2K7LA

Nmr structure of a complex formed by the c-terminal domain of human rap74 and a phosphorylated peptide from the central domain of the fcp1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords centFCP1-T584PO4 peptide
publication title NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2008-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k7lA00
2ZBKA 4EQQA 2D1HA 5H6RA 3HSEA 5CVRA 3D0SA 2P6SA 4G6DA 2EA4A 3ECHA 1ZYRF 3JAMK 1ZG5A 2VN2A 5J8FA 3FX3A 2STWA 3MCZA 2ZJ2A 1SFUA 3SHFA 3W6KB 3IRRA 2K4BA 3P9KA 1R5HA 2C6YA 2OQRA 2IT0A 2UXXA 3K0LA 1HW1A 5DCFA 1U2WA 2QENA 3I71A 1REPC 2CO5A 1T0FA 1K79A 5IT9K 1P92A 1YW8A 4P9FA 2OD5A 3F8BA 4HV5A 3Q9SA 1UHMA 1QBJA 3IRQA 4AIHA 3E5XA 1IRFA 4GO1A 1IAWA 2P4WA 3HTUA 4EM1A 1USSA 2DFIA 2W84A 3JTGA 1JHHA 4N9HA 1SD4A 4GYIA 1O7LA 1HQCA 3J81Z 3HRUA 2IJLA 4KYWA 2HKXA 2EFWA 5FB2A 3O6BB 3T8RA 3N97A 2VOOA 1RNLA 4LMYA 2L01A 1IN6A 4MGRA 2O3FA 3F8FA 3AAFA 3P7NA 5TRDA 3WTZA 5HDNA 3GEZA 3EQLF 3E6MA 1Z7UA 5D6FA 1QZZA 3CO6C 4IF4A 2PQ8A 4XLNF 1XN7A 1LDDA 3EETA 1MD0A 2HTSA 2DAOA 2HYGD 4KN4X 2GZWA 2K4JA 2MC3A 2VBYA 1PUEE 3E97A 4A0ZA 1BJAA 2VBWA 1XDUA 1HKTA 4EJUA 5AIQA 5F6FA 1NHAA 4P55A 3BY6A 1YFHA 2A6EF 3WTVC 4FX4A 3U2RA 2NYXA 5LLQA 2MLGA 1U8RA 3M9AA 1D8JA 2LF8A 3U9GA 4A6EA 1QQIA 5DD8A 4I09A 3PQJA 3DP7A 4LJZF 1XGMA 3K9TA 4TV7A 1ZHFA 1K78A 3KZZA 1IW7F 4I02A 1B9NA 3ZPLA 1JGSA 1BC7C 4HDVA 3GYHX 3FF5A 4PGHA 3DEUA 2CWEA 2PI0A 4DNCA 3VB2A 4EMSA 2LNBA 3KLOA 2IPQX 4L9NA 4CICA 3CUQC 1ZARA 1QO0D 1IN8A 4G9YA 5TJJA 1U5TA 2XAHA 3GVAA 4G7HF 4ON0A 4BXUA 3WGHA 1G3SA 4EJTA 3QU6A 2PEXA 3DXJF 1G6NA 4ZH4F 4XRFA 4WXCA 3HRSA 4YG2F 1PP8F 3MZYA 4EJWA 2CQKA 4U88A 2EB7A 5L3BA 5FD6A 6PAXA 2RGVA 5JHUA 4LG0A 3LAPA 4AIKA 5D8LB 3ZQ7A 1J5YA 1ZLKA 2MBFA 3GF2A 2FEZA 2BBYA 2YPRA 4L5IA 3WU1B 1HW5A 2IP2A 2ZCWA 1G3TA 5FD5A 2XUBA 1R7JA 4KIBA 1B1BA 2Z5UA 1T98A 3T8TA 4L9VA 1ZAOA 2ESNA 4I2OA 2XV4S 4M9SA 3L7WA 1DP7P 3EYIA 3T0YA 1XSVA 3ELKA 1U78A 2HS5A 5DDGA 5DEQA 3HRMA 1RZ4A 3FHZA 1E17A 2RC4A 2XAGA 2R7DA 1WQ2A 2ZXJA 1XGNA 2ETHA 2QWWA 2YX7A 4O6JA 3F8CA 1FZPB 4EVIA 3CUQA 1DDNA 5AONA 2VC0A 4M9XA 4ENMA 1X3UA 3RKXA 3G3ZA 5FFXA 2YX4A 5D8KB 5BPDA 3QP5A 1YIOA 3R0AA 4RAZA 3CO7C 1F4KA 3M7GA 2XGXA 2QQBA 3HHGA 2KJCA 4LFUA 5H6QA 3KP7A 2QQAA 5DYMA 4A0XA 5LRRA 2L54A 4LLGF 1HXDA 3KEOA 4IJAA 1ODDA 2QYOA 1KU9A 4ESJA 2VXZA 4QLCU 1W5SA 3K1PA 3ERED 3SFZA 4WX9A 1FY7A 3KP5A 2G7HA 2KIMA 4HX7A 3KCCA 5HDGA 1XDSA 3WTUC 2QM3A 4LB6B 3ZMTA 2JZYA 4CYDA 4EV0A 3N4MA 2DO7A 4BQAA 4E70A 2V79A 4LK1F 1YYVA 2FBIA 3OV8A 2VONA 4ENJA 2UXNA 1IUYA 4AVPA 2W25A 3E5QA 4FHTA 1R5GA 5HS7A 3LAJA 4R8HA 3C1DA 3E6BA 1XGOA 3J80Z 1O3RA 3F3XA 4GGGA 3GW2A 1K78B 2JT1A 1K6OA 4F7ZA 2L4MA 5BPIA 4PGGA 1CF7A 2ZNZA 3HSRA 1XB4A 3ZP5A 2XHKA 3Q5FA 3TO9A 1H0MA 2ESHA 3V7RA 4AD9A 5LBQA 2M30A 1GHCA 1D5VA 4OINF 5EEHA 1MZBA 4LK0F 2GWRA 1U5TB 1G3YA 1SMYF 1I6XA 2WC2A 3C7JA 2HDCA 3BPXA 1HW2A 3V8KA 1OMIA 2WTEA 3CDHA 1IZ1A 4G7ZF 4IHSA 5E17F 2TDXA 1HKSA 2VT3A 1J0RA 5HLGA 5IT9Z 2HQNA 3O2PE 4LLNA 2ACJA 3NRVA 5FO5A 4A2UA 4LG0B 3FXRA 4A12A 3QP6A 4ZYEA 3FXUA 1IF1A 4KICA 4KMFA 4BYYA 4CZZA 1BI0A 5CJ9A 2BV6A 1R23A 1TQPA 2P5LC 4ENNA 2RNJA 3MWMA 4CDGA 2MH2A 1W7PA 1SFXA 2IRFG 3J80K 2CW0F 2VE8A 4XBFA 2ZMEA 1TBXA 3HIFA 3FM3A 1W5TA 1KQ0A 2H6CA 1C0WA 1XMAA 5K5RA 4JQFA 1FC3A 2IA0A 4KN7X 2VODA 1OYYA 2RQPA 3CUQB 4IVNA 1R1TA 1O3QA 1MDMA 5FFZA 2RDPA 1S7AA 1LDKB 5CVIA 1IXSB 4FT8A 5DCMA 1DUXC 1ZH5A 1R58A 3ZN0A 1Z1DA 3H92A 1O3SA 3R6SA 1S6LA 3ISPA 2KIFA 4UV8A 4RGUA 5J6XA 3WE3A 4BNCA 5FLXK 5CLSA 1FYLA 1MKMA 2DTRA 3BJOA 2Y0MA 2FSWA 2Q8KA 2K27A 1WKMA 2VBXA 2EFOA 3V7SA 3LA7A 1ON2A 4HF0A 2DBBA 2J5PA 2D1VA 3L00A 1AOYA 4FX0A 1W4MA 2JRTA 4Y13A 2GAUA 3TO7A 1BI1A 5HS8A 1J9IA 5KK1A 2DK5A 3F6OA 1FBUA 1I1SA 5DUIA 1R1VA 4Q5SF 4ZYDA 2XIGA 3K69A 2ZFWA 3HSFA 2RN7A 1OPCA 5ICEA 2Z9OA 4EGYA 3VODA 3WGGA 2W24A 5K5OA 3LQRA 4WXDA 3BDDA 1QGPA 3F72A 2PLYA 2F5CA 1MJ9A 3ABTA 5LHGA 4EGZA 1Y0UA 2A5YB 2EFQA 4Z2YA 1HBXG 4S05A 1KU7A 3WTTC 2CFXA 2FE3A 2H6BA 2OBPA 3IC7A 4AIJA 2BE5F 1T39A 1GXPA 1HKQA 2XAQA 3KETA 1KGSA 3F6VA 2X0LA 1BIBA 4UNOA 2HWVA 