2K7AA

Ensemble structures of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase.
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
b'GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3 domain of Tyrosine-protein kinase ITK/TSK
molecule tags Transferase
source organism Mus musculus
publication title Proline Isomerization Preorganizes the Itk SH2 Domain for Binding to the Itk SH3 Domain
doi rcsb
total genus 6
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2k7aA00
1NLPC 1H8KA 2D0NA 4Z88A 2ESWA 2KROA 4D8DA 2GGRA 2KT1A 4CC7A 4RTWA 3UATA 5L23A 4JJBA 1NM7A 2JM8A 5GJWB 1Z9ZA 3SEMA 1K1ZA 1PNJA 2JW4A 1NG2A 2FPFA 2JT4A 2CT3A 5IH2A 1UFFA 3KFVA 4AFSC 2DM1A 2W0ZA 1H92A 2O9VA 3QWYA 3EG1A 1AWWA 2A28A 1ZBJA 4HVWA 1X2KA 1WYXA 1JEGA 1PHTA 1TUDA 1GFDA 2BZYA 5FWBA 1Y0MA 2J7IA 3NHNA 2HBWA 1FYNA 2ROLA 2DX1A 3ZL7C 4Z89A 2J6KA 4J9BA 4AFZC 2LJ3A 2IIMA 3EGUA 3M0RA 2A36A 2K6DA 2L2PA 4HCKA 1A0NB 4J9HA 1K4US 3VS0A 2KNBB 5I11A 2F2WA 2RQWA 2E5KA 2RQRA 4K11A 2YDLA 1GFCA 1TUCA 4RTZA 1B07A 2DL4A 3QWXX 2LZ6B 3CQTA 4OMQA 1JXOA 4KRTA 1SRMA 2RMOA 2MOXA 1MV0B 2LNHB 2HEQA 4JJCA 2NUZA 1RLPC 4Z8AA 2DF6A 3UF4A 2X3WD 2KRMA 1AWJA 3FJ5A 1H3HA 2CSIA 1AWXA 2JTEA 1HSQA 1NYFA 2ED0A 1EFNA 5IXFA 1T3LA 1WDXA 2EPDA 1AEYA 1BBZA 2AZVA 1X43A 1I0CA 1E6GA 2HSPA 1HD3A 2O88A 2DL8A 2AZSA 1M30A 2K7AA 2JMCA 1WA7A 1YNZA 1M3CA 3C0CA 2P4RA 1NYGA 2CDTA 3RBBB 4JJDA 2YSQA 1I07A 3EG2A 2VVKA 1WI7A 5IHKA 3M0SA 2C0IA 2SRCA 1VYVA 2DYBA 1XOVA 1SRLA 2K3BA 3EHRA 4ZNXA 2AKKA 3TSWA 1QCFA 2KXCA 3TVTA 1YWPA 3LH5A 5FW9A 1QKXA 1ZSGA 2V1QA 4JZ4A 1RUWA 1GCPA 2LMJA 1K0XA 1E7OA 2EYYA 2CT4A 3H0IA 1G83A 3I5SA 1UTIA 3M0UA 1HJDA 2NWMA 1MV3A 5I22A 2CH4A 1BU1A 1OOTA 1UUEA 2YT6A 1CSKA 3VS3A 2GTJA 3VS6A 2DMOA 2W10A 1AOJA 1UECA 2HDAA 4RTTA 3UA7A 1WXBA 4AG2C 2DBKA 2RPNA 2EYWA 1PKSA 2AKLA 3U23A 2EYXA 2YUOA 2I0NA 1G2BA 1ZUUA 4CC4B 1M3AA 1AZGB 3PE0A 2MIOA 4GLMA 2JMAA 1U5SA 1B3QA 1W70A 4LUEA 1RLQC 2D8HA 3VRZA 3NPFA 2EGEA 4JPBW 1WX6A 3VS7A 2JS2A 2KGTA 1VA7A 1IO6A 3EHQA 4Y92A 1JO8A 2DA9A 2QDLA 4AG1C 2KBTA 2EBPA 1RI9A 2L3PA 4ORZA 1UDLA 2JXBA 2CUDA 2DVJA 2DRMA 1WLPB 4IIOA 2DL3A 1Y57A 2KXDA 4RTVA 4J9FA 4J9GA 1GCQC 2CH4W 4X1VA 1ZX6A 1PRLC 4J9EA 4EIKA 2EYZA 2GBQA 2KRSA 1SHFA 2X3XD 1GCQA 2RQUA 4D8KA 1VYUA 1LCKA 2A08A 2LJ1A 2O2OA 1AVZC 2RF0A 1VYTA 4HXJA 1X6BA 2YUNA 2RQTA 1X69A 4OMOA 1KJWA 4F14A 1QKWA 2PTKA 2KYMA 4FSSA 2J6FA 2BZ8A 5HCKA 1NEGA 1QLYA 2M51A 1M3BA 1PWTA 1OEBA 2K9GA 1JU5C 1UG1A 2GNCA 1J3TA 3O5ZA 2KR3A 1AWOA 1UJ0A 3PVLA 1AD5A 1K0SA 2EW3A 2D8JA 2DL5A 4OMMA 4J9IA 2SEMA 3RNJA 1ABOA 1K76A 1YN8A 2C0OA 2JM9A 3EG3A 2RQVA 1OPLA 2HCKA 1ZLMA 3SHWA 1UJYA 1UE9A 2DNUA 4OMLA 1QWEA 4A63B 1WIEA 1TG0A 2LP5A 2EVRA 1X2QA 3VS1A 1W1FA 2LJ0A 3A98A 1M27C 4QT7A 2FPDA 2RNAA 3JV3A 1Z9QA 2KRNA 2B86A 3EG0A 3VS5A 3VS2A 2BZXA 1YCSB 1GL5A 1PKTA 1V1CA 2KYBA 4E6RA 3GBQA 3I9QA 2CUBA 3NMZC 4ESRA 1T0HA 4DEXA 1I1JA 1GBQA 1NLOC 2FRWA 4CC3A 2J06A 1W6XA 3M0TA 1OV3A 2A37A 2KEAA 2G6FX 2PNIA 4AFQC 2GQIA 3H0FA 1U06A 1CKAA 2KT8A 2DILA 2EQIA 2FRYA 1GBRA 1S1NA 3R6NA 1UGVA 1UHFA 2OJ2A 5IHIA 4LN2A 1U3OA 4GBQA 2ABLA 4R0KA 1K9AA 4F17A 1WFWA 4OMNA 1AZEA 2DBMA 1N5ZA 1JXMA 1MUZA 2FEIA 2PZ1A 1BB9A 2K2MA 5FWCA 2ENMA 1ARKA 3REBB 2M0YA 2EGAA 2FO0A 2DL7A 5GJVB 2DJQA 3PVQA 4RTUA 3H0HA 2FPEA 4RUGA 1NEBA 2D1XA 5EC7A 3VS4A 1GRIA 1CKBA 4RTXA 1BK2A 2RN8A 4IIMA 2K79A 3I5RA 4LE9A 2L0AA 3I35A 2O31A 2DLPA 3IQLA 3ULRB 4OMPA 1X27A 1SSHA 2EKHA 2BTTA 2O9SA 4DEYA 2LX7A 3THKA 1SEMA 3H41A 2FG0A 2OAWA 4M4ZA 2AK5A 1PRMC 2OI3A 3TSZA 2J6OA 1WXUA 4WCIA 1KFZA 3M0QA 1SHGA 1UHCA 2L3SA 2C0TA 1KSWA 2VKNA 2H8HA 4CC2A 1JQQA 4HVUA 3REAB 2YUQA 4HVVA 2MCNA 2LQNA 2CSQA 1E6HA 2GTOA 2ECZA 2F2VA 2F2XA 4F16A 1X6GA 2DRKA 4LUDA 3VRYA 4RTYA 1WXTA 2V1RA 2L3QA 2EGCA 2ED1A 1OPKA 1ABQA 1FMKA 1YWOA 2J05A 3NGPA 2ROTA 4LNPA 2VWFA 1KIKA 2LQWA 1ZUYA 1T3SA 2DE0X 1T0JA 4AFUC 3M0PA 4JZ3A 3UA6A 2CREA 2JS0A 4J9DA 2LCSA 1M8MA 2KE9A 1SPKA 5ECAA 4J9CA 2XMFA 1ZUKA 2YUPA 5IHNA 5IXBA 1YP5A 1QWFA
chains in the Genus database with same CATH superfamily
1PC0A 2H3JA 5KYYB 2KT1A 1BI2A 1K73U 3UATA 4JJBA 5CKFA 1NJIC 1WGSA 1KK7A 4M78B 1XJWB 4N0AC 1K1ZA 1HYOA 5LJ5f 2OTLT 1H92A 4AFSC 1G3TA 2W0ZA 4C8QD 4EMKC 2KAFA 1VQLT 4OF1A 1QVGS 1ZBJA 3C94A 2CP6A 4M77A 4FW1A 3CC4A 1YJ9A 1D1AA 5LJ5d 2M16A 2E10A 1Y0MA 2J7IA 3GNFB 3ZBDA 5GAOr 1FYNA 1TXQA 2ROLA 4Z89A 4M7AF 3TREA 4M75C 4R56A 2ZZDA 3S6WA 2A0FB 1K4US 1KG1A 3JB9D 1IHVA 3MPUB 2F2WA 4KBMB 2YDLA 4EMKB 2QTVA 1QMCA 3OS2A 2OTJT 1C0MA 2MWOA 3CQTA 4OMQA 4KGXB 4KH0B 4CI0C 5CKBA 4NL2A 5GANg 2MOXA 3CC2T 2EJFA 3UF4A 1IHWA 4FW2A 2ZAEA 1VQ8A 2CKKA 4IUUA 4M78A 4RCCA 1NJIR 4J7FA 3F70A 3P8BB 3OW2P 4DA4A 3V7RA 5KH6A 1D09B 1HSQA 1NYFA 4XTUA 1VQNT 4A54A 3KXTA 1EFNA 2JJ9A 1I5OB 3JCMb 2OTLA 1QVPA 2DIQA 3C4SA 1PG5B 1PCXA 5GAMd 1V29B 2D0QB 9ATCB 4GLKA 1VQ9T 1HD3A 3HPWA 2DL8A 3OBWA 2XDPA 1VQ5A 2JMCA 3BY7A 5GAMj 1JJ2P 1G3YA 5KYNA 4FYVB 4DBFA 5GAN7 2QG9B 2RHIA 1RABB 3CEYA 1WI7A 2OX7A 5IHKA 3M0SA 1R0BG 1XOVA 1N9RA 2DERA 2ZPGB 4ZNXA 1M8VA 2AKKA 4KT0E 3CBMA 4PJNA 1YHQT 1W4SA 5FW9A 5J26A 2V1QA 4JZ4A 1YJWT 1OYXA 3FLGA 2RA2A 1E7OA 2CT4A 3L2VA 2HAXA 2AT1B 1HJDA 4XTWA 1YJNA 2QGGA 5I22A 3CMAQ 1VQKQ 3VYHB 2CH4A 3P8DA 4C92E 1CSKA 4C92G 3HRSA 2GTJA 2W10A 3NTKA 2HDAA 2X4XA 4RTTA 3UA7A 4X9DA 3OMCA 4NOYA 2PU9B 2COYA 2E5QA 2HNIA 3RERA 1PKSA 3U23A 2BE7D 3SB2A 5KYXB 2HBPA 2EYXA 1WHGA 2I0NA 2P0PA 2QA4A 1M3AA 3M59A 3LYIA 3NTHA 2M1HA 4GLMA 4HT9A 1ZA2B 4PNOA 1W70A 3HRTA 3CD6A 1Q82U 2ZPFB 4JPBW 1WX6A 3VS7A 4EMGA 1LVKA 3OYAA 4BI8B 4P5NA 1VQ7A 3RUXA 4ZGEB 3OMGA 4OGEA 1KC8R 2JXBA 2QTXA 2DRMA 4M7DA 1WLPB 3CCQA 4M7AE 1WQWA 1ZQ1A 1GCQC 1WHLA 2A7YA 1KHCA 1SHFA 2RQUA 1YI2T 5GMKj 3G6EA 2LJ1A 1M2VB 1VYTA 1U1SA 2YUNA 4M75D 2P0KA 4BI4A 1U1TA 1KJWA 3JCMf 1QKWA 2E65A 2X9HA 4PJOD 2DD4A 3WXMB 5GAN4 3GPLA 3JB9I 5AT1B 3CCRT 2E4HA 3T9NA 1J3TA 3BW1A 2KR3A 1VQPT 1UJ0A 1VIFA 2Z0WA 3RIRA 2XDDA 1N8RC 1VQ6T 4X34A 4IKFA 2RB6A 2SEMA 1ABOA 4C0ZA 1EZZB 2NUTB 5KCHA 2RQVA 4QVCA 3SWNA 2DNUA 2NUTA 4RMOA 4A63B 2PQWA 3M58A 1TG0A 2LP5A 1RAIB 4PFOA 3M55A 4F04B 5LJ3h 3CBOA 3OQ5A 3GOXA 1W1FA 3A98A 2R57A 3CCJA 2K57A 3CD6T 1K8AU 1Z9QA 2B86A 3EG0A 2P4TA 