2K7AA

Ensemble structures of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
b'GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain of Tyrosine-protein kinase ITK/TSK
publication title Proline Isomerization Preorganizes the Itk SH2 Domain for Binding to the Itk SH3 Domain
doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 6
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k7aA00
1PNJA 2FRWA 2RQVA 2BTTA 2KT8A 1ZUUA 2DL8A 2O2OA 2PNIA 3NGPA 5HCKA 2DX1A 2DL5A 2BZYA 2A36A 1UE9A 2LNHB 4J9HA 2ECZA 2VVKA 4J9GA 2JM8A 4RTVA 5FWCA 1UTIA 2V1RA 4DEXA 1WA7A 1SEMA 4J9EA 5I11A 3GBQA 1VYVA 2DL3A 3PE0A 2JMAA 1WFWA 4F16A 1K9AA 2ROTA 4AFSC 2OI3A 3A98A 4ESRA 3IQLA 4F14A 2EYYA 3VS4A 1KSWA 2KNBB 2M51A 1OEBA 1SPKA 1GBRA 2RPNA 2O31A 1BBZA 1YN8A 4CC4B 3EG1A 1OPKA 2EYZA 4IIMA 1I07A 4Y92A 2LJ0A 1QCFA 2EKHA 1AOJA 2YUNA 3EGUA 1GCQA 2FRYA 4RTYA 1U3OA 4Z8AA 1E7OA 4WCIA 1X2KA 2DE0X 2CT3A 4J9CA 1B07A 2L2PA 1M3BA 1TG0A 1UG1A 1XOVA 1Z9QA 2W0ZA 3M0QA 2GQIA 2AKLA 2LZ6B 1U06A 2ABLA 2JT4A 1KFZA 1W6XA 2GTJA 2DLPA 2F2WA 4A63B 1NG2A 2YUQA 4M4ZA 5IH2A 1BU1A 2KRNA 2NUZA 1E6GA 4J9IA 1UDLA 4RTUA 1ZBJA 2DL4A 1YNZA 4KRTA 2DYBA 1EFNA 1K1ZA 1G83A 1QWFA 4LUDA 2JTEA 1ABOA 2F2VA 2GNCA 5IXFA 1PKSA 4RTWA 2KRSA 4FSSA 2JXBA 1QLYA 2L3QA 3C0CA 2EW3A 1I0CA 1OV3A 3ZL7C 1YCSB 5FWBA 2GGRA 3H41A 2CREA 4QT7A 5IHIA 1JXOA 2EYXA 3R6NA 1S1NA 2DNUA 2DVJA 3VRYA 4LN2A 1BB9A 2KBTA 2W10A 1UFFA 1MV3A 3SEMA 1T0HA 4D8KA 2O88A 1ZX6A 1NEGA 1MV0B 1PWTA 4JPBW 4R0KA 2BZXA 1AWWA 4AFUC 2DBMA 1UJ0A 4GBQA 3VS2A 1WXUA 1GCPA 2KGTA 4AG2C 2DF6A 2KYMA 1PRLC 1LCKA 3VS7A 1GFDA 1G2BA 1TUCA 1JXMA 1CKAA 3EG2A 1B3QA 1J3TA 2DA9A 1AVZC 1RI9A 3EG3A 2RQWA 1CKBA 4K11A 1X6BA 1H8KA 2CH4W 2K7AA 3TSZA 3M0TA 1WIEA 1WYXA 1M8MA 2QDLA 2A28A 2E5KA 3CQTA 2KYBA 3O5ZA 2I0NA 2J6OA 1TUDA 4AFQC 2RQRA 5L23A 1NLOC 2C0IA 1RUWA 2CSQA 2HEQA 2GTOA 2EQIA 2BZ8A 2CUBA 1Z9ZA 1QWEA 2SEMA 1ARKA 2MOXA 1NLPC 2D8HA 2J6KA 5IHNA 2DRMA 4LE9A 2RNAA 2LX7A 3M0RA 1AEYA 4JZ4A 4OMLA 2JM9A 4RUGA 1K76A 2GBQA 1K0XA 2KROA 2EGCA 2AZVA 1NEBA 2D1XA 1HJDA 2M0YA 3VS3A 1SRMA 2LCSA 1A0NB 5EC7A 2JW4A 1M3CA 1UHFA 2JMCA 4EIKA 4RTZA 2HSPA 3EG0A 1HD3A 3UA7A 5IHKA 1RLQC 2RQTA 1M3AA 3REAB 4OMOA 2DILA 4OMMA 1PKTA 2MIOA 2RF0A 4J9BA 3U23A 2L3SA 2A37A 1T3LA 3M0PA 3NHNA 1YWPA 2HDAA 2RQUA 1CSKA 2FPFA 2A08A 1GFCA 2K3BA 2DL7A 1H92A 2EVRA 2DM1A 3RNJA 5GJWB 1PRMC 1NM7A 3ULRB 1SHFA 1AWJA 4JJCA 4OMNA 3UA6A 2K9GA 1KIKA 2G6FX 2AZSA 2HCKA 3FJ5A 1AWXA 1JQQA 4HVVA 2YUOA 4CC2A 2ROLA 2AK5A 3RBBB 1ABQA 3THKA 1H3HA 3TVTA 1UECA 4RTXA 3H0FA 1OOTA 4F17A 3NMZC 3QWYA 3TSWA 1WI7A 1FYNA 2DRKA 1AZGB 1VA7A 3PVLA 2FG0A 1AD5A 1MUZA 1BK2A 1K4US 2YUPA 1U5SA 3VRZA 2HBWA 2JS0A 2OJ2A 1SRLA 1UUEA 2SRCA 1Y57A 2MCNA 2X3XD 1GBQA 4JJBA 1W70A 1UGVA 1T0JA 3PVQA 1JU5C 2KE9A 1NYFA 1ZUKA 2CDTA 3LH5A 4OMQA 3EHQA 2K79A 1IO6A 3REBB 4Z88A 1W1FA 3I5RA 1QKWA 2YT6A 2C0TA 2X3WD 3EHRA 1M27C 1X43A 2DJQA 1V1CA 2KXCA 2LQNA 2FPDA 4ORZA 4LUEA 2PZ1A 2KRMA 2OAWA 2LQWA 2EBPA 1ZUYA 1X6GA 2LJ3A 2F2XA 1I1JA 4Z89A 3VS1A 4D8DA 1X2QA 4JZ3A 2YSQA 2JS2A 1JO8A 2CSIA 2ED1A 4ZNXA 1NYGA 4HXJA 2ED0A 1ZSGA 2VWFA 1YP5A 2LP5A 2XMFA 2NWMA 1ZLMA 2B86A 4GLMA 1AWOA 2EYWA 5I22A 2J7IA 1WXBA 2EPDA 2KEAA 2PTKA 1SSHA 3I5SA 2J05A 2J6FA 1WDXA 1WLPB 2RMOA 3JV3A 3VS0A 1K0SA 4HCKA 1UHCA 2CT4A 1WX6A 2CH4A 3UF4A 3VS6A 2K6DA 1VYTA 3UATA 3VS5A 3H0IA 4HVUA 1HSQA 2RN8A 2YDLA 1OPLA 4JJDA 4DEYA 4OMPA 3NPFA 2KR3A 1Y0MA 1GRIA 2D0NA 2LMJA 4X1VA 2L3PA 2LJ1A 3I9QA 3H0HA 2P4RA 4CC7A 1GCQC 4AG1C 1VYUA 1AZEA 2AKKA 5FW9A 1WXTA 1X27A 2FEIA 2O9VA 2CUDA 2KT1A 1UJYA 2EGEA 5GJVB 3SHWA 1SHGA 2FPEA 1KJWA 1FMKA 2KXDA 2DBKA 2J06A 2EGAA 2VKNA 3I35A 4E6RA 2K2MA 4J9DA 1JEGA 1PHTA 1RLPC 5ECAA 3M0UA 1GL5A 2ENMA 4AFZC 2L0AA 2C0OA 4CC3A 2ESWA 4IIOA 3QWXX 3KFVA 4RTTA 4J9FA 2IIMA 2O9SA 2V1QA 1E6HA 1N5ZA 1X69A 1YWOA 2FO0A 2D8JA 2H8HA 1QKXA 3M0SA 2DMOA 4HVWA 1M30A 4LNPA 1T3SA 5IXBA
chains in the Genus database with same CATH superfamily
3SWNC 5GAMe 2GCXA 2GQVA 2KT8A 3G4SA 1WZOA 1ZUUA 2DL8A 2PNIA 2RHIA 5HCKA 1NE8A 4C0GA 2L89A 1UE9A 2P0PA 2LNHB 5GMKe 1K8AU 2M16A 3V7CA 1D0XA 4J9GA 5CKBA 3C4SA 1UTIA 2V1RA 4J6XA 1SEMA 2DZCA 3C95A 2A0FB 5KYXB 4AT1B 3R6OA 3WVDB 2E6ZA 3RKXA 3CC7A 1WFWA 1PSEA 4ESRA 1KSWA 2M51A 1SPKA 1XQHA 5GANg 1IGUA 2RPNA 2RHUA 6AT1B 2CZ6B 4Y92A 2LJ0A 3PGGA 1Q81C 1G3WA 1GCQA 3OS5A 4E7IA 1WPYA 2VV5A 1AHJB 2BE9B 2X51A 2B8AA 1X2KA 4J9CA 2CT3A 2HKQB 1Z9QA 2E70A 2LZ6B 2ABLA 2EQMA 2JT4A 1IGQA 2ZPEB 3OA6A 1W6XA 1UGRB 3H9NA 1VQOT 2L3RA 2DLPA 5GANf 3QZ5B 2YUQA 4CRIA 2VXEA 5FROA 3J81E 2HQXA 4M7DD 2DL4A 1EFNA 3RUXA 1K73U 4NL2A 3VJPA 3CCLT 3INZA 4OF1A 3RESA 1BI1A 2JTEA 1ABOA 2GNCA 4RCBA 1PKSA 3MEUA 3GF5A 1Y96B 3MEAA 2LC4A 4QQDA 4NOYA 1M1KR 2EW3A 3RR6A 3VKIA 2DTIA 1ZSZA 4C5HA 4FSXA 4LN2A 5HY6A 2ZAEA 3QXEB 3SEMA 1T0HA 3PFSA 2KI7A 4R55A 1FX7A 4C0DC 1I81A 3ASKA 3CCUT 1PD1A 2DKGA 4JLIA 2BZXA 4AFUC 4M75C 4FL6A 2LRQA 1WXUA 4ZN1A 2ZPHB 4BY6B 5J26A 2KYMA 1PRLC 1NBEB 1GFDA 4GY5A 1VQLT 2JJ9A 1G3TA 3EG2A 1ZA1B 1B3QA 1MMDA 4F7UG 1J3TA 2DA9A 2RHZA 2DTHA 2RM4A 3D7SB 3TSZA 2HQEA 3VV0A 4DBHA 2QDLA 2A28A 2E5KA 2KYBA 1MNDA 4JRQA 3A5ZB 5L23A 3JCMb 3HFNA 2C0IA 1RUWA 4PLLA 8AT1B 2SEMA 1ZHIA 1VQ6Q 2MOXA 1NLPC 2J6KA 5KYYB 4BD3A 4A53A 4XTZA 2CP3A 4LDYA 4OMLA 2GBQA 2P0KA 2EGCA 2CP7A 3CXCP 1KD1U 3JCMX 1LPLA 3RKWA 2D1XA 1YJNA 1YJNT 2EQJA 1OX9A 1JJ2P 2V8KA 2JW4A 1M3CA 4EIKA 1O75A 3CCJA 3CCJT 3QKJA 1YJ9A 1Y71A 3E9GA 2HSPA 4M77E 1D3BA 1MGQA 1VQ8T 4KT0E 3EG0A 1RLQC 2RQTA 2X4WA 5C0MA 4OMOA 4OMMA 2IPOB 4J9BA 4FCYA 1T3LA 5LL6S 1YI2A 1YI2T 1YWPA 3CD6Q 2HQHA 1CSKA 3I55A 2CZ0B 3EFOA 3SWNA 1VOMA 3RNJA 4J8OA 5GJWB 1D0ZA 4PJOE 1AWJA 1N9SA 1KIKA 1U1TA 1BI0A 1AWXA 2YRDA 3EGXA 2YUOA 2JUFA 2P84A 3C94A 2HAXA 3META 3RBBB 3OYFA 2LCLA 3M59A 3LYIA 4M77A 4RTXA 2FZCB 3TSWA 5LJ3h 3M57A 1I5LA 2K4YA 2FG0A 1MUZA 2MYSA 4M7AG 3CCEA 2XHCA 1V29B 4PKCC 4KGZB 3HHTB 4RCCA 1VQMA 1SRLA 2RJDA 3RMSA 4DOWA 1UUEA 1G3SA 4PJOA 1VUBA 4JJBA 4M7AB 1UGVA 3PVQA 4JRIA 1Q7YR 1V76A 3LH5A 3EFRA 4C8QB 2NUTB 2K79A 1Q86R 2MWOA 1YITA 1YITT 5LJ3j 2QI2A 3REBB 4N4HA 4BACA 2CKKA 4HCBA 4B9WA 5LJ3g 4M78C 2YT6A 3C12A 2X3WD 3EHRA 4HCCA 2XD0A 4BUGA 