA 3VS2A 2KK4A 1H3HA 1YITT 4BD3A 4E7JA 1OQKA 4KULA 4AFQC 1G83A 3LX7A 2FO0A 3EGXA 1I07A 2V26A 2OI3A 2Y4XA 4XTVA 1KQ2A 3QJ6A 4D6WA 2Z0WA 1ZUKA 5A2QE 4PJMA 1VQ8A 2HSEB 3MEVA 3ZBDA 1O9SA 1IHWA 3WVDB 3N5BB 3FJPA 2F2VA 4QVDA 3CC4Q 2FRYA 5FU7C 2EIFA 1FMVA 1M2OA 2XDPA 4M75A 1SRLA 4ZN3A 2HBWA 4L6V5 3QIIA 5GAOn 5IHKA 3V7CA 4IIOA 1VQ6Q 3UT1A 3SWNC 1OPLA 4PJOF 5L23A 2LVMA 1E6GA 4RUGA 3QDRB 4C92B 2E3IA 2QTXA 2A0FB 4EMKB 5A0LA 2L3SA 1K0SA 2E4HA 4FT4A 3CPWS 2QEXA 2KRMA 1B34A 4PFOA 2XG8D 3JB9D 4M77G 5LJ5d 3S3MA 3R6NA 1S72Q 1QKWA 1UUEA 2KYMA 5CIUA 4E7SA 2XKOC 3CXCS 1WHGA 2LX7A 2P84A 3C0CA 1UGVA 2M02A 2K5LA 1NYFA 2YUQA 5I21A 3GF5A 1NJIR 4XTWA 3EGUA 2E12A 4FM4B 1M90C 2CH4W 4RTYA 5GAOq 4M77F 4C8QF 3CCJA 1SRMA 1MNDA 1WXBA 2X3XD 3OMCA 2H8HA 2BUDA 4J9FA 2GGRA 4ZTFA 2BZXA 3HRUA 4HCBA 5GAOl 2GCXA 4F7UA 3RBBB 2DJZA 1VQ8T 2KMTA 3OYMA 1MHNA 5KYWA 3A8GB 1K1ZA 4DEXA 5IN1A 2OTJQ 1BK2A 2DO3A 4QVZA 4M7DB 3MO8A 2L8DA 3OBWA 2E65A 2BE7D 1YIJQ 1AWXA 1Y7XA 2RA2A 5C6SA 2COWA 5EG2A 2ENMA 4NS5A 2R57A 3X24B 4C0DC 1YHQA 2KEAA 4OMOA 3NTKA 1VQOA 1BI1A 3SB2A 2HMAA 2ZPFB 1N8RU 2J6FA 3V8LA 2K2VA 1KHIA 5DY9A 2QEXT 4C92G 3REAB 1TU0B 3META 4JJCA 4JJBA 1B7TA 1XQHA 4F7UE 5J3BA 5AYFA 3J7AF 3OYCA 5LL6S 5DM7R 1QVGP 5GAN5 1M1KU 2E64A 2HL5C 2CZ6B 5GANh 4BI8B 2CSQA 3PIPA 3GOXA 3PMIA 3EGDA 3H0IA 2CUDA 3DLMA 3OYBA 3X25B 2DRMA 5IT9E 1SSHA 3CCJT 4X34A 4LE9A 2MYSA 3MKDA 1K4US 3PNWC 3OYGA 2M16A 2PVGB 2DL7A 2HSPA 4BDZA 3G6EA 3EGXB 1D0XA 2AZSA 1LPLA 1SPKA 3CCEA 2DVEA 4M7DG 5HKCA 1RLPC 4LUEA 1YHQT 5LJ3j 2HQEA 5FRNA 2R5AA 3G4SA 1VQOT 1BI3A 2F69A 3CCSQ 5LJ3f 2GQVA 2XI9A 4E47A 3CCLT 4E7LA 2P4TA 1MV0B 3CCMQ 1WFWA 4LDUA 4DOWA 2QA4A 1IO6A 3TSWA 4M78B 3CEYA 2RJDA 3QG1A 2CREA 1EFNA 3PE0A 5KYUA 3CC7A 3NFCA 2ZGWA 2EGAA 2JOYA 2EKOA 2GFUA 4LDYA 1X01A 4DBRA 2FPEA 4DBFA 5FW9A 2CP0A 4J9HA 3RR6A 1PCXA 1ZSGA 3RESA 3LLRA 4XU1A 4BY6B 1NEBA 4FYYB 4J6XA 5GMKm 1ZLMA 3JCMd 4OB2B 1Q81R 1RAGB 2DTIA 3VS1A 4A4HA 2EYZA 2PNIA 1YJWQ 4Z88A 2KRSA 3G6ET 3S3NA 2EJ9A 1FXXA 3EG3A 3RMQA 3CCET 1MMGA 1T0HA 1NEGA 4JRPA 1GBRA 2QQRA 2JN0A 5KCHA 2JZ2A 2LQKA 2VUBA 2O31A 2ZPEB 1Q95G 5FU7B 3G4ST 1GCQA 3UA7A 1RI9A 1RAIB 1R77A 1YI2A 4CC4B 5KYYB 3HRSA 2MF2A 2V1RA 4M7AC 2QA4T 1KJWA 4J9GA 2HEQA 3MPUB 5GAN8 1Y07A 3SWNB 9ATCB 4M75G 3CQTA 2ZZDA 4Q5WA 4M78G 1VYVA 1LVKA 2KQWA 1LNXA 3EH2A 1WZOA 1YCSB 3JCMX 3SD4A 2F1LA 3CXCP 4OMNA 2E10A 1M90U 1UG1A 4A53A 4J6WA 2CDTA 1PWTA 2VYTA 2PZ1A 2QGFB 2DLPA 5CAIA 3I56Q 2M1HA 1KIKA 4M75F 4AFUC 2K9GA 5GMKj 1VQPT 1MMNA 1WPYA 1KD1C 3VKIA 4OP0A 4AG2C 4LDVA 1G2BA 4EDUA 4HKEA 4QW2A 2DRKA 4JLIA 5GAMh 1AWJA 5HY6A 2GFAA 4NL3A 3CPWA 1VQ7A 3L2ZA 1IRXA 2J6KA 1U1TA 3CMEA 2NUTB 3F70A 3M0TA 2MWPA 1RACB 4BI3A 4PJOD 5LJ3g 3LGFA 5I2MA 3QYGB 2KXCA 1H92A 2CT3A 4K11A 3VV0A 4CC2A 2DK3A 3CXCA 1E7OA 1QCFA 1YI2T 3BE3A 2K5IA 3C12A 2G6FX 4M77E 2LDMA 4C8QE 4C0DB 2D0QB 4E6RA 3JB9I 1BYMA 2PVOB 4XQ3A 1KQSP 2A3LA 1X75C 2P0PA 4KUDK 2RI2A 2O4XB 1KC8C 3A1PA 1IHVA 4LD6A 1PM3A 2YUOA 4F7UF 1YCYA 3L1AA 1PHTA 2NWMA 4HVUA 3CC2A 2OX7A 4C92A 1AWOA 3OYFA 3BW1A 2WACA 5KYUB 4EMKA 3OY9A 3L2QA 1ZUYA 4C0GA 2GNCA 1I1JA 4C0FA 1WHKA 2PUKB 3BY7A 1LOJA 3FIFA 1N9RA 4KUIA 2Y4YA 2R5MA 1ZQ1A 4HCKA 4FW1A 4XU0A 4Y91A 2HKNA 4IKFA 4JRQA 4R56A 6AT1B 3HHTB 1VQKA 2FL7A 1UHFA 1VYUA 2RMOA 5HCKA 4HXJA 1VQ7T 1M5Q1 2KR3A 3A8LB 3H9NA 1N8RC 1UGPB 3JCMh 2NUZA 1QQJA 1E6HA 1WHJA 3IQLA 4C92E 1AZEA 2CP2A 1NM7A 1YN8A 1PKTA 2ROTA 2PVDB 3LH0A 3CPFA 1MGQA 2LJ1A 3UF4A 3PVQA 4C5IA 1N6AA 4FYXB 2DTHA 5C0MA 4M7DA 3FDRA 3HL8A 4OMLA 5LJ5j 3OMGA 4ATOA 5I2SA 3OS5A 1LJOA 2JXBA 4JPBW 3I55A 1IGQA 1AWWA 3FRNA 1AT1B 3NTIA 2L3QA 5LJ5f 2K57A 3M0UA 1SEMA 1VQ4Q 2MIOA 1U06A 4ZN1A 1X6BA 3CC2T 2GTJA 4QT7A 4X9CA 3VUBA 2O01E 4J9DA 1V1CA 4NL2A 3V8KA 2H3JA 2DILA 1YITQ 1YBYA 4E7IA 2DE0X 3A98A 1T0JA 2M51A 3JAME 1RAAB 3VUZA 3GPLA 1VQ9A 1YJNA 2L3RA 1N27A 1WHLA 5LJ3e 4M7DE 3S3OA 4IUVA 5GANd 4KBMB 2CKKA 2V8KA 2A08A 2CS7A 3MCAB 4XTZA 3T9NA 3CCRQ 4JJNK 3L42A 4RG2A 1VQ5A 2LRQA 4OB1B 3I5SA 2LNVA 3G1JA 1YP5A 3JB9J 2DXCA 3H0FA 1H8KA 5GJWB 3O8VA 1ZSZC 2QXFA 2BTTA 2RQVA 3E19A 4J9IA 1UECA 2E5QA 3OYAA 3G71A 1QMCA 2WSFE 1FMWA 1ZBXA 1XTDA 3CMAA 1F1BB 2LMJA 3I55T 2D8JA 1W2BS 1HD3A 2PQWA 4GY5A 4M7AB 2CUBA 4RTVA 2DF6A 2L3PA 1RAFB 1R0BG 5GJVB 3JCMQ 1ZX6A 1Q86R 4HCCA 1UJYA 3GP8A 1KD1U 4FW2A 4EMHA 3JCMW 1VQNA 1I5LA 4M78A 3HTRA 2E6NA 1K8AC 1PSEA 5D6XA 2HL3A 2QQBA 1U5SA 3CCUA 1VQ9T 1X2KA 2RI5A 1YJNT 5IHNA 2QQ9A 5IXBA 5CO7A 1JBMA 1VQ8Q 2D6FA 2EPDA 4LDWA 1VYTA 4RTXA 1X69A 3D7SB 3OS0A 1ZUUA 1M2VB 4QQ6A 3GNGA 2IIMA 4AMCA 2O88A 4MZMA 5M9OA 4XAXB 1LCKA 2VASA 2C0TA 4N0AC 3L2UA 4MZPA 2ZPHB 1VQ5T 2P4RA 2VKNA 2MPXC 1NG2A 5FLXE 2JTEA 2EFIA 1ZSZA 3OYYA 3KXTA 2YRDA 5CR2A 1M1KR 3SHWA 2QI2A 5ECAA 2CH4A 4M75E 4CC3A 2KI7A 2E1HA 1XOVA 2JJ9A 2QEXQ 4M78E 3G71T 1KC8U 3E9GA 2EQMA 1SKUB 2FG0A 3M9QA 4J5YA 1ZBJA 1Q7YC 1TTHB 2JNGA 3CMAT 5FRMA 1OYXA 4FSXA 2QTVA 1BI0A 4ME7A 1TG0A 3KBGA 4RCBA 3LWHA 5GMKe 1OPKA 5GAOr 2RHXA 4M7AG 2ZCFB 2DX1A 1K9AA 1JXMA 1RUWA 2VXEA 5KYYA 4WTOB 2M9UA 4OF1A 1JJ2S 1V29B 2XIDA 1VQNT 2WSCE 3AHUA 1TXQA 3QPHA 3SWNA 3CCJQ 5CKHA 3QZ9B 5I11A 4IURA 3CCUT 1GL5A 3JCMf 4NOYA 3CCLA 1TOVA 2XDBA 1RAEB 2DYBA 3ZL7C 1AVZC 2D9TA 1M1GA 3VS7A 4JS5A 2W10A 1Y71A 2B86A 2VB6A 