3VS5A 1MNDA 4AMCA 1IGQA 2RJEA 3M5AA 3L2QA 3E2UA 1PKTA 2EQMA 1V1CA 4EPCA 2A3LA 2ZPHB 4FSXA 2K5FA 1WPYA 3I55T 3CCLT 1O9SA 2CUBA 1T0HA 4IUPA 4DEXA 1RAAB 3CC7T 1W6XA 4LD9K 3M0TA 2DTHA 1TH7A 2KEAA 2G6FX 3Q1JA 5CKDA 4PJOE 2DTOA 1U06A 2VV5A 4XK8E 5IAYA 1UGVA 2OJ2A 4PLLA 1OX9A 2E41A 2KDSA 4OMNA 2DBMA 2FEIA 2PZ1A 1YJWA 1YHQA 4FT2A 1OULA 2E12A 1ARKA 4M7AD 3HFNA 4OB2B 3H0HA 2FPEA 3X20B 2KY9A 3VS4A 1GRIA 2DAQA 4RTXA 2HMAA 3E19A 2QASA 2COZA 2RN8A 3OS5A 3CC4Q 1Q82C 2CP7A 3IQLA 3CCSA 3ULRB 4OMPA 4E7IA 5GAN8 1X27A 1M1KC 1AHJB 1I4K1 3L42A 1YFNA 4M78G 2OTJQ 3H41A 4C92B 3SWNC 3EGXA 2EJ9A 3QDFA 4BI3A 1VQ4T 2RH2A 2HL3A 4M7DF 3M0QA 2BE9B 3PMTA 2L3SA 1W2BA 4CC2A 2XU8A 2XICA 4MMLA 5I2MA 2JTMA 2PUOB 1JQQA 2VXEA 5FU7B 2YUQA 4BD3A 3GLXA 4KULA 1PSEA 3BE3A 3CC2A 2CSQA 1E6HA 2F2VA 5KYUA 1BCMA 4TVRA 4LUDA 3VRYA 4PJMA 1D3BB 2LC4A 2V1RA 2YXYA 3GF5A 2IPOB 2J05A 4OMFB 1IZ6A 3SWNB 2VWFA 1ZUYA 3G7ZA 2DE0X 3LLRA 4JZ3A 5LJ5g 5I21A 1TUGB 3QBYA 2H3EB 1M8MA 3CC7A 4XTXA 4J9CA 1ZUKA 3RR6A 2YUPA 4V2SA 4C8QG 4M78F 4DOWA 4M75F 1QWFA 3HL8A 3CPWA 4OB0B 2DETA 4Z88A 2Y4XA 2GGRA 1G5VA 2CP0A 4CC7A 4RTWA 3LX7A 4A53A 2KI7A 5GJWB 4M77G 4E7SA 4ATOA 3CPFA 4BDYA 3SEMA 3QJYA 5GAOn 2JT4A 5IH2A 1LPLA 3JCMd 1MHNA 3OYDA 3EGDB 1AWWA 3CCVQ 4N0AA 2A28A 2V26A 3CCUQ 1WYXA 2AHJB 1PHTA 3SDZA 5CR2A 1GFDA 5FWBA 4EMKA 3BDLA 3CXCS 3NHNA 3INZA 2DX1A 1VQNQ 3G71Q 3QSUA 2LDMA 2LJ3A 1YCYA 3EGUA 1G3WA 2K6DA 3VS0A 2M9UA 1K73C 2KNBB 5I11A 2JN0A 2E5KA 2HKQB 2RQRA 5I2SA 3FDRA 2LZ6B 4IUQA 4AT1B 5D6WA 2JNGA 5CIUA 2LRQA 4JJCA 2NUZA 4L5GA 3G6ET 1RLPC 4C5IA 2DF6A 3VU3C 2X3WD 1AWJA 1H3HA 3OYCA 1Q86U 3SFMA 2JTEA 3VYGA 5HK3A 1AEYA 2DEQA 5GAN2 1PD0A 4M7AC 4XU0A 3BFMA 2CZ7B 4FM4B 1RL2A 2HSPA 2L3RA 5KCOA 3QZ9B 3M57A 2O88A 5CKEA 1K9MU 1OU8A 2QQSA 3VKIA 2K7AA 1IXDA 2O4XB 2EAYA 1M3CA 2P4RA 4BE1A 1M1FA 1NYGA 3JCMh 5CQYA 2XHCA 4JJDA 2ZGWA 1BI0A 2GQVA 2VVKA 4C0GA 3CPWS 2SRCA 1G8XA 3TCJA 3JCMc 1IB8A 2COWA 3OY9A 2E1HA 1RACB 1QCFA 2KXCA 3TVTA 2QA4T 2QYZA 1VQ8Q 1ZSGA 1GCPA 4QQDA 1K0XA 1UB4A 2YRDA 5M9OA 2VYTA 3URGA 1G83A 4FT4A 5FLXE 1NJIU 4ME7A 2HQHA 1VQPQ 2YT6A 4N4IA 3VS3A 4BDZA 1Q81R 3DB3A 2I2LA 3VS6A 1AOJA 1UECA 1R8OB 1KC8U 1YJNT 2RHUA 5HK0A 4FU6A 4KUIA 3TQ7P 2AKLA 2E6NA 2XD0A 3CC4T 4OVAA 3MEAA 4ZGJB 2K3XA 3C95A 3LH0A 2E3IA 2QQAA 3SD4A 1AZGB 3PE0A 4BY6C 5EG2A 4FCYA 2JMAA 4XTZA 1B3QA 1D0XA 3CCJT 4LUEA 1RLQC 3JCMX 1KHIA 1RADB 3A8OB 3H6ZA 5FU7C 1JO8A 1PD1A 2QDLA 4C92F 4LDVA 2X4WA 1UGPB 4XAXB 4AG1C 4N4HA 3JB9H 4XU2A 4RG2A 3HP9A 1VQ5T 1RI9A 2L3PA 3CMAA 4QVDA 2NLUA 4ORZA 5CQXA 3VV0A 5GAN5 1VQ9A 1ZA1B 1KQ2A 1QVGP 4IIOA 4ANJA 1EX4A 5C0MA 1Y07A 4J9FA 4J9GA 1BI1A 3I56A 3A8LB 2JVVA 1ZX6A 3CXCP 4J9EA 4EIKA 2YHTA 1XQHA 4IUTA 1QVFP 4RKUE 2GBQA 2KRSA 3CCRA 5GAMh 1N6AA 2M02A 4QQ6A 4D8KA 2DXBA 5GAOq 2A08A 3L2WA 5IT9E 5DLQE 4L6V5 4HXJA 3KBGA 3I55Q 4OMOA 4F14A 2HL5C 2XI9A 2QDYB 3ZFJA 1M3BA 3MP8A 1OEBA 2K9GA 1AT1B 1TS9A 1UG1A 3JCMQ 2GNCA 5GAOl 3LGFA 3O5ZA 4EMHA 1K0SA 2FB7A 2D8JA 1JBMA 2M0OA 4C8QF 1M2VA 3CCQT 2C0OA 1N8RU 2CZ0B 3EG3A 1OPLA 1S72A 1UE9A 1IRXA 2DXTA 3CBPA 1VQ7T 1X2QA 5GAMe 2QQBA 4J7IA 3VS1A 1XNIA 3FB9A 2NYSA 2LJ0A 1VQ4Q 4RCBA 1VQ6Q 1M27C 1S72T 1JJ2S 3A8HB 1EIFA 4MZTA 4ELYC 3HSBA 2YLBA 5LJ3e 1N8RR 1M90C 2QXFA 3VS2A 1GL5A 1N9SA 1QVFA 3CPWP 2KYBA 2VUBA 4E6RA 3GBQA 3OYIA 3I9QA 2RI5A 3TEEA 4ESRA 4M78E 4DQ2A 2MK5A 2J06A 3M56A 2A37A 2K3YA 2RHXA 4AFQC 1OQKA 2RI3A 2QEXQ 3J7AF 3J80E 2GQIA 1ZBXA 1YJ9Q 1CKAA 4PJJA 1Q82R 1S1NA 4FIBA 2PVDB 3CMEQ 1KQSS 2ABLA 4F17A 1WFWA 3EFRA 1N5ZA 1JXMA 8AT1B 3CCMA 1WHKA 1BB9A 3MCAB 4WTOB 2DPPB 5FWCA 2ENMA 5A2QE 3MP1A 2M0YA 2BIVA 1BI3A 2RHYA 2FO0A 3A8MB 5GJVB 3EG9B 4QKUA 3PVQA 3QXEB 4RUGA 1NEBA 4XQ3A 5EC7A 5LL6S 2BUDA 4C8QB 3EG9A 3CCET 4M77C 1O75A 2L0AA 3JCMW 1Y96B 1KQSA 4XTYA 1SSHA 2EKHA 1YIJT 3RKWA 3V7SA 3G4SA 2O01E 1H641 5GMKh 1R77A 3OYYA 2RI2A 1ZSZB 2ZPIB 3HFOA 2J6OA 4FYXB 4WCIA 4LXCA 1KFZA 5KYXA 1WJSA 5AYFA 1KSWA 3JAME 2G3RA 1K73R 3JCMJ 4JLIA 1WHMA 3REAB 4C92D 1WZOA 3NTIA 2LQNA 4BUGA 3G1JA 2GTOA 3JCMV 2F2XA 5DY9A 1X6GA 4PJOC 3LWHA 1WXTA 4A4HA 2L3QA 2DVEA 1M2OA 1ABQA 1FMKA 3QDRB 2RK1A 2RD1A 2GFUA 4C8QA 4LNPA 2DKGA 3X24B 1T3SA 1T0JA 1Y7XA 3S3MA 2LCSA 2KE9A 5ECAA 2XIDA 4O5VA 4JRKA 5IHNA 1YJ9T 1MMAA 2LX9A 4JJNK 3DLLA 5J3BA 1H8KA 4C0FA 4M7AG 3OYHA 3JCMP 1VQOQ 3G71T 1BCOA 4PJOB 4D8DA 1MGQA 1FX7A 3E9FA 5GMKe 3GIBA 5L23A 1MNEA 2JM8A 2L5QA 1Z9ZA 1PNJA 2JW4A 2FPFA 1DJ7B 4M77B 2CT3A 4JRIA 1UFFA 2LQKA 4NL3A 4D6WA 2DM1A 2WSEE 2O9VA 4PJOA 3QWYA 3L2ZA 1ACMB 3EG1A 1I8FA 3CCEA 4HVWA 2F5TX 2FL7A 1X2KA 4J5YA 1QP3A 3PNWC 1TUDA 2GCXA 2EJGA 3JCMe 1YBYA 2FZKB 1VUBA 4C0DC 2J6KA 4HCBA 4Y91A 3HTRA 4N4GA 1XTDA 4ZGDB 1Q81C 1A0NB 3M4GA 3OYEA 2KQWA 2V8KA 2X4YA 3CCQQ 5A0GA 2RQWA 4BE2A 2EQJA 4K11A 1Q7YU 3WVDB 2D9TA 4M7DB 1TTHB 3QWXX 2V8JA 2YWWA 1X6OA 4PK4A 4KRTA 2F69A 1KQSP 5FRNA 5CVIA 3EFSA 3HRUA 2XKOC 4BB7A 4VUBA 2CP2A 3RKYA 4OP0A 1VQLQ 5GANj 5CK9A 3DKMA 3FJ5A 4PJLA 1AWXA 4M7DD 4HCCA 3OYGA 4X9CA 2ED0A 5IXFA 5GANd 5KE2A 2EPDA 3PMIA 5L8RE 1BBZA 4HCZA 2EKOA 2AZVA 1NPRA 1I0CA 1Q81U 1E6GA 5GANf 5C6SA 3PTAA 2DXUA 2AZSA 4QQGA 1M30A 3RKXA 3OS1A 1YNZA 3C0CA 2DZ9A 3CCRQ 4M78C 1P92A 2CDTA 3RBBB 1VQ5Q 3EG2A 1FMWA 1BIBA 2DYBA 4Q5WA 1SRLA 2K3BA 2DZCA 1LNXA 3JB9G 1YWPA 2QGFB 3LH5A 3CCJQ 5LJ3f 3N5BB 1VQKA 1W2BS 1Q7YC 3OYBA 1FWZA 2EYYA 1PSFA 3ZEHA 4C0DB 1VQOT 1Q86R 3M0UA 3JRZA 1MV3A 4C92C 2DK3A 4QW2A 1K9MC 1OOTA 2QQRA 4J6WA 2DMOA 2QAZA 1RAFB 1WXBA 4AG2C 3CCVT 2L89A 2RPNA 2EWNA 2KVQG 2EYWA 1M1KR 2ZCFB 3QO3A 2LTOA 2YUOA 3OYNA 3BDUA 2FZGB 1VQ4A 1ZUUA 2LT1A 4CC4B 1SSFA 2E6ZA 2L8DA 4C92A 7AT1B 2MIOA 2YRVA 5GAOm 3X28B 2HSEB 2D8HA 3VRZA 2EGEA 4Y92A 1IO6A 2PUKB 3EHQA 1D0YA 2VXFA 2ZPBB 3MKDA 1N27A 3KUFA 2EBPA 2GFAA 4PKCC 3OB9A 1UDLA 2HD0A 2DVJA 5HKCA 2QEXA 1G3SA 2DL3A 2KXDA 2K2VA 3PGGA 4JDSA 5A0LA 5LJ5e 2X35A 4HKEA 2EIFA 4FYWB 4PFZA 3OYFA 2CP5A 4L59A 4LDYA 2X3XD 2V8IA 3GNGA 1VYUA 1LCKA 5DLOA 2O2OA 3MEWA 1B7TA 1D1BA 2CP3A 2RF0A 4XU1A 1UGSB 1VQMQ 3EAEA 2EQKA 5HCKA 1NEGA 2LVMA 2M51A 3L2UA 2BKDN 3EGDA 4M77E 1JU5C 2HQEA 1KD1U 4ZN1A 1AWOA 3M4YA 3PVLA 1BIAA 1AD5A 2EW3A 4NS5A 1I81A 1M90R 4II1A 5FU6C 3VUZA 3G4SQ 1SKUB 4B9WA 2JTFA 1YN8A 2K4YA 2RJDA 3EH2A 