1CF7B 4UXNA 4L0ZB 1MJAA 3RTRA 2FU4A 2NS0A 4M73A 2FA5A 4IHTA 3ZMUA 3ZN1A 3REOA 1WSUA 1USTA 1H9TA 4KIGA 3NQOA 3IKTA 2F5FA 4BHPA 1LJ9A 4KT5C 4HQMA 1OKRA 4A6DA 3E6CC 2XKOA 3QOPA 5E1XA 4L0YB 2ISYA 2H94A 2Y75A 5D5UB 1FSEA 2O03A 4MEXF 3Q9VA 4OIRF 1TTYA 3H3ZA 3ZMVA 3K1NA 3FWEA 5LGNA 3L2CA 2V1DA 1P2FA 1OYIA 3IHUA 2A69F 2OAZA 2XVCA 5JFRA 1W7PB 1TW2A 1QPMA 2FF4A 4KIFA 3K2ZA 2ZMEB 5HS9A 1Z05A 2AS5F 5KVRA 4HV6A 3FMQA 2V6CA 1EH6A 3I53A 2PJPA 1I5ZA 3QU3A 3WE2A 4OIPF 5ILUA 4MHGA 1BM9A 3QRFF 4OMYA 2EJRA 3PQKA 4A5NA 2JPCA 5D4RA 3U1DA 1XCBA 4UUVA 1MDMB 1LNWA 4JBAA 2R3SA 3RI4A 4MTDA 1S7OA 5DCMB 4UVAA 2HR3A 4G6QA 2XROA 4HX8A 2FOKA 1BI3A 3RPUA 5CVJA 4HDUA 5DV5A 3JTHA 3LFKA 2O61A 2OZ6A 3CJNA 3L9FA 3GZ6A 1G3WA 3DKWA 1LDJA 2V1XA 1QZYA 3IKVA 2M45A 3GX4X 3C18A 3KE2A 2O6GE 1YW9A 4RAYA 4P9UA 2KRFA 3R60A 4RB2C 4PCQA 2DQRA 4IXAA 5LEKA 3GFMA 2EFNA 1L0OC 4HBLA 5E18F 1EH8A 2QVOA 1RUNA 1Q1HA 4GXOA 1R36A 4MQ9F 1MJBA 2OZUA 4L5JA 1A04A 2WWYA 3J7AO 4L9TA 2Q0OA 2OU2A 2A07F 4KDPA 1ZGAA 4H0EA 5ILSA 1ZG3A 2QBYA 2IW5A 1EV7A 3QPHA 2VT2A 3F22A 1BN5A 1O7FA 3L09A 2D45A 2YSRA 1GXQA 5D5XB 1JXSA 4CHUA 2G9WA 1Z91A 4M6XA 1TQIA 3GFLA 1RUOA 2OA4A 1VTNC 3ML6A 1WWXA 1I1GA 5K1YA 1FX7A 1ZG1A 1YQAA 3DPTA 3KEQA 3G73A 1QNTA 2V9VA 3KP3A 4KUMA 4KFCA 3LQQA 4M74A 5E8GA 2W85A 3M1EA 1B4AA 2PMUA 3SXYA 3MAJA 4EM0B 1J7KA 5E1WA 4YIIA 5DUKA 4I0AA 4LLLA 4IRIA 1FP2A 2R7FA 4U7BA 4Q47A 3JSOA 1ZN2A 1UHWA 2PMHA 2P6TA 3M8EA 2A3SA 1ONVA 3BOQA 1FBQA 4P5OA 3TKYA 1E2XA 4M71A 3ZMZA 3GFIA 1Z9CA 2EV5A 2CG4A 1U3EM 1ZGJA 3WG9A 4UHTA 3TO6A 2FQ3A 3RDIA 2L02A 4HOBA 3RYRA 3ECOA 3JW4A 2GA1A 4G7OF 1G4DA 5A2QK 2MD5A 3RYPA 3LSTA 5BQTA 1J75A 1KU2A 4Q4ZF 1EH7A 3LWFA 4GCVA 1FYKA 1ZRCA 4HA8A 3WGIA 5ICCA 2BEOA 3I58A 4HZFA 5FLXZ 1P6RA 3BROA 1T6SA 4IRGA 2CGPA 1YO5C 3R4KA 2M87A 3M8FA 3MFKA 2LDUA 4YFXF 4IPAA 3E6DA 1FYMA 1ULYA 2NNYA 1SFEA 1Z6TA 3C3WA 2HTJA 2XASA 4I01A 4Q48A 5HOOA 3HHHA 1FSHA 5DD4A 2M8EA 4RGSA 5CVUA 2HYFA 4CGZA 3T5XA 1D8KA 1YG2A 3OOPA 1IXRC 2HFHA 1KQ8A 1F1ZA 4R1HA 2FNAA 2M5WA 3NEUA 1T38A 