3UWNA 2KK4A 5GAN5 1AT1B 3OSVA 2PZ1A 1KQ1A 2M0OA 2R5MA 1I5OB 1OU8A 4ELYC 4JJNK 2LJ3A 1I1JA 4D8DA 4JZ3A 2JS2A 3SB2A 3L2UA 2ED1A 1NYGA 5KE3A 4RG2A 4M75E 2ED0A 4A4KA 1YP5A 3JCMW 5LJ3f 2F1LA 2K5LA 2YRCA 1IB8A 1WXBA 2EPDA 2PTKA 2ZPBB 1M1FA 4JRKA 4JRPA 8ATCB 2J6FA 2CS7A 1WDXA 2RK1A 2LDMA 3UF4A 1OZ2A 3VS6A 1F1BB 4GLKA 2VXFA 1NJIU 2RN8A 2D0NA 3PIPA 1QVFS 2L3PA 2XU8A 3OYYA 2P4RA 1GCQC 4AG1C 3CC2Q 1KQSP 5GMKm 1C0MA 4M75A 2AIRB 2FEIA 3QBYA 2QQAA 1UJYA 4KH1B 3SHWA 3MP1A 1SHGA 2KSSA 3QPHA 1RLPC 1MMNA 3GIBA 3M0UA 3JB9F 5CKHA 3CCSA 2HL3A 4BB7A 2C0OA 4IIOA 3QWXX 2NUPA 1G3YA 3EAEA 4FM4B 1Q95G 2H8HA 1M5Q1 2LQKA 4C92G 5GAOm 3MEVA 3CCMT 2FZGB 1BI2A 3OYLA 5FRMA 1QVFP 3QDFA 3M58A 4EDUA 1RACB 1ZBXA 2YLBA 2VGNA 3NGPA 2DX1A 3M4GA 2A36A 1VQ9T 2QA4A 4C92B 4L59A 3L42A 3CPWP 3CCVA 2ECZA 3CCVT 2VVKA 5FWCA 4M7DG 1ZSZC 4MZPA 2DD4A 1VQNQ 1WA7A 4LDWA 1VQNT 4ZGEB 4M75F 1N9RA 3OYEA 3GBQA 1VYVA 3JSCA 1XJWB 1Q82C 2ROTA 4AFSC 5AYFA 3A98A 1X75C 4F14A 5CQYA 4M7DB 2X4YA 1H3ZA 3VS4A 2KNBB 3JCMe 1OEBA 4HKEA 1BIAA 1VQ4A 2EYZA 5FRNA 1BI3A 1I07A 3X24B 3NTIA 2QASA 3BDUA 1K9MU 2EQUA 5DLQE 2EKHA 1WHHA 1AOJA 2JN0A 2FRYA 4RTYA 1U3OA 1E7OA 3LWIA 5HK3A 1M90U 1YHQA 1YHQT 3OYIA 2AKLA 1U06A 1UEBA 2COWA 1VQKT 1GXIE 2EFIA 4FYXB 2GFAA 4O5VA 1NG2A 4FW1A 3G7ZA 4JS4A 1YJWQ 1RI0A 5IH2A 1TUGB 2KRNA 2FL7A 3LX7A 1M1KC 4J9IA 1ZBJA 2VC8A 1X01A 1NPRA 2XICA 4PK4A 2E3IA 3G71A 4E2FB 3OQ5A 4Y28E 5D6XA 1WHLA 3TREA 3CMEQ 1B34A 4RTWA 2D6FA 2K57A 2QEXA 2QEXT 2FVUA 3X26B 1I0CA 5KYXA 3FJPA 3ZL7C 3A8GB 4FT2A 1YCSB 3H41A 2CREA 3CEYA 4QT7A 5IHIA 1PG5B 2EYXA 3EGDB 2LT4A 2DVJA 5GAMh 4C5EA 2HNIA 4OB0B 1UFFA 2QQRA 2ZPIB 3OB9A 3A8OB 5DM7R 1QVPA 3G4SQ 4QKUA 1VQ7A 1VQ7T 2A7YA 3G4ST 1NEGA 4JPBW 5GMKh 2DD5A 3GOXA 1GCPA 3HKSA 3JCMP 2DF6A 2BE7D 4C8QC 3VS7A 4FW2A 3A1PA 3M9QA 3CCRA 3CCRT 4M77C 3A8LB 1MMGA 3WXMB 5GAMj 3CC7T 1CKBA 1WQWA 3JB9D 4K11A 4F04B 1H8KA 2VYTA 4FU6A 3OYDA 1KHCA 1QQJA 2PVOB 5GAMg 1M8MA 3MP6A 4X34A 3E19A 5KYWB 5GMKj 3O5ZA 2I0NA 1MHNA 1N8RC 4PJOC 3L2VA 4QVDA 3OYHA 5IT9E 2R58A 2HEQA 2GTOA 2CUBA 4B9XA 3CCQA 3HP9A 3CCQT 1Q82R 4M78F 3P8BB 4BDYA 2MMPA 1Y07A 3QZ9B 2COZA 2RNAA 5GAN7 2LX7A 3FDRA 4MDXA 4C92D 1Y96A 1AEYA 1W2BS 5GAMf 2X4XA 1VQOQ 1K76A 2XIDA 3RDVA 2ATCB 2AZVA 2EWNA 1VIFA 2H3JA 1I8FA 1ZQ1A 2BUDA 1A0NB 2E6NA 3L2RA 1RADB 1UHFA 2LX9A 3DB4A 5IHKA 5KCOA 2M02A 3CCLQ 3REAB 1YBYA 1PKTA 2L3SA 3NHNA 2RQUA 4A4FA 3BE3A 4UC4A 5KH6A 2DM1A 2LNVA 1PRMC 5DY9A 1NM7A 2DFUA 3UA6A 3A8MB 2RH2A 3CBOA 3VYGA 2HCKA 2A3LA 2RHYA 4CC2A 2AK5A 4HT8A 1C6VX 2QDYB 1OOTA 4F17A 3NMZC 2EYQA 3E1SA 1Q7YC 1WI7A 1FYNA 2DRKA 1AZGB 3CCUQ 1M9SA 2X9HA 2PVGB 1Q86C 1BK2A 2L5QA 1H641 1OULA 4E7ZA 4OVAA 5GAMd 2HBWA 2JS0A 1Q81U 4HT9A 1SF9A 2SRCA 5KYYA 2X3XD 1VQLQ 4LDXA 1TWBA 2L8DA 2PUOB 4JS5A 1ZUKA 4E47A 3S6WA 3OS1A 3FLGA 1HXDA 4E7SA 1IO6A 3E9FA 2XKOC 2X4JA 4OGCA 3CC4A 3I5RA 3CC4T 3JB9H 1SKUB 4F7UB 2MWPA 2C0TA 2F5KA 1M27C 1X43A 2DJQA 1V1CA 2CP5A 4DBRA 4HA8A 3QJ6A 1MMAA 3V7RA 1TH7A 3OYGA 4LUEA 4N4GA 2YRVA 2KRMA 4E7LA 5FU6B 2EBPA 3L2WA 3FIFA 1ZUYA 1X6GA 2RK2A 2Z0WA 1X2QA 3BW1A 2LT1A 4ZNXA 2K5FA 5GAOp 1HK9A 4M7AE 2YXYA 1N8RR 2NWMA 1YJNQ 2R57A 1BCOA 2CGHA 5IN1A 4J6WA 2KEAA 5I21A 1SSHA 4C8QE 1VQ6A 1OX8A 3CCJQ 1W2BA 1WLPB 2QXFA 1YJ9T 3DLMA 4HCKA 2CT4A 1VQ8Q 2CH4A 5KYNA 4BE0A 2M9UA 3H0IA 3URGA 5EG2A 3PIOA 4MZTA 2YDLA 1UGQB 4OMPA 3NPFA 2KR3A 1TOVA 1VQ5A 1RAFB 2DXUA 1VQ5T 4N0AC 2LMJA 1YI2Q 2RI5A 4HCZA 2LJ1A 2XDDA 3I55T 3OMGA 4CC7A 2RJEA 4Q5WA 3LGLA 2G3RA 4QVCA 4J7IA 4M78D 4M7AA 1XNIA 2OTLA 2CUDA 2EGEA 2LVMA 3QHSA 4C8QA 2NUTA 4PNOA 4XU1A 2DIQA 2J06A 2K2MA 3CD6A 3M53A 3N5BB 1N27A 2MAMA 5DLOA 3CMAA 4C0FA 3CMAT 5ECAA 3EH1A 1R77A 3FB9A 2BIVA 2V8IA 2ESWA 5FU7B 3OYJA 3VYHB 3TEEA 4RTTA 4EMKB 2O9SA 2V1QA 4XTXA 4Y91A 3CCET 4IUTA 1VQMQ 1YWOA 1R0CB 3OY9A 1VQMT 3G6EA 3G6ET 2IVWA 3M0SA 2HZYA 3AT1B 4PFPA 2YLCA 2CYZB 1PNJA 3HRSA 2BTTA 1W4SA 2QAZA 2DL5A 4C5GA 1YITQ 2F5TX 4VUBA 3EFOB 3OS2A 3SWNB 3LH0A 2JM8A 1Y7XA 5CCAA 4DEXA 3I56A 4J9EA 3I56T 1ACMB 3PTAA 4F16A 1K9AA 2E10A 4C5IA 5HKCA 2K3YA 3IQLA 4C8QF 2EYYA 2ZGWA 3SFMA 1WHMA 7AT1B 4M77F 1M4ZA 3EH2A 2VGMA 2O31A 2O4XB 4CC4B 2DETA 3EG1A 1OPKA 2PVDB 1IXDA 1FXXA 2YUNA 2DEUA 3QDRB 1R0BG 3OYKA 4C92E 2X35A 2DE0X 2E64A 4PJOF 1XOVA 2DPPB 2W0ZA 3M0QA 2GQIA 3OYAA 2O01E 5GAOr 4YTLA 1JRIA 4ANJA 4A63B 2KMTA 4M4ZA 1KC8C 3L1AA 1BU1A 2NUZA 4M7DE 5KYUB 1PD0A 2COYA 1C1AA 1YNZA 3JB9G 4KRTA 1WQ7A 2DVEA 1RAHB 4FYWB 4XTYA 3JCMJ 4C92A 3MKDA 4LUDA 4QQGA 3QIIA 1IREB 3CC2A 4FSSA 2JXBA 3TU4K 2EQKA 3CCST 2LTOA 2L3QA 3C0CA 1D1BA 5AT1B 1QP2A 2D9TA 5FWBA 4PJJA 4XTVA 1JXOA 3R6NA 4M7DA 1S1NA 4PJLA 3CCMQ 3VRYA 2KBTA 2W10A 4QW2A 1MV3A 3S3MA 4D6WA 3QG1A 2ZPGB 2DJZA 4D8KA 4BY6C 1VQPA 1VQPT 2O88A 5CO7A 2OX7A 4M75G 1PWTA 3HL8A 1M2VB 1VQ9Q 2DBMA 4JLGA 2QA4Q 3A8HB 2QA4T 3CCVQ 4XQ3A 2KGTA 1EZZB 3GNGA 4C0DB 2DYIA 1G2BA 4FIBA 5GAN6 1TUCA 4M75B 1JXMA 2YHTA 1CKAA 1KQ2A 1AVZC 1WGSA 4E7JA 1NJIR 1D09B 5D6WA 3JCMh 2FB7A 2CH4W 1UGPB 2K7AA 3EG9B 3M0TA 3PNWC 1WIEA 2ZCFB 3ZEHA 2YWWA 3LWHA 1SSFA 1YCYA 3CQTA 2FZKB 5CK9A 2DEQA 3CPFA 2J6OA 1TUDA 1TSFA 1VQ4T 1QCNA 1NLOC 2NUPB 4LD6A 4N0AA 5GAN4 2CSQA 2K3XA 1HYOA 2JNGA 2VB6A 2EQIA 5D7UA 4MZMA 1QWEA 1YIJA 1ARKA 2D8HA 2OTJA 2XDBA 5IHNA 3HRTA 4DA4A 2DRMA 4LE9A 3J7AF 1YHQQ 1WJQA 1I4K1 3LW5E 1D1CA 4DQ2A 1VQKQ 1S72A 1S72T 2RJCA 4JZ4A 2JM9A 4RUGA 3RERA 1K0XA 1QVGA 2PU9B 5GAN8 4TVRA 4OGEA 5LJ5e 3JCMg 3QJYA 1NEBA 1K8AC 4EMHA 3BFMA 4WF2A 2RI2A 2M0YA 3VS3A 4IUVA 1RABB 2GF7A 4A4EA 4XTWA 3FC3A 3UA7A 4IUQA 5L8RE 1O9SA 1IRXA 2RF0A 2MIOA 4J6YA 3U23A 3G71T 4ZTFA 2A37A 3PMIA 3OBWA 1YJWA 5LJ5j 2A08A 2K3BA 4NL3A 1H92A 1FMVA 2EVRA 2LCCA 4FYYB 3T9NA 2R5AA 3JAME 4MDWA 2QEXQ 1KC8R 2EJ9A 1OZ3A 2PUKB 3NFCA 3X20B 5A0LA 4AMCA 2KAFA 3HFOA 3MCAB 4KGXB 1Q82U 1ABQA 1H3HA 1UECA 3H0FA 3CMEA 4E7HA 1VQ7Q 1VA7A 4LDUA 4J83A 1QW1A 1RAIB 4M7AC 5CVIA 2MI6A 2YUPA 1U5SA 4LDVA 2K5IA 2E5QA 4FT4A 5GMKi 2RHXA 1WHKA 4MMLA 3SD4A 1Y57A 2FYKA 3CCRQ 5D6YA 1M90R 1UGSB 1K73C 1T0JA 2CP6A 4JUVA 2HBPA 3CC7Q 5GANe 1NYFA 2CDTA 1R8OB 4Z02A 3OW2A 4A54A 4KH0B 2NLUA 2E3HA 1KG1A 1B34B 1W1FA 5I2SA 4M78G 1QKWA 2P0QA 1OQKA 3HSBA 2DO3A 3PT9A 1M1KU 2KXCA 3JCMd 2JTMA 2LQNA 