2X4XA 1QVFS 2FZKB 4R55A 4AT1B 1YHQQ 1S1NA 1HYOA 3VRZA 1QKXA 3M0SA 1W70A 3MJXA 2LJ3A 3JCMV 4OVAA 3OW2S 4C92F 2GQIA 3PIOA 1K9MC 1ARKA 1Q82C 2C06A 2RQRA 2EGEA 5GAMd 2KXDA 1JEGA 3H6ZA 1VQMA 2RK2A 4C5HA 2YHTA 2CGHA 2NUTA 4JLGA 2EYYA 3LWIA 1PC0A 2IPOB 4OMMA 1MUZA 1KSWA 3L2VA 1YIJT 1RAHB 1SF9A 1V76A 1HK9A 2E5KA 3I35A 2RNAA 4O5VA 2SEMA 2DZCA 3S6WA 2RN8A 5A0GA 1N5ZA 1C6VX 3OSVA 3JCMc 2O4XA 1BCOA 2O2OA 5KE2A 2X4JA 3OYJA 4A4KA 4B9WA 4DOVA 1W4SA 5CKEA 3G6EQ 2FEIA 4YTLA 2AZVA 4FL6A 3WVEB 3A8MB 4M7DF 2DM1A 4ZGEB 3CCEQ 4FU6A 4RMOA 4PJOC 2EJFA 2XDDA 1UGSB 2E3HA 2YRVA 3G4SQ 3CBPA 5LJ5e 3WXMB 2AKLA 4DQ2A 3V7RA 1WXTA 4OB0B 1QWFA 1M90R 3JRZA 2JM9A 5EC7A 2QA4Q 4PKCC 2E70A 4EMGA 1AZGB 2IVWA 1D1CA 4BE0A 3CC7Q 1ZSZB 1OI1A 1VQMT 1VQPA 3VS3A 2BE9B 2DBMA 1CSKA 3RDVA 2RJCA 4J9CA 1W2BP 3VS0A 3CCQA 1I0CA 4RG8A 2YWWA 3M54A 2RJFA 2KT8A 1QWEA 1D0ZA 1EZZB 3HPWA 1K8AU 2DBKA 1IGUA 1CKBA 4C8QC 2YDLA 3JB9G 2LCLA 2QQSA 2ZPBB 3FB9A 2P0QA 2DTOA 4HVWA 1OZ2A 3VYHB 1GXIE 1CKAA 5DLQE 3INZA 1D3BB 2DD5A 3MEAA 2R58A 3P8DA 3P8HA 3DB3A 4J9EA 4O6JA 2GF7A 4ZGJB 4RCCA 3CPWP 2LT4A 2LNHB 2QDLA 3I9QA 1JRIA 2DFUA 2HD0A 2OJ2A 1IB8A 5I22A 3JCMb 2J05A 1AD5A 1UGQB 1PRLC 1YJ9A 1W2BA 1TUCA 1GRIA 4II1A 1R0CB 3EG0A 3QWXX 1YI2Q 1M3CA 1SG5A 1RI0A 2DETA 2EQUA 3ULRB 4D8KA 3UWNA 1Q7YU 4N4GA 4QVCA 3I56A 5CKFA 4OGEA 4ELZC 1WDXA 2KY9A 1TS9A 2DL8A 2V8JA 2AT1B 1RABB 4FYWB 4F17A 4D8DA 3FC3A 5HK0A 4M78F 2MCNA 4Z02A 1JXOA 3QO3A 2FVUA 4PFZA 2RHZA 1QCNA 2O9VA 4X1VA 2PU9B 3CCQT 1K73C 5J26A 4PNOA 3X28B 3OS1A 4XTUA 2ZPIB 4CC7A 3EG9B 3OQ5A 1WHMA 1GCPA 2CZ0B 3TVTA 1WX6A 1G3WA 3E9FA 3VJPA 5IAYA 2RQTA 1JJ2P 2EQJA 5GAN7 2D1XA 2K2MA 1BBZA 4XU2A 2DPPB 2RHUA 1RADB 1M3BA 2LQNA 1U3OA 2QK0A 4M7AA 4OGCA 5GANj 1U8RA 1VQ7Q 4PJNA 3MP8A 1R8OB 3EHRA 2ED1A 4PJJA 4RKUE 3R6OA 3CMEQ 5GANf 3P8BB 2QGGA 3H41A 4MMLA 3QZ5B 3A8HB 2D0NA 3SEMA 3FLGA 3TSZA 3OYDA 4GLKA 5CQXA 1YJ9T 1VA7A 1K9MU 3NHNA 4RTZA 4OMFB 1Q82U 2JS2A 1I8FA 4MDWA 1PNJA 1TUGB 2DYIA 3DB4A 3I56T 2OTLA 1W1FA 1BU1A 1GBQA 4M77D 2DAQA 5GAN6 4C8QD 2GBQA 2YT6A 4KT0E 1I81A 1M2VA 1JJ2A 4IUPA 4C0ZA 5GAN4 2Y90A 2A7YA 1G3TA 3J81E 4CRIA 4M7AE 3HKSA 1SHGA 2OAWA 2FZGB 2ABLA 2EYXA 3JCMe 4UC4A 2I0NA 4XTYA 4ZTJA 3CC2Q 8AT1B 1PG5B 1PKSA 2KBTA 4E7ZA 1OEBA 1WI7A 3C94A 4DA4A 1EIFA 1N9SA 2DVJA 1QP2A 1Y57A 1P92A 2C0OA 2FYKA 3MHXA 4HVVA 1X6GA 1VQKQ 5FU6C 1PD1A 2RK1A 3UATA 1BI2A 3ER0A 3E2UA 3CD6A 3SDZA 4GLMA 3VS6A 1QVGS 2EKHA 1WIEA 4J6YA 2MK5A 2A37A 2KYBA 4JJDA 4KGXB 5D7UA 2FRWA 4HT8A 2F2XA 3PFSA 1C1AA 2G3RA 2HZYA 1QCOA 1W6XA 1OV3A 4C92D 1B07A 2DL3A 2HQHA 1OU9A 2D8HA 5IH2A 4EPCA 2OTLT 3OA6A 4PJOB 1NJIC 1WLPB 1OULA 2DNUA 1KD1R 2LCSA 3M4YA 3U23A 2QDYB 2ECZA 2KAFA 3I55Q 1VQLA 1NZ9A 5A0DA 3RERA 2F2WA 3MP1A 2ESWA 1FWZA 3M0PA 2JVVA 4OMPA 5HK3A 2YLCA 2LTOA 2RHYA 2J06A 1O75A 1G3YA 4E7HA 5CVIA 2BZ8A 4M75C 4TVRA 1M8MA 4PLLA 2NYSA 2MI6A 3CCVA 4E7KA 1WQ7A 3OBYA 4QKUA 1QVPA 1VOMA 4A63B 4HT9A 4BE1A 3M56A 4CI0C 2K3YA 3RIRA 1VQ9Q 1YJNQ 4JZ3A 1PRMC 3QWYA 1A0NB 2EYQA 1M27C 4C8QB 3CBMA 2JMCA 5GANg 4RTWA 3M59A 5LJ3h 3CD6T 4M7DD 5KYXB 1KC8R 4XK8E 1RL2A 3PVLA 1VQ5Q 2COYA 3OS2A 4E2FB 1NPRA 4ORZA 2NUPB 2JTMA 1NBEB 2HAXA 4MMKA 3QBYA 2COZA 2DL5A 2SRCA 2XD0A 3CC4A 2JM8A 1YWPA 4ZNXA 2YXYA 2XICA 4A4GA 4KGZB 1M1FA 3QJYA 3G71Q 2EVRA 5GAMj 1VQ6A 1UHCA 2E41A 2OAUA 3EFOB 4LUDA 3E1SA 2HKQB 1M9SA 4LDXA 3CMAQ 4PJOG 3RMSA 5GAMf 1K73U 4LXCA 2ATCB 2HNIA 1J3TA 2WSEE 3C95A 2YUPA 1VQLT 3VRYA 1NPPA 3M5AA 3BFMA 1HSQA 2FHDA 1N8RR 1ACMB 5D6WA 2BKDN 4FCYA 3CCRT 2MOXA 2QQAA 2DL4A 5CKDA 2L0AA 4C5GA 3ZEHA 3CCVT 1S72A 1VQNQ 2FB7A 2EQKA 4N4IA 3CCUQ 4BACA 4BB7A 4Y28E 4R0KA 4ELYC 2JW4A 2RD1A 3REBB 1X2QA 1MNEA 1QW1A 3SFMA 1M30A 4C8QG 4ZGDB 2CP7A 2VVKA 3TEEA 5LJ5g 1KG1A 1ZHIA 4XU3A 2FPDA 2QYZA
chains in the Genus database with same CATH topology
2J6KA 1M3AA 4OMQA 2DA9A 3M0TA 2EGCA 1AEYA 2W0ZA 3NPFA 2AKLA 2K3BA 2KNBB 2KXCA 3UA6A 1H92A 1WXTA 1HJDA 2CT3A 4K11A 1QWFA 2LP5A 4CC2A 1E7OA 1QCFA 4LNPA 2JM9A 5EC7A 1RLQC 2G6FX 2KROA 2EW3A 1AZGB 4E6RA 1QLYA 5IHIA 2V1QA 3VS3A 1JQQA 2DBMA 1CSKA 2LJ0A 4J9CA 3VS0A 1I0CA 1UFFA 2YUOA 3I5RA 3VS5A 1PHTA 2NWMA 4HVUA 2KT8A 1QWEA 1JU5C 2KT1A 3RNJA 2DBKA 1AWOA 3THKA 1CKBA 2YDLA 1FYNA 4LN2A 1ZUYA 1K76A 2GNCA 3VS2A 1I1JA 1H3HA 5FWCA 4HVWA 4AFQC 1CKAA 1G83A 2FO0A 4HCKA 1I07A 2OI3A 4J9EA 2DMOA 1ZUKA 1UHFA 1VYUA 2RMOA 5HCKA 1X27A 2LNHB 2QDLA 4HXJA 3I9QA 2KR3A 2GTOA 2OJ2A 2F2VA 5I22A 2FRYA 2NUZA 2EBPA 1E6HA 2J05A 1AD5A 3IQLA 2J7IA 1SRLA 1PRLC 3H0HA 2HBWA 1TUCA 1YWOA 1GRIA 3EG0A 3QWXX 1AZEA 3FJ5A 5IHKA 1M3CA 4IIOA 4GBQA 1NM7A 3ULRB 4D8KA 1OPLA 2JS0A 5L23A 1YN8A 1MV3A 1E6GA 1PKTA 4RUGA 1T3LA 1WDXA 4RTTA 2ROTA 3VS4A 2DL8A 2LJ1A 3UF4A 3PVQA 2A36A 2L3SA 4F17A 1T3SA 1K0SA 4D8DA 1K0XA 2PTKA 1GFCA 4M4ZA 2MCNA 1JXOA 2KRMA 4OMLA 2RF0A 4AFZC 2O9VA 2LQWA 4X1VA 2JXBA 4JPBW 1AWWA 2L3QA 3M0UA 3R6NA 4RTUA 2JT4A 1QKWA 1SEMA 1UUEA 2KYMA 4CC7A 2MIOA 1U06A 1X6BA 2HCKA 2GTJA 4Y92A 1GCPA 4QT7A 4J9DA 1V1CA 3TVTA 2LX7A 2DILA 3C0CA 1WX6A 1UGVA 2RQTA 2A28A 1NYFA 1GCQC 2K7AA 2YUQA 4J9BA 2DE0X 2D1XA 2K2MA 1T0JA 2M51A 3A98A 3EGUA 1BBZA 4AFSC 2CH4W 4RTYA 1SRMA 1M3BA 1WXBA 2LQNA 2X3XD 2H8HA 1U3OA 1NLOC 4J9FA 2GGRA 2BZXA 1ABOA 3RBBB 2VWFA 3EHRA 2ED1A 4DEXA 1K1ZA 3H41A 