4MNUA 3S2WA 2L3DA 2XKPA 1IN5A 4KMUX 5CVVA 3ZMSA 2EV6A 5ED4A 3F8NA 3MZHA 4L18B 4RGXA 4B8XA 5LRSA 3TDUC 4XSXF 4EJVA 3H3UA 2CYYA 5JR3A 2M1BA 2UWMA 5HLHA 3DQVC 1FT9A 4L9JA 1UB9A 4I0BA 1U6GA 1R00A 3BZ6A 3MQ0A 2FNPA 3SZTA 4EJOA 4OMZA 4B09A 4MTEA 3TOBA 2GIVA 3I0TA 3BP8A 1PDNC 1HSJA 2O0YA 1BC8C 2ZO4A 2A68F 3D5LA 3HOTA 1TNSA 2FXAA 1BOAA 4RGRA 3TDZC 2KIUA 2P5VA 4PZJA 3RJPA 3MEXA 4P96A 4JK1X 3IL2A 2RVCA 1B6AA 3V7CA 2JTVA 3GO5A 4HQEA 4O3MA 3GZ5A 1WRJA 3BPVA 4MEYF 1L3LA 2QBYB 1KU3A 2STTA 2PN6A 2YR2A 3P9IA 3W6JB 1P4XA 2HOEA 3BJ6A 3DFGA 1FNNA 5HVQC 1TLHB 1R22A 2GQQA 1SD6A 4YFKF 1FWZA 1ZREA 2GXGA 2GA2A 2P5KA 3I54A 3CUOA 2RV8A 2CSOA 2Z99A 3F21A 2V1UA 2HKOA 2PBIA 5AIPA 5L3FA 1KA8A 4OIOF 2ZKZA 1DPRA 2F2EA 5BMZA 4WK8F 2OQGA 2DPDA 4ZYGA 1U5TC 3I5UA 2D2WA 3O3KA 1XMKA 2ELHA 2VBZA 3E3VA 3GUDA 4RS8A 1TQMA 1LVAA 4YIFA 4UVBA 4YFNF 2P7CB 3WODF 2ZNYA 3V8LA 5F1RA 5L3EA 1O57A 5ICFA 3SZPA 2DQLA 2NNNA 4XLPF 1SD7A 3WTSC 2HEOA 4HYEA 5ICGA 3TGNA 4NB5A 5F64A 1SAXA 3I59A 3ROUA 3KP4A 4XSZF 3V4GA 4PDKA 3RKYA 1O3TA 3COAC 1ZLJA 2EK5A 3DPLC 3E5UA 2DW4A 1SD5A 1BIAA 2DLLA 4ETSA 5LGUA 5CYVA 3HUGA 4U0WA 3RIRA 3J81K 4D0PA 4Y15A 3VEPA 1ZRDA 3LA3A 3FXQA 1UCRA 1IRGA 2DI3A 2H09A 2E7WA 1XD7A 4WF2A 1T2KA 1XSXA 4LGWA 5IT3A 3KP2A 4HX4A 1JE8A 5BOXA 4U0YA 2NRAC 2VC1A 4M6YA 3V8JA 4ASNA 4GYGA 3K1MA 1TW3A 2FMYA 2A6HF 3GWZA 3KLNA 5L3GA 3F8MA 2PFBA 1HSTA 1TNTA 5FGMA 4S04A 4RB0A 1JHFA 2FBHA 5JVTA 4ZZLA 4RB3C 1F9NA 1LQ1A 1IN4A 3R61A 3ABUA 3HOSA 4MQVA 4BH9A 2E1NA 3B02A 1FOKA 3DF8A 3VOEA 1KYZA 2DU9A 1LB2A 5L3DA 2W57A 2HQRA 5JI6A 2UZKA 4HF2A 5EEGA 1FPQA 1RIOH 1K7AA 3LA2A 5D6EA 3WTXC 2P8TA 2PG4A 3GXOA 2L4AA 3DV8A 2XRNA 3WTWC 1F5TA 2IA1A 5ERIA 4R79A 2EWNA 2MA3A 4I98B 5LGTA 3SQNA 1V4RA 1S8NA 3BWGA 2IVMA 3HTSB 2K86A 2YU3A 4M72A 4ZZDA 3RKWA 1YS7A 4K2EA 4WXHA 1J2XA 1S29A 1Z6RA 3WTYC 2ADUA 4HLXA 3QAHA 4A0YA 5L3CA 5D4SA 4WCGA 2XAFA 2F5DA 4DQ2A 4HLYA 4UV9A 1OR7A 1YLFA 3P9CA 1H9GA 5HDKA 2KKOA 3FZVA 3KZYA 2ISZA 1UFMA 3TOAA 2EA2A 1BI2A 2HGCA 1KQ9A 4LB5A 1CGPA 3IWFA 5LHHA 5A2QZ 