5CAIA 1C6VX 2QEXT 2HCKA 1ZLMA 3JCMg 3GP8A 1UJYA 2NUPA 3H9NA 4ZTFA 3QPHA 1WIEA 3PFSA 3O8VA 4BACA 1QQJA 4LD6A 3L1AA 4FYYB 4OB1B 3CCUT 4F7UF 3FRNA 5D7UA 4M7DE 2VGNA 3QKJA 2BZXA 3QYGB 1YJNQ 1H3ZA 2XG8D 4M78D 1TU0B 1MMGA 2VB6A 2R58A 5GMKl 3ER0A 4M75G 3DB4A 1I1JA 1GBQA 1NLOC 5KYYA 1OV3A 1Y71A 4PJOG 2R5MA 1M4ZA 1YITA 2LCLA 1YITT 1JB0E 1TWBA 2PVOB 3QZ5B 4KGZB 4MMKA 2LCCA 3E1SA 1VOMA 2FRYA 3R6NA 4F7UB 4A4GA 1UHFA 5IHIA 1YI2A 3OYMA 4LN2A 3LWIA 3M53A 1U3OA 1K8AR 4O6JA 4R0KA 1K9AA 2DJZA 4LDUA 1AZEA 4FL6A 3MEVA 3TU4K 4BE0A 1VQKT 3CD6Q 1RAGB 4B9XA 2WSFE 1Q7YR 3JSCA 3META 2K5LA 3VJPA 3ME9A 4A4FA 2DL7A 2P0QA 2RHZA 4RTUA 5KYUB 3RESA 3M54A 4JS5A 1YHQQ 4DBRA 4UC4A 1CKBA 1TSFA 3FEOA 3V8JA 2WACA 4DOVA 1RAHB 3I35A 2O31A 2DLPA 2EYQA 2BTTA 8ATCB 1KD1R 2CZ6B 1SEMA 2FG0A 2OAWA 4M4ZA 5FRMA 2MMPA 1I5LA 3V7CA 5GANe 3TSZA 4E47A 4OB3B 1OI1A 2F5KA 2C0TA 2KSSA 1Y96A 2VKNA 2MYSA 1NZ9A 4HVUA 4RG8A 1ZSZA 4A4EA 4HVVA 1QVFS 5CKHA 1NBEB 2RM4A 4F16A 2DRKA 4OGCA 1SG5A 4RTYA 2DXCA 4M75B 3CC2Q 2EGCA 2ED1A 1OPKA 3CCLA 1VIEA 3NGPA 2NUPB 3UPUA 1KIKA 2LQWA 5GMKm 4M7AA 3M0PA 4KUDK 3UA6A 3HHTB 2CREA 1SF9A 4XU3A 1JRIA 4C8QC 1U8RA 1SPKA 3C12A 4C8QE 2KMTA 4JUVA 2DO3A 1NLPC 3QYHB 4E7JA 2WSCE 2D0NA 4PJOF 2ESWA 2KROA 5GANh 4R55A 3OW2A 3AHUA 4F7UA 2XK0A 1ZSZC 2CZ1B 1NM7A 3CCUA 1NG2A 5D6XA 1BYMA 3KFVA 3OYLA 1X75C 4IUVA 4JRQA 3OYJA 3HKSA 1JEGA 3A5ZB 1JJ2A 1UEBA 2BZYA 5A0DA 5IN1A 2OTLQ 3CCVA 2HBWA 1NE8A 5GAOp 3ZL7C 2E70A 4J9BA 4AFZC 2IIMA 2PVGB 1YIJQ 3M0RA 2A36A 3E9GA 1FXXA 3UT1A 4E7LA 2L2PA 1WJQA 1YJWQ 4HCKA 4J9HA 1TOVA 3A8GB 1LJOA 4M75A 1VQOA 4C5EA 4M7DG 2FYKA 5LJ3g 1GFCA 5HY6A 1TUCA 1ZHIA 4RTZA 3UDCA 1B07A 2RJCA 1WHJA 2DL4A 3QG1A 3OA6A 1JXOA 1GXIE 1SRMA 3OS0A 2RMOA 1MV0B 2LNHB 2HEQA 3X25B 2CGHA 2X4JA 4Z8AA 2QQ9A 5GAMf 4J8OA 1K8AC 2KRMA 3CCEQ 2K5IA 4J6XA 4BY6B 2CSIA 3EGXB 2CYZB 4GY5A 2DFUA 2E3HA 4M77D 1T3LA 1WDXA 3EFOB 1X43A 5J39A 3J81E 4J6YA 2QI2A 3OSVA 2ZPEB 1WA7A 2P84A 3S3OA 3RMQA 1OX8A 2YSQA 1I07A 2C0IA 5DM7R 3PT9A 4EDUA 1VYVA 1Q95G 1M5Q1 2LNVA 3EHRA 1VQMA 4J83A 1Q86C 1M1GA 3TSWA 4JS4A 5GAN3 1QVGA 1VQ6A 3FJPA 1D0ZA 4M7AB 1QKXA 1RUWA 1MMDA 4M7DC 1B34B 4WF2A 1VQPA 2LMJA 3A1PA 2FVUA 1VQ7Q 1UGQB 3H0IA 1V76A 3PIPA 3I5SA 1UTIA 3CC7Q 2FZCB 3MO8A 2NWMA 1BU1A 5CCAA 1UUEA 3P8HA 2JZ2A 1X01A 1WHHA 4MZMA 2O4XA 2DBKA 1K9MR 1WJRA 5CO7A 1IGUA 1KC8C 2CS7A 4QVZA 1G2BA 3V8LA 2YRCA 2RJFA 3EFOA 2RK2A 1B34A 1U5SA 1OU9A 3CCST 3CCMQ 3FIFA 3NPFA 1IREB 2JS2A 2KGTA 1VA7A 4ELZC 3L2RA 2DA9A 2QK0A 1VQNA 3G71A 4F7UG 1QCNA 2DIGA 2KBTA 4M75E 2XDBA 2Y90A 3I56Q 1KD1C 3OYKA 2CUDA 5GMKi 2FHDA 1YITQ 1LOJA 2JOYA 4KGVB 3UWNA 3V8KA 1Y57A 4RTVA 2CH4W 3DLMA 4X1VA 3H8ZA 1VQ9Q 2D6FA 1PRLC 4E7HA 2VC8A 2EYZA 4Z02A 1PM3A 4XTVA 1GCQA 2YLCA 3LGLA 1AVZC 1X6BA 2HZYA 2RQTA 4IURA 1X69A 2DYIA 2KYMA 2PTKA 4FSSA 2J6FA 2BZ8A 1MMNA 1QLYA 4YTLA 1PWTA 2HKNA 2R5AA 3FC3A 3I55A 1RAEB 3WVEB 4DBHA 5FROA 1R0CB 1RI0A 3EH1A 2DL5A 4OMMA 2AIRB 4J9IA 3JB9F 3RNJA 1K76A 2C06A 2MI6A 4A4KA 1WNLA 2JM9A 3G4ST 3SHWA 1NPPA 4OMLA 2RO0A 1QWEA 2KK4A 3MP6A 2EVRA 3M9QA 1M1KU 2IG0A 3MEUA 4LDXA 4QT7A 2QA4Q 1F1BB 2FPDA 1D1CA 3OSSC 2RNAA 3JV3A 2KRNA 2F1LA 3CXCA 5KE3A 1YCSB 5KYWB 2HQXA 3CCMT 1D3BA 3CCLQ 1VQ8T 3NMZC 4PL6A 3QUIA 4JLGA 4MDWA 1OZ3A 4KH1B 1WQ7A 3CCSQ 2FRWA 4CC3A 3LW5E 1W2BP 1KQ1A 2PNIA 4E7ZA 4ZN3A 3H0FA 5LJ5j 2KT8A 3JB9J 2OTJA 1QCOA 1M9SA 2DILA 2EQIA 1GBRA 4E2FB 3VUBA 4C5HA 3X26B 5FU6B 2MAMA 2ATCB 4GBQA 3PIOA 2LQ8A 1MUZA 2Y4YA 2K2MA 3G6EQ 3CMEA 3OW2S 1OZ2A 1QW1A 4LDWA 4CRIA 3REBB 4HA8A 2EGAA 3AT1B 2DJQA 1HXDA 2D1XA 2VGMA 3RMSA 2MPXC 1HK9A 3D7SB 2B8AA 1BK2A 4IIMA 2K79A 4C5GA 3I5RA 3MJXA 4LE9A 1VQLA 1BKBA 1M90U 3MHXA 4PLIA 4DBQA 2O9SA 3OBYA 3QJ6A 4DEYA 2LX7A 1YIJA 2DEUA 3THKA 3ASKA 3CMET 3R6OA 2AK5A 2DTIA 1PRMC 2OI3A 5LJ5h 1YI2Q 1WXUA 1SHGA 1UHCA 2LT4A 4M77F 4E7KA 5KYWA 2H8HA 2IVWA 6AT1B 2EFIA 2MF2A 1C1AA 4ZTJA 3RDVA 4MDXA 2MCNA 1UGRB 2ECZA 4F7UE 2VASA 2DD5A 1QP2A 3QHSA 5LJ3d 1YWOA 4HT8A 2JUFA 2EQUA 2GF7A 2ROTA 4B6MA 5GAMg 2MWPA 2OAUA 1FMVA 5GAN6 1S72Q 4AFUC 3I56T 5D6YA 5LJ3j 3QIIA 2JS0A 4J9DA 3NFCA 4PFPA 4Y28E 1VQMT 2E64A 4MZPA 2X51A 2XMFA 5IXBA 4JRPA 3S3NA 1YP5A 3CMAT
chains in the Genus database with same CATH topology
1NLPC 1H8KA 2D0NA 4Z88A 2ESWA 2KROA 4D8DA 2GGRA 2KT1A 4CC7A 4RTWA 3UATA 5L23A 4JJBA 1NM7A 2JM8A 5GJWB 1Z9ZA 3SEMA 1K1ZA 1PNJA 2JW4A 1NG2A 2FPFA 2JT4A 2CT3A 5IH2A 1UFFA 3KFVA 4AFSC 2DM1A 2W0ZA 1H92A 2O9VA 3QWYA 3EG1A 1AWWA 2A28A 1ZBJA 4HVWA 1X2KA 1WYXA 1JEGA 1PHTA 1TUDA 1GFDA 2BZYA 5FWBA 1Y0MA 2J7IA 3NHNA 2HBWA 1FYNA 2ROLA 2DX1A 3ZL7C 4Z89A 2J6KA 4J9BA 4AFZC 2LJ3A 2IIMA 3EGUA 3M0RA 2A36A 2K6DA 2L2PA 4HCKA 1A0NB 4J9HA 1K4US 3VS0A 2KNBB 5I11A 2F2WA 2RQWA 2E5KA 2RQRA 4K11A 2YDLA 1GFCA 1TUCA 4RTZA 1B07A 2DL4A 3QWXX 2LZ6B 3CQTA 4OMQA 1JXOA 4KRTA 1SRMA 2RMOA 2MOXA 1MV0B 2LNHB 2HEQA 4JJCA 2NUZA 1RLPC 4Z8AA 2DF6A 3UF4A 2X3WD 2KRMA 1AWJA 3FJ5A 1H3HA 2CSIA 1AWXA 2JTEA 1HSQA 1NYFA 2ED0A 1EFNA 5IXFA 1T3LA 1WDXA 2EPDA 1AEYA 1BBZA 2AZVA 1X43A 1I0CA 1E6GA 2HSPA 1HD3A 2O88A 2DL8A 2AZSA 1M30A 2K7AA 2JMCA 1WA7A 1YNZA 1M3CA 3C0CA 2P4RA 1NYGA 2CDTA 3RBBB 4JJDA 2YSQA 1I07A 3EG2A 2VVKA 1WI7A 5IHKA 3M0SA 2C0IA 2SRCA 1VYVA 2DYBA 1XOVA 1SRLA 2K3BA 3EHRA 4ZNXA 2AKKA 3TSWA 1QCFA 2KXCA 3TVTA 1YWPA 3LH5A 5FW9A 1QKXA 1ZSGA 2V1QA 4JZ4A 1RUWA 1GCPA 2LMJA 1K0XA 1E7OA 2EYYA 2CT4A 3H0IA 1G83A 3I5SA 1UTIA 3M0UA 1HJDA 2NWMA 1MV3A 5I22A 2CH4A 1BU1A 1OOTA 1UUEA 2YT6A 1CSKA 3VS3A 2GTJA 3VS6A 2DMOA 2W10A 1AOJA 1UECA 2HDAA 4RTTA 3UA7A 1WXBA 4AG2C 2DBKA 2RPNA 2EYWA 1PKSA 2AKLA 3U23A 2EYXA 2YUOA 2I0NA 1G2BA 1ZUUA 4CC4B 1M3AA 1AZGB 3PE0A 2MIOA 4GLMA 2JMAA 1U5SA 1B3QA 1W70A 4LUEA 1RLQC 2D8HA 3VRZA 3NPFA 2EGEA 4JPBW 1WX6A 3VS7A 2JS2A 2KGTA 1VA7A 1IO6A 3EHQA 4Y92A 1JO8A 2DA9A 2QDLA 4AG1C 2KBTA 2EBPA 1RI9A 2L3PA 4ORZA 1UDLA 2JXBA 2CUDA 2DVJA 2DRMA 1WLPB 4IIOA 2DL3A 1Y57A 2KXDA 4RTVA 4J9FA 4J9GA 1GCQC 2CH4W 4X1VA 1ZX6A 1PRLC 4J9EA 4EIKA 2EYZA 2GBQA 2KRSA 1SHFA 2X3XD 1GCQA 2RQUA 4D8KA 1VYUA 1LCKA 2A08A 2LJ1A 2O2OA 1AVZC 2RF0A 1VYTA 4HXJA 1X6BA 2YUNA 2RQTA 1X69A 4OMOA 1KJWA 4F14A 1QKWA 2PTKA 2KYMA 4FSSA 2J6FA 2BZ8A 5HCKA 1NEGA 1QLYA 2M51A 1M3BA 1PWTA 1OEBA 2K9GA 1JU5C 