2FPDA 2E12A 4ORZA 4XK8E 3CCQQ 5GANj 3KBGA 3JB9J 2OAWA 3ER0A 4M78B 4V2SA 3BDLA 4PL6A 3JCMc 4Z89A 3VS1A 3P8HA 3HTRA 1JO8A 2CSIA 5CQXA 1TS9A 2MK5A 4HXJA 2VASA 1ZSGA 2VWFA 3CBPA 1TU0B 2XMFA 5GAOn 1ZLMA 2B86A 4GLMA 4M75D 2J7IA 2RO0A 2BKDN 1PSFA 3I5SA 3G1JA 3BY7A 2WSFE 5LJ5d 2RMOA 3JV3A 3VS0A 5A0GA 1JBMA 3L2ZA 2K6DA 1U1SA 1VYTA 1WHGA 1P92A 3VS5A 4F7UE 1VQOA 1HSQA 4RKUE 1OPLA 1IHVA 1LOJA 1GRIA 2XI9A 1M8VA 3I9QA 1QMCA 3H0HA 1OI1A 1K8AR 3JCMQ 3ZBDA 1AZEA 1X27A 4QVZA 4A4HA 1QCOA 2KT1A 4ZGDB 3CCLA 5KCHA 2QGFB 1FMKA 3MO8A 2KXDA 2DBKA 1W2BP 5GAN2 2EJGA 2VKNA 3OSSC 4J9DA 1PHTA 4BI8B 1GL5A 2ENMA 2E65A 4AFZC 4F7UA 1KD1C 3V8KA 5J3BA 1UB4A 4XAXB 3KFVA 2PQWA 4J9FA 2IIMA 1N8RU 3QYGB 4ZTJA 5CKFA 3LGFA 1X69A 3GNFB 2FO0A 2D8JA 1FWZA 1NZ9A 1RAEB 2F69A 2RB6A 4HVWA 1IHWA 4C92C 1FMWA 1RAGB 1T3SA 5IXBA 1K0SA 2FRWA 2DTOA 2RQVA 2XK0A 3CCUA 4KBMB 2O2OA 2QK0A 3MP8A 1PM3A 2ZPFB 2LQ8A 2BZYA 4FYVB 3TQ7P 1BYMA 1EIFA 4OP0A 4J9HA 5GANd 4J5YA 3CC4Q 2AHJB 1EX4A 4RTVA 9ATCB 4ZGJB 1NPPA 3CXCS 4M7DC 1VQLA 5I11A 5M9OA 1JJ2S 2DL3A 2WACA 3PE0A 2JMAA 2OI3A 1K73R 5CKEA 4DBFA 2RA2A 1ZSZB 2E1HA 1QP3A 2P4TA 3F70A 4IURA 4JDSA 1KHIA 2RI3A 3J80E 1WJRA 1GBRA 1BBZA 1YN8A 4F7UF 3RKYA 2DXBA 5GAN3 4IIMA 3TCJA 1WNLA 1QCFA 5A0DA 2OAUA 2KDSA 3EGUA 2Y4XA 2HL5C 4Z8AA 3OMCA 1VQ6T 4WCIA 1YJ9Q 1B07A 3OBYA 4C0ZA 4CI0C 2L2PA 1M3BA 1TG0A 1UG1A 4PLIA 4RMOA 4BDZA 1XTDA 2QG9B 2C06A 3S3OA 1OYXA 2CZ1B 2H3EB 4ME7A 1Q7YU 1KFZA 4EMKA 2GTJA 2F2WA 2JOYA 1X6OA 1VQ5Q 1Q86U 1PC0A 3SDZA 3I55Q 4BE1A 5CKDA 1Q81R 3RMQA 2MPXC 1E6GA 4XTUA 1UDLA 4RTUA 5I2MA 2HSEB 1VQ8A 2OTLQ 2GFUA 2QQBA 4KULA 2DYBA 4ELZC 1K1ZA 2DK3A 2OTLT 3LLRA 2JZ2A 2HKNA 1G83A 1QWFA 2QQ9A 3H6ZA 1BIBA 2F2VA 3CMAQ 3CBMA 3CD6T 5IXFA 1TXQA 4R56A 2KRSA 4BE2A 3RIRA 3VUBA 1MNEA 1QLYA 4XU3A 4OB2B 3CCEQ 2EJFA 2E41A 3QUIA 1OV3A 2GGRA 1PCXA 3NTKA 1WHJA 3G6EQ 3NTHA 4BI3A 2DNUA 1BB9A 3JCMV 1RAAB 2DAQA 3OYNA 1D3BB 1NJIC 2O4XA 2K2VA 1LVKA 1VIEA 1ZX6A 1MV0B 4E7KA 4R0KA 5LJ3e 1AWWA 1LJOA 1KD1R 1UJ0A 4GBQA 3E2UA 4OB3B 3OYCA 3VS2A 4DOVA 3H8ZA 1SG5A 4C8QG 4AG2C 1IZ6A 1LCKA 1RL2A 2KVQG 3I56Q 2CP2A 4M77G 4M7AF 2RJFA 4XU0A 5IAYA 4PFZA 1RI9A 3EG3A 2RQWA 3JRZA 3KXTA 3M55A 1X6BA 2EKOA 3EGXB 3CXCA 4KUIA 3HPWA 1WYXA 3M5AA 4M77B 1JJ2A 4II1A 5KYUA 2XG8D 4P5NA 4PJOG 4AFQC 1N6AA 2RQRA 4J7FA 4A4GA 2MF2A 2DIGA 5KE2A 3PMTA 2BZ8A 2ZZDA 1KQSS 3FRNA 1LNXA 1Z9ZA 1QVGS 2V8JA 4PJOB 1D1AA 2EIFA 3M0RA 5GMKl 3OYMA 4LD9K 1YFNA 2V26A 3S3NA 2KROA 2XDPA 4MMKA 2QQSA 3WVEB 1HJDA 4B6MA 1SRMA 2KQWA 2LCSA 5EC7A 3OS0A 2JMCA 4PJMA 4RTZA 2JVVA 2WSCE 5C6SA 2QGGA 1HD3A 3ME9A 3V8JA 3OYBA 1M3AA 1M2VA 2DILA 3Q1JA 5CAIA 3MJXA 3M0PA 4RG8A 2HDAA 2FPFA 2RD1A 5GAOl 1GFCA 1DJ7B 2DL7A 4XU2A 4NS5A 4BI4A 3CCSQ 3CC2T 1K9MC 3ULRB 1D0YA 1SHFA 1QVGP 4JJCA 4OMNA 2CZ7B 2K9GA 1M1GA 3CPWS 2G6FX 4N4IA 3QYHB 1U8RA 2AZSA 3FJ5A 1JQQA 4HVVA 3DB3A 3QO3A 1B7TA 4L5GA 1M90C 2ROLA 3EG9A 3THKA 4PFOA 3FEOA 3M54A 3O8VA 3TVTA 1VQPQ 3QWYA 3DLLA 3PVLA 3GP8A 1AD5A 1KK7A 1K4US 3VRZA 2M1HA 3V7SA 2OJ2A 3GPLA 1BCMA 5LJ3d 3OW2S 3CCMA 2NYSA 2MCNA 2DERA 2QYZA 3VU3C 1GBQA 1W70A 1BKBA 4LXCA 1JU5C 3HRUA 2KE9A 4IUUA 5A2QE 3M56A 4OMQA 3EHQA 1VQ9A 4KUDK 4C92F 5CR2A 2QTXA 2KY9A 4Z88A 3AHUA 4IKFA 1KC8U 4X9CA 1VQ4Q 5FU6C 1VQNA 2I2LA 2IG0A 3DKMA 4EMGA 4QQ6A 2HD0A 1YIJQ 1G5VA 4M7DF 2OTJQ 2LQWA 1YIJT 2OTJT 2Y4YA 5CIUA 2F2XA 4OMFB 1S72Q 2YSQA 2CP0A 2WSEE 5LJ5h 5GAOq 2VUBA 2D0QB 3P8DA 1KQSA 3OW2P 4EPCA 2LP5A 3EFSA 3JB9I 4M7AD 1AWOA 2EYWA 5I22A 4X9DA 3MEWA 3EGDA 2J05A 4ZN3A 5HK0A 2DXTA 4C8QD 2JTFA 1UHCA 1WX6A 5J39A 2DZ9A 1VQKA 3VUZA 1WJSA 3ZFJA 3UATA 4M77D 4HVUA 4O6JA 2QTVA 4JJDA 4DEYA 3G71Q 1Y0MA 4X1VA 1YJWT 2Y90A 1G8XA 3UDCA 3GLXA 1VYUA 4M78E 2FHDA 4PJNA 3JCMf 1ZA2B 1JB0E 5LJ5g 2AKKA 5FW9A 1WXTA 3L2QA 1TTHB 2O9VA 4PJOD 5GJVB 1QVFA 4OB1B 2E4HA 4L6V5 3MHXA 2FPEA 1KJWA 5FU7C 4IUPA 2EAYA 3UT1A 4EMKC 1OU9A 4ATOA 2EGAA 4E6RA 3I35A 2DXCA 1JEGA 3QSUA 3KUFA 3CPWA 5KYWA 3CMET 3X25B 4WTOB 2L0AA 2HMAA 3M4YA 4CC3A 1M2OA 5FLXE 3X28B 1K9MR 1E6HA 1N5ZA 3MPUB 5LJ5f 4KGVB 3V8LA 3UPUA 1QKXA 4M78A 2DMOA 1M30A 4LNPA 4DBQA 2AT1B 5GANh
chains in the Genus database with same CATH topology
1PNJA 2FRWA 2RQVA 2BTTA 2KT8A 1ZUUA 2DL8A 2O2OA 2PNIA 3NGPA 5HCKA 2DX1A 2DL5A 2BZYA 2A36A 1UE9A 2LNHB 4J9HA 2ECZA 2VVKA 4J9GA 2JM8A 4RTVA 5FWCA 1UTIA 2V1RA 4DEXA 1WA7A 1SEMA 4J9EA 5I11A 3GBQA 1VYVA 2DL3A 3PE0A 2JMAA 1WFWA 4F16A 1K9AA 2ROTA 4AFSC 2OI3A 3A98A 4ESRA 3IQLA 4F14A 2EYYA 3VS4A 1KSWA 2KNBB 2M51A 1OEBA 1SPKA 1GBRA 2RPNA 2O31A 1BBZA 1YN8A 4CC4B 3EG1A 1OPKA 2EYZA 4IIMA 1I07A 4Y92A 2LJ0A 1QCFA 2EKHA 1AOJA 2YUNA 3EGUA 1GCQA 2FRYA 4RTYA 1U3OA 4Z8AA 1E7OA 4WCIA 1X2KA 2DE0X 2CT3A 4J9CA 1B07A 2L2PA 1M3BA 1TG0A 1UG1A 1XOVA 1Z9QA 2W0ZA 3M0QA 2GQIA 2AKLA 2LZ6B 1U06A 2ABLA 2JT4A 1KFZA 1W6XA 2GTJA 2DLPA 2F2WA 4A63B 1NG2A 2YUQA 4M4ZA 5IH2A 1BU1A 2KRNA 2NUZA 1E6GA 4J9IA 1UDLA 4RTUA 1ZBJA 2DL4A 1YNZA 4KRTA 2DYBA 1EFNA 1K1ZA 1G83A 1QWFA 4LUDA 2JTEA 1ABOA 2F2VA 2GNCA 5IXFA 1PKSA 4RTWA 2KRSA 4FSSA 2JXBA 1QLYA 2L3QA 3C0CA 2EW3A 1I0CA 1OV3A 3ZL7C 1YCSB 5FWBA 2GGRA 3H41A 2CREA 4QT7A 5IHIA 1JXOA 2EYXA 3R6NA 1S1NA 2DNUA 2DVJA 3VRYA 4LN2A 1BB9A 2KBTA 2W10A 1UFFA 1MV3A 3SEMA 1T0HA 4D8KA 2O88A 1ZX6A 1NEGA 1MV0B 1PWTA 4JPBW 4R0KA 2BZXA 1AWWA 4AFUC 2DBMA 1UJ0A 4GBQA 3VS2A 1WXUA 1GCPA 2KGTA 4AG2C 2DF6A 2KYMA 1PRLC 1LCKA 3VS7A 1GFDA 1G2BA 1TUCA 1JXMA 1CKAA 3EG2A 1B3QA 1J3TA 2DA9A 1AVZC 1RI9A 3EG3A 2RQWA 1CKBA 4K11A 1X6BA 1H8KA 2CH4W 2K7AA 3TSZA 3M0TA 1WIEA 1WYXA 1M8MA 2QDLA 2A28A 2E5KA 3CQTA 2KYBA 3O5ZA 2I0NA 2J6OA 1TUDA 4AFQC 2RQRA 5L23A 1NLOC 2C0IA 1RUWA 2CSQA 2HEQA 2GTOA 2EQIA 2BZ8A 2CUBA 1Z9ZA 1QWEA 2SEMA 1ARKA 2MOXA 1NLPC 2D8HA 2J6KA 5IHNA 2DRMA 4LE9A 2RNAA 2LX7A 3M0RA 1AEYA 4JZ4A 4OMLA 2JM9A 4RUGA 1K76A 2GBQA 1K0XA 2KROA 2EGCA 2AZVA 1NEBA 2D1XA 1HJDA 2M0YA 3VS3A 1SRMA 2LCSA 1A0NB 5EC7A 2JW4A 1M3CA 1UHFA 2JMCA 4EIKA 4RTZA 2HSPA 3EG0A 1HD3A 3UA7A 5IHKA 1RLQC 2RQTA 1M3AA 3REAB 4OMOA 2DILA 4OMMA 1PKTA 2MIOA 2RF0A 4J9BA 3U23A 2L3SA 2A37A 1T3LA 3M0PA 3NHNA 1YWPA 2HDAA 2RQUA 1CSKA 2FPFA 2A08A 1GFCA 2K3BA 2DL7A 1H92A 2EVRA 2DM1A 3RNJA 5GJWB 1PRMC 1NM7A 3ULRB 1SHFA 1AWJA 4JJCA 4OMNA 3UA6A 