2A08A 1BK2A 2D0NA 3SEMA 2FPFA 1AWXA 3TSZA 3I5SA 3JV3A 1KFZA 2ENMA 1VA7A 1YP5A 3NHNA 4RTZA 3H0FA 1H8KA 5GJWB 2JS2A 1PNJA 2KEAA 2BTTA 4OMOA 2RQVA 1W1FA 1BU1A 4J9IA 4F16A 1UECA 1GBQA 2DJQA 2J6FA 2GBQA 2YT6A 2CSIA 3REAB 2ROLA 4FSSA 2K6DA 4JJCA 4JJBA 1SHGA 2OAWA 3EG1A 2LMJA 2ABLA 2D8JA 2EYXA 2I0NA 1HD3A 2CUBA 2C0IA 4RTVA 1PKSA 2DF6A 2KRNA 2L3PA 2KBTA 1OEBA 5GJVB 1ZX6A 2CSQA 1WI7A 1UJYA 2DVJA 1Y57A 1UDLA 2RPNA 2CUDA 3H0IA 2C0OA 4HVVA 1X6GA 1UTIA 1U5SA 2DRMA 1SSHA 2RQWA 1NYGA 2X3WD 1X2KA 4LE9A 5IHNA 5IXBA 1K4US 2EPDA 1VYTA 4RTXA 3UATA 1X69A 4GLMA 3VS6A 1UJ0A 1ZUUA 2EKHA 1WIEA 2DL7A 2HSPA 2A37A 2IIMA 2KYBA 2O88A 4JJDA 1LCKA 2C0TA 2FRWA 1SHFA 2F2XA 2AZSA 2KGTA 1SPKA 2P4RA 2VKNA 1NG2A 2JTEA 1W6XA 1OV3A 1RLPC 4LUEA 1B07A 2DL3A 3SHWA 2D8HA 5ECAA 5IH2A 2CH4A 2LZ6B 1GFDA 4WCIA 4CC3A 1WLPB 1XOVA 2DNUA 3NMZC 5IXFA 4IIMA 3M0RA 1MV0B 2LCSA 3U23A 1WFWA 2J6OA 2FG0A 1ZBJA 1ABQA 1IO6A 3TSWA 2ECZA 4ESRA 2F2WA 2EQIA 2CREA 1EFNA 2ESWA 3PE0A 3M0PA 2EGAA 4OMPA 1X43A 3KFVA 1TG0A 3O5ZA 1OPKA 2J06A 2FPEA 2BZ8A 2O9SA 5FW9A 4J9HA 2DX1A 1K9AA 1M8MA 1JXMA 2CT4A 1RUWA 1ZSGA 4A63B 1TUDA 1NEBA 2YSQA 2YUNA 2K79A 1WXUA 4JZ3A 5I11A 1PRMC 3QWYA 1A0NB 2XMFA 1GL5A 1M27C 1ZLMA 2JMCA 4RTWA 1NLPC 2HDAA 3VS1A 1WYXA 2DYBA 2EYZA 1AVZC 2PNIA 3M0QA 3ZL7C 4Z88A 3VS7A 2KRSA 2W10A 3PVLA 2B86A 2KE9A 2EYWA 1BB9A 4ORZA 4Z89A 3EG3A 2DL5A 2SRCA 1S1NA 3VRZA 2AK5A 2JM8A 1QKXA 1YWPA 1T0HA 3M0SA 1NEGA 1W70A 4ZNXA 1GBRA 1Y0MA 2LJ3A 2O31A 4DEYA 1AOJA 1GCQA 3UA7A 1RI9A 1Z9ZA 2GQIA 1YNZA 2EVRA 4CC4B 1UE9A 1UHCA 4LUDA 1ARKA 4JZ4A 2V1RA 3NGPA 1FMKA 2JMAA 2EGEA 2RQRA 3LH5A 1KJWA 2KXDA 4J9GA 2HEQA 1J3TA 2YUPA 1JEGA 3VRYA 2EYYA 3CQTA 2ED0A 1HSQA 5FWBA 1VYVA 4OMMA 1MUZA 4F14A 1KSWA 1YCSB 2MOXA 1OOTA 2DL4A 2L0AA 3EHQA 4OMNA 1UG1A 4KRTA 2CDTA 1WA7A 2E5KA 3I35A 1PWTA 2RNAA 2PZ1A 2RQUA 2DLPA 2SEMA 1KIKA 2RN8A 4R0KA 2JW4A 4AFUC 1N5ZA 2K9GA 3REBB 1X2QA 3GBQA 2L2PA 4AG1C 2O2OA 4Z8AA 4EIKA 4AG2C 1G2BA 1B3QA 1M30A 2DRKA 2FEIA 2VVKA 3EG2A 2AZVA 1Z9QA 1AWJA 1JO8A 2FPDA 2DM1A 2AKKA 2BZYA 2M0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6K A;  1M3A A;  4OMQ A;  2DA9 A;  3M0T A;  2EGC A;  1AEY A;  2W0Z A;  3NPF A;  2AKL A;  2K3B A;  2KNB B;  2KXC A;  3UA6 A;  1H92 A;  1WXT A;  1HJD A;  2CT3 A;  4K11 A;  1QWF A;  2LP5 A;  4CC2 A;  1E7O A;  1QCF A;  4LNP A;  2JM9 A;  5EC7 A;  1RLQ C;  2G6F X;  2KRO A;  2EW3 A;  1AZG B;  4E6R A;  1QLY A;  5IHI A;  2V1Q A;  3VS3 A;  1JQQ A;  2DBM A;  1CSK A;  2LJ0 A;  4J9C A;  3VS0 A;  1I0C A;  1UFF A;  2YUO A;  3I5R A;  3VS5 A;  1PHT A;  2NWM A;  4HVU A;  2KT8 A;  1QWE A;  1JU5 C;  2KT1 A;  3RNJ A;  2DBK A;  1AWO A;  3THK A;  1CKB A;  2YDL A;  1FYN A;  4LN2 A;  1ZUY A;  1K76 A;  2GNC A;  3VS2 A;  1I1J A;  1H3H A;  5FWC A;  4HVW A;  4AFQ C;  1CKA A;  1G83 A;  2FO0 A;  4HCK A;  1I07 A;  2OI3 A;  4J9E A;  2DMO A;  1ZUK A;  1UHF A;  1VYU A;  2RMO A;  5HCK A;  1X27 A;  2LNH B;  2QDL A;  4HXJ A;  3I9Q A;  2KR3 A;  2GTO A;  2OJ2 A;  2F2V A;  5I22 A;  2FRY A;  2NUZ A;  2EBP A;  1E6H A;  2J05 A;  1AD5 A;  3IQL A;  2J7I A;  1SRL A;  1PRL C;  3H0H A;  2HBW A;  1TUC A;  1YWO A;  1GRI A;  3EG0 A;  3QWX X;  1AZE A;  3FJ5 A;  5IHK A;  1M3C A;  4IIO A;  4GBQ A;  1NM7 A;  3ULR B;  4D8K A;  1OPL A;  2JS0 A;  5L23 A;  1YN8 A;  1MV3 A;  1E6G A;  1PKT A;  4RUG A;  1T3L A;  1WDX A;  4RTT A;  2ROT A;  3VS4 A;  2DL8 A;  2LJ1 A;  3UF4 A;  3PVQ A;  2A36 A;  2L3S A;  4F17 A;  1T3S A;  1K0S A;  4D8D A;  1K0X A;  2PTK A;  1GFC A;  4M4Z A;  2MCN A;  1JXO A;  2KRM A;  4OML A;  2RF0 A;  4AFZ C;  2O9V A;  2LQW A;  4X1V A;  2JXB A;  4JPB W;  1AWW A;  2L3Q A;  3M0U A;  3R6N A;  4RTU A;  2JT4 A;  1QKW A;  1SEM A;  1UUE A;  2KYM A;  4CC7 A;  2MIO A;  1U06 A;  1X6B A;  2HCK A;  2GTJ A;  4Y92 A;  1GCP A;  4QT7 A;  4J9D A;  1V1C A;  3TVT A;  2LX7 A;  2DIL A;  3C0C A;  1WX6 A;  1UGV A;  2RQT A;  2A28 A;  1NYF A;  1GCQ C;  2K7A A;  2YUQ A;  4J9B A;  2DE0 X;  2D1X A;  2K2M A;  1T0J A;  2M51 A;  3A98 A;  3EGU A;  1BBZ A;  4AFS C;  2CH4 W;  4RTY A;  1SRM A;  1M3B A;  1WXB A;  2LQN A;  2X3X D;  2H8H A;  1U3O A;  1NLO C;  4J9F A;  2GGR A;  2BZX A;  1ABO A;  3RBB B;  2VWF A;  3EHR A;  2ED1 A;  4DEX A;  1K1Z A;  3H41 A;  2A08 A;  1BK2 A;  2D0N A;  3SEM A;  2FPF A;  1AWX A;  3TSZ A;  3I5S A;  3JV3 A;  1KFZ A;  2ENM A;  1VA7 A;  1YP5 A;  3NHN A;  4RTZ A;  3H0F A;  1H8K A;  5GJW B;  2JS2 A;  1PNJ A;  2KEA A;  2BTT A;  4OMO A;  2RQV A;  1W1F A;  1BU1 A;  4J9I A;  4F16 A;  1UEC A;  1GBQ A;  2DJQ A;  2J6F A;  2GBQ A;  2YT6 A;  2CSI A;  3REA B;  2ROL A;  4FSS A;  2K6D A;  4JJC A;  4JJB A;  1SHG A;  2OAW A;  3EG1 A;  2LMJ A;  2ABL A;  2D8J A;  2EYX A;  2I0N A;  1HD3 A;  2CUB A;  2C0I A;  4RTV A;  1PKS A;  2DF6 A;  2KRN A;  2L3P A;  2KBT A;  1OEB A;  5GJV B;  1ZX6 A;  2CSQ A;  1WI7 A;  1UJY A;  2DVJ A;  1Y57 A;  1UDL A;  2RPN A;  2CUD A;  3H0I A;  2C0O A;  4HVV A;  1X6G A;  1UTI A;  1U5S A;  2DRM A;  1SSH A;  2RQW A;  1NYG A;  2X3W D;  1X2K A;  4LE9 A;  5IHN A;  5IXB A;  1K4U S;  2EPD A;  1VYT A;  4RTX A;  3UAT A;  1X69 A;  4GLM A;  3VS6 A;  1UJ0 A;  1ZUU A;  2EKH A;  1WIE A;  2DL7 A;  2HSP A;  2A37 A;  2IIM A;  2KYB A;  2O88 A;  4JJD A;  1LCK