1UG1A 2GNCA 1J3TA 3O5ZA 2KR3A 1AWOA 1UJ0A 3PVLA 1AD5A 1K0SA 2EW3A 2D8JA 2DL5A 4OMMA 4J9IA 2SEMA 3RNJA 1ABOA 1K76A 1YN8A 2C0OA 2JM9A 3EG3A 2RQVA 1OPLA 2HCKA 1ZLMA 3SHWA 1UJYA 1UE9A 2DNUA 4OMLA 1QWEA 4A63B 1WIEA 1TG0A 2LP5A 2EVRA 1X2QA 3VS1A 1W1FA 2LJ0A 3A98A 1M27C 4QT7A 2FPDA 2RNAA 3JV3A 1Z9QA 2KRNA 2B86A 3EG0A 3VS5A 3VS2A 2BZXA 1YCSB 1GL5A 1PKTA 1V1CA 2KYBA 4E6RA 3GBQA 3I9QA 2CUBA 3NMZC 4ESRA 1T0HA 4DEXA 1I1JA 1GBQA 1NLOC 2FRWA 4CC3A 2J06A 1W6XA 3M0TA 1OV3A 2A37A 2KEAA 2G6FX 2PNIA 4AFQC 2GQIA 3H0FA 1U06A 1CKAA 2KT8A 2DILA 2EQIA 2FRYA 1GBRA 1S1NA 3R6NA 1UGVA 1UHFA 2OJ2A 5IHIA 4LN2A 1U3OA 4GBQA 2ABLA 4R0KA 1K9AA 4F17A 1WFWA 4OMNA 1AZEA 2DBMA 1N5ZA 1JXMA 1MUZA 2FEIA 2PZ1A 1BB9A 2K2MA 5FWCA 2ENMA 1ARKA 3REBB 2M0YA 2EGAA 2FO0A 2DL7A 5GJVB 2DJQA 3PVQA 4RTUA 3H0HA 2FPEA 4RUGA 1NEBA 2D1XA 5EC7A 3VS4A 1GRIA 1CKBA 4RTXA 1BK2A 2RN8A 4IIMA 2K79A 3I5RA 4LE9A 2L0AA 3I35A 2O31A 2DLPA 3IQLA 3ULRB 4OMPA 1X27A 1SSHA 2EKHA 2BTTA 2O9SA 4DEYA 2LX7A 3THKA 1SEMA 3H41A 2FG0A 2OAWA 4M4ZA 2AK5A 1PRMC 2OI3A 3TSZA 2J6OA 1WXUA 4WCIA 1KFZA 3M0QA 1SHGA 1UHCA 2L3SA 2C0TA 1KSWA 2VKNA 2H8HA 4CC2A 1JQQA 4HVUA 3REAB 2YUQA 4HVVA 2MCNA 2LQNA 2CSQA 1E6HA 2GTOA 2ECZA 2F2VA 2F2XA 4F16A 1X6GA 2DRKA 4LUDA 3VRYA 4RTYA 1WXTA 2V1RA 2L3QA 2EGCA 2ED1A 1OPKA 1ABQA 1FMKA 1YWOA 2J05A 3NGPA 2ROTA 4LNPA 2VWFA 1KIKA 2LQWA 1ZUYA 1T3SA 2DE0X 1T0JA 4AFUC 3M0PA 4JZ3A 3UA6A 2CREA 2JS0A 4J9DA 2LCSA 1M8MA 2KE9A 1SPKA 5ECAA 4J9CA 2XMFA 1ZUKA 2YUPA 5IHNA 5IXBA 1YP5A 1QWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLP C;  1H8K A;  2D0N A;  4Z88 A;  2ESW A;  2KRO A;  4D8D A;  2GGR A;  2KT1 A;  4CC7 A;  4RTW A;  3UAT A;  5L23 A;  4JJB A;  1NM7 A;  2JM8 A;  5GJW B;  1Z9Z A;  3SEM A;  1K1Z A;  1PNJ A;  2JW4 A;  1NG2 A;  2FPF A;  2JT4 A;  2CT3 A;  5IH2 A;  1UFF A;  3KFV A;  4AFS C;  2DM1 A;  2W0Z A;  1H92 A;  2O9V A;  3QWY A;  3EG1 A;  1AWW A;  2A28 A;  1ZBJ A;  4HVW A;  1X2K A;  1WYX A;  1JEG A;  1PHT A;  1TUD A;  1GFD A;  2BZY A;  5FWB A;  1Y0M A;  2J7I A;  3NHN A;  2HBW A;  1FYN A;  2ROL A;  2DX1 A;  3ZL7 C;  4Z89 A;  2J6K A;  4J9B A;  4AFZ C;  2LJ3 A;  2IIM A;  3EGU A;  3M0R A;  2A36 A;  2K6D A;  2L2P A;  4HCK A;  1A0N B;  4J9H A;  1K4U S;  3VS0 A;  2KNB B;  5I11 A;  2F2W A;  2RQW A;  2E5K A;  2RQR A;  4K11 A;  2YDL A;  1GFC A;  1TUC A;  4RTZ A;  1B07 A;  2DL4 A;  3QWX X;  2LZ6 B;  3CQT A;  4OMQ A;  1JXO A;  4KRT A;  1SRM A;  2RMO A;  2MOX A;  1MV0 B;  2LNH B;  2HEQ A;  4JJC A;  2NUZ A;  1RLP C;  4Z8A A;  2DF6 A;  3UF4 A;  2X3W D;  2KRM A;  1AWJ A;  3FJ5 A;  1H3H A;  2CSI A;  1AWX A;  2JTE A;  1HSQ A;  1NYF A;  2ED0 A;  1EFN A;  5IXF A;  1T3L A;  1WDX A;  2EPD A;  1AEY A;  1BBZ A;  2AZV A;  1X43 A;  1I0C A;  1E6G A;  2HSP A;  1HD3 A;  2O88 A;  2DL8 A;  2AZS A;  1M30 A;  2K7A A;  2JMC A;  1WA7 A;  1YNZ A;  1M3C A;  3C0C A;  2P4R A;  1NYG A;  2CDT A;  3RBB B;  4JJD A;  2YSQ A;  1I07 A;  3EG2 A;  2VVK A;  1WI7 A;  5IHK A;  3M0S A;  2C0I A;  2SRC A;  1VYV A;  2DYB A;  1XOV A;  1SRL A;  2K3B A;  3EHR A;  4ZNX A;  2AKK A;  3TSW A;  1QCF A;  2KXC A;  3TVT A;  1YWP A;  3LH5 A;  5FW9 A;  1QKX A;  1ZSG A;  2V1Q A;  4JZ4 A;  1RUW A;  1GCP A;  2LMJ A;  1K0X A;  1E7O A;  2EYY A;  2CT4 A;  3H0I A;  1G83 A;  3I5S A;  1UTI A;  3M0U A;  1HJD A;  2NWM A;  1MV3 A;  5I22 A;  2CH4 A;  1BU1 A;  1OOT A;  1UUE A;  2YT6 A;  1CSK A;  3VS3 A;  2GTJ A;  3VS6 A;  2DMO A;  2W10 A;  1AOJ A;  1UEC A;  2HDA A;  4RTT A;  3UA7 A;  1WXB A;  4AG2 C;  2DBK A;  2RPN A;  2EYW A;  1PKS A;  2AKL A;  3U23 A;  2EYX A;  2YUO A;  2I0N A;  1G2B A;  1ZUU A;  4CC4 B;  1M3A A;  1AZG B;  3PE0 A;  2MIO A;  4GLM A;  2JMA A;  1U5S A;  1B3Q A;  1W70 A;  4LUE A;  1RLQ C;  2D8H A;  3VRZ A;  3NPF A;  2EGE A;  4JPB W;  1WX6 A;  3VS7 A;  2JS2 A;  2KGT A;  1VA7 A;  1IO6 A;  3EHQ A;  4Y92 A;  1JO8 A;  2DA9 A;  2QDL A;  4AG1 C;  2KBT A;  2EBP A;  1RI9 A;  2L3P A;  4ORZ A;  1UDL A;  2JXB A;  2CUD A;  2DVJ A;  2DRM A;  1WLP B;  4IIO A;  2DL3 A;  1Y57 A;  2KXD A;  4RTV A;  4J9F A;  4J9G A;  1GCQ C;  2CH4 W;  4X1V A;  1ZX6 A;  1PRL C;  4J9E A;  4EIK A;  2EYZ A;  2GBQ A;  2KRS A;  1SHF A;  2X3X D;  1GCQ A;  2RQU A;  4D8K A;  1VYU A;  1LCK A;  2A08 A;  2LJ1 A;  2O2O A;  1AVZ C;  2RF0 A;  1VYT A;  4HXJ A;  1X6B A;  2YUN A;  2RQT A;  1X69 A;  4OMO A;  1KJW A;  4F14 A;  1QKW A;  2PTK A;  2KYM A;  4FSS A;  2J6F A;  2BZ8 A;  5HCK A;  1NEG A;  1QLY A;  2M51 A;  1M3B A;  1PWT A;  1OEB A;  2K9G A;  1JU5 C;  1UG1 A;  2GNC A;  1J3T A;  3O5Z A;  2KR3 A;  1AWO A;  1UJ0 A;  3PVL A;  1AD5 A;  1K0S A;  2EW3 A;  2D8J A;  2DL5 A;  4OMM A;  4J9I A;  2SEM A;  3RNJ A;  1ABO A;  1K76 A;  1YN8 A;  2C0O A;  2JM9 A;  3EG3 A;  2RQV A;  1OPL A;  2HCK A;  1ZLM A;  3SHW A;  1UJY A;  1UE9 A;  2DNU A;  4OML A;  1QWE A;  4A63 B;  1WIE A;  1TG0 A;  2LP5 A;  2EVR A;  1X2Q A;  3VS1 A;  1W1F A;  2LJ0 A;  3A98 A;  1M27 C;  4QT7 A;  2FPD A;  2RNA A;  3JV3 A;  1Z9Q A;  2KRN A;  2B86 A;  3EG0 A;  3VS5 A;  3VS2 A;  2BZX A;  1YCS B;  1GL5 A;  1PKT A;  1V1C A;  2KYB A;  4E6R A;  3GBQ A;  3I9Q A;  2CUB A;  3NMZ C;  4ESR A;  1T0H A;  4DEX A;  1I1J A;  1GBQ A;  1NLO C;  2FRW A;  4CC3 A;  2J06 A;  1W6X A;  3M0T A;  1OV3 A;  2A37 A;  2KEA A;  2G6F X;  2PNI A;  4AFQ C;  2GQI A;  3H0F A;  1U06 A;  1CKA A;  2KT8 A;  2DIL A;  2EQI A;  2FRY A;  1GBR A;  1S1N A;  3R6N A;  1UGV A;  1UHF A;  2OJ2 A;  5IHI A;  4LN2 A;  1U3O A;  4GBQ A;  2ABL A;  4R0K A;  1K9A A;  4F17 A;  1WFW A;  4OMN A;  1AZE A;  2DBM A;  1N5Z A;  1JXM A;  1MUZ A;  2FEI A;  2PZ1 A;  1BB9 A;  2K2M A;  5FWC A;  2ENM A;  1ARK A;  3REB B;  2M0Y A;  2EGA A;  2FO0 A;  2DL7 A;  5GJV B;  2DJQ A;  3PVQ A;  4RTU A;  3H0H A;  2FPE A;  4RUG A;  1NEB A;  2D1X A;  5EC7 A;  3VS4 A;  1GRI A;  1CKB A;  4RTX A;  1BK2 A;  2RN8 A;  4IIM A;  2K79 A;  3I5R A;  4LE9 A;  2L0A A;  3I35 A;  2O31 A;  2DLP A;  3IQL A;  3ULR B;  4OMP A;  1X27 A;  1SSH A;  2EKH A;  2BTT A;  2O9S A;  4DEY A;  2LX7 A;  3THK A;  1SEM A;  3H41 A;  2FG0 A;  2OAW A;  4M4Z A;  2AK5 A;  1PRM C;  2OI3 A;  3TSZ A;  2J6O A;  1WXU A;  4WCI A;  1KFZ A;  3M0Q A;  1SHG A;  1UHC A;  2L3S A;  2C0T A;  1KSW A;  2VKN A;  2H8H A;  4CC2 A;  1JQQ A;  4HVU A;  3REA B;  2YUQ A;  4HVV A;  2MCN A;  2LQN A;  2CSQ A;  1E6H A;  2GTO A;  2ECZ A;  2F2V A;  2F2X A;  4F16 A;  1X6G A;  2DRK A;  4LUD A;  3VRY A;  4RTY A;  1WXT A;  2V1R A;  2L3Q A;  2EGC A;  2ED1 A;  1OPK A;  1ABQ A;  1FMK A;  1YWO A;  2J05 A;  3NGP A;  2ROT A;  4LNP A;  2VWF A;  1KIK A;  2LQW A;  1ZUY A;  1T3S A;  2DE0 X;  1T0J A;  4AFU C;  3M0P A;  4JZ3 A;  3UA6 A;  2CRE A;  2JS0 A;  4J9D A;  2LCS A;  1M8M A;  2KE9 A;  1SPK A;  5ECA A;  4J9C A;  2XMF A;  1ZUK A;  2YUP A;  5IHN A;  5IXB A;  1YP5 A;  1QWF A; 