2K9GA 1KIKA 2G6FX 2AZSA 2HCKA 3FJ5A 1AWXA 1JQQA 4HVVA 2YUOA 4CC2A 2ROLA 2AK5A 3RBBB 1ABQA 3THKA 1H3HA 3TVTA 1UECA 4RTXA 3H0FA 1OOTA 4F17A 3NMZC 3QWYA 3TSWA 1WI7A 1FYNA 2DRKA 1AZGB 1VA7A 3PVLA 2FG0A 1AD5A 1MUZA 1BK2A 1K4US 2YUPA 1U5SA 3VRZA 2HBWA 2JS0A 2OJ2A 1SRLA 1UUEA 2SRCA 1Y57A 2MCNA 2X3XD 1GBQA 4JJBA 1W70A 1UGVA 1T0JA 3PVQA 1JU5C 2KE9A 1NYFA 1ZUKA 2CDTA 3LH5A 4OMQA 3EHQA 2K79A 1IO6A 3REBB 4Z88A 1W1FA 3I5RA 1QKWA 2YT6A 2C0TA 2X3WD 3EHRA 1M27C 1X43A 2DJQA 1V1CA 2KXCA 2LQNA 2FPDA 4ORZA 4LUEA 2PZ1A 2KRMA 2OAWA 2LQWA 2EBPA 1ZUYA 1X6GA 2LJ3A 2F2XA 1I1JA 4Z89A 3VS1A 4D8DA 1X2QA 4JZ3A 2YSQA 2JS2A 1JO8A 2CSIA 2ED1A 4ZNXA 1NYGA 4HXJA 2ED0A 1ZSGA 2VWFA 1YP5A 2LP5A 2XMFA 2NWMA 1ZLMA 2B86A 4GLMA 1AWOA 2EYWA 5I22A 2J7IA 1WXBA 2EPDA 2KEAA 2PTKA 1SSHA 3I5SA 2J05A 2J6FA 1WDXA 1WLPB 2RMOA 3JV3A 3VS0A 1K0SA 4HCKA 1UHCA 2CT4A 1WX6A 2CH4A 3UF4A 3VS6A 2K6DA 1VYTA 3UATA 3VS5A 3H0IA 4HVUA 1HSQA 2RN8A 2YDLA 1OPLA 4JJDA 4DEYA 4OMPA 3NPFA 2KR3A 1Y0MA 1GRIA 2D0NA 2LMJA 4X1VA 2L3PA 2LJ1A 3I9QA 3H0HA 2P4RA 4CC7A 1GCQC 4AG1C 1VYUA 1AZEA 2AKKA 5FW9A 1WXTA 1X27A 2FEIA 2O9VA 2CUDA 2KT1A 1UJYA 2EGEA 5GJVB 3SHWA 1SHGA 2FPEA 1KJWA 1FMKA 2KXDA 2DBKA 2J06A 2EGAA 2VKNA 3I35A 4E6RA 2K2MA 4J9DA 1JEGA 1PHTA 1RLPC 5ECAA 3M0UA 1GL5A 2ENMA 4AFZC 2L0AA 2C0OA 4CC3A 2ESWA 4IIOA 3QWXX 3KFVA 4RTTA 4J9FA 2IIMA 2O9SA 2V1QA 1E6HA 1N5ZA 1X69A 1YWOA 2FO0A 2D8JA 2H8HA 1QKXA 3M0SA 2DMOA 4HVWA 1M30A 4LNPA 1T3SA 5IXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  2FRW A;  2RQV A;  2BTT A;  2KT8 A;  1ZUU A;  2DL8 A;  2O2O A;  2PNI A;  3NGP A;  5HCK A;  2DX1 A;  2DL5 A;  2BZY A;  2A36 A;  1UE9 A;  2LNH B;  4J9H A;  2ECZ A;  2VVK A;  4J9G A;  2JM8 A;  4RTV A;  5FWC A;  1UTI A;  2V1R A;  4DEX A;  1WA7 A;  1SEM A;  4J9E A;  5I11 A;  3GBQ A;  1VYV A;  2DL3 A;  3PE0 A;  2JMA A;  1WFW A;  4F16 A;  1K9A A;  2ROT A;  4AFS C;  2OI3 A;  3A98 A;  4ESR A;  3IQL A;  4F14 A;  2EYY A;  3VS4 A;  1KSW A;  2KNB B;  2M51 A;  1OEB A;  1SPK A;  1GBR A;  2RPN A;  2O31 A;  1BBZ A;  1YN8 A;  4CC4 B;  3EG1 A;  1OPK A;  2EYZ A;  4IIM A;  1I07 A;  4Y92 A;  2LJ0 A;  1QCF A;  2EKH A;  1AOJ A;  2YUN A;  3EGU A;  1GCQ A;  2FRY A;  4RTY A;  1U3O A;  4Z8A A;  1E7O A;  4WCI A;  1X2K A;  2DE0 X;  2CT3 A;  4J9C A;  1B07 A;  2L2P A;  1M3B A;  1TG0 A;  1UG1 A;  1XOV A;  1Z9Q A;  2W0Z A;  3M0Q A;  2GQI A;  2AKL A;  2LZ6 B;  1U06 A;  2ABL A;  2JT4 A;  1KFZ A;  1W6X A;  2GTJ A;  2DLP A;  2F2W A;  4A63 B;  1NG2 A;  2YUQ A;  4M4Z A;  5IH2 A;  1BU1 A;  2KRN A;  2NUZ A;  1E6G A;  4J9I A;  1UDL A;  4RTU A;  1ZBJ A;  2DL4 A;  1YNZ A;  4KRT A;  2DYB A;  1EFN A;  1K1Z A;  1G83 A;  1QWF A;  4LUD A;  2JTE A;  1ABO A;  2F2V A;  2GNC A;  5IXF A;  1PKS A;  4RTW A;  2KRS A;  4FSS A;  2JXB A;  1QLY A;  2L3Q A;  3C0C A;  2EW3 A;  1I0C A;  1OV3 A;  3ZL7 C;  1YCS B;  5FWB A;  2GGR A;  3H41 A;  2CRE A;  4QT7 A;  5IHI A;  1JXO A;  2EYX A;  3R6N A;  1S1N A;  2DNU A;  2DVJ A;  3VRY A;  4LN2 A;  1BB9 A;  2KBT A;  2W10 A;  1UFF A;  1MV3 A;  3SEM A;  1T0H A;  4D8K A;  2O88 A;  1ZX6 A;  1NEG A;  1MV0 B;  1PWT A;  4JPB W;  4R0K A;  2BZX A;  1AWW A;  4AFU C;  2DBM A;  1UJ0 A;  4GBQ A;  3VS2 A;  1WXU A;  1GCP A;  2KGT A;  4AG2 C;  2DF6 A;  2KYM A;  1PRL C;  1LCK A;  3VS7 A;  1GFD A;  1G2B A;  1TUC A;  1JXM A;  1CKA A;  3EG2 A;  1B3Q A;  1J3T A;  2DA9 A;  1AVZ C;  1RI9 A;  3EG3 A;  2RQW A;  1CKB A;  4K11 A;  1X6B A;  1H8K A;  2CH4 W;  2K7A A;  3TSZ A;  3M0T A;  1WIE A;  1WYX A;  1M8M A;  2QDL A;  2A28 A;  2E5K A;  3CQT A;  2KYB A;  3O5Z A;  2I0N A;  2J6O A;  1TUD A;  4AFQ C;  2RQR A;  5L23 A;  1NLO C;  2C0I A;  1RUW A;  2CSQ A;  2HEQ A;  2GTO A;  2EQI A;  2BZ8 A;  2CUB A;  1Z9Z A;  1QWE A;  2SEM A;  1ARK A;  2MOX A;  1NLP C;  2D8H A;  2J6K A;  5IHN A;  2DRM A;  4LE9 A;  2RNA A;  2LX7 A;  3M0R A;  1AEY A;  4JZ4 A;  4OML A;  2JM9 A;  4RUG A;  1K76 A;  2GBQ A;  1K0X A;  2KRO A;  2EGC A;  2AZV A;  1NEB A;  2D1X A;  1HJD A;  2M0Y A;  3VS3 A;  1SRM A;  2LCS A;  1A0N B;  5EC7 A;  2JW4 A;  1M3C A;  1UHF A;  2JMC A;  4EIK A;  4RTZ A;  2HSP A;  3EG0 A;  1HD3 A;  3UA7 A;  5IHK A;  1RLQ C;  2RQT A;  1M3A A;  3REA B;  4OMO A;  2DIL A;  4OMM A;  1PKT A;  2MIO A;  2RF0 A;  4J9B A;  3U23 A;  2L3S A;  2A37 A;  1T3L A;  3M0P A;  3NHN A;  1YWP A;  2HDA A;  2RQU A;  1CSK A;  2FPF A;  2A08 A;  1GFC A;  2K3B A;  2DL7 A;  1H92 A;  2EVR A;  2DM1 A;  3RNJ A;  5GJW B;  1PRM C;  1NM7 A;  3ULR B;  1SHF A;  1AWJ A;  4JJC A;  4OMN A;  3UA6 A;  2K9G A;  1KIK A;  2G6F X;  2AZS A;  2HCK A;  3FJ5 A;  1AWX A;  1JQQ A;  4HVV A;  2YUO A;  4CC2 A;  2ROL A;  2AK5 A;  3RBB B;  1ABQ A;  3THK A;  1H3H A;  3TVT A;  1UEC A;  4RTX A;  3H0F A;  1OOT A;  4F17 A;  3NMZ C;  3QWY A;  3TSW A;  1WI7 A;  1FYN A;  2DRK A;  1AZG B;  1VA7 A;  3PVL A;  2FG0 A;  1AD5 A;  1MUZ A;  1BK2 A;  1K4U S;  2YUP A;  1U5S A;  3VRZ A;  2HBW A;  2JS0 A;  2OJ2 A;  1SRL A;  1UUE A;  2SRC A;  1Y57 A;  2MCN A;  2X3X D;  1GBQ A;  4JJB A;  1W70 A;  1UGV A;  1T0J A;  3PVQ A;  1JU5 C;  2KE9 A;  1NYF A;  1ZUK A;  2CDT A;  3LH5 A;  4OMQ A;  3EHQ A;  2K79 A;  1IO6 A;  3REB B;  4Z88 A;  1W1F A;  3I5R A;  1QKW A;  2YT6 A;  2C0T A;  2X3W D;  3EHR A;  1M27 C;  1X43 A;  2DJQ A;  1V1C A;  2KXC A;  2LQN A;  2FPD A;  4ORZ A;  4LUE A;  2PZ1 A;  2KRM A;  2OAW A;  2LQW A;  2EBP A;  1ZUY A;  1X6G A;  2LJ3 A;  2F2X A;  1I1J A;  4Z89 A;  3VS1 A;  4D8D A;  1X2Q A;  4JZ3 A;  2YSQ A;  2JS2 A;  1JO8 A;  2CSI A;  2ED1 A;  4ZNX A;  1NYG A;  4HXJ A;  2ED0 A;  1ZSG A;  2VWF A;  1YP5 A;  2LP5 A;  2XMF A;  2NWM A;  1ZLM A;  2B86 A;  4GLM A;  1AWO A;  2EYW A;  5I22 A;  2J7I A;  1WXB A;  2EPD A;  2KEA A;  2PTK A;  1SSH A;  3I5S A;  2J05 A;  2J6F A;  1WDX A;  1WLP B;  2RMO A;  3JV3 A;  3VS0 A;  1K0S A;  4HCK A;  1UHC A;  2CT4 A;  1WX6 A;  2CH4 A;  3UF4 A;  3VS6 A;  2K6D A;  1VYT A;  3UAT A;  3VS5 A;  3H0I A;  4HVU A;  1HSQ A;  2RN8 A;  2YDL A;  1OPL A;  4JJD A;  4DEY A;  4OMP A;  3NPF A;  2KR3 A;  1Y0M A;  1GRI A;  2D0N A;  2LMJ A;  4X1V A;  2L3P A;  2LJ1 A;  3I9Q A;  3H0H A;  2P4R A;  4CC7 A;  1GCQ C;  4AG1 C;  1VYU A;  1AZE A;  2AKK A;  5FW9 A;  1WXT A;  1X27 A;  2FEI A;  2O9V A;  2CUD A;  2KT1 A;  1UJY A;  2EGE A;  5GJV B;  3SHW A;  1SHG A;  2FPE A;  1KJW A;  1FMK A;  2KXD A;  2DBK A;  2J06 A;  2EGA A;  2VKN A;  3I35 A;  4E6R A;  2K2M A;  4J9D A;  1JEG A;  1PHT A;  1RLP C;  5ECA A;  3M0U A;  1GL5 A;  2ENM A;  4AFZ C;  2L0A A;  2C0O A;  4CC3 A;  2ESW A;  4IIO A;  3QWX X;  3KFV A;  4RTT A;  4J9F A;  2IIM A;  2O9S A;  2V1Q A;  1E6H A;  1N5Z A;  1X69 A;  1YWO A;  2FO0 A;  2D8J A;  2H8H A;  1QKX A;  3M0S A;  2DMO A;  4HVW A;  1M30 A;  4LNP A;  1T3S A;  5IXB A; 
#chains in the Genus database with same CATH topology
 3SWN C;  5GAM e;  2GCX A;  2GQV A;  2KT8 A;  3G4S A;  1WZO A;  1ZUU A;  2DL8 A;  2PNI A;  2RHI A;  5HCK A;  1NE8 A;  4C0G A;  2L89 A;  1UE9 A;  2P0P A;  2LNH B;  5GMK e;  1K8A U;  2M16 A;  3V7C A;  1D0X A;  4J9G A;  5CKB A;  3C4S A;  1UTI A;  2V1R A;  4J6X A;  1SEM A;  2DZC A;  3C95 A;  2A0F B;  5KYX B;  4AT1 B;  3R6O A;  3WVD B;  2E6Z A;  3RKX A;  3CC7 A;  1WFW A;  1PSE A;  4ESR A;  1KSW A;  2M51 A;  1SPK A;  1XQH A;  5GAN g;  1IGU A;  2RPN A;  2RHU A;  6AT1 B;  2CZ6 B;  4Y92 A;  2LJ0 A;  3PGG A;  1Q81 C;  1G3W A;  1GCQ A;  3OS5 A;  4E7I A;  1WPY A;  2VV5 A;  1AHJ B;  2BE9 B;  2X51 A;  2B8A A;  1X2K A;  4J9C A;  2CT3 A;  2HKQ B;  1Z9Q A;  2E70 A;  2LZ6 B;  2ABL A;  2EQM A;  2JT4 A;  1IGQ A;  2ZPE B;  3OA6 A;  1W6X A;  1UGR B;  3H9N A;  1VQO T;  2L3R A;  2DLP A;  5GAN f;  3QZ5 B;  2YUQ A;  4CRI A;  2VXE A;  5FRO A;  3J81 E;  2HQX A;  4M7D D;  2DL4 A;  1EFN A;  3RUX A;  1K73 U;  4NL2 A;  3VJP A;  3CCL T;  3INZ A;  4OF1 A;  3RES A;  1BI1 A;  2JTE A;  1ABO A;  2GNC A;  4RCB A;  1PKS A;  3MEU A;  3GF5 A;  1Y96 B;  3MEA A;  2LC4 A;  4QQD A;  4NOY A;  1M1K R;  2EW3 A;  3RR6 A;  3VKI A;  2DTI A;  1ZSZ A;  4C5H A;  4FSX A;  4LN2 A;  5HY6 A;  2ZAE A;  3QXE B;  3SEM A;  1T0H A;  3PFS A;  2KI7 A;  4R55 A;  1FX7 A;  4C0D C;  1I81 A;  3ASK A;  3CCU T;  1PD1 A;  2DKG A;  4JLI A;  2BZX A;  4AFU C;  4M75 C;  4FL6 A;  2LRQ A;  1WXU A;  4ZN1 A;  2ZPH B;  4BY6 B;  5J26 A;  2KYM A;  1PRL C;  1NBE B;  1GFD A;  4GY5 A;  1VQL T;  2JJ9 A;  1G3T A;  3EG2 A;  1ZA1 B;  1B3Q A;  1MMD A;  4F7U G;  1J3T A;  2DA9 A;  2RHZ A;  2DTH A;  2RM4 A;  3D7S B;  3TSZ A;  2HQE A;  3VV0 A;  4DBH A;  2QDL A;  2A28 A;  2E5K A;  2KYB A;  1MND A;  4JRQ A;  3A5Z B;  5L23 A;  3JCM b;  3HFN A;  2C0I A;  1RUW A;  4PLL A;  8AT1 B;  2SEM A;  1ZHI A;  1VQ6 Q;  2MOX A;  1NLP C;  2J6K A;  5KYY B;  4BD3 A;  4A53 A;  4XTZ A;  2CP3 A;  4LDY A;  4OML A;  2GBQ A;  2P0K A;  2EGC A;  2CP7 A;  3CXC P;  1KD1 U;  3JCM X;  1LPL A;  3RKW A;  2D1X A;  1YJN A;  1YJN T;  2EQJ A;  1OX9 A;  1JJ2 P;  2V8K A;  2JW4 A;  1M3C A;  4EIK A;  1O75 A;  3CCJ A;  3CCJ T;  3QKJ A;  1YJ9 A;  1Y71 A;  3E9G A;  2HSP A;  4M77 E;  1D3B A;  1MGQ A;  1VQ8 T;  4KT0 E;  3EG0 A;  1RLQ C;  2RQT A;  2X4W A;  5C0M A;  4OMO A;  4OMM A;  2IPO B;  4J9B A;  4FCY A;  1T3L A;  5LL6 S;  1YI2 A;  1YI2 T;  1YWP A;  3CD6 Q;  2HQH A;  1CSK A;  3I55 A;  2CZ0 B;  3EFO A;  3SWN A;  1VOM A;  3RNJ A;  4J8O A;  5GJW B;  1D0Z A;  4PJO E;  1AWJ A;  1N9S A;  1KIK A;  1U1T A;  1BI0 A;  1AWX A;  2YRD A;  3EGX A;  2YUO A;  2JUF A;  2P84 A;  3C94 A;  2HAX A;  3MET A;  3RBB B;  3OYF A;  2LCL A;  3M59 A;  3LYI A;  4M77 A;  4RTX A;  2FZC B;  3TSW A;  5LJ3 h;  3M57 A;  1I5L A;  2K4Y A;  2FG0 A;  1MUZ A;  2MYS A;  4M7A G;  3CCE A;  2XHC A;  1V29 B;  4PKC C;  4KGZ B;  3HHT B;  4RCC A;  1VQM A;  1SRL A;  2RJD A;  3RMS A;  4DOW A;  1UUE A;  1G3S A;  4PJO A;  1VUB A;  4JJB A;  4M7A B;  1UGV A;  3PVQ A;  4JRI A;  1Q7Y R;  1V76 A;  3LH5 A;  3EFR A;  4C8Q B;  2NUT B;  2K79 A;  1Q86 R;  2MWO A;  1YIT A;  1YIT T;  5LJ3 j;  2QI2 A;  3REB B;  4N4H A;  4BAC A;  2CKK A;  4HCB A;  4B9W A;  5LJ3 g;  4M78 C;  2YT6 A;  3C12 A;  2X3W D;  3EHR A;  4HCC A;  2XD0 A;  4BUG A;  3UWN A;  2KK4 A;  5GAN 5;  1AT1 B;  3OSV A;  2PZ1 A;  1KQ1 A;  2M0O A;  2R5M A;  1I5O B;  1OU8 A;  4ELY C;  4JJN K;  2LJ3 A;  1I1J A;  4D8D A;  4JZ3 A;  2JS2 A;  3SB2 A;  3L2U A;  2ED1 A;  1NYG A;  5KE3 A;  4RG2 A;  4M75 E;  2ED0 A;  4A4K A;  1YP5 A;  3JCM W;  5LJ3 f;  2F1L A;  2K5L A;  2YRC A;  1IB8 A;  1WXB A;  2EPD A;  2PTK A;  2ZPB B;  1M1F A;  4JRK A;  4JRP A;  8ATC B;  2J6F A;  2CS7 A;  1WDX A;  2RK1 A;  2LDM A;  3UF4 A;  1OZ2 A;  3VS6 A;  1F1B B;  4GLK A;  2VXF A;  1NJI U;  2RN8 A;  2D0N A;  3PIP A;  1QVF S;  2L3P A;  2XU8 A;  3OYY A;  2P4R A;  1GCQ C;  4AG1 C;  3CC2 Q;  1KQS P;  5GMK m;  1C0M A;  4M75 A;  2AIR B;  2FEI A;  3QBY A;  2QQA A;  1UJY A;  4KH1 B;  3SHW A;  3MP1 A;  1SHG A;  2KSS A;  3QPH A;  1RLP C;  1MMN A;  3GIB A;  3M0U A;  3JB9 F;  5CKH A;  3CCS A;  2HL3 A;  4BB7 A;  2C0O A;  4IIO A;  3QWX X;  2NUP A;  1G3Y A;  3EAE A;  4FM4 B;  1Q95 G;  2H8H A;  1M5Q 1;  2LQK A;  4C92 G;  5GAO m;  3MEV A;  3CCM T;  2FZG B;  1BI2 A;  3OYL A;  5FRM A;  1QVF P;  3QDF A;  3M58 A;  4EDU A;  1RAC B;  1ZBX A;  2YLB A;  2VGN A;  3NGP A;  2DX1 A;  3M4G A;  2A36 A;  1VQ9 T;  2QA4 A;  4C92 B;  4L59 A;  3L42 A;  3CPW P;  3CCV A;  2ECZ A;  3CCV T;  2VVK A;  5FWC A;  4M7D G;  1ZSZ C;  4MZP A;  2DD4 A;  1VQN Q;  1WA7 A;  4LDW A;  1VQN T;  4ZGE B;  4M75 F;  1N9R A;  3OYE A;  3GBQ A;  1VYV A;  3JSC A;  1XJW B;  1Q82 C;  2ROT A;  4AFS C;  5AYF A;  3A98 A;  1X75 C;  4F14 A;  5CQY A;  4M7D B;  2X4Y A;  1H3Z A;  3VS4 A;  2KNB B;  3JCM e;  1OEB A;  4HKE A;  1BIA A;  1VQ4 A;  2EYZ A;  5FRN A;  1BI3 A;  1I07 A;  3X24 B;  3NTI A;  2QAS A;  3BDU A;  1K9M U;  2EQU A;  5DLQ E;  2EKH A;  1WHH A;  1AOJ A;  2JN0 A;  2FRY A;  4RTY A;  1U3O A;  1E7O A;  3LWI A;  5HK3 A;  1M90 U;  1YHQ A;  1YHQ T;  3OYI A;  2AKL A;  1U06 A;  1UEB A;  2COW A;  1VQK T;  1GXI E;  2EFI A;  4FYX B;  2GFA A;  4O5V A;  1NG2 A;  4FW1 A;  3G7Z A;  4JS4 A;  1YJW Q;  1RI0 A;  5IH2 A;  1TUG B;  2KRN A;  2FL7 A;  3LX7 A;  1M1K C;  4J9I A;  1ZBJ A;  2VC8 A;  1X01 A;  1NPR A;  2XIC A;  4PK4 A;  2E3I A;  3G71 A;  4E2F B;  3OQ5 A;  4Y28 E;  5D6X A;  1WHL A;  3TRE A;  3CME Q;  1B34 A;  4RTW A;  2D6F A;  2K57 A;  2QEX A;  2QEX T;  