A;  2C0T A;  2FRW A;  1SHF A;  2F2X A;  2AZS A;  2KGT A;  1SPK A;  2P4R A;  2VKN A;  1NG2 A;  2JTE A;  1W6X A;  1OV3 A;  1RLP C;  4LUE A;  1B07 A;  2DL3 A;  3SHW A;  2D8H A;  5ECA A;  5IH2 A;  2CH4 A;  2LZ6 B;  1GFD A;  4WCI A;  4CC3 A;  1WLP B;  1XOV A;  2DNU A;  3NMZ C;  5IXF A;  4IIM A;  3M0R A;  1MV0 B;  2LCS A;  3U23 A;  1WFW A;  2J6O A;  2FG0 A;  1ZBJ A;  1ABQ A;  1IO6 A;  3TSW A;  2ECZ A;  4ESR A;  2F2W A;  2EQI A;  2CRE A;  1EFN A;  2ESW A;  3PE0 A;  3M0P A;  2EGA A;  4OMP A;  1X43 A;  3KFV A;  1TG0 A;  3O5Z A;  1OPK A;  2J06 A;  2FPE A;  2BZ8 A;  2O9S A;  5FW9 A;  4J9H A;  2DX1 A;  1K9A A;  1M8M A;  1JXM A;  2CT4 A;  1RUW A;  1ZSG A;  4A63 B;  1TUD A;  1NEB A;  2YSQ A;  2YUN A;  2K79 A;  1WXU A;  4JZ3 A;  5I11 A;  1PRM C;  3QWY A;  1A0N B;  2XMF A;  1GL5 A;  1M27 C;  1ZLM A;  2JMC A;  4RTW A;  1NLP C;  2HDA A;  3VS1 A;  1WYX A;  2DYB A;  2EYZ A;  1AVZ C;  2PNI A;  3M0Q A;  3ZL7 C;  4Z88 A;  3VS7 A;  2KRS A;  2W10 A;  3PVL A;  2B86 A;  2KE9 A;  2EYW A;  1BB9 A;  4ORZ A;  4Z89 A;  3EG3 A;  2DL5 A;  2SRC A;  1S1N A;  3VRZ A;  2AK5 A;  2JM8 A;  1QKX A;  1YWP A;  1T0H A;  3M0S A;  1NEG A;  1W70 A;  4ZNX A;  1GBR A;  1Y0M A;  2LJ3 A;  2O31 A;  4DEY A;  1AOJ A;  1GCQ A;  3UA7 A;  1RI9 A;  1Z9Z A;  2GQI A;  1YNZ A;  2EVR A;  4CC4 B;  1UE9 A;  1UHC A;  4LUD A;  1ARK A;  4JZ4 A;  2V1R A;  3NGP A;  1FMK A;  2JMA A;  2EGE A;  2RQR A;  3LH5 A;  1KJW A;  2KXD A;  4J9G A;  2HEQ A;  1J3T A;  2YUP A;  1JEG A;  3VRY A;  2EYY A;  3CQT A;  2ED0 A;  1HSQ A;  5FWB A;  1VYV A;  4OMM A;  1MUZ A;  4F14 A;  1KSW A;  1YCS B;  2MOX A;  1OOT A;  2DL4 A;  2L0A A;  3EHQ A;  4OMN A;  1UG1 A;  4KRT A;  2CDT A;  1WA7 A;  2E5K A;  3I35 A;  1PWT A;  2RNA A;  2PZ1 A;  2RQU A;  2DLP A;  2SEM A;  1KIK A;  2RN8 A;  4R0K A;  2JW4 A;  4AFU C;  1N5Z A;  2K9G A;  3REB B;  1X2Q A;  3GBQ A;  2L2P A;  4AG1 C;  2O2O A;  4Z8A A;  4EIK A;  4AG2 C;  1G2B A;  1B3Q A;  1M30 A;  2DRK A;  2FEI A;  2VVK A;  3EG2 A;  2AZV A;  1Z9Q A;  1AWJ A;  1JO8 A;  2FPD A;  2DM1 A;  2AKK A;  2BZY A;  2M0Y A; 
#chains in the Genus database with same CATH topology
 2DXT A;  3PTA A;  4OMQ A;  3URG A;  1VUB A;  2DA9 A;  1D0Y A;  1BCM A;  2RM4 A;  4JDS A;  2OTJ A;  3TU4 K;  2EGC A;  3CC4 T;  1AEY A;  2W0Z A;  2L89 A;  1YIJ A;  2K3B A;  1D3B A;  3UA6 A;  5GAN 2;  4M75 D;  4BDY A;  2LP5 A;  4LNP A;  1VQ6 T;  3DKM A;  1RLQ C;  3AT1 B;  2KRO A;  4M78 D;  2EW3 A;  2AHJ B;  2MAM A;  3JB9 H;  1QLY A;  2ZAE A;  3V8J A;  3L2R A;  3L2W A;  1I5O B;  1Q81 C;  2V1Q A;  1AHJ B;  1Q86 U;  1JQQ A;  2JTF A;  3RKX A;  3J80 E;  1VIE A;  4M7A F;  5CKB A;  5GMK h;  1UFF A;  4BE2 A;  2NLU A;  1I4K 1;  1Y96 B;  4N0A A;  1G3S A;  3QXE B;  2VGM A;  5GAN e;  1S72 T;  2KT1 A;  2CZ1 B;  3EH1 A;  3NTH A;  1FX7 A;  1K76 A;  2X4Y A;  5FWC A;  1VQO Q;  4J7I A;  1IRE B;  3CCL Q;  1KHC A;  4VUB A;  3RUX A;  1KQS S;  3CBO A;  4C5E A;  2K3X A;  5KCO A;  2DMO A;  3EG9 A;  1G8X A;  1UGR B;  4OB3 B;  1X27 A;  3X26 B;  2GTO A;  3UPU A;  5FU6 B;  2V8I A;  2EBP A;  3TRE A;  3BDU A;  1NJI U;  2OTJ T;  2J7I A;  3ME9 A;  3H0H A;  4J83 A;  3MP6 A;  1YWO A;  3FJ5 A;  4GBQ A;  5GAM g;  4F04 B;  2JS0 A;  1K8A R;  1MV3 A;  1T3L A;  4RTT A;  3VS4 A;  1VQM Q;  1KQ1 A;  2A36 A;  3QKJ A;  1T3S A;  2LX9 A;  4JS4 A;  3CCS A;  1K0X A;  2PTK A;  5KH6 A;  1GFC A;  4M4Z A;  3CCM A;  4IUU A;  3HFO A;  2DIG A;  2RF0 A;  2X51 A;  4AFZ C;  1DJ7 B;  2LQW A;  5CK9 A;  4KGV B;  2X4W A;  4KH1 B;  1OX8 A;  4B6M A;  4LD9 K;  1WNL A;  4RTU A;  2JT4 A;  3MEU A;  1QVG A;  2RI3 A;  5J39 A;  3EFS A;  4DBH A;  2HCK A;  4Y92 A;  3DLL A;  4PFP A;  1BIB A;  5CQY A;  4QQG A;  1ZA1 B;  1IXD A;  2A28 A;  2M0O A;  1GCQ C;  2K7A A;  4J9B A;  1IZ6 A;  4QQD A;  4AFS C;  2RH2 A;  4M75 B;  2YLB A;  1QP3 A;  2X35 A;  4X9D A;  1Q7Y R;  1NLO C;  1ABO A;  2VWF A;  4ANJ A;  3UDC A;  2P0K A;  1XNI A;  2DD4 A;  1YJW A;  2FPF A;  3A8O B;  2F5T X;  1B34 B;  3JV3 A;  4L59 A;  1KFZ A;  3HP9 A;  5LJ5 h;  3JSC A;  3OYH A;  2F5K A;  4BI4 A;  2YRC A;  4M77 C;  4F16 A;  2DJQ A;  3JCM g;  3M55 A;  1VQP Q;  2LT1 A;  2CSI A;  2KSS A;  1BIA A;  2CYZ B;  3CCS T;  2EWN A;  2ROL A;  4FSS A;  2K6D A;  2RO0 A;  2IG0 A;  3CCM T;  3H8Z A;  3M58 A;  3CCQ Q;  3EG1 A;  4FIB A;  2EJG A;  5GAO p;  3QSU A;  4F7U B;  2C0I A;  3PT9 A;  1WJS A;  5L8R E;  3JB9 F;  2KRN A;  4PJO A;  1KK7 A;  5KYW B;  3EFR A;  1HXD A;  2VC8 A;  1UDL A;  2RPN A;  3A5Z B;  3RKY A;  1K9M R;  1ZA2 B;  1Q82 R;  1UTI A;  3QHS A;  3EAE A;  2RQW A;  1NYG A;  2X9H A;  2X3W D;  3GIB A;  3M4G A;  3CC7 T;  2DEQ A;  4MDX A;  2VXF A;  1SSF A;  1UJ0 A;  1U1S A;  1D1A A;  1G5V A;  4BUG A;  5GAM e;  1YJW T;  4PLI A;  4HCZ A;  1YJ9 Q;  1SHF A;  2KGT A;  5CCA A;  2CP6 A;  4C92 C;  2XHC A;  2RHI A;  7AT1 B;  4PJO E;  3HSB A;  4EMK C;  2CZ7 B;  4M77 A;  3V7S A;  2K4Y A;  4C8Q A;  1GFD A;  2LZ6 B;  3OYI A;  2KVQ G;  1H64 1;  2I2L A;  4WCI A;  1Q81 U;  1UB4 A;  2H3E B;  4DBQ A;  5LJ3 d;  3NMZ C;  5IXF A;  4IIM A;  3M0R A;  5KYX A;  1WJQ A;  3EGD B;  2J6O A;  3PMT A;  1ABQ A;  1EX4 A;  4ESR A;  4IUQ A;  2NUP A;  2XK0 A;  2EQI A;  3ASK A;  4J7F A;  3TQ7 P;  2QAZ A;  5DLO A;  1X43 A;  2CP3 A;  3KFV A;  3O5Z A;  1OX9 A;  2DEU A;  2B8A A;  4JRI A;  1JB0 E;  2O9S A;  4PK4 A;  4HA8 A;  2DIQ A;  4IUT A;  1H3Z A;  5KYN A;  2CT4 A;  2VV5 A;  3EFO A;  4F7U G;  1QVF P;  1TUD A;  4A4F A;  2YSQ A;  3G7Z A;  2YUN A;  2K79 A;  1WXU A;  3GLX A;  3TCJ A;  8ATC B;  2XMF A;  1MMA A;  3OW2 P;  1TSF A;  4M7D C;  1NLP C;  2HDA A;  4L5G A;  3OSS C;  1PD0 A;  1M4Z A;  1WYX A;  3M0Q A;  2RB6 A;  3FEO A;  2MWO A;  4WF2 A;  3X20 B;  5D6Y A;  2KE9 A;  4A4E A;  1MMD A;  2EYW A;  1BB9 A;  4Z89 A;  3BDL A;  1M8V A;  3OYL A;  2LQ8 A;  2ZPG B;  3OB9 A;  1VIF A;  2AK5 A;  3VU3 C;  2OTL Q;  2DER A;  1Q86 C;  1Y0M A;  5GAO m;  3M57 A;  1X6O A;  3HRT A;  4DEY A;  1AOJ A;  3QDF A;  1Z9Z A;  1YNZ A;  1UEB A;  1QVF A;  1UE9 A;  4FT2 A;  2FZC B;  4MZT A;  4JZ4 A;  5AT1 B;  5KE3 A;  3NGP A;  1FMK A;  2JMA A;  3LH5 A;  1WJR A;  3QUI A;  4M7A D;  2RJE A;  4J8O A;  2LC4 A;  3OW2 A;  2ED0 A;  3CME T;  1KQS A;  5FWB A;  4F14 A;  1WGS A;  4PJL A;  1OOT A;  2KDS A;  3EHQ A;  4N4H A;  1OZ3 A;  4KRT A;  1VQ4 A;  3Q1J A;  1WHH A;  2K5F A;  1WA7 A;  1M1K C;  1NE8 A;  1YFN A;  2MMP A;  2RQU A;  1YIT A;  2JUF A;  2QAS A;  3GNF B;  2DZ9 A;  3M53 A;  1D1B A;  5GAN 3;  5GMK i;  3GBQ A;  4KH0 B;  3CD6 Q;  2HQX A;  4JRK A;  2L2P A;  4JUV A;  4AG1 C;  1BKB A;  1TH7 A;  4Z8A A;  1Y96 A;  4EIK A;  2E6Z A;  3LGL A;  4XTX A;  1B3Q A;  1XJW B;  5GMK l;  1C0M A;  3EG2 A;  2VGN A;  1Z9Q A;  1K73 R;  1D09 B;  4V2S A;  1JO8 A;  3RKW A;  2AKK A;  2BZY A;  1PSF A;  2M0Y A;  3OYE A;  1M3A A;  5FRO A;  2HBP A;  3OYK A;  3JCM P;  3C4S A;  4A54 A;  3NPF A;  3CCR A;  2KNB B;  3LW5 E;  2AIR B;  4P5N A;  1HJD A;  3PGG A;  2BIV A;  3KUF A;  4M78 C;  4PL6 A;  2DXB A;  3QYH B;  2PUO B;  3ZFJ A;  4FYV B;  1VQL Q;  4B9X A;  1VQK T;  5IHI A;  3OYN A;  2DKG A;  2XU8 A;  2QG9 B;  4M77 B;  3LYI A;  2LJ0 A;  3VYG A;  2CP5 A;  3JCM J;  1OU8 A;  3CCV Q;  4BY6 C;  3I5R A;  3VS5 A;  1JU5 C;  3RNJ A;  1WQW A;  2L5Q A;  1VQ4 T;  3THK A;  3MEW A;  1TWB A;  2EAY A;  3HFN A;  1FYN A;  2LCC A;  4LN2 A;  2DXU A;  3VS2 A;  2KK4 A;  1H3H A;  1YIT T;  4BD3 A;  4E7J A;  1OQK A;  4KUL A;  4AFQ C;  1G83 A;  3LX7 A;  2FO0 A;  3EGX A;  1I07 A;  2V26 A;  2OI3 A;  2Y4X A;  4XTV A;  1KQ2 A;  3QJ6 A;  4D6W A;  2Z0W A;  1ZUK A;  5A2Q E;  4PJM A;  1VQ8 A;  2HSE B;  3MEV A;  3ZBD A;  1O9S A;  1IHW A;  3WVD B;  3N5B B;  3FJP A;  2F2V A;  4QVD A;  3CC4 Q;  2FRY A;  5FU7 C;  2EIF A;  1FMV A;  1M2O A;  2XDP A;  4M75 A;  1SRL A;  4ZN3 A;  2HBW A;  4L6V 5;  3QII A;  5GAO n;  5IHK A;  3V7C A;  4IIO A;  1VQ6 Q;  3UT1 A;  3SWN C;  1OPL A;  4PJO F;  5L23 A;  2LVM A;  1E6G A;  4RUG A;  3QDR B;  4C92 B;  2E3I A;  2QTX A;  2A0F B;  4EMK B;  5A0L A;  2L3S A;  1K0S A;  2E4H A;  4FT4 A;  3CPW S;  2QEX A;  2KRM A;  1B34 A;  4PFO A;  2XG8 D;  3JB9 D;  4M77 G;  5LJ5 d;  3S3M A;  3R6N A;  1S72 Q;  1QKW A;  1UUE A;  2KYM A;  5CIU A;  4E7S A;  2XKO C;  3CXC S;  1WHG A;  2LX7 A;  2P84 A;  3C0C A;  1UGV A;  2M02 A;  2K5L A;  1NYF A;  2YUQ A;  5I21 A;  3GF5 A;  1NJI R;  4XTW A;  3EGU A;  2E12 A;  4FM4 B;  1M90 C;  2CH4 W;  4RTY A;  5GAO q;  4M77 F;  4C8Q F;  3CCJ A;  1SRM A;  1MND A;  1WXB A;  2X3X D;  3OMC A;  2H8H A;  2BUD A;  4J9F A;  2GGR A;  4ZTF A;  2BZX A;  3HRU A;  4HCB A;  5GAO l;  2GCX A;  4F7U A;  3RBB B;  2DJZ A;  1VQ8 T;  2KMT A;  3OYM A;  1MHN A;  5KYW A;  3A8G B;  1K1Z A;  4DEX A;  5IN1 A;  2OTJ Q;  1BK2 A;  2DO3 A;  4QVZ A;  4M7D B;  3MO8 A;  2L8D A;  3OBW A;  2E65 A;  2BE7 D;  1YIJ Q;  1AWX A;  1Y7X A;  2RA2 A;  5C6S A;  2COW A;  5EG2 A;  2ENM A;  4NS5 A;  2R57 A;  3X24 B;  4C0D C;  1YHQ A;  2KEA A;  4OMO A;  3NTK A;  1VQO A;  1BI1 A;  3SB2 A;  2HMA A;  2ZPF B;  1N8R U;  2J6F A;  3V8L A;  2K2V A;  1KHI A;  5DY9 A;  2QEX T;  4C92 G;  3REA B;  1TU0 B;  3MET A;  4JJC A;  4JJB A;  1B7T A;  1XQH A;  4F7U E;  5J3B A;  5AYF A;  3J7A F;  3OYC A;  5LL6 S;  5DM7 R;  1QVG P;  5GAN 5;  1M1K U;  2E64 A;  2HL5 C;  2CZ6 B;  5GAN h;  4BI8 B;  2CSQ A;  3PIP A;  3GOX A;  3PMI A;  3EGD A;  3H0I A;  2CUD A;  3DLM A;  3OYB A;  3X25 B;  2DRM A;  5IT9 E;  1SSH A;  3CCJ T;  4X34 A;  4LE9 A;  2MYS A;  3MKD A;  1K4U S;  3PNW C;  3OYG A;  2M16 A;  2PVG B;  2DL7 A;  2HSP A;  4BDZ A;  3G6E A;  3EGX B;  1D0X A;  2AZS A;  1LPL A;  1SPK A;  3CCE A;  2DVE A;  4M7D G;  5HKC A;  1RLP C;  4LUE A;  1YHQ T;  5LJ3 j;  2HQE A;  5FRN A;  2R5A A;  3G4S A;  1VQO T;  1BI3 A;  2F69 A;  3CCS Q;  5LJ3 f;  2GQV A;  2XI9 A;  4E47 A;  3CCL T;  4E7L A;  2P4T A;  1MV0 B;  3CCM Q;  1WFW A;  4LDU A;  4DOW A;  2QA4 A;  1IO6 A;  3TSW A;  4M78 B;  3CEY A;  2RJD A;  3QG1 A;  2CRE A;  1EFN A;  3PE0 A;  5KYU A;  3CC7 A;  3NFC A;  2ZGW A;  2EGA A;  2JOY A;  2EKO A;  2GFU A;  4LDY A;  1X01 A;  4DBR A;  2FPE A;  4DBF A;  5FW9 A;  2CP0 A;  4J9H A;  3RR6 A;  1PCX A;  1ZSG A;  3RES A;  3LLR A;  4XU1 A;  4BY6 B;  1NEB A;  4FYY B;  4J6X A;  5GMK m;  1ZLM A;  3JCM d;  4OB2 B;  1Q81 R;  1RAG B;  2DTI A;  3VS1 A;  4A4H A;  2EYZ A;  2PNI A;  1YJW Q;  4Z88 A;  2KRS A;  3G6E T;  3S3N A;  2EJ9 A;  1FXX A;  3EG3 A;  3RMQ A;  3CCE T;  1MMG A;  1T0H A;  1NEG A;  4JRP A;  1GBR A;  2QQR A;  