#chains in the Genus database with same CATH topology
 1PC0 A;  2H3J A;  5KYY B;  2KT1 A;  1BI2 A;  1K73 U;  3UAT A;  4JJB A;  5CKF A;  1NJI C;  1WGS A;  1KK7 A;  4M78 B;  1XJW B;  4N0A C;  1K1Z A;  1HYO A;  5LJ5 f;  2OTL T;  1H92 A;  4AFS C;  1G3T A;  2W0Z A;  4C8Q D;  4EMK C;  2KAF A;  1VQL T;  4OF1 A;  1QVG S;  1ZBJ A;  3C94 A;  2CP6 A;  4M77 A;  4FW1 A;  3CC4 A;  1YJ9 A;  1D1A A;  5LJ5 d;  2M16 A;  2E10 A;  1Y0M A;  2J7I A;  3GNF B;  3ZBD A;  5GAO r;  1FYN A;  1TXQ A;  2ROL A;  4Z89 A;  4M7A F;  3TRE A;  4M75 C;  4R56 A;  2ZZD A;  3S6W A;  2A0F B;  1K4U S;  1KG1 A;  3JB9 D;  1IHV A;  3MPU B;  2F2W A;  4KBM B;  2YDL A;  4EMK B;  2QTV A;  1QMC A;  3OS2 A;  2OTJ T;  1C0M A;  2MWO A;  3CQT A;  4OMQ A;  4KGX B;  4KH0 B;  4CI0 C;  5CKB A;  4NL2 A;  5GAN g;  2MOX A;  3CC2 T;  2EJF A;  3UF4 A;  1IHW A;  4FW2 A;  2ZAE A;  1VQ8 A;  2CKK A;  4IUU A;  4M78 A;  4RCC A;  1NJI R;  4J7F A;  3F70 A;  3P8B B;  3OW2 P;  4DA4 A;  3V7R A;  5KH6 A;  1D09 B;  1HSQ A;  1NYF A;  4XTU A;  1VQN T;  4A54 A;  3KXT A;  1EFN A;  2JJ9 A;  1I5O B;  3JCM b;  2OTL A;  1QVP A;  2DIQ A;  3C4S A;  1PG5 B;  1PCX A;  5GAM d;  1V29 B;  2D0Q B;  9ATC B;  4GLK A;  1VQ9 T;  1HD3 A;  3HPW A;  2DL8 A;  3OBW A;  2XDP A;  1VQ5 A;  2JMC A;  3BY7 A;  5GAM j;  1JJ2 P;  1G3Y A;  5KYN A;  4FYV B;  4DBF A;  5GAN 7;  2QG9 B;  2RHI A;  1RAB B;  3CEY A;  1WI7 A;  2OX7 A;  5IHK A;  3M0S A;  1R0B G;  1XOV A;  1N9R A;  2DER A;  2ZPG B;  4ZNX A;  1M8V A;  2AKK A;  4KT0 E;  3CBM A;  4PJN A;  1YHQ T;  1W4S A;  5FW9 A;  5J26 A;  2V1Q A;  4JZ4 A;  1YJW T;  1OYX A;  3FLG A;  2RA2 A;  1E7O A;  2CT4 A;  3L2V A;  2HAX A;  2AT1 B;  1HJD A;  4XTW A;  1YJN A;  2QGG A;  5I22 A;  3CMA Q;  1VQK Q;  3VYH B;  2CH4 A;  3P8D A;  4C92 E;  1CSK A;  4C92 G;  3HRS A;  2GTJ A;  2W10 A;  3NTK A;  2HDA A;  2X4X A;  4RTT A;  3UA7 A;  4X9D A;  3OMC A;  4NOY A;  2PU9 B;  2COY A;  2E5Q A;  2HNI A;  3RER A;  1PKS A;  3U23 A;  2BE7 D;  3SB2 A;  5KYX B;  2HBP A;  2EYX A;  1WHG A;  2I0N A;  2P0P A;  2QA4 A;  1M3A A;  3M59 A;  3LYI A;  3NTH A;  2M1H A;  4GLM A;  4HT9 A;  1ZA2 B;  4PNO A;  1W70 A;  3HRT A;  3CD6 A;  1Q82 U;  2ZPF B;  4JPB W;  1WX6 A;  3VS7 A;  4EMG A;  1LVK A;  3OYA A;  4BI8 B;  4P5N A;  1VQ7 A;  3RUX A;  4ZGE B;  3OMG A;  4OGE A;  1KC8 R;  2JXB A;  2QTX A;  2DRM A;  4M7D A;  1WLP B;  3CCQ A;  4M7A E;  1WQW A;  1ZQ1 A;  1GCQ C;  1WHL A;  2A7Y A;  1KHC A;  1SHF A;  2RQU A;  1YI2 T;  5GMK j;  3G6E A;  2LJ1 A;  1M2V B;  1VYT A;  1U1S A;  2YUN A;  4M75 D;  2P0K A;  4BI4 A;  1U1T A;  1KJW A;  3JCM f;  1QKW A;  2E65 A;  2X9H A;  4PJO D;  2DD4 A;  3WXM B;  5GAN 4;  3GPL A;  3JB9 I;  5AT1 B;  3CCR T;  2E4H A;  3T9N A;  1J3T A;  3BW1 A;  2KR3 A;  1VQP T;  1UJ0 A;  1VIF A;  2Z0W A;  3RIR A;  2XDD A;  1N8R C;  1VQ6 T;  4X34 A;  4IKF A;  2RB6 A;  2SEM A;  1ABO A;  4C0Z A;  1EZZ B;  2NUT B;  5KCH A;  2RQV A;  4QVC A;  3SWN A;  2DNU A;  2NUT A;  4RMO A;  4A63 B;  2PQW A;  3M58 A;  1TG0 A;  2LP5 A;  1RAI B;  4PFO A;  3M55 A;  4F04 B;  5LJ3 h;  3CBO A;  3OQ5 A;  3GOX A;  1W1F A;  3A98 A;  2R57 A;  3CCJ A;  2K57 A;  3CD6 T;  1K8A U;  1Z9Q A;  2B86 A;  3EG0 A;  2P4T A;  3VS5 A;  1MND A;  4AMC A;  1IGQ A;  2RJE A;  3M5A A;  3L2Q A;  3E2U A;  1PKT A;  2EQM A;  1V1C A;  4EPC A;  2A3L A;  2ZPH B;  4FSX A;  2K5F A;  1WPY A;  3I55 T;  3CCL T;  1O9S A;  2CUB A;  1T0H A;  4IUP A;  4DEX A;  1RAA B;  3CC7 T;  1W6X A;  4LD9 K;  3M0T A;  2DTH A;  1TH7 A;  2KEA A;  2G6F X;  3Q1J A;  5CKD A;  4PJO E;  2DTO A;  1U06 A;  2VV5 A;  4XK8 E;  5IAY A;  1UGV A;  2OJ2 A;  4PLL A;  1OX9 A;  2E41 A;  2KDS A;  4OMN A;  2DBM A;  2FEI A;  2PZ1 A;  1YJW A;  1YHQ A;  4FT2 A;  1OUL A;  2E12 A;  1ARK A;  4M7A D;  3HFN A;  4OB2 B;  3H0H A;  2FPE A;  3X20 B;  2KY9 A;  3VS4 A;  1GRI A;  2DAQ A;  4RTX A;  2HMA A;  3E19 A;  2QAS A;  2COZ A;  2RN8 A;  3OS5 A;  3CC4 Q;  1Q82 C;  2CP7 A;  3IQL A;  3CCS A;  3ULR B;  4OMP A;  4E7I A;  5GAN 8;  1X27 A;  1M1K C;  1AHJ B;  1I4K 1;  3L42 A;  1YFN A;  4M78 G;  2OTJ Q;  3H41 A;  4C92 B;  3SWN C;  3EGX A;  2EJ9 A;  3QDF A;  4BI3 A;  1VQ4 T;  2RH2 A;  2HL3 A;  4M7D F;  3M0Q A;  2BE9 B;  3PMT A;  2L3S A;  1W2B A;  4CC2 A;  2XU8 A;  2XIC A;  4MML A;  5I2M A;  2JTM A;  2PUO B;  1JQQ A;  2VXE A;  5FU7 B;  2YUQ A;  4BD3 A;  3GLX A;  4KUL A;  1PSE A;  3BE3 A;  3CC2 A;  2CSQ A;  1E6H A;  2F2V A;  5KYU A;  1BCM A;  4TVR A;  4LUD A;  3VRY A;  4PJM A;  1D3B B;  2LC4 A;  2V1R A;  2YXY A;  3GF5 A;  2IPO B;  2J05 A;  4OMF B;  1IZ6 A;  3SWN B;  2VWF A;  1ZUY A;  3G7Z A;  2DE0 X;  3LLR A;  4JZ3 A;  5LJ5 g;  5I21 A;  1TUG B;  3QBY A;  2H3E B;  1M8M A;  3CC7 A;  4XTX A;  4J9C A;  1ZUK A;  3RR6 A;  2YUP A;  4V2S A;  4C8Q G;  4M78 F;  4DOW A;  4M75 F;  1QWF A;  3HL8 A;  3CPW A;  4OB0 B;  2DET A;  4Z88 A;  2Y4X A;  2GGR A;  1G5V A;  2CP0 A;  4CC7 A;  4RTW A;  3LX7 A;  4A53 A;  2KI7 A;  5GJW B;  4M77 G;  4E7S A;  4ATO A;  3CPF A;  4BDY A;  3SEM A;  3QJY A;  5GAO n;  2JT4 A;  5IH2 A;  1LPL A;  3JCM d;  1MHN A;  3OYD A;  3EGD B;  1AWW A;  3CCV Q;  4N0A A;  2A28 A;  2V26 A;  3CCU Q;  1WYX A;  2AHJ B;  1PHT A;  3SDZ A;  5CR2 A;  1GFD A;  5FWB A;  4EMK A;  3BDL A;  3CXC S;  3NHN A;  3INZ A;  2DX1 A;  1VQN Q;  3G71 Q;  3QSU A;  2LDM A;  2LJ3 A;  1YCY A;  3EGU A;  1G3W A;  2K6D A;  3VS0 A;  2M9U A;  1K73 C;  2KNB B;  5I11 A;  2JN0 A;  2E5K A;  2HKQ B;  2RQR A;  5I2S A;  3FDR A;  2LZ6 B;  4IUQ A;  4AT1 B;  5D6W A;  2JNG A;  5CIU A;  2LRQ A;  4JJC A;  2NUZ A;  4L5G A;  3G6E T;  1RLP C;  4C5I A;  2DF6 A;  3VU3 C;  2X3W D;  1AWJ A;  1H3H A;  3OYC A;  1Q86 U;  3SFM A;  2JTE A;  3VYG A;  5HK3 A;  1AEY A;  2DEQ A;  5GAN 2;  1PD0 A;  4M7A C;  4XU0 A;  3BFM A;  2CZ7 B;  4FM4 B;  1RL2 A;  2HSP A;  2L3R A;  5KCO A;  3QZ9 B;  3M57 A;  2O88 A;  5CKE A;  1K9M U;  1OU8 A;  2QQS A;  3VKI A;  2K7A A;  1IXD A;  2O4X B;  2EAY A;  1M3C A;  2P4R A;  4BE1 A;  1M1F A;  1NYG A;  3JCM h;  5CQY A;  2XHC A;  4JJD A;  2ZGW A;  1BI0 A;  2GQV A;  2VVK A;  4C0G A;  3CPW S;  2SRC A;  1G8X A;  3TCJ A;  3JCM c;  1IB8 A;  2COW A;  3OY9 A;  2E1H A;  1RAC B;  1QCF A;  2KXC A;  3TVT A;  2QA4 T;  2QYZ A;  1VQ8 Q;  1ZSG A;  1GCP A;  4QQD A;  1K0X A;  1UB4 A;  2YRD A;  5M9O A;  2VYT A;  3URG A;  1G83 A;  4FT4 A;  5FLX E;  1NJI U;  4ME7 A;  2HQH A;  1VQP Q;  2YT6 A;  4N4I A;  3VS3 A;  4BDZ A;  1Q81 R;  3DB3 A;  2I2L A;  3VS6 A;  1AOJ A;  1UEC A;  1R8O B;  1KC8 U;  1YJN T;  2RHU A;  5HK0 A;  4FU6 A;  4KUI A;  3TQ7 P;  2AKL A;  2E6N A;  2XD0 A;  3CC4 T;  4OVA A;  3MEA A;  4ZGJ B;  2K3X A;  3C95 A;  3LH0 A;  2E3I A;  2QQA A;  3SD4 A;  1AZG B;  3PE0 A;  4BY6 C;  5EG2 A;  4FCY A;  2JMA A;  4XTZ A;  1B3Q A;  1D0X A;  3CCJ T;  4LUE A;  1RLQ C;  3JCM X;  1KHI A;  1RAD B;  3A8O B;  3H6Z A;  5FU7 C;  1JO8 A;  1PD1 A;  2QDL A;  4C92 F;  4LDV A;  2X4W A;  1UGP B;  4XAX B;  4AG1 C;  4N4H A;  3JB9 H;  4XU2 A;  4RG2 A;  3HP9 A;  1VQ5 T;  1RI9 A;  2L3P A;  3CMA A;  4QVD A;  2NLU A;  4ORZ A;  5CQX A;  3VV0 A;  5GAN 5;  1VQ9 A;  1ZA1 B;  1KQ2 A;  1QVG P;  4IIO A;  4ANJ A;  1EX4 A;  5C0M A;  1Y07 A;  4J9F A;  4J9G A;  1BI1 A;  3I56 A;  3A8L B;  2JVV A;  1ZX6 A;  3CXC P;  4J9E A;  4EIK A;  2YHT A;  1XQH A;  4IUT A;  1QVF P;  4RKU E;  2GBQ A;  2KRS A;  3CCR A;  5GAM h;  1N6A A;  2M02 A;  4QQ6 A;  4D8K A;  2DXB A;  5GAO q;  2A08 A;  3L2W A;  5IT9 E;  5DLQ E;  4L6V 5;  4HXJ A;  3KBG A;  3I55 Q;  4OMO A;  4F14 A;  2HL5 C;  2XI9 A;  2QDY B;  3ZFJ A;  1M3B A;  3MP8 A;  1OEB A;  2K9G A;  1AT1 B;  1TS9 A;  1UG1 A;  3JCM Q;  2GNC A;  5GAO l;  3LGF A;  3O5Z A;  4EMH A;  1K0S A;  2FB7 A;  2D8J A;  1JBM A;  2M0O A;  4C8Q F;  1M2V A;  3CCQ T;  2C0O A;  1N8R U;  2CZ0 B;  3EG3 A;  1OPL A;  1S72 A;  1UE9 A;  1IRX A;  2DXT A;  3CBP A;  1VQ7 T;  1X2Q A;  5GAM e;  2QQB A;  4J7I A;  3VS1 A;  1XNI A;  3FB9 A;  2NYS A;  2LJ0 A;  1VQ4 Q;  4RCB A;  1VQ6 Q;  1M27 C;  1S72 T;  1JJ2 S;  3A8H B;  1EIF A;  4MZT A;  4ELY C;  3HSB A;  2YLB A;  5LJ3 e;  1N8R R;  1M90 C;  2QXF A;  3VS2 A;  1GL5 A;  1N9S A;  1QVF A;  3CPW P;  2KYB A;  2VUB A;  4E6R A;  3GBQ A;  3OYI A;  3I9Q A;  2RI5 A;  3TEE A;  4ESR A;  4M78 E;  4DQ2 A;  2MK5 A;  2J06 A;  3M56 A;  2A37 A;  2K3Y A;  2RHX A;  4AFQ C;  1OQK A;  2RI3 A;  2QEX Q;  3J7A F;  3J80 E;  2GQI A;  1ZBX A;  1YJ9 Q;  1CKA A;  4PJJ A;  1Q82 R;  1S1N A;  4FIB A;  2PVD B;  3CME Q;  1KQS S;  2ABL A;  4F17 A;  1WFW A;  3EFR A;  1N5Z A;  1JXM A;  8AT1 B;  3CCM A;  1WHK A;  1BB9 A;  3MCA B;  4WTO B;  2DPP B;  5FWC A;  2ENM A;  5A2Q E;  3MP1 A;  2M0Y A;  2BIV A;  1BI3 A;  2RHY A;  2FO0 A;  3A8M B;  5GJV B;  3EG9 B;  4QKU A;  3PVQ A;  3QXE B;  4RUG A;  1NEB A;  4XQ3 A;  5EC7 A;  5LL6 S;  2BUD A;  4C8Q B;  3EG9 A;  3CCE T;  4M77 C;  1O75 A;  2L0A A;  3JCM W;  1Y96 B;  1KQS A;  4XTY A;  1SSH A;  2EKH A;  1YIJ T;  3RKW A;  3V7S A;  3G4S A;  2O01 E;  1H64 1;  5GMK h;  1R77 A;  3OYY A;  2RI2 A;  1ZSZ B;  2ZPI B;  3HFO A;  2J6O A;  4FYX B;  4WCI A;  4LXC A;  1KFZ A;  5KYX A;  1WJS A;  5AYF A;  1KSW A;  3JAM E;  2G3R A;  1K73 R;  3JCM J;  4JLI A;  1WHM A;  3REA B;  4C92 D;  1WZO A;  3NTI A;  2LQN A;  4BUG A;  3G1J A;  2GTO A;  3JCM V;  2F2X A;  5DY9 A;  1X6G A;  4PJO C;  3LWH A;  1WXT A;  4A4H A;  2L3Q A;  2DVE A;  1M2O A;  1ABQ A;  1FMK A;  3QDR B;  2RK1 A;  2RD1 A;  2GFU A;  4C8Q A;  4LNP A;  2DKG A;  3X24 B;  1T3S A;  1T0J A;  1Y7X A;  3S3M A;  2LCS A;  2KE9 A;  5ECA A;  2XID A;  4O5V A;  4JRK A;  5IHN A;  1YJ9 T;  1MMA A;  2LX9 A;  4JJN K;  3DLL A;  5J3B A;  1H8K A;  4C0F A;  4M7A G;  3OYH A;  3JCM P;  1VQO Q;  3G71 T;  1BCO A;  4PJO B;  4D8D A;  1MGQ A;  1FX7 A;  3E9F A;  5GMK e;  3GIB A;  5L23 A;  1MNE A;  2JM8 A;  2L5Q A;  1Z9Z A;  1PNJ A;  2JW4 A;  2FPF A;  1DJ7 B;  4M77 B;  2CT3 A;  4JRI A;  1UFF A;  2LQK A;  4NL3 A;  4D6W A;  2DM1 A;  2WSE E;  2O9V A;  4PJO A;  3QWY A;  3L2Z A;  1ACM B;  3EG1 A;  1I8F A;  3CCE A;  4HVW A;  2F5T X;  2FL7 A;  1X2K A;  4J5Y A;  1QP3 A;  3PNW C;  1TUD A;  2GCX A;  2EJG A;  3JCM e;  1YBY A;  2FZK B;  1VUB A;  4C0D C;  2J6K A;  4HCB A;  4Y91 A;  3HTR A;  4N4G A;  1XTD A;  4ZGD B;  1Q81 C;  1A0N B;  3M4G A;  3OYE A;  2KQW A;  2V8K A;  2X4Y A;  3CCQ Q;  5A0G A;  2RQW A;  4BE2 A;  2EQJ A;  4K11 A;  1Q7Y U;  3WVD B;  2D9T A;  4M7D B;  1TTH B;  3QWX X;  2V8J A;  2YWW A;  1X6O A;  4PK4 A;  4KRT A;  2F69 A;  1KQS P;  5FRN A;  5CVI A;  3EFS A;  3HRU A;  2XKO C;  4BB7 A;  4VUB A;  2CP2 A;  3RKY A;  4OP0 A;  1VQL Q;  5GAN j;  5CK9 A;  3DKM A;  3FJ5 A;  4PJL A;  1AWX A;  4M7D D;  4HCC A;  3OYG A;  4X9C A;  2ED0 A;  5IXF A;  5GAN d;  5KE2 A;  2EPD A;  3PMI A;  5L8R E;  1BBZ A;  4HCZ A;  2EKO A;  2AZV A;  1NPR A;  1I0C A;  1Q81 U;  1E6G A;  5GAN f;  5C6S A;  3PTA A;  2DXU A;  2AZS A;  4QQG A;  1M30 A;  3RKX A;  3OS1 A;  1YNZ A;  3C0C A;  2DZ9 A;  3CCR Q;  4M78 C;  1P92 A;  2CDT A;  3RBB B;  1VQ5 Q;  3EG2 A;  1FMW A;  1BIB A;  2DYB A;  4Q5W A;  1SRL A;  2K3B A;  2DZC A;  1LNX A;  3JB9 G;  1YWP A;  2QGF B;  3LH5 A;  3CCJ Q;  5LJ3 f;  3N5B B;  1VQK A;  1W2B S;  1Q7Y C;  3OYB A;  1FWZ A;  2EYY A;  1PSF A;  3ZEH A;  4C0D B;  1VQO T;  1Q86 R;  3M0U A;  3JRZ A;  1MV3 A;  4C92 C;  2DK3 A;  4QW2 A;  1K9M C;  1OOT A;  2QQR A;  4J6W A;  2DMO A;  2QAZ A;  1RAF B;  1WXB A;  4AG2 C;  3CCV T;  2L89 A;  2RPN A;  2EWN A;  2KVQ G;  2EYW A;  1M1K R;  2ZCF B;  3QO3 A;  2LTO A;  2YUO A;  3OYN A;  3BDU A;  2FZG B;  1VQ4 A;  1ZUU A;  2LT1 A;  4CC4 B;  1SSF A;  2E6Z A;  2L8D A;  4C92 A;  7AT1 B;  2MIO A;  2YRV A;  5GAO m;  3X28 B;  2HSE B;  2D8H A;  3VRZ A;  2EGE A;  4Y92 A;  1IO6 A;  2PUK B;  3EHQ A;  