2FVU A;  3X26 B;  1I0C A;  5KYX A;  3FJP A;  3ZL7 C;  3A8G B;  4FT2 A;  1YCS B;  3H41 A;  2CRE A;  3CEY A;  4QT7 A;  5IHI A;  1PG5 B;  2EYX A;  3EGD B;  2LT4 A;  2DVJ A;  5GAM h;  4C5E A;  2HNI A;  4OB0 B;  1UFF A;  2QQR A;  2ZPI B;  3OB9 A;  3A8O B;  5DM7 R;  1QVP A;  3G4S Q;  4QKU A;  1VQ7 A;  1VQ7 T;  2A7Y A;  3G4S T;  1NEG A;  4JPB W;  5GMK h;  2DD5 A;  3GOX A;  1GCP A;  3HKS A;  3JCM P;  2DF6 A;  2BE7 D;  4C8Q C;  3VS7 A;  4FW2 A;  3A1P A;  3M9Q A;  3CCR A;  3CCR T;  4M77 C;  3A8L B;  1MMG A;  3WXM B;  5GAM j;  3CC7 T;  1CKB A;  1WQW A;  3JB9 D;  4K11 A;  4F04 B;  1H8K A;  2VYT A;  4FU6 A;  3OYD A;  1KHC A;  1QQJ A;  2PVO B;  5GAM g;  1M8M A;  3MP6 A;  4X34 A;  3E19 A;  5KYW B;  5GMK j;  3O5Z A;  2I0N A;  1MHN A;  1N8R C;  4PJO C;  3L2V A;  4QVD A;  3OYH A;  5IT9 E;  2R58 A;  2HEQ A;  2GTO A;  2CUB A;  4B9X A;  3CCQ A;  3HP9 A;  3CCQ T;  1Q82 R;  4M78 F;  3P8B B;  4BDY A;  2MMP A;  1Y07 A;  3QZ9 B;  2COZ A;  2RNA A;  5GAN 7;  2LX7 A;  3FDR A;  4MDX A;  4C92 D;  1Y96 A;  1AEY A;  1W2B S;  5GAM f;  2X4X A;  1VQO Q;  1K76 A;  2XID A;  3RDV A;  2ATC B;  2AZV A;  2EWN A;  1VIF A;  2H3J A;  1I8F A;  1ZQ1 A;  2BUD A;  1A0N B;  2E6N A;  3L2R A;  1RAD B;  1UHF A;  2LX9 A;  3DB4 A;  5IHK A;  5KCO A;  2M02 A;  3CCL Q;  3REA B;  1YBY A;  1PKT A;  2L3S A;  3NHN A;  2RQU A;  4A4F A;  3BE3 A;  4UC4 A;  5KH6 A;  2DM1 A;  2LNV A;  1PRM C;  5DY9 A;  1NM7 A;  2DFU A;  3UA6 A;  3A8M B;  2RH2 A;  3CBO A;  3VYG A;  2HCK A;  2A3L A;  2RHY A;  4CC2 A;  2AK5 A;  4HT8 A;  1C6V X;  2QDY B;  1OOT A;  4F17 A;  3NMZ C;  2EYQ A;  3E1S A;  1Q7Y C;  1WI7 A;  1FYN A;  2DRK A;  1AZG B;  3CCU Q;  1M9S A;  2X9H A;  2PVG B;  1Q86 C;  1BK2 A;  2L5Q A;  1H64 1;  1OUL A;  4E7Z A;  4OVA A;  5GAM d;  2HBW A;  2JS0 A;  1Q81 U;  4HT9 A;  1SF9 A;  2SRC A;  5KYY A;  2X3X D;  1VQL Q;  4LDX A;  1TWB A;  2L8D A;  2PUO B;  4JS5 A;  1ZUK A;  4E47 A;  3S6W A;  3OS1 A;  3FLG A;  1HXD A;  4E7S A;  1IO6 A;  3E9F A;  2XKO C;  2X4J A;  4OGC A;  3CC4 A;  3I5R A;  3CC4 T;  3JB9 H;  1SKU B;  4F7U B;  2MWP A;  2C0T A;  2F5K A;  1M27 C;  1X43 A;  2DJQ A;  1V1C A;  2CP5 A;  4DBR A;  4HA8 A;  3QJ6 A;  1MMA A;  3V7R A;  1TH7 A;  3OYG A;  4LUE A;  4N4G A;  2YRV A;  2KRM A;  4E7L A;  5FU6 B;  2EBP A;  3L2W A;  3FIF A;  1ZUY A;  1X6G A;  2RK2 A;  2Z0W A;  1X2Q A;  3BW1 A;  2LT1 A;  4ZNX A;  2K5F A;  5GAO p;  1HK9 A;  4M7A E;  2YXY A;  1N8R R;  2NWM A;  1YJN Q;  2R57 A;  1BCO A;  2CGH A;  5IN1 A;  4J6W A;  2KEA A;  5I21 A;  1SSH A;  4C8Q E;  1VQ6 A;  1OX8 A;  3CCJ Q;  1W2B A;  1WLP B;  2QXF A;  1YJ9 T;  3DLM A;  4HCK A;  2CT4 A;  1VQ8 Q;  2CH4 A;  5KYN A;  4BE0 A;  2M9U A;  3H0I A;  3URG A;  5EG2 A;  3PIO A;  4MZT A;  2YDL A;  1UGQ B;  4OMP A;  3NPF A;  2KR3 A;  1TOV A;  1VQ5 A;  1RAF B;  2DXU A;  1VQ5 T;  4N0A C;  2LMJ A;  1YI2 Q;  2RI5 A;  4HCZ A;  2LJ1 A;  2XDD A;  3I55 T;  3OMG A;  4CC7 A;  2RJE A;  4Q5W A;  3LGL A;  2G3R A;  4QVC A;  4J7I A;  4M78 D;  4M7A A;  1XNI A;  2OTL A;  2CUD A;  2EGE A;  2LVM A;  3QHS A;  4C8Q A;  2NUT A;  4PNO A;  4XU1 A;  2DIQ A;  2J06 A;  2K2M A;  3CD6 A;  3M53 A;  3N5B B;  1N27 A;  2MAM A;  5DLO A;  3CMA A;  4C0F A;  3CMA T;  5ECA A;  3EH1 A;  1R77 A;  3FB9 A;  2BIV A;  2V8I A;  2ESW A;  5FU7 B;  3OYJ A;  3VYH B;  3TEE A;  4RTT A;  4EMK B;  2O9S A;  2V1Q A;  4XTX A;  4Y91 A;  3CCE T;  4IUT A;  1VQM Q;  1YWO A;  1R0C B;  3OY9 A;  1VQM T;  3G6E A;  3G6E T;  2IVW A;  3M0S A;  2HZY A;  3AT1 B;  4PFP A;  2YLC A;  2CYZ B;  1PNJ A;  3HRS A;  2BTT A;  1W4S A;  2QAZ A;  2DL5 A;  4C5G A;  1YIT Q;  2F5T X;  4VUB A;  3EFO B;  3OS2 A;  3SWN B;  3LH0 A;  2JM8 A;  1Y7X A;  5CCA A;  4DEX A;  3I56 A;  4J9E A;  3I56 T;  1ACM B;  3PTA A;  4F16 A;  1K9A A;  2E10 A;  4C5I A;  5HKC A;  2K3Y A;  3IQL A;  4C8Q F;  2EYY A;  2ZGW A;  3SFM A;  1WHM A;  7AT1 B;  4M77 F;  1M4Z A;  3EH2 A;  2VGM A;  2O31 A;  2O4X B;  4CC4 B;  2DET A;  3EG1 A;  1OPK A;  2PVD B;  1IXD A;  1FXX A;  2YUN A;  2DEU A;  3QDR B;  1R0B G;  3OYK A;  4C92 E;  2X35 A;  2DE0 X;  2E64 A;  4PJO F;  1XOV A;  2DPP B;  2W0Z A;  3M0Q A;  2GQI A;  3OYA A;  2O01 E;  5GAO r;  4YTL A;  1JRI A;  4ANJ A;  4A63 B;  2KMT A;  4M4Z A;  1KC8 C;  3L1A A;  1BU1 A;  2NUZ A;  4M7D E;  5KYU B;  1PD0 A;  2COY A;  1C1A A;  1YNZ A;  3JB9 G;  4KRT A;  1WQ7 A;  2DVE A;  1RAH B;  4FYW B;  4XTY A;  3JCM J;  4C92 A;  3MKD A;  4LUD A;  4QQG A;  3QII A;  1IRE B;  3CC2 A;  4FSS A;  2JXB A;  3TU4 K;  2EQK A;  3CCS T;  2LTO A;  2L3Q A;  3C0C A;  1D1B A;  5AT1 B;  1QP2 A;  2D9T A;  5FWB A;  4PJJ A;  4XTV A;  1JXO A;  3R6N A;  4M7D A;  1S1N A;  4PJL A;  3CCM Q;  3VRY A;  2KBT A;  2W10 A;  4QW2 A;  1MV3 A;  3S3M A;  4D6W A;  3QG1 A;  2ZPG B;  2DJZ A;  4D8K A;  4BY6 C;  1VQP A;  1VQP T;  2O88 A;  5CO7 A;  2OX7 A;  4M75 G;  1PWT A;  3HL8 A;  1M2V B;  1VQ9 Q;  2DBM A;  4JLG A;  2QA4 Q;  3A8H B;  2QA4 T;  3CCV Q;  4XQ3 A;  2KGT A;  1EZZ B;  3GNG A;  4C0D B;  2DYI A;  1G2B A;  4FIB A;  5GAN 6;  1TUC A;  4M75 B;  1JXM A;  2YHT A;  1CKA A;  1KQ2 A;  1AVZ C;  1WGS A;  4E7J A;  1NJI R;  1D09 B;  5D6W A;  3JCM h;  2FB7 A;  2CH4 W;  1UGP B;  2K7A A;  3EG9 B;  3M0T A;  3PNW C;  1WIE A;  2ZCF B;  3ZEH A;  2YWW A;  3LWH A;  1SSF A;  1YCY A;  3CQT A;  2FZK B;  5CK9 A;  2DEQ A;  3CPF A;  2J6O A;  1TUD A;  1TSF A;  1VQ4 T;  1QCN A;  1NLO C;  2NUP B;  4LD6 A;  4N0A A;  5GAN 4;  2CSQ A;  2K3X A;  1HYO A;  2JNG A;  2VB6 A;  2EQI A;  5D7U A;  4MZM A;  1QWE A;  1YIJ A;  1ARK A;  2D8H A;  2OTJ A;  2XDB A;  5IHN A;  3HRT A;  4DA4 A;  2DRM A;  4LE9 A;  3J7A F;  1YHQ Q;  1WJQ A;  1I4K 1;  3LW5 E;  1D1C A;  4DQ2 A;  1VQK Q;  1S72 A;  1S72 T;  2RJC A;  4JZ4 A;  2JM9 A;  4RUG A;  3RER A;  1K0X A;  1QVG A;  2PU9 B;  5GAN 8;  4TVR A;  4OGE A;  5LJ5 e;  3JCM g;  3QJY A;  1NEB A;  1K8A C;  4EMH A;  3BFM A;  4WF2 A;  2RI2 A;  2M0Y A;  3VS3 A;  4IUV A;  1RAB B;  2GF7 A;  4A4E A;  4XTW A;  3FC3 A;  3UA7 A;  4IUQ A;  5L8R E;  1O9S A;  1IRX A;  2RF0 A;  2MIO A;  4J6Y A;  3U23 A;  3G71 T;  4ZTF A;  2A37 A;  3PMI A;  3OBW A;  1YJW A;  5LJ5 j;  2A08 A;  2K3B