2AXLA 2COMA 1OYWA 2FMLA 4HAMA 4OIQF 1P4WA 1B59A 4OOIA 3KFWX 1P4AA 4M9ZA 3CLOA 4Y17A 3ZMDA 2VOPA 2E1CA 2IA2A 4ZYHA 2QUFA 3KP6A 1IXCA 1WI9A 1STZA 2XAJA 4KNYA 4BHBA 3F23A 4ENKA 1SMTA 4QWQA 1XGSA 2Z3YA 3BJAA 2LKPA 2A61A 1LEAA 5E1ZB 1ZRFA 2G7UA 4AWXB 1DPUA 3IWZA 4O5VA 1R1UA 5HLIA 1KYWA 4BHCA 2Y48A 2P7VB 3VFZA 4CO8A 3TQNA 2DK8A 1YW7A 3FMRA 3I59B 2GXBA 5H20A 3FM5A 4N9IA 4ESFA 5J8CA 2NAZA 5LHIA 3I4PA 5ILVA 1RI7A 1FBSA 2EV0A 1MGTA 5E8IA 4EM2A 4U7DA 3HYIA 1D3YA 1AWCA 4UVCA 3GFJA 4A5MA 4G94A 4I7HA 5D5WB 1B9MA 2JPBA 3T1BA 1LEBA 1FP1D 3R0JA 1YS6A 2WV0A 4HF1A 2KJBA 5E20A 2B0LA 2FBKA 3FMSA 2VE9A 4HW0A 3HRTA 4CXFA 5LEJA 5K5QA 4KA4A 3JAMZ 3I64A 2DT5A 4G8XA 2QLZA 4BAYA 2BGCA 3JSPA 1ON1A 2HZTA 1XSDA 1IN7A 3QPTA 4NQWA 4NHJA 2FRHA 4LD5A 4IRHA 1BBYA 2Q2EA 2QZ8A 2MH9A 2RKHA 1I27A 3ULQB 1V3FA 2F5EA 1J59A 2E7XA 1XCVA 3EUHA 2BYVE 5D5VB 4U0VA 3EYYA 2LSOA 2EFPA 3RPQA 1W7PD 4ESBA 3B73A 2H27A 2K7LA 3CTAA 1S3JA 2LF7A 3PFIA 2DPUA 2MLKA 2K02A 2JSCA 3GLXA 2J5OA 1PP7U 3WU0A 4WWCA 2X4HA 4RB1A 2QQ9A 1YTYA 1GVJA 4OU0A 3EDPA 1FLIA 4N0BA 2O8XA 2Z33A 5BS6A
chains in the Genus database with same CATH superfamily
2IXSA 4BUPA 4LG3A 2ZBKA 2M4KA 4EQQA 2D1HA 5H6RA 3HSEA 2KL4A 1VQMI 5CVRA 4XRMA 2X6YA 2YUSA 3GCMA 3D0SA 1XPXA 2P6SA 1BR2A 4G6DA 2EA4A 3ECHA 1ZYRF 2L7KA 3BTCA 4PFOA 3K4NA 1YITI 3JAMK 2BY0A 1P7JA 1ZG5A 2IBDA 2HZDA 4DYCA 2VN2A 1RPWA 5J8FA 3FX3A 3D1NI 2STWA 3MCZA 2ECCA 2ZJ2A 1SFUA 3RZDJ 3SHFA 3W6KB 3IRRA 2K4BA 3A01A 4KITB 3P9KA 1R5HA 3BQZA 2OQRA 5GAHJ 1PUFA 2C6YA 2IT0A 2IS4A 2HVQA 2UXXA 3PFYA 3K0LA 4BS9A 1VQOI 3TMOA 1QA6A 9ANTA 1HW1A 3M1CA 3IAS2 5DCFA 1U2WA 2QENA 2E2JJ 4XONA 3I71A 1REPC 2CO5A 3MKZA 2B63J 1T0FA 1K79A 5IT9K 1OCRH 3HXLA 1P92A 1YW8A 4P9FA 1F36A 3H9JA 5K7FA 2QKLB 2OD5A 4E7LA 3F8BA 1P9QC 4HV5A 3Q9SA 1UHMA 1QHGA 4D1QA 3BG6A 4BE1A 1QBJA 3IRQA 2MGQA 4A3FJ 2WAQA 4AIHA 3E5XA 1IRFA 4GO1A 1IAWA 3AL0B 2P4WA 3HTUA 4B47A 4NDLA 4EM1A 1OCZH 2K9LA 1UHSA 3HOXJ 1USSA 2DFIA 2W84A 1VQ4I 3DEWA 3JTGA 1JHHA 4N9HA 1SD4A 4GYIA 5EEAA 2E2IJ 1WJBA 3IV5A 