2JN0 A;  5KCH A;  2JZ2 A;  2LQK A;  2VUB A;  2O31 A;  2ZPE B;  1Q95 G;  5FU7 B;  3G4S T;  1GCQ A;  3UA7 A;  1RI9 A;  1RAI B;  1R77 A;  1YI2 A;  4CC4 B;  5KYY B;  3HRS A;  2MF2 A;  2V1R A;  4M7A C;  2QA4 T;  1KJW A;  4J9G A;  2HEQ A;  3MPU B;  5GAN 8;  1Y07 A;  3SWN B;  9ATC B;  4M75 G;  3CQT A;  2ZZD A;  4Q5W A;  4M78 G;  1VYV A;  1LVK A;  2KQW A;  1LNX A;  3EH2 A;  1WZO A;  1YCS B;  3JCM X;  3SD4 A;  2F1L A;  3CXC P;  4OMN A;  2E10 A;  1M90 U;  1UG1 A;  4A53 A;  4J6W A;  2CDT A;  1PWT A;  2VYT A;  2PZ1 A;  2QGF B;  2DLP A;  5CAI A;  3I56 Q;  2M1H A;  1KIK A;  4M75 F;  4AFU C;  2K9G A;  5GMK j;  1VQP T;  1MMN A;  1WPY A;  1KD1 C;  3VKI A;  4OP0 A;  4AG2 C;  4LDV A;  1G2B A;  4EDU A;  4HKE A;  4QW2 A;  2DRK A;  4JLI A;  5GAM h;  1AWJ A;  5HY6 A;  2GFA A;  4NL3 A;  3CPW A;  1VQ7 A;  3L2Z A;  1IRX A;  2J6K A;  1U1T A;  3CME A;  2NUT B;  3F70 A;  3M0T A;  2MWP A;  1RAC B;  4BI3 A;  4PJO D;  5LJ3 g;  3LGF A;  5I2M A;  3QYG B;  2KXC A;  1H92 A;  2CT3 A;  4K11 A;  3VV0 A;  4CC2 A;  2DK3 A;  3CXC A;  1E7O A;  1QCF A;  1YI2 T;  3BE3 A;  2K5I A;  3C12 A;  2G6F X;  4M77 E;  2LDM A;  4C8Q E;  4C0D B;  2D0Q B;  4E6R A;  3JB9 I;  1BYM A;  2PVO B;  4XQ3 A;  1KQS P;  2A3L A;  1X75 C;  2P0P A;  4KUD K;  2RI2 A;  2O4X B;  1KC8 C;  3A1P A;  1IHV A;  4LD6 A;  1PM3 A;  2YUO A;  4F7U F;  1YCY A;  3L1A A;  1PHT A;  2NWM A;  4HVU A;  3CC2 A;  2OX7 A;  4C92 A;  1AWO A;  3OYF A;  3BW1 A;  2WAC A;  5KYU B;  4EMK A;  3OY9 A;  3L2Q A;  1ZUY A;  4C0G A;  2GNC A;  1I1J A;  4C0F A;  1WHK A;  2PUK B;  3BY7 A;  1LOJ A;  3FIF A;  1N9R A;  4KUI A;  2Y4Y A;  2R5M A;  1ZQ1 A;  4HCK A;  4FW1 A;  4XU0 A;  4Y91 A;  2HKN A;  4IKF A;  4JRQ A;  4R56 A;  6AT1 B;  3HHT B;  1VQK A;  2FL7 A;  1UHF A;  1VYU A;  2RMO A;  5HCK A;  4HXJ A;  1VQ7 T;  1M5Q 1;  2KR3 A;  3A8L B;  3H9N A;  1N8R C;  1UGP B;  3JCM h;  2NUZ A;  1QQJ A;  1E6H A;  1WHJ A;  3IQL A;  4C92 E;  1AZE A;  2CP2 A;  1NM7 A;  1YN8 A;  1PKT A;  2ROT A;  2PVD B;  3LH0 A;  3CPF A;  1MGQ A;  2LJ1 A;  3UF4 A;  3PVQ A;  4C5I A;  1N6A A;  4FYX B;  2DTH A;  5C0M A;  4M7D A;  3FDR A;  3HL8 A;  4OML A;  5LJ5 j;  3OMG A;  4ATO A;  5I2S A;  3OS5 A;  1LJO A;  2JXB A;  4JPB W;  3I55 A;  1IGQ A;  1AWW A;  3FRN A;  1AT1 B;  3NTI A;  2L3Q A;  5LJ5 f;  2K57 A;  3M0U A;  1SEM A;  1VQ4 Q;  2MIO A;  1U06 A;  4ZN1 A;  1X6B A;  3CC2 T;  2GTJ A;  4QT7 A;  4X9C A;  3VUB A;  2O01 E;  4J9D A;  1V1C A;  4NL2 A;  3V8K A;  2H3J A;  2DIL A;  1YIT Q;  1YBY A;  4E7I A;  2DE0 X;  3A98 A;  1T0J A;  2M51 A;  3JAM E;  1RAA B;  3VUZ A;  3GPL A;  1VQ9 A;  1YJN A;  2L3R A;  1N27 A;  1WHL A;  5LJ3 e;  4M7D E;  3S3O A;  4IUV A;  5GAN d;  4KBM B;  2CKK A;  2V8K A;  2A08 A;  2CS7 A;  3MCA B;  4XTZ A;  3T9N A;  3CCR Q;  4JJN K;  3L42 A;  4RG2 A;  1VQ5 A;  2LRQ A;  4OB1 B;  3I5S A;  2LNV A;  3G1J A;  1YP5 A;  3JB9 J;  2DXC A;  3H0F A;  1H8K A;  5GJW B;  3O8V A;  1ZSZ C;  2QXF A;  2BTT A;  2RQV A;  3E19 A;  4J9I A;  1UEC A;  2E5Q A;  3OYA A;  3G71 A;  1QMC A;  2WSF E;  1FMW A;  1ZBX A;  1XTD A;  3CMA A;  1F1B B;  2LMJ A;  3I55 T;  2D8J A;  1W2B S;  1HD3 A;  2PQW A;  4GY5 A;  4M7A B;  2CUB A;  4RTV A;  2DF6 A;  2L3P A;  1RAF B;  1R0B G;  5GJV B;  3JCM Q;  1ZX6 A;  1Q86 R;  4HCC A;  1UJY A;  3GP8 A;  1KD1 U;  4FW2 A;  4EMH A;  3JCM W;  1VQN A;  1I5L A;  4M78 A;  3HTR A;  2E6N A;  1K8A C;  1PSE A;  5D6X A;  2HL3 A;  2QQB A;  1U5S A;  3CCU A;  1VQ9 T;  1X2K A;  2RI5 A;  1YJN T;  5IHN A;  2QQ9 A;  5IXB A;  5CO7 A;  1JBM A;  1VQ8 Q;  2D6F A;  2EPD A;  4LDW A;  1VYT A;  4RTX A;  1X69 A;  3D7S B;  3OS0 A;  1ZUU A;  1M2V B;  4QQ6 A;  3GNG A;  2IIM A;  4AMC A;  2O88 A;  4MZM A;  5M9O A;  4XAX B;  1LCK A;  2VAS A;  2C0T A;  4N0A C;  3L2U A;  4MZP A;  2ZPH B;  1VQ5 T;  2P4R A;  2VKN A;  2MPX C;  1NG2 A;  5FLX E;  2JTE A;  2EFI A;  1ZSZ A;  3OYY A;  3KXT A;  2YRD A;  5CR2 A;  1M1K R;  3SHW A;  2QI2 A;  5ECA A;  2CH4 A;  4M75 E;  4CC3 A;  2KI7 A;  2E1H A;  1XOV A;  2JJ9 A;  2QEX Q;  4M78 E;  3G71 T;  1KC8 U;  3E9G A;  2EQM A;  1SKU B;  2FG0 A;  3M9Q A;  4J5Y A;  1ZBJ A;  1Q7Y C;  1TTH B;  2JNG A;  3CMA T;  5FRM A;  1OYX A;  4FSX A;  2QTV A;  1BI0 A;  4ME7 A;  1TG0 A;  3KBG A;  4RCB A;  3LWH A;  5GMK e;  1OPK A;  5GAO r;  2RHX A;  4M7A G;  2ZCF B;  2DX1 A;  1K9A A;  1JXM A;  1RUW A;  2VXE A;  5KYY A;  4WTO B;  2M9U A;  4OF1 A;  1JJ2 S;  1V29 B;  2XID A;  1VQN T;  2WSC E;  3AHU A;  1TXQ A;  3QPH A;  3SWN A;  3CCJ Q;  5CKH A;  3QZ9 B;  5I11 A;  4IUR A;  3CCU T;  1GL5 A;  3JCM f;  4NOY A;  3CCL A;  1TOV A;  2XDB A;  1RAE B;  2DYB A;  3ZL7 C;  1AVZ C;  2D9T A;  1M1G A;  3VS7 A;  4JS5 A;  2W10 A;  1Y71 A;  2B86 A;  2VB6 A;  2X4X A;  1QVF S;  2FZK B;  4R55 A;  4AT1 B;  1YHQ Q;  1S1N A;  1HYO A;  3VRZ A;  1QKX A;  3M0S A;  1W70 A;  3MJX A;  2LJ3 A;  3JCM V;  4OVA A;  3OW2 S;  4C92 F;  2GQI A;  3PIO A;  1K9M C;  1ARK A;  1Q82 C;  2C06 A;  2RQR A;  2EGE A;  5GAM d;  2KXD A;  1JEG A;  3H6Z A;  1VQM A;  2RK2 A;  4C5H A;  2YHT A;  2CGH A;  2NUT A;  4JLG A;  2EYY A;  3LWI A;  1PC0 A;  2IPO B;  4OMM A;  1MUZ A;  1KSW A;  3L2V A;  1YIJ T;  1RAH B;  1SF9 A;  1V76 A;  1HK9 A;  2E5K A;  3I35 A;  2RNA