1D0Y A;  2VXF A;  2ZPB B;  3MKD A;  1N27 A;  3KUF A;  2EBP A;  2GFA A;  4PKC C;  3OB9 A;  1UDL A;  2HD0 A;  2DVJ A;  5HKC A;  2QEX A;  1G3S A;  2DL3 A;  2KXD A;  2K2V A;  3PGG A;  4JDS A;  5A0L A;  5LJ5 e;  2X35 A;  4HKE A;  2EIF A;  4FYW B;  4PFZ A;  3OYF A;  2CP5 A;  4L59 A;  4LDY A;  2X3X D;  2V8I A;  3GNG A;  1VYU A;  1LCK A;  5DLO A;  2O2O A;  3MEW A;  1B7T A;  1D1B A;  2CP3 A;  2RF0 A;  4XU1 A;  1UGS B;  1VQM Q;  3EAE A;  2EQK A;  5HCK A;  1NEG A;  2LVM A;  2M51 A;  3L2U A;  2BKD N;  3EGD A;  4M77 E;  1JU5 C;  2HQE A;  1KD1 U;  4ZN1 A;  1AWO A;  3M4Y A;  3PVL A;  1BIA A;  1AD5 A;  2EW3 A;  4NS5 A;  1I81 A;  1M90 R;  4II1 A;  5FU6 C;  3VUZ A;  3G4S Q;  1SKU B;  4B9W A;  2JTF A;  1YN8 A;  2K4Y A;  2RJD A;  3EH2 A;  5CAI A;  1C6V X;  2QEX T;  2HCK A;  1ZLM A;  3JCM g;  3GP8 A;  1UJY A;  2NUP A;  3H9N A;  4ZTF A;  3QPH A;  1WIE A;  3PFS A;  3O8V A;  4BAC A;  1QQJ A;  4LD6 A;  3L1A A;  4FYY B;  4OB1 B;  3CCU T;  4F7U F;  3FRN A;  5D7U A;  4M7D E;  2VGN A;  3QKJ A;  2BZX A;  3QYG B;  1YJN Q;  1H3Z A;  2XG8 D;  4M78 D;  1TU0 B;  1MMG A;  2VB6 A;  2R58 A;  5GMK l;  3ER0 A;  4M75 G;  3DB4 A;  1I1J A;  1GBQ A;  1NLO C;  5KYY A;  1OV3 A;  1Y71 A;  4PJO G;  2R5M A;  1M4Z A;  1YIT A;  2LCL A;  1YIT T;  1JB0 E;  1TWB A;  2PVO B;  3QZ5 B;  4KGZ B;  4MMK A;  2LCC A;  3E1S A;  1VOM A;  2FRY A;  3R6N A;  4F7U B;  4A4G A;  1UHF A;  5IHI A;  1YI2 A;  3OYM A;  4LN2 A;  3LWI A;  3M53 A;  1U3O A;  1K8A R;  4O6J A;  4R0K A;  1K9A A;  2DJZ A;  4LDU A;  1AZE A;  4FL6 A;  3MEV A;  3TU4 K;  4BE0 A;  1VQK T;  3CD6 Q;  1RAG B;  4B9X A;  2WSF E;  1Q7Y R;  3JSC A;  3MET A;  2K5L A;  3VJP A;  3ME9 A;  4A4F A;  2DL7 A;  2P0Q A;  2RHZ A;  4RTU A;  5KYU B;  3RES A;  3M54 A;  4JS5 A;  1YHQ Q;  4DBR A;  4UC4 A;  1CKB A;  1TSF A;  3FEO A;  3V8J A;  2WAC A;  4DOV A;  1RAH B;  3I35 A;  2O31 A;  2DLP A;  2EYQ A;  2BTT A;  8ATC B;  1KD1 R;  2CZ6 B;  1SEM A;  2FG0 A;  2OAW A;  4M4Z A;  5FRM A;  2MMP A;  1I5L A;  3V7C A;  5GAN e;  3TSZ A;  4E47 A;  4OB3 B;  1OI1 A;  2F5K A;  2C0T A;  2KSS A;  1Y96 A;  2VKN A;  2MYS A;  1NZ9 A;  4HVU A;  4RG8 A;  1ZSZ A;  4A4E A;  4HVV A;  1QVF S;  5CKH A;  1NBE B;  2RM4 A;  4F16 A;  2DRK A;  4OGC A;  1SG5 A;  4RTY A;  2DXC A;  4M75 B;  3CC2 Q;  2EGC A;  2ED1 A;  1OPK A;  3CCL A;  1VIE A;  3NGP A;  2NUP B;  3UPU A;  1KIK A;  2LQW A;  5GMK m;  4M7A A;  3M0P A;  4KUD K;  3UA6 A;  3HHT B;  2CRE A;  1SF9 A;  4XU3 A;  1JRI A;  4C8Q C;  1U8R A;  1SPK A;  3C12 A;  4C8Q E;  2KMT A;  4JUV A;  2DO3 A;  1NLP C;  3QYH B;  4E7J A;  2WSC E;  2D0N A;  4PJO F;  2ESW A;  2KRO A;  5GAN h;  4R55 A;  3OW2 A;  3AHU A;  4F7U A;  2XK0 A;  1ZSZ C;  2CZ1 B;  1NM7 A;  3CCU A;  1NG2 A;  5D6X A;  1BYM A;  3KFV A;  3OYL A;  1X75 C;  4IUV A;  4JRQ A;  3OYJ A;  3HKS A;  1JEG A;  3A5Z B;  1JJ2 A;  1UEB A;  2BZY A;  5A0D A;  5IN1 A;  2OTL Q;  3CCV A;  2HBW A;  1NE8 A;  5GAO p;  3ZL7 C;  2E70 A;  4J9B A;  4AFZ C;  2IIM A;  2PVG B;  1YIJ Q;  3M0R A;  2A36 A;  3E9G A;  1FXX A;  3UT1 A;  4E7L A;  2L2P A;  1WJQ A;  1YJW Q;  4HCK A;  4J9H A;  1TOV A;  3A8G B;  1LJO A;  4M75 A;  1VQO A;  4C5E A;  4M7D G;  2FYK A;  5LJ3 g;  1GFC A;  5HY6 A;  1TUC A;  1ZHI A;  4RTZ A;  3UDC A;  1B07 A;  2RJC A;  1WHJ A;  2DL4 A;  3QG1 A;  3OA6 A;  1JXO A;  1GXI E;  1SRM A;  3OS0 A;  2RMO A;  1MV0 B;  2LNH B;  2HEQ A;  3X25 B;  2CGH A;  2X4J A;  4Z8A A;  2QQ9 A;  5GAM f;  4J8O A;  1K8A C;  2KRM A;  3CCE Q;  2K5I A;  4J6X A;  4BY6 B;  2CSI A;  3EGX B;  2CYZ B;  4GY5 A;  2DFU A;  2E3H A;  4M77 D;  1T3L A;  1WDX A;  3EFO B;  1X43 A;  5J39 A;  3J81 E;  4J6Y A;  2QI2 A;  3OSV A;  2ZPE B;  1WA7 A;  2P84 A;  3S3O A;  3RMQ A;  1OX8 A;  2YSQ A;  1I07 A;  2C0I A;  5DM7 R;  3PT9 A;  4EDU A;  1VYV A;  1Q95 G;  1M5Q 1;  2LNV A;  3EHR A;  1VQM A;  4J83 A;  1Q86 C;  1M1G A;  3TSW A;  4JS4 A;  5GAN 3;  1QVG A;  1VQ6 A;  3FJP A;  1D0Z A;  4M7A B;  1QKX A;  1RUW A;  1MMD A;  4M7D C;  1B34 B;  4WF2 A;  1VQP A;  2LMJ A;  3A1P A;  2FVU A;  1VQ7 Q;  1UGQ B;  3H0I A;  1V76 A;  3PIP A;  3I5S A;  1UTI A;  3CC7 Q;  2FZC B;  3MO8 A;  2NWM A;  1BU1 A;  5CCA A;  1UUE A;  3P8H A;  2JZ2 A;  1X01 A;  1WHH A;  4MZM A;  2O4X A;  2DBK A;  1K9M R;  1WJR A;  5CO7 A;  1IGU A;  1KC8 C;  2CS7 A;  4QVZ A;  1G2B A;  3V8L A;  2YRC A;  2RJF A;  3EFO A;  2RK2 A;  1B34 A;  1U5S A;  1OU9 A;  3CCS T;  3CCM Q;  3FIF A;  3NPF A;  1IRE B;  2JS2 A;  2KGT A;  1VA7 A;  4ELZ C;  3L2R A;  2DA9 A;  2QK0 A;  1VQN A;  3G71 A;  4F7U G;  1QCN A;  2DIG A;  2KBT A;  4M75 E;  2XDB A;  2Y90 A;  3I56 Q;  1KD1 C;  3OYK A;  2CUD A;  5GMK i;  2FHD A;  1YIT Q;  1LOJ A;  2JOY A;  4KGV B;  3UWN A;  3V8K A;  1Y57 A;  4RTV A;  2CH4 W;  3DLM A;  4X1V A;  3H8Z A;  1VQ9 Q;  2D6F A;  1PRL C;  4E7H A;  2VC8 A;  2EYZ A;  4Z02 A;  1PM3 A;  4XTV A;  1GCQ A;  2YLC A;  3LGL A;  1AVZ C;  1X6B A;  2HZY A;  2RQT A;  4IUR A;  1X69 A;  2DYI A;  2KYM A;  2PTK A;  4FSS A;  2J6F A;  2BZ8 A;  1MMN A;  1QLY A;  4YTL A;  1PWT A;  2HKN A;  2R5A A;  3FC3 A;  3I55 A;  1RAE B;  3WVE B;  4DBH A;  5FRO A;  1R0C B;  1RI0 A;  3EH1 A;  2DL5 A;  4OMM A;  2AIR B;  4J9I A;  3JB9 F;  3RNJ A;  1K76 A;  2C06 A;  2MI6 A;  4A4K A;  1WNL A;  2JM9 A;  3G4S T;  3SHW A;  1NPP A;  4OML A;  2RO0 A;  1QWE A;  2KK4 A;  3MP6 A;  2EVR A;  3M9Q A;  1M1K U;  2IG0 A;  3MEU A;  4LDX A;  4QT7 A;  2QA4 Q;  1F1B B;  2FPD A;  1D1C A;  3OSS C;  2RNA A;  3JV3 A;  2KRN A;  2F1L A;  3CXC A;  5KE3 A;  1YCS B;  5KYW B;  2HQX A;  3CCM T;  1D3B A;  3CCL Q;  1VQ8 T;  3NMZ C;  4PL6 A;  3QUI A;  4JLG A;  4MDW A;  1OZ3 A;  4KH1 B;  1WQ7 A;  3CCS Q;  2FRW A;  4CC3 A;  3LW5 E;  1W2B P;  1KQ1 A;  2PNI A;  4E7Z A;  4ZN3 A;  3H0F A;  5LJ5 j;  2KT8 A;  3JB9 J;  2OTJ A;  1QCO A;  1M9S A;  2DIL A;  2EQI A;  1GBR A;  4E2F B;  3VUB A;  4C5H A;  3X26 B;  5FU6 B;  2MAM A;  2ATC B;  4GBQ A;  3PIO A;  2LQ8 A;  1MUZ A;  2Y4Y A;  2K2M A;  3G6E Q;  3CME A;  3OW2 S;  1OZ2 A;  1QW1 A;  4LDW A;  4CRI A;  3REB B;  4HA8 A;  2EGA A;  3AT1 B;  2DJQ A;  1HXD A;  2D1X A;  2VGM A;  3RMS A;  2MPX C;  1HK9 A;  3D7S B;  2B8A A;  1BK2 A;  4IIM A;  2K79 A;  4C5G A;  3I5R A;  3MJX A;  4LE9 A;  1VQL A;  1BKB A;  1M90 U;  3MHX A;  4PLI A;  4DBQ A;  2O9S A;  3OBY A;  3QJ6 A;  4DEY A;  2LX7 A;  1YIJ A;  2DEU A;  3THK A;  3ASK A;  3CME T;  3R6O A;  2AK5 A;  2DTI A;  1PRM C;  2OI3 A;  5LJ5 h;  1YI2 Q;  1WXU A;  1SHG A;  1UHC A;  2LT4 A;  4M77 F;  4E7K A;  5KYW A;  2H8H A;  2IVW A;  6AT1 B;  2EFI A;  2MF2 A;  1C1A A;  4ZTJ A;  3RDV A;  4MDX A;  2MCN A;  1UGR B;  2ECZ A;  4F7U E;  2VAS A;  2DD5 A;  1QP2 A;  3QHS A;  5LJ3 d;  1YWO A;  4HT8 A;  2JUF A;  2EQU A;  2GF7 A;  2ROT A;  4B6M A;  5GAM g;  2MWP A;  2OAU A;  1FMV A;  5GAN 6;  1S72 Q;  4AFU C;  3I56 T;  5D6Y A;  5LJ3 j;  3QII A;  2JS0 A;  4J9D A;  3NFC A;  4PFP A;  4Y28 E;  1VQM T;  2E64 A;  4MZP A;  2X51 A;  2XMF A;  5IXB A;  4JRP A;  3S3N A;  1YP5 A;  3CMA T; 