2L0KA 1O7LA 1HQCA 2IAIA 3J81Z 3HRUA 5J4YA 2IJLA 1BL0A 4KYWA 2HKXA 2EFWA 1D0XA 5FB2A 3ZR8X 3O6BB 4W97A 3T8RA 1PYVA 3N97A 2LH9A 2VOOA 1RNLA 4LMYA 1FJLA 3BG9A 2I8DA 3I9V2 2L01A 4A3BJ 1IN6A 4MGRA 1RRJA 2O3FA 3F8FA 1ZQ3P 2VJ4A 3AAFA 3CP2A 3PM1A 3P7NA 5TRDA 5TGTA 3WTZA 4CCOA 4F52A 5HDNA 3CCVI 2FQ4A 3GEZA 3EQLF 3E6MA 2NVYJ 2ELKA 1Z7UA 2XGCA 5D6FA 1QZZA 3NWSA 5HNFA 3CJRB 2R7OA 4CCMA 4A3GJ 2OTJI 1D1BA 3CO6C 4IF4A 4A3EJ 2PQ8A 4FISA 4NNJA 2MFZA 4S0HB 3GMEA 1U8BA 3PJRA 3OYMA 4XLNF 2M8GX 2WADA 1XN7A 3ESWB 1AKHA 3DTIA 1LDDA 4BGDA 1JKRC 1NG6A 4C2UA 3VPRA 4XK4A 3EETA 1MD0A 2OTLI 2HTSA 2DAOA 2HYGD 4KN4X 3C2BA 3M8JA 2GZWA 2K4JA 2MC3A 4D5CA 2VBYA 3BG7A 4XL9A 1PUEE 3E97A 4A0ZA 1BJAA 4RBOA 2VBWA 4Y52J 2QCOA 2DA7A 3PO3J 1XDUA 1HKTA 2WAFA 4EJUA 3CQZJ 5AIQA 5F6FA 3UR3C 1NHAA 4P55A 3BY6A 1YFHA 2A6EF 3U1KA 2JUCA 3WTVC 4FX4A 3ZQLA 3U2RA 2NYXA 3K4JA 5LLQA 2MC4A 2MLGA 1U8RA 2R7ZJ 2ME0A 2K3PA 3UNGC 2DTZA 4AM3A 3M9AA 1D8JA 2LF8A 1IRZA 2LK2A 3BZCA 3U9GA 1WJCA 2VUMJ 4A6EA 1X58A 1Y8QB 1X3WB 1QQIA 1QZEA 5DD8A 4I09A 1T08B 3PQJA 1K6YA 1V5FA 4NQWB 3DP7A 1ITYA 4LJZF 1VQPI 1XGMA 3K9TA 5J1YA 4TV7A 1ZHFA 2Q2EB 3LSKA 5F0FA 1FTZA 2VI6A 1K78A 3KZZA 1IW7F 4I02A 4N4NB 1B9NA 1U9NA 3ZPLA 1JGSA 1BC7C 2NS7A 4DOZA 4HDVA 1APLC 4XMYA 3H36A 1MMGA 3GYHX 2E1MC 1DU6A 3FF5A 4PGHA 3DEUA 3G1MA 4ZTJA 2CWEA 2PI0A 1E3HA 2XAUA 4DNCA 1K4SA 4M3EA 1TC3C 4A3KJ 3LMMA 3VB2A 3OIOA 2OCEA 4BEHB 4RLQA 1UZCA 1POGA 4EMSA 3OSGA 3W2AA 2LNBA 3KLOA 2ZB9A 2IPQX 1VI0A 4L9NA 4CICA 4V2FA 3CUQC 1FIPA 1ZARA 1MMSA 1HLVA 2ZC2A 1QO0D 1DP3A 1IN8A 4G9YA 1G2HA 4B48A 5TJJA 1U5TA 2XAHA 3BTIA 3GVAA 4G7HF 4M3GA 3ONQA 3OYLA 4CH7A 2DMNA 4ON0A 4BXUA 3WGHA 1G3SA 4EJTA 2CFOA 3QU6A 2PEXA 3DXJF 1G6NA 2O8KA 1OCTC 2CW8A 3CESA 3DPUA 4ZH4F 1MBFA 4HPQA 1IJWC 4RDUA 2X48A 4XRFA 5E3NA 1JJ8C 2R5YB 2NOJB 3BG5A 4WXCA 3HRSA 3O8HA 1IO2A 2RREA 1IDZA 4YG2F 1PP8F 3MZYA 4EJWA 2CQKA 1MNDA 4U88A 2EB7A 4EATA 5L3BA 5FD6A 3JRHA 6PAXA 3H3VK 2RGVA 1Z0XA 5JHUA 3ASOH 2M0MA 1MH3A 2EILH 4LG0A 3LAPA 2GM4A 5J1UA 4AIKA 5D8LB 3ZQ7A 