A;  4NL3 A;  1H92 A;  1FMV A;  2EVR A;  2LCC A;  4FYY B;  3T9N A;  2R5A A;  3JAM E;  4MDW A;  2QEX Q;  1KC8 R;  2EJ9 A;  1OZ3 A;  2PUK B;  3NFC A;  3X20 B;  5A0L A;  4AMC A;  2KAF A;  3HFO A;  3MCA B;  4KGX B;  1Q82 U;  1ABQ A;  1H3H A;  1UEC A;  3H0F A;  3CME A;  4E7H A;  1VQ7 Q;  1VA7 A;  4LDU A;  4J83 A;  1QW1 A;  1RAI B;  4M7A C;  5CVI A;  2MI6 A;  2YUP A;  1U5S A;  4LDV A;  2K5I A;  2E5Q A;  4FT4 A;  5GMK i;  2RHX A;  1WHK A;  4MML A;  3SD4 A;  1Y57 A;  2FYK A;  3CCR Q;  5D6Y A;  1M90 R;  1UGS B;  1K73 C;  1T0J A;  2CP6 A;  4JUV A;  2HBP A;  3CC7 Q;  5GAN e;  1NYF A;  2CDT A;  1R8O B;  4Z02 A;  3OW2 A;  4A54 A;  4KH0 B;  2NLU A;  2E3H A;  1KG1 A;  1B34 B;  1W1F A;  5I2S A;  4M78 G;  1QKW A;  2P0Q A;  1OQK A;  3HSB A;  2DO3 A;  3PT9 A;  1M1K U;  2KXC A;  3JCM d;  2JTM A;  2LQN A;  2FPD A;  2E12 A;  4ORZ A;  4XK8 E;  3CCQ Q;  5GAN j;  3KBG A;  3JB9 J;  2OAW A;  3ER0 A;  4M78 B;  4V2S A;  3BDL A;  4PL6 A;  3JCM c;  4Z89 A;  3VS1 A;  3P8H A;  3HTR A;  1JO8 A;  2CSI A;  5CQX A;  1TS9 A;  2MK5 A;  4HXJ A;  2VAS A;  1ZSG A;  2VWF A;  3CBP A;  1TU0 B;  2XMF A;  5GAO n;  1ZLM A;  2B86 A;  4GLM A;  4M75 D;  2J7I A;  2RO0 A;  2BKD N;  1PSF A;  3I5S A;  3G1J A;  3BY7 A;  2WSF E;  5LJ5 d;  2RMO A;  3JV3 A;  3VS0 A;  5A0G A;  1JBM A;  3L2Z A;  2K6D A;  1U1S A;  1VYT A;  1WHG A;  1P92 A;  3VS5 A;  4F7U E;  1VQO A;  1HSQ A;  4RKU E;  1OPL A;  1IHV A;  1LOJ A;  1GRI A;  2XI9 A;  1M8V A;  3I9Q A;  1QMC A;  3H0H A;  1OI1 A;  1K8A R;  3JCM Q;  3ZBD A;  1AZE A;  1X27 A;  4QVZ A;  4A4H A;  1QCO A;  2KT1 A;  4ZGD B;  3CCL A;  5KCH A;  2QGF B;  1FMK A;  3MO8 A;  2KXD A;  2DBK A;  1W2B P;  5GAN 2;  2EJG A;  2VKN A;  3OSS C;  4J9D A;  1PHT A;  4BI8 B;  1GL5 A;  2ENM A;  2E65 A;  4AFZ C;  4F7U A;  1KD1 C;  3V8K A;  5J3B A;  1UB4 A;  4XAX B;  3KFV A;  2PQW A;  4J9F A;  2IIM A;  1N8R U;  3QYG B;  4ZTJ A;  5CKF A;  3LGF A;  1X69 A;  3GNF B;  2FO0 A;  2D8J A;  1FWZ A;  1NZ9 A;  1RAE B;  2F69 A;  2RB6 A;  4HVW A;  1IHW A;  4C92 C;  1FMW A;  1RAG B;  1T3S A;  5IXB A;  1K0S A;  2FRW A;  2DTO A;  2RQV A;  2XK0 A;  3CCU A;  4KBM B;  2O2O A;  2QK0 A;  3MP8 A;  1PM3 A;  2ZPF B;  2LQ8 A;  2BZY A;  4FYV B;  3TQ7 P;  1BYM A;  1EIF A;  4OP0 A;  4J9H A;  5GAN d;  4J5Y A;  3CC4 Q;  2AHJ B;  1EX4 A;  4RTV A;  9ATC B;  4ZGJ B;  1NPP A;  3CXC S;  4M7D C;  1VQL A;  5I11 A;  5M9O A;  1JJ2 S;  2DL3 A;  2WAC A;  3PE0 A;  2JMA A;  2OI3 A;  1K73 R;  5CKE A;  4DBF A;  2RA2 A;  1ZSZ B;  2E1H A;  1QP3 A;  2P4T A;  3F70 A;  4IUR A;  4JDS A;  1KHI A;  2RI3 A;  3J80 E;  1WJR A;  1GBR A;  1BBZ A;  1YN8 A;  4F7U F;  3RKY A;  2DXB A;  5GAN 3;  4IIM A;  3TCJ A;  1WNL A;  1QCF A;  5A0D A;  2OAU A;  2KDS A;  3EGU A;  2Y4X A;  2HL5 C;  4Z8A A;  3OMC A;  1VQ6 T;  4WCI A;  1YJ9 Q;  1B07 A;  3OBY A;  4C0Z A;  4CI0 C;  2L2P A;  1M3B A;  1TG0 A;  1UG1 A;  4PLI A;  4RMO A;  4BDZ A;  1XTD A;  2QG9 B;  2C06 A;  3S3O A;  1OYX A;  2CZ1 B;  2H3E B;  4ME7 A;  1Q7Y U;  1KFZ A;  4EMK A;  2GTJ A;  2F2W A;  2JOY A;  1X6O A;  1VQ5 Q;  1Q86 U;  1PC0 A;  3SDZ A;  3I55 Q;  4BE1 A;  5CKD A;  1Q81 R;  3RMQ A;  2MPX C;  1E6G A;  4XTU A;  1UDL A;  4RTU A;  5I2M A;  2HSE B;  1VQ8 A;  2OTL Q;  2GFU A;  2QQB A;  4KUL A;  2DYB A;  4ELZ C;  1K1Z A;  2DK3 A;  2OTL T;  3LLR A;  2JZ2 A;  2HKN A;  1G83 A;  1QWF A;  2QQ9 A;  3H6Z A;  1BIB A;  2F2V A;  3CMA Q;  3CBM A;  3CD6 T;  5IXF A;  1TXQ A;  4R56 A;  2KRS A;  4BE2 A;  3RIR A;  3VUB A;  1MNE A;  1QLY A;  4XU3 A;  4OB2 B;  3CCE Q;  2EJF A;  2E41 A;  3QUI A;  1OV3 A;  2GGR A;  1PCX A;  3NTK A;  1WHJ A;  3G6E Q;  3NTH A;  4BI3 A;  2DNU A;  1BB9 A;  3JCM V;  1RAA B;  2DAQ A;  3OYN A;  1D3B B;  1NJI C;  2O4X A;  2K2V A;  1LVK A;  1VIE A;  1ZX6 A;  1MV0 B;  4E7K A;  4R0K A;  5LJ3 e;  1AWW A;  1LJO A;  1KD1 R;  1UJ0 A;  4GBQ A;  3E2U A;  4OB3 B;  3OYC A;  3VS2 A;  4DOV A;  3H8Z A;  1SG5 A;  4C8Q G;  4AG2 C;  1IZ6 A;  1LCK A;  1RL2 A;  2KVQ G;  3I56 Q;  2CP2 A;  4M77 G;  4M7A F;  2RJF A;  4XU0 A;  5IAY A;  4PFZ A;  1RI9 A;  3EG3 A;  2RQW A;  3JRZ A;  3KXT A;  3M55 A;  1X6B A;  2EKO A;  3EGX B;  3CXC A;  4KUI A;  3HPW A;  1WYX A;  3M5A A;  4M77 B;  1JJ2 A;  4II1 A;  5KYU A;  2XG8 D;  4P5N A;  4PJO G;  4AFQ C;  1N6A A;  2RQR A;  4J7F A;  4A4G A;  2MF2 A;  2DIG A;  5KE2 A;  3PMT A;  2BZ8 A;  2ZZD A;  1KQS S;  3FRN A;  1LNX A;  1Z9Z A;  1QVG S;  2V8J A;  4PJO B;  1D1A A;  2EIF A;  3M0R A;  5GMK l;  3OYM A;  4LD9 K;  1YFN A;  2V26 A;  3S3N A;  2KRO A;  2XDP A;  4MMK A;  2QQS A;  3WVE B;  1HJD A;  4B6M A;  1SRM A;  2KQW A;  2LCS A;  5EC7 A;  3OS0 A;  2JMC A;  4PJM A;  4RTZ A;  2JVV A;  2WSC E;  5C6S A;  2QGG A;  1HD3 A;  3ME9 A;  3V8J A;  3OYB A;  1M3A A;  1M2V A;  2DIL A;  3Q1J A;  5CAI A;  3MJX A;  3M0P A;  4RG8 A;  2HDA A;  2FPF A;  2RD1 A;  5GAO l;  1GFC A;  1DJ7 B;  2DL7 A;  4XU2 A;  4NS5 A;  4BI4 A;  3CCS Q;  3CC2 T;  1K9M C;  3ULR B;  1D0Y A;  1SHF A;  1QVG P;  4JJC A;  4OMN A;  2CZ7 B;  2K9G A;  1M1G A;  3CPW S;  2G6F X;  4N4I A;  3QYH B;  1U8R A;  2AZS A;  3FJ5 A;  1JQQ A;  4HVV A;  3DB3 A;  3QO3 A;  1B7T A;  4L5G A;  1M90 C;  2ROL A;  3EG9 A;  3THK A;  4PFO A;  3FEO A;  3M54 A;  3O8V A;  3TVT A;  1VQP Q;  3QWY A;  3DLL A;  3PVL A;  3GP8 A;  1AD5 A;  1KK7 A;  1K4U S;  3VRZ A;  2M1H A;  3V7S A;  2OJ2 A;  3GPL A;  1BCM A;  5LJ3 d;  3OW2 S;  3CCM A;  2NYS A;  2MCN A;  2DER A;  2QYZ A;  3VU3 C;  1GBQ A;  1W70 A;  1BKB A;  4LXC A;  1JU5 C;  3HRU A;  2KE9 A;  4IUU A;  5A2Q E;  3M56 A;  4OMQ A;  3EHQ A;  1VQ9 A;  4KUD K;  4C92 F;  5CR2 A;  2QTX A;  2KY9 A;  4Z88 A;  3AHU A;  4IKF A;  1KC8 U;  4X9C A;  1VQ4 Q;  5FU6 C;  1VQN A;  2I2L A;  2IG0 A;  3DKM A;  4EMG A;  4QQ6 A;  2HD0 A;  1YIJ Q;  1G5V A;  4M7D F;  2OTJ Q;  2LQW A;  1YIJ T;  2OTJ T;  2Y4Y A;  5CIU A;  2F2X A;  4OMF B;  1S72 Q;  2YSQ A;  2CP0 A;  2WSE E;  5LJ5 h;  5GAO q;  2VUB A;  2D0Q B;  3P8D A;  1KQS A;  3OW2 P;  4EPC A;  2LP5 A;  3EFS A;  3JB9 I;  4M7A D;  1AWO A;  2EYW A;  5I22 A;  4X9D A;  3MEW A;  3EGD A;  2J05 A;  4ZN3 A;  5HK0 A;  2DXT A;  4C8Q D;  2JTF A;  1UHC A;  1WX6 A;  5J39 A;  2DZ9 A;  1VQK A;  3VUZ A;  1WJS A;  3ZFJ A;  3UAT A;  4M77 D;  4HVU A;  4O6J A;  2QTV A;  4JJD A;  4DEY A;  3G71 Q;  1Y0M A;  4X1V A;  1YJW T;  2Y90 A;  1G8X A;  3UDC A;  3GLX A;  1VYU A;  4M78 E;  2FHD A;  4PJN A;  3JCM f;  1ZA2 B;  1JB0 E;  5LJ5 g;  2AKK A;  5FW9 A;  1WXT A;  3L2Q A;  1TTH B;  2O9V A;  4PJO D;  5GJV B;  1QVF A;  4OB1 B;  2E4H A;  4L6V 5;  3MHX A;  2FPE A;  1KJW A;  5FU7 C;  4IUP A;  2EAY A;  3UT1 A;  4EMK C;  1OU9 A;  4ATO A;  2EGA A;  4E6R A;  3I35 A;  2DXC A;  1JEG A;  3QSU A;  3KUF A;  3CPW A;  5KYW A;  3CME T;  3X25 B;  4WTO B;  2L0A A;  2HMA A;  3M4Y A;  4CC3 A;  1M2O A;  5FLX E;  3X28 B;  1K9M R;  1E6H A;  1N5Z A;  3MPU B;  5LJ5 f;  4KGV B;  3V8L A;  3UPU A;  1QKX A;  4M78 A;  2DMO A;  1M30 A;  4LNP A;  4DBQ A;  2AT1 B;  5GAN h; 