#chains in the Genus database with same CATH homology
 1NLP C;  1H8K A;  2D0N A;  4Z88 A;  2ESW A;  2KRO A;  4D8D A;  2GGR A;  2KT1 A;  4CC7 A;  4RTW A;  3UAT A;  5L23 A;  4JJB A;  1NM7 A;  2JM8 A;  5GJW B;  1Z9Z A;  3SEM A;  1K1Z A;  1PNJ A;  2JW4 A;  1NG2 A;  2FPF A;  2JT4 A;  2CT3 A;  5IH2 A;  1UFF A;  3KFV A;  4AFS C;  2DM1 A;  2W0Z A;  1H92 A;  2O9V A;  3QWY A;  3EG1 A;  1AWW A;  2A28 A;  1ZBJ A;  4HVW A;  1X2K A;  1WYX A;  1JEG A;  1PHT A;  1TUD A;  1GFD A;  2BZY A;  5FWB A;  1Y0M A;  2J7I A;  3NHN A;  2HBW A;  1FYN A;  2ROL A;  2DX1 A;  3ZL7 C;  4Z89 A;  2J6K A;  4J9B A;  4AFZ C;  2LJ3 A;  2IIM A;  3EGU A;  3M0R A;  2A36 A;  2K6D A;  2L2P A;  4HCK A;  1A0N B;  4J9H A;  1K4U S;  3VS0 A;  2KNB B;  5I11 A;  2F2W A;  2RQW A;  2E5K A;  2RQR A;  4K11 A;  2YDL A;  1GFC A;  1TUC A;  4RTZ A;  1B07 A;  2DL4 A;  3QWX X;  2LZ6 B;  3CQT A;  4OMQ A;  1JXO A;  4KRT A;  1SRM A;  2RMO A;  2MOX A;  1MV0 B;  2LNH B;  2HEQ A;  4JJC A;  2NUZ A;  1RLP C;  4Z8A A;  2DF6 A;  3UF4 A;  2X3W D;  2KRM A;  1AWJ A;  3FJ5 A;  1H3H A;  2CSI A;  1AWX A;  2JTE A;  1HSQ A;  1NYF A;  2ED0 A;  1EFN A;  5IXF A;  1T3L A;  1WDX A;  2EPD A;  1AEY A;  1BBZ A;  2AZV A;  1X43 A;  1I0C A;  1E6G A;  2HSP A;  1HD3 A;  2O88 A;  2DL8 A;  2AZS A;  1M30 A;  2K7A A;  2JMC A;  1WA7 A;  1YNZ A;  1M3C A;  3C0C A;  2P4R A;  1NYG A;  2CDT A;  3RBB B;  4JJD A;  2YSQ A;  1I07 A;  3EG2 A;  2VVK A;  1WI7 A;  5IHK A;  3M0S A;  2C0I A;  2SRC A;  1VYV A;  2DYB A;  1XOV A;  1SRL A;  2K3B A;  3EHR A;  4ZNX A;  2AKK A;  3TSW A;  1QCF A;  2KXC A;  3TVT A;  1YWP A;  3LH5 A;  5FW9 A;  1QKX A;  1ZSG A;  2V1Q A;  4JZ4 A;  1RUW A;  1GCP A;  2LMJ A;  1K0X A;  1E7O A;  2EYY A;  2CT4 A;  3H0I A;  1G83 A;  3I5S A;  1UTI A;  3M0U A;  1HJD A;  2NWM A;  1MV3 A;  5I22 A;  2CH4 A;  1BU1 A;  1OOT A;  1UUE A;  2YT6 A;  1CSK A;  3VS3 A;  2GTJ A;  3VS6 A;  2DMO A;  2W10 A;  1AOJ A;  1UEC A;  2HDA A;  4RTT A;  3UA7 A;  1WXB A;  4AG2 C;  2DBK A;  2RPN A;  2EYW A;  1PKS A;  2AKL A;  3U23 A;  2EYX A;  2YUO A;  2I0N A;  1G2B A;  1ZUU A;  4CC4 B;  1M3A A;  1AZG B;  3PE0 A;  2MIO A;  4GLM A;  2JMA A;  1U5S A;  1B3Q A;  1W70 A;  4LUE A;  1RLQ C;  2D8H A;  3VRZ A;  3NPF A;  2EGE A;  4JPB W;  1WX6 A;  3VS7 A;  2JS2 A;  2KGT A;  1VA7 A;  1IO6 A;  3EHQ A;  4Y92 A;  1JO8 A;  2DA9 A;  2QDL A;  4AG1 C;  2KBT A;  2EBP A;  1RI9 A;  2L3P A;  4ORZ A;  1UDL A;  2JXB A;  2CUD A;  2DVJ A;  2DRM A;  1WLP B;  4IIO A;  2DL3 A;  1Y57 A;  2KXD A;  4RTV A;  4J9F A;  4J9G A;  1GCQ C;  2CH4 W;  4X1V A;  1ZX6 A;  1PRL C;  4J9E A;  4EIK A;  2EYZ A;  2GBQ A;  2KRS A;  1SHF A;  2X3X D;  1GCQ A;  2RQU A;  4D8K A;  1VYU A;  1LCK A;  2A08 A;  2LJ1 A;  2O2O A;  1AVZ C;  2RF0 A;  1VYT A;  4HXJ A;  1X6B A;  2YUN A;  2RQT A;  1X69 A;  4OMO A;  1KJW A;  4F14 A;  1QKW A;  2PTK A;  2KYM A;  4FSS A;  2J6F A;  2BZ8 A;  5HCK A;  1NEG A;  1QLY A;  2M51 A;  1M3B A;  1PWT A;  1OEB A;  2K9G A;  1JU5 C;  1UG1 A;  2GNC A;  1J3T A;  3O5Z A;  2KR3 A;  1AWO A;  1UJ0 A;  3PVL A;  1AD5 A;  1K0S A;  2EW3 A;  2D8J A;  2DL5 A;  4OMM A;  4J9I A;  2SEM A;  3RNJ A;  1ABO A;  1K76 A;  1YN8 A;  2C0O A;  2JM9 A;  3EG3 A;  2RQV A;  1OPL A;  2HCK A;  1ZLM A;  3SHW A;  1UJY A;  1UE9 A;  2DNU A;  4OML A;  1QWE A;  4A63 B;  1WIE A;  1TG0 A;  2LP5 A;  2EVR A;  1X2Q A;  3VS1 A;  1W1F A;  2LJ0 A;  3A98 A;  1M27 C;  4QT7 A;  2FPD A;  2RNA A;  3JV3 A;  1Z9Q A;  2KRN A;  2B86 A;  3EG0 A;  3VS5 A;  3VS2 A;  2BZX A;  1YCS B;  1GL5 A;  1PKT A;  1V1C A;  2KYB A;  4E6R A;  3GBQ A;  3I9Q A;  2CUB A;  3NMZ C;  4ESR A;  1T0H A;  4DEX A;  1I1J A;  1GBQ A;  1NLO C;  2FRW A;  4CC3 A;  2J06 A;  1W6X A;  3M0T A;  1OV3 A;  2A37 A;  2KEA A;  2G6F X;  2PNI A;  4AFQ C;  2GQI A;  3H0F A;  1U06 A;  1CKA A;  2KT8 A;  2DIL A;  2EQI A;  2FRY A;  1GBR A;  1S1N A;  3R6N A;  1UGV A;  1UHF A;  2OJ2 A;  5IHI A;  4LN2 A;  1U3O A;  4GBQ A;  2ABL A;  4R0K A;  1K9A A;  4F17 A;  1WFW A;  4OMN A;  1AZE A;  2DBM A;  1N5Z A;  1JXM A;  1MUZ A;  2FEI A;  2PZ1 A;  1BB9 A;  2K2M A;  5FWC A;  2ENM A;  1ARK A;  3REB B;  2M0Y A;  2EGA A;  2FO0 A;  2DL7 A;  5GJV B;  2DJQ A;  3PVQ A;  4RTU A;  3H0H A;  2FPE A;  4RUG A;  1NEB A;  2D1X A;  5EC7 A;  3VS4 A;  1GRI A;  1CKB A;  4RTX A;  1BK2 A;  2RN8 A;  4IIM A;  2K79 A;  3I5R A;  4LE9 A;  2L0A A;  3I35 A;  2O31 A;  2DLP A;  3IQL A;  3ULR B;  4OMP A;  1X27 A;  1SSH A;  2EKH A;  2BTT A;  2O9S A;  4DEY A;  2LX7 A;  3THK A;  1SEM A;  3H41 A;  2FG0 A;  2OAW A;  4M4Z A;  2AK5 A;  1PRM C;  2OI3 A;  3TSZ A;  2J6O A;  1WXU A;  4WCI A;  1KFZ A;  3M0Q A;  1SHG A;  1UHC A;  2L3S A;  2C0T A;  1KSW A;  2VKN A;  2H8H A;  4CC2 A;  1JQQ A;  4HVU A;  3REA B;  2YUQ A;  4HVV A;  2MCN A;  2LQN A;  2CSQ A;  1E6H A;  2GTO A;  2ECZ A;  2F2V A;  2F2X A;  4F16 A;  1X6G A;  2DRK A;  4LUD A;  3VRY A;  4RTY A;  1WXT A;  2V1R A;  2L3Q A;  2EGC A;  2ED1 A;  1OPK A;  1ABQ A;  1FMK A;  1YWO A;  2J05 A;  3NGP A;  2ROT A;  4LNP A;  2VWF A;  1KIK A;  2LQW A;  1ZUY A;  1T3S A;  2DE0 X;  1T0J A;  4AFU C;  3M0P A;  4JZ3 A;  3UA6 A;  2CRE A;  2JS0 A;  4J9D A;  2LCS A;  1M8M A;  2KE9 A;  1SPK A;  5ECA A;  4J9C A;  2XMF A;  1ZUK A;  2YUP A;  5IHN A;  5IXB A;  1YP5 A;  1QWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...