2L9SA 3K4BA 1J5YA 2LD5A 4D9JA 2E19A 3OYCA 1XTAA 3M07A 1ZLKA 5GP9A 2CV0A 2MBFA 4BY1J 2DODA 3GF2A 2FEZA 2LY1A 2GOMA 1FTTA 3GTQJ 2BBYA 2YPRA 1ZR2A 4L5IA 3S2HJ 5KHDA 3WU1B 1HW5A 2VKHA 2IP2A 2ZCWA 4I76A 3E1SA 4X1EA 4C3JJ 1G3TA 1MMNA 5FD5A 2HVSA 2XUBA 1R7JA 4KIBA 1B1BA 2BOLA 2Z5UA 5EDNA 1T98A 2LY2A 3JRBA 3T8TA 3RPUD 5EZHA 3FKIJ 4L9VA 2LR8A 4IL6C 2KT0A 2MYSA 4NC6A 3A01B 3OS2A 1PUFB 3DCFA 1ZAOA 2ESNA 4I2OA 2XV4S 1FMWA 2E5ZA 4M9SA 3TP0A 1LUJB 1ETOA 3L7WA 1DP7P 3EYIA 3T0YA 3X2QH 2L7MP 2GLOA 2R7QA 2JA7J 1XSVA 3QYFA 3M3YJ 3ELKA 1U78A 2HS5A 4AIDA 5J47A 5DDGA 2JA8J 3BR2A 5DEQA 4IX7A 3DTEA 1RZ4A 3HRMA 3FHZA 1E17A 3SJMA 2RC4A 2XAGA 2R7DA 1WQ2A 1ETKA 2ZXJA 2E34A 1XGNA 5CKTA 2ETHA 3WG7H 2EPFA 2QWWA 2V9KA 2F6CA 2XGEA 2YX7A 4O6JA 3F8CA 4XICA 4EVIA 1FZPB 3CUQA 4XKWA 1QVUA 2L5QA 1DDNA 5AONA 5C3EJ 2VC0A 2B9SA 1MBGA 4KISA 4M9XA 4ENMA 5K7HA 1X3UA 4C9YA 1YJ9I 3PSIA 3RKXA 4DYQA 3G3ZA 5FFXA 3A2KA 5J40A 2YX4A 4DJAA 5D8KB 5BPDA 3QP5A 1IGNA 1YIOA 1VFCA 3OYEA 3R0AA 4RAZA 3CO7C 5C4JJ 1F4KA 4CCJA 4JP0A 1ACIA 4QPQA 3CDLA 3HOUJ 4D7MA 4DIQA 2CV2A 2M7BA 2XF6A 5J4VA 1SVLA 2IGMA 5IOYA 3M7GA 2XGXA 2LP0A 2QQBA 2W48A 3K6GA 3HHGA 5K7ZA 2KJCA 4LFUA 5H6QA 3KP7A 1U0JA 2QQAA 5DYMA 3CCMI 2GIZA 4A0XA 1A35A 3SDBA 5LRRA 2L54A 3BR3A 4JX6A 2RAEA 1H89C 2E5NA 2YU9J 4LLGF 1HXDA 4IO9F 3KEOA 4HSTA 4IJAA 1ODDA 1YJNI 4MIMA 2X6OA 2QYOA 2CS3A 2HI3A 2VPLA 1N77A 3KPHA 1KU9A 1AKHB 4ESJA 2VXZA 4BXFA 4QLCU 4B1RA 1W5SA 3K1PA 1TP4A 2VIXA 3ERED 3NWTA 4Y4RA 3AG2H 3SFZA 4BJ6C 4WX9A 2GOXB 1FY7A 1FOXA 3KP5A 4IQ4A 2G7HA 2KIMA 4HX7A 3KCCA 5HDGA 2KPMA 1XDSA 5EGOA 3FK7A 2CMPA 4OAZA 3BR1A 3VYUB 3WTUC 2QM3A 3FIWA 2IS2A 4LB6B 5IOZA 3ZMTA 2JZYA 3JRDA 5FKKA 4CYDA 4QTRA 1AHDP 4EV0A 1TWAJ 1MNMC 3OL4A 1ZKGA 3N4MA 2DO7A 4BQAA 1ZK8A 1DGWY 4E70A 2HDWA 2V79A 3JRIA 4LK1F 1YYVA 2FBIA 3OV8A 2VONA 4V2GA 3WU2C 1Y1WJ 4ENJA 2H8RA 4UB6C 5F0HA 2UXNA 1IUYA 4AVPA 2O7OA 3HPHA 2W25A 3E5QA 4FHTA 1T95A 1R5GA 1D0ZA 5HS7A 4E7ZA 3LAJA 3EUKL 2M2EA 2V1NA 4R8HA 3TL4X 3C1DA 3E6BA 1XGOA 3J80Z 2ZMEC 1O3RA 3F3XA 