#chains in the Genus database with same CATH homology
 1PNJ A;  2FRW A;  2RQV A;  2BTT A;  2KT8 A;  1ZUU A;  2DL8 A;  2O2O A;  2PNI A;  3NGP A;  5HCK A;  2DX1 A;  2DL5 A;  2BZY A;  2A36 A;  1UE9 A;  2LNH B;  4J9H A;  2ECZ A;  2VVK A;  4J9G A;  2JM8 A;  4RTV A;  5FWC A;  1UTI A;  2V1R A;  4DEX A;  1WA7 A;  1SEM A;  4J9E A;  5I11 A;  3GBQ A;  1VYV A;  2DL3 A;  3PE0 A;  2JMA A;  1WFW A;  4F16 A;  1K9A A;  2ROT A;  4AFS C;  2OI3 A;  3A98 A;  4ESR A;  3IQL A;  4F14 A;  2EYY A;  3VS4 A;  1KSW A;  2KNB B;  2M51 A;  1OEB A;  1SPK A;  1GBR A;  2RPN A;  2O31 A;  1BBZ A;  1YN8 A;  4CC4 B;  3EG1 A;  1OPK A;  2EYZ A;  4IIM A;  1I07 A;  4Y92 A;  2LJ0 A;  1QCF A;  2EKH A;  1AOJ A;  2YUN A;  3EGU A;  1GCQ A;  2FRY A;  4RTY A;  1U3O A;  4Z8A A;  1E7O A;  4WCI A;  1X2K A;  2DE0 X;  2CT3 A;  4J9C A;  1B07 A;  2L2P A;  1M3B A;  1TG0 A;  1UG1 A;  1XOV A;  1Z9Q A;  2W0Z A;  3M0Q A;  2GQI A;  2AKL A;  2LZ6 B;  1U06 A;  2ABL A;  2JT4 A;  1KFZ A;  1W6X A;  2GTJ A;  2DLP A;  2F2W A;  4A63 B;  1NG2 A;  2YUQ A;  4M4Z A;  5IH2 A;  1BU1 A;  2KRN A;  2NUZ A;  1E6G A;  4J9I A;  1UDL A;  4RTU A;  1ZBJ A;  2DL4 A;  1YNZ A;  4KRT A;  2DYB A;  1EFN A;  1K1Z A;  1G83 A;  1QWF A;  4LUD A;  2JTE A;  1ABO A;  2F2V A;  2GNC A;  5IXF A;  1PKS A;  4RTW A;  2KRS A;  4FSS A;  2JXB A;  1QLY A;  2L3Q A;  3C0C A;  2EW3 A;  1I0C A;  1OV3 A;  3ZL7 C;  1YCS B;  5FWB A;  2GGR A;  3H41 A;  2CRE A;  4QT7 A;  5IHI A;  1JXO A;  2EYX A;  3R6N A;  1S1N A;  2DNU A;  2DVJ A;  3VRY A;  4LN2 A;  1BB9 A;  2KBT A;  2W10 A;  1UFF A;  1MV3 A;  3SEM A;  1T0H A;  4D8K A;  2O88 A;  1ZX6 A;  1NEG A;  1MV0 B;  1PWT A;  4JPB W;  4R0K A;  2BZX A;  1AWW A;  4AFU C;  2DBM A;  1UJ0 A;  4GBQ A;  3VS2 A;  1WXU A;  1GCP A;  2KGT A;  4AG2 C;  2DF6 A;  2KYM A;  1PRL C;  1LCK A;  3VS7 A;  1GFD A;  1G2B A;  1TUC A;  1JXM A;  1CKA A;  3EG2 A;  1B3Q A;  1J3T A;  2DA9 A;  1AVZ C;  1RI9 A;  3EG3 A;  2RQW A;  1CKB A;  4K11 A;  1X6B A;  1H8K A;  2CH4 W;  2K7A A;  3TSZ A;  3M0T A;  1WIE A;  1WYX A;  1M8M A;  2QDL A;  2A28 A;  2E5K A;  3CQT A;  2KYB A;  3O5Z A;  2I0N A;  2J6O A;  1TUD A;  4AFQ C;  2RQR A;  5L23 A;  1NLO C;  2C0I A;  1RUW A;  2CSQ A;  2HEQ A;  2GTO A;  2EQI A;  2BZ8 A;  2CUB A;  1Z9Z A;  1QWE A;  2SEM A;  1ARK A;  2MOX A;  1NLP C;  2D8H A;  2J6K A;  5IHN A;  2DRM A;  4LE9 A;  2RNA A;  2LX7 A;  3M0R A;  1AEY A;  4JZ4 A;  4OML A;  2JM9 A;  4RUG A;  1K76 A;  2GBQ A;  1K0X A;  2KRO A;  2EGC A;  2AZV A;  1NEB A;  2D1X A;  1HJD A;  2M0Y A;  3VS3 A;  1SRM A;  2LCS A;  1A0N B;  5EC7 A;  2JW4 A;  1M3C A;  1UHF A;  2JMC A;  4EIK A;  4RTZ A;  2HSP A;  3EG0 A;  1HD3 A;  3UA7 A;  5IHK A;  1RLQ C;  2RQT A;  1M3A A;  3REA B;  4OMO A;  2DIL A;  4OMM A;  1PKT A;  2MIO A;  2RF0 A;  4J9B A;  3U23 A;  2L3S A;  2A37 A;  1T3L A;  3M0P A;  3NHN A;  1YWP A;  2HDA A;  2RQU A;  1CSK A;  2FPF A;  2A08 A;  1GFC A;  2K3B A;  2DL7 A;  1H92 A;  2EVR A;  2DM1 A;  3RNJ A;  5GJW B;  1PRM C;  1NM7 A;  3ULR B;  1SHF A;  1AWJ A;  4JJC A;  4OMN A;  3UA6 A;  2K9G A;  1KIK A;  2G6F X;  2AZS A;  2HCK A;  3FJ5 A;  1AWX A;  1JQQ A;  4HVV A;  2YUO A;  4CC2 A;  2ROL A;  2AK5 A;  3RBB B;  1ABQ A;  3THK A;  1H3H A;  3TVT A;  1UEC A;  4RTX A;  3H0F A;  1OOT A;  4F17 A;  3NMZ C;  3QWY A;  3TSW A;  1WI7 A;  1FYN A;  2DRK A;  1AZG B;  1VA7 A;  3PVL A;  2FG0 A;  1AD5 A;  1MUZ A;  1BK2 A;  1K4U S;  2YUP A;  1U5S A;  3VRZ A;  2HBW A;  2JS0 A;  2OJ2 A;  1SRL A;  1UUE A;  2SRC A;  1Y57 A;  2MCN A;  2X3X D;  1GBQ A;  4JJB A;  1W70 A;  1UGV A;  1T0J A;  3PVQ A;  1JU5 C;  2KE9 A;  1NYF A;  1ZUK A;  2CDT A;  3LH5 A;  4OMQ A;  3EHQ A;  2K79 A;  1IO6 A;  3REB B;  4Z88 A;  1W1F A;  3I5R A;  1QKW A;  2YT6 A;  2C0T A;  2X3W D;  3EHR A;  1M27 C;  1X43 A;  2DJQ A;  1V1C A;  2KXC A;  2LQN A;  2FPD A;  4ORZ A;  4LUE A;  2PZ1 A;  2KRM A;  2OAW A;  2LQW A;  2EBP A;  1ZUY A;  1X6G A;  2LJ3 A;  2F2X A;  1I1J A;  4Z89 A;  3VS1 A;  4D8D A;  1X2Q A;  4JZ3 A;  2YSQ A;  2JS2 A;  1JO8 A;  2CSI A;  2ED1 A;  4ZNX A;  1NYG A;  4HXJ A;  2ED0 A;  1ZSG A;  2VWF A;  1YP5 A;  2LP5 A;  2XMF A;  2NWM A;  1ZLM A;  2B86 A;  4GLM A;  1AWO A;  2EYW A;  5I22 A;  2J7I A;  1WXB A;  2EPD A;  2KEA A;  2PTK A;  1SSH A;  3I5S A;  2J05 A;  2J6F A;  1WDX A;  1WLP B;  2RMO A;  3JV3 A;  3VS0 A;  1K0S A;  4HCK A;  1UHC A;  2CT4 A;  1WX6 A;  2CH4 A;  3UF4 A;  3VS6 A;  2K6D A;  1VYT A;  3UAT A;  3VS5 A;  3H0I A;  4HVU A;  1HSQ A;  2RN8 A;  2YDL A;  1OPL A;  4JJD A;  4DEY A;  4OMP A;  3NPF A;  2KR3 A;  1Y0M A;  1GRI A;  2D0N A;  2LMJ A;  4X1V A;  2L3P A;  2LJ1 A;  3I9Q A;  3H0H A;  2P4R A;  4CC7 A;  1GCQ C;  4AG1 C;  1VYU A;  1AZE A;  2AKK A;  5FW9 A;  1WXT A;  1X27 A;  2FEI A;  2O9V A;  2CUD A;  2KT1 A;  1UJY A;  2EGE A;  5GJV B;  3SHW A;  1SHG A;  2FPE A;  1KJW A;  1FMK A;  2KXD A;  2DBK A;  2J06 A;  2EGA A;  2VKN A;  3I35 A;  4E6R A;  2K2M A;  4J9D A;  1JEG A;  1PHT A;  1RLP C;  5ECA A;  3M0U A;  1GL5 A;  2ENM A;  4AFZ C;  2L0A A;  2C0O A;  4CC3 A;  2ESW A;  4IIO A;  3QWX X;  3KFV A;  4RTT A;  4J9F A;  2IIM A;  2O9S A;  2V1Q A;  1E6H A;  1N5Z A;  1X69 A;  1YWO A;  2FO0 A;  2D8J A;  2H8H A;  1QKX A;  3M0S A;  2DMO A;  4HVW A;  1M30 A;  4LNP A;  1T3S A;  5IXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...