A;  4O5V A;  2SEM A;  2DZC A;  3S6W A;  2RN8 A;  5A0G A;  1N5Z A;  1C6V X;  3OSV A;  3JCM c;  2O4X A;  1BCO A;  2O2O A;  5KE2 A;  2X4J A;  3OYJ A;  4A4K A;  4B9W A;  4DOV A;  1W4S A;  5CKE A;  3G6E Q;  2FEI A;  4YTL A;  2AZV A;  4FL6 A;  3WVE B;  3A8M B;  4M7D F;  2DM1 A;  4ZGE B;  3CCE Q;  4FU6 A;  4RMO A;  4PJO C;  2EJF A;  2XDD A;  1UGS B;  2E3H A;  2YRV A;  3G4S Q;  3CBP A;  5LJ5 e;  3WXM B;  2AKL A;  4DQ2 A;  3V7R A;  1WXT A;  4OB0 B;  1QWF A;  1M90 R;  3JRZ A;  2JM9 A;  5EC7 A;  2QA4 Q;  4PKC C;  2E70 A;  4EMG A;  1AZG B;  2IVW A;  1D1C A;  4BE0 A;  3CC7 Q;  1ZSZ B;  1OI1 A;  1VQM T;  1VQP A;  3VS3 A;  2BE9 B;  2DBM A;  1CSK A;  3RDV A;  2RJC A;  4J9C A;  1W2B P;  3VS0 A;  3CCQ A;  1I0C A;  4RG8 A;  2YWW A;  3M54 A;  2RJF A;  2KT8 A;  1QWE A;  1D0Z A;  1EZZ B;  3HPW A;  1K8A U;  2DBK A;  1IGU A;  1CKB A;  4C8Q C;  2YDL A;  3JB9 G;  2LCL A;  2QQS A;  2ZPB B;  3FB9 A;  2P0Q A;  2DTO A;  4HVW A;  1OZ2 A;  3VYH B;  1GXI E;  1CKA A;  5DLQ E;  3INZ A;  1D3B B;  2DD5 A;  3MEA A;  2R58 A;  3P8D A;  3P8H A;  3DB3 A;  4J9E A;  4O6J A;  2GF7 A;  4ZGJ B;  4RCC A;  3CPW P;  2LT4 A;  2LNH B;  2QDL A;  3I9Q A;  1JRI A;  2DFU A;  2HD0 A;  2OJ2 A;  1IB8 A;  5I22 A;  3JCM b;  2J05 A;  1AD5 A;  1UGQ B;  1PRL C;  1YJ9 A;  1W2B A;  1TUC A;  1GRI A;  4II1 A;  1R0C B;  3EG0 A;  3QWX X;  1YI2 Q;  1M3C A;  1SG5 A;  1RI0 A;  2DET A;  2EQU A;  3ULR B;  4D8K A;  3UWN A;  1Q7Y U;  4N4G A;  4QVC A;  3I56 A;  5CKF A;  4OGE A;  4ELZ C;  1WDX A;  2KY9 A;  1TS9 A;  2DL8 A;  2V8J A;  2AT1 B;  1RAB B;  4FYW B;  4F17 A;  4D8D A;  3FC3 A;  5HK0 A;  4M78 F;  2MCN A;  4Z02 A;  1JXO A;  3QO3 A;  2FVU A;  4PFZ A;  2RHZ A;  1QCN A;  2O9V A;  4X1V A;  2PU9 B;  3CCQ T;  1K73 C;  5J26 A;  4PNO A;  3X28 B;  3OS1 A;  4XTU A;  2ZPI B;  4CC7 A;  3EG9 B;  3OQ5 A;  1WHM A;  1GCP A;  2CZ0 B;  3TVT A;  1WX6 A;  1G3W A;  3E9F A;  3VJP A;  5IAY A;  2RQT A;  1JJ2 P;  2EQJ A;  5GAN 7;  2D1X A;  2K2M A;  1BBZ A;  4XU2 A;  2DPP B;  2RHU A;  1RAD B;  1M3B A;  2LQN A;  1U3O A;  2QK0 A;  4M7A A;  4OGC A;  5GAN j;  1U8R A;  1VQ7 Q;  4PJN A;  3MP8 A;  1R8O B;  3EHR A;  2ED1 A;  4PJJ A;  4RKU E;  3R6O A;  3CME Q;  5GAN f;  3P8B B;  2QGG A;  3H41 A;  4MML A;  3QZ5 B;  3A8H B;  2D0N A;  3SEM A;  3FLG A;  3TSZ A;  3OYD A;  4GLK A;  5CQX A;  1YJ9 T;  1VA7 A;  1K9M U;  3NHN A;  4RTZ A;  4OMF B;  1Q82 U;  2JS2 A;  1I8F A;  4MDW A;  1PNJ A;  1TUG B;  2DYI A;  3DB4 A;  3I56 T;  2OTL A;  1W1F A;  1BU1 A;  1GBQ A;  4M77 D;  2DAQ A;  5GAN 6;  4C8Q D;  2GBQ A;  2YT6 A;  4KT0 E;  1I81 A;  1M2V A;  1JJ2 A;  4IUP A;  4C0Z A;  5GAN 4;  2Y90 A;  2A7Y A;  1G3T A;  3J81 E;  4CRI A;  4M7A E;  3HKS A;  1SHG A;  2OAW A;  2FZG B;  2ABL A;  2EYX A;  3JCM e;  4UC4 A;  2I0N A;  4XTY A;  4ZTJ A;  3CC2 Q;  8AT1 B;  1PG5 B;  1PKS A;  2KBT A;  4E7Z A;  1OEB A;  1WI7 A;  3C94 A;  4DA4 A;  1EIF A;  1N9S A;  2DVJ A;  1QP2 A;  1Y57 A;  1P92 A;  2C0O A;  2FYK A;  3MHX A;  4HVV A;  1X6G A;  1VQK Q;  5FU6 C;  1PD1 A;  2RK1 A;  3UAT A;  1BI2 A;  3ER0 A;  3E2U A;  3CD6 A;  3SDZ A;  4GLM A;  3VS6 A;  1QVG S;  2EKH A;  1WIE A;  4J6Y A;  2MK5 A;  2A37 A;  2KYB A;  4JJD A;  4KGX B;  5D7U A;  2FRW A;  4HT8 A;  2F2X A;  3PFS A;  1C1A A;  2G3R A;  2HZY A;  1QCO A;  1W6X A;  1OV3 A;  4C92 D;  1B07 A;  2DL3 A;  2HQH A;  1OU9 A;  2D8H A;  5IH2 A;  4EPC A;  2OTL T;  3OA6 A;  4PJO B;  1NJI C;  1WLP B;  1OUL A;  2DNU A;  1KD1 R;  2LCS A;  3M4Y A;  3U23 A;  2QDY B;  2ECZ A;  2KAF A;  3I55 Q;  1VQL A;  1NZ9 A;  5A0D A;  3RER A;  2F2W A;  3MP1 A;  2ESW A;  1FWZ A;  3M0P A;  2JVV A;  4OMP A;  5HK3 A;  2YLC A;  2LTO A;  2RHY A;  2J06 A;  1O75 A;  1G3Y A;  4E7H A;  5CVI A;  2BZ8 A;  4M75 C;  4TVR A;  1M8M A;  4PLL A;  2NYS A;  2MI6 A;  3CCV A;  4E7K A;  1WQ7 A;  3OBY A;  4QKU A;  1QVP A;  1VOM A;  4A63 B;  4HT9 A;  4BE1 A;  3M56 A;  4CI0 C;  2K3Y A;  3RIR A;  1VQ9 Q;  1YJN Q;  4JZ3 A;  1PRM C;  3QWY A;  1A0N B;  2EYQ A;  1M27 C;  4C8Q B;  3CBM A;  2JMC A;  5GAN g;  4RTW A;  3M59 A;  5LJ3 h;  3CD6 T;  4M7D D;  5KYX B;  1KC8 R;  4XK8 E;  1RL2 A;  3PVL A;  1VQ5 Q;  2COY A;  3OS2 A;  4E2F B;  1NPR A;  4ORZ A;  2NUP B;  2JTM A;  1NBE B;  2HAX A;  4MMK A;  3QBY A;  2COZ A;  2DL5 A;  2SRC A;  2XD0 A;  3CC4 A;  2JM8 A;  1YWP A;  4ZNX A;  2YXY A;  2XIC A;  4A4G A;  4KGZ B;  1M1F A;  3QJY A;  3G71 Q;  2EVR A;  5GAM j;  1VQ6 A;  1UHC A;  2E41 A;  2OAU A;  3EFO B;  4LUD A;  3E1S A;  2HKQ B;  1M9S A;  4LDX A;  3CMA Q;  4PJO G;  3RMS A;  5GAM f;  1K73 U;  4LXC A;  2ATC B;  2HNI A;  1J3T A;  2WSE E;  3C95 A;  2YUP A;  1VQL T;  3VRY A;  1NPP A;  3M5A A;  3BFM A;  1HSQ A;  2FHD A;  1N8R R;  1ACM B;  5D6W A;  2BKD N;  4FCY A;  3CCR T;  2MOX A;  2QQA A;  2DL4 A;  5CKD A;  2L0A A;  4C5G A;  3ZEH A;  3CCV T;  1S72 A;  1VQN Q;  2FB7 A;  2EQK A;  4N4I A;  3CCU Q;  4BAC A;  4BB7 A;  4Y28 E;  4R0K A;  4ELY C;  2JW4 A;  2RD1 A;  3REB B;  1X2Q A;  1MNE A;  1QW1 A;  3SFM A;  1M30 A;  4C8Q G;  4ZGD B;  2CP7 A;  2VVK A;  3TEE A;  5LJ5 g;  1KG1 A;  1ZHI A;  4XU3 A;  2FPD A;  2QYZ A; 
#chains in the Genus database with same CATH homology
 2J6K A;  1M3A A;  4OMQ A;  2DA9 A;  3M0T A;  2EGC A;  1AEY A;  2W0Z A;  3NPF A;  2AKL A;  2K3B A;  2KNB B;  2KXC A;  3UA6 A;  1H92 A;  1WXT A;  1HJD A;  2CT3 A;  4K11 A;  1QWF A;  2LP5 A;  4CC2 A;  1E7O A;  1QCF A;  4LNP A;  2JM9 A;  5EC7 A;  1RLQ C;  2G6F X;  2KRO A;  2EW3 A;  1AZG B;  4E6R A;  1QLY A;  5IHI A;  2V1Q A;  3VS3 A;  1JQQ A;  2DBM A;  1CSK A;  2LJ0 A;  4J9C A;  3VS0 A;  1I0C A;  1UFF A;  2YUO A;  3I5R A;  3VS5 A;  1PHT A;  2NWM A;  4HVU A;  2KT8 A;  1QWE A;  1JU5 C;  2KT1 A;  3RNJ A;  2DBK A;  1AWO A;  3THK A;  1CKB A;  2YDL A;  1FYN A;  4LN2 A;  1ZUY A;  1K76 A;  2GNC A;  3VS2 A;  1I1J A;  1H3H A;  5FWC A;  4HVW A;  4AFQ C;  1CKA A;  1G83 A;  2FO0 A;  4HCK A;  1I07 A;  2OI3 A;  4J9E A;  2DMO A;  1ZUK A;  1UHF A;  1VYU A;  2RMO A;  5HCK A;  1X27 A;  2LNH B;  2QDL A;  4HXJ A;  3I9Q A;  2KR3 A;  2GTO A;  2OJ2 A;  2F2V A;  5I22 A;  2FRY A;  2NUZ A;  2EBP A;  1E6H A;  2J05 A;  1AD5 A;  3IQL A;  2J7I A;  1SRL A;  1PRL C;  3H0H A;  2HBW A;  1TUC A;  1YWO A;  1GRI A;  3EG0 A;  3QWX X;  1AZE A;  3FJ5 A;  5IHK A;  1M3C A;  4IIO A;  4GBQ A;  1NM7 A;  3ULR B;  4D8K A;  1OPL A;  2JS0 A;  5L23 A;  1YN8 A;  1MV3 A;  1E6G A;  1PKT A;  4RUG A;  1T3L A;  1WDX A;  4RTT A;  2ROT A;  3VS4 A;  2DL8 A;  2LJ1 A;  3UF4 A;  3PVQ A;  2A36 A;  2L3S A;  4F17 A;  1T3S A;  1K0S A;  4D8D A;  1K0X A;  2PTK A;  1GFC A;  4M4Z A;  2MCN A;  1JXO A;  2KRM A;  4OML A;  2RF0 A;  4AFZ C;  2O9V A;  2LQW A;  4X1V A;  2JXB A;  4JPB W;  1AWW A;  2L3Q A;  3M0U A;  3R6N A;  4RTU A;  2JT4 A;  1QKW A;  1SEM A;  1UUE A;  2KYM A;  4CC7 A;  2MIO A;  1U06 A;  1X6B A;  2HCK A;  2GTJ A;  4Y92 A;  1GCP A;  4QT7 A;  4J9D A;  1V1C A;  3TVT A;  2LX7 A;  2DIL A;  3C0C A;  1WX6 A;  1UGV A;  2RQT A;  2A28 A;  1NYF A;  1GCQ C;  2K7A A;  2YUQ A;  4J9B A;  2DE0 X;  2D1X A;  2K2M A;  1T0J A;  2M51 A;  3A98 A;  3EGU A;  1BBZ A;  4AFS C;  2CH4 W;  4RTY A;  1SRM A;  1M3B A;  1WXB A;  2LQN A;  2X3X D;  2H8H A;  1U3O A;  1NLO C;  4J9F A;  2GGR A;  2BZX A;  1ABO A;  3RBB B;  2VWF A;  3EHR A;  2ED1 A;  4DEX A;  1K1Z A;  3H41 A;  2A08 A;  1BK2 A;  2D0N A;  3SEM A;  2FPF A;  1AWX A;  3TSZ A;  3I5S A;  3JV3 A;  1KFZ A;  2ENM A;  1VA7 A;  1YP5 A;  3NHN A;  4RTZ A;  3H0F A;  1H8K A;  5GJW B;  2JS2 A;  1PNJ A;  2KEA A;  2BTT A;  4OMO A;  2RQV A;  1W1F A;  1BU1 A;  4J9I A;  4F16 A;  1UEC A;  1GBQ A;  2DJQ A;  2J6F A;  2GBQ A;  2YT6 A;  2CSI A;  3REA B;  2ROL A;  4FSS A;  2K6D A;  4JJC A;  4JJB A;  1SHG A;  2OAW A;  3EG1 A;  2LMJ A;  2ABL A;  2D8J A;  2EYX A;  2I0N A;  1HD3 A;  2CUB A;  2C0I A;  4RTV A;  1PKS A;  2DF6 A;  2KRN A;  2L3P A;  2KBT A;  1OEB A;  5GJV B;  1ZX6 A;  2CSQ A;  1WI7 A;  1UJY A;  2DVJ A;  1Y57 A;  1UDL A;  2RPN A;  2CUD A;  3H0I A;  2C0O A;  4HVV A;  1X6G A;  1UTI A;  1U5S A;  2DRM A;  1SSH A;  2RQW A;  1NYG A;  2X3W D;  1X2K A;  4LE9 A;  5IHN A;  5IXB A;  1K4U S;  2EPD A;  1VYT A;  4RTX A;  3UAT A;  1X69 A;  4GLM A;  3VS6 A;  1UJ0 A;  1ZUU A;  2EKH A;  1WIE A;  2DL7 A;  2HSP A;  2A37 A;  2IIM A;  2KYB A;  2O88 A;  4JJD A;  1LCK A;  2C0T A;  2FRW A;  1SHF A;  2F2X A;  2AZS A;  2KGT A;  1SPK A;  2P4R A;  2VKN A;  1NG2 A;  2JTE A;  1W6X A;  1OV3 A;  1RLP C;  4LUE A;  1B07 A;  2DL3 A;  3SHW A;  2D8H A;  5ECA A;  5IH2 A;  2CH4 A;  2LZ6 B;  1GFD A;  4WCI A;  4CC3 A;  1WLP B;  1XOV A;  2DNU A;  3NMZ C;  5IXF A;  4IIM A;  3M0R A;  1MV0 B;  2LCS A;  3U23 A;  1WFW A;  2J6O A;  2FG0 A;  1ZBJ A;  1ABQ A;  1IO6 A;  3TSW A;  2ECZ A;  4ESR A;  2F2W A;  2EQI A;  2CRE A;  1EFN A;  2ESW A;  3PE0 A;  3M0P A;  2EGA A;  4OMP A;  1X43 A;  3KFV A;  1TG0 A;  3O5Z A;  1OPK A;  2J06 A;  2FPE A;  2BZ8 A;  2O9S A;  5FW9 A;  4J9H A;  2DX1 A;  1K9A A;  1M8M A;  1JXM A;  2CT4 A;  1RUW A;  1ZSG A;  4A63 B;  1TUD A;  1NEB A;  2YSQ A;  2YUN A;  2K79 A;  1WXU A;  4JZ3 A;  5I11 A;  1PRM C;  3QWY A;  1A0N B;  2XMF A;  1GL5 A;  1M27 C;  1ZLM A;  2JMC A;  4RTW A;  1NLP C;  2HDA A;  3VS1 A;  1WYX A;  2DYB A;  2EYZ A;  1AVZ C;  2PNI A;  3M0Q A;  3ZL7 C;  4Z88 A;  3VS7 A;  2KRS A;  2W10 A;  3PVL A;  2B86 A;  2KE9 A;  2EYW A;  1BB9 A;  4ORZ A;  4Z89 A;  3EG3 A;  2DL5 A;  2SRC A;  1S1N A;  3VRZ A;  2AK5 A;  2JM8 A;  1QKX A;  1YWP A;  1T0H A;  3M0S A;  1NEG A;  1W70 A;  4ZNX A;  1GBR A;  1Y0M A;  2LJ3 A;  2O31 A;  4DEY A;  1AOJ A;  1GCQ A;  3UA7 A;  1RI9 A;  1Z9Z A;  2GQI A;  1YNZ A;  2EVR A;  4CC4 B;  1UE9 A;  1UHC A;  4LUD A;  1ARK A;  4JZ4 A;  2V1R A;  3NGP A;  1FMK A;  2JMA A;  2EGE A;  2RQR A;  3LH5 A;  1KJW A;  2KXD A;  4J9G A;  2HEQ A;  1J3T A;  2YUP A;  1JEG A;  3VRY A;  2EYY A;  3CQT A;  2ED0 A;  1HSQ A;  5FWB A;  1VYV A;  4OMM A;  1MUZ A;  4F14 A;  1KSW A;  1YCS B;  2MOX A;  1OOT A;  2DL4 A;  2L0A A;  3EHQ A;  4OMN A;  1UG1 A;  4KRT A;  2CDT A;  1WA7 A;  2E5K A;  3I35 A;  1PWT A;  2RNA A;  2PZ1 A;  2RQU A;  2DLP A;  2SEM A;  1KIK A;  2RN8 A;  4R0K A;  2JW4 A;  4AFU C;  1N5Z A;  2K9G A;  3REB B;  1X2Q A;  3GBQ A;  2L2P A;  4AG1 C;  2O2O A;  4Z8A A;  4EIK A;  4AG2 C;  1G2B A;  1B3Q A;  1M30 A;  2DRK A;  2FEI A;  2VVK A;  3EG2 A;  2AZV A;  1Z9Q A;  1AWJ A;  1JO8 A;  2FPD A;  2DM1 A;  2AKK A;  2BZY A;  2M0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...