5GADJ 4GGGA 4PSWA 2EIKH 3GW2A 1SC7A 2JT1A 1K78B 1K6OA 3A02A 4F7ZA 4E7SA 4HNTA 5E3MA 2L4MA 2R5ZA 5BPIA 3TW6A 5C4XJ 4PGGA 1CF7A 2XF5A 2ZNZA 3HSRA 1XB4A 2L9NA 5E79C 4C3IJ 3ZP5A 2CQQA 2XSDC 2XHKA 3IH3A 4XRSG 3Q5FA 1WVRA 3TO9A 2LMDA 3MD2A 1VQ6I 1R6RA 1H0MA 1B8IA 2FUG2 1Z21A 2X1CA 2R7WA 2ESHA 3V7RA 4AD9A 5LBQA 3H5RA 2M30A 3OOUA 4FETA 3GBGA 1JGGA 4ZDPA 1D5VA 1GHCA 3FHNA 4OINF 2KQRA 5EEHA 4C30A 1MZBA 3CF2A 1VQKI 4CA0A 1LFPA 4LK0F 2MG4A 2GWRA 3K4CA 1U5TB 3RQIA 2DYSH 1G3YA 1YJWI 1A5JA 1SMYF 1X1PA 1I6XA 4CCLA 2WC2A 1R5ID 3C7JA 2HDCA 2KISA 3BPXA 1HW2A 2K40A 1WPKA 1A6QA 3HB9A 3V8KA 1OMIA 2WTEA 3ZQCA 3CDHA 1IZ1A 4G7ZF 3SEZA 3PL8A 4IHSA 2TDXA 5E17F 1HKSA 2VT3A 1OCCH 4AYBN 2NVQJ 1J0RA 5HLGA 4XLCA 1YIJI 2FD5A 3CLQA 5IT9Z 5IY5H 3RSNA 2HQNA 3DKYA 3O2PE 1ETVA 4Y3OA 4LLNA 2K85A 3OL3A 2ACJA 3NRVA 1QVTA 5FO5A 4A2UA 3BR6A 1OFCX 4LG0B 3FXRA 3C2HA 4A12A 3S3MA 5FKLA 2KLOA 3QP6A 4ZYEA 2RQQA 4BBRJ 3CC7I 4E4HA 4LITA 3FXUA 1IF1A 1X2NA 4KICA 5GPCA 4GRIA 4KMFA 4BYYA 4CZZA 4JOMA 1BI0A 5CJ9A 2BV6A 1R23A 1TQPA 2P5LC 4ENNA 3S3OA 4C3HJ 2RNJA 4BDZA 1MH4A 2DA3A 1TWHJ 3LSIA 2MH2A 3MWMA 4CDGA 4Y7NJ 2VKEA 2PX9A 2DOFA 3L2QA 1W7PA 3FDYA 3ZCOA 2EH3A 3HOZJ 2ZXWH 2L7ZA 1SFXA 2Y30A 5HODA 3VSLA 3FXOA 5B3SH 2IRFG 1MBHA 2CW0F 3FKJA 3J80K 2VE8A 2Q1ZB 4XBFA 2ZMEA 1YHQI 1HC8A 3EUAA 3H5NA 3E0JB 3OYIA 2B7EA 3OYNA 1TBXA 3KEYA 3HIFA 3FM3A 1W5TA 3MN2A 1KQ0A 2H6CA 1C0WA 1XMAA 2E1MB 5F04A 1A31A 2TRTA 1HOMA 3SYTA 5K5RA 4JQFA 1FC3A 2OJED 2IA0A 4KN7X 2VODA 4B43A 1V54H 4MFEA 2HOAA 3G71I 1DQUA 4PJJA 2LC2A 1OYYA 2RQPA 3GZNB 3CUQB 4IVNA 3OYJA 1MNEA 1R1TA 3G1OA 1O3QA 3CMAI 2AQEA 3L2UA 1MDMA 1IRXA 5FFZA 3LNQA 2MD0A 3K4LA 5E3OA 2RDPA 1S7AA 4UUSB 1LDKB 2WB1A 4PJMA 5CVIA 5FJ8J 3FBNB 1IXSB 3ZQHA 4FT8A 3PNYA 5DCMA 1DUXC 1Z77A 1ZH5A 4YELA 1R58A 3ZN0A 1Z1DA 1U9OA 3H92A 3KYDB 5F0CA 1O3SA 3R6SA 1S72I 3S16J 1S6LA 1MIJA 2JA6J 4XKCA 2V26A 3ISPA 2KIFA 2KRHA 2M9HA 4UV8A 4RGUA 2E60A 2IS1A 4XLEA 2HYJA 5J6XA 3WE3A 1FMVA 1BR4A 2CUFA 4BNCA 5FLXK 2E1OA 5CLSA 3TW7A 2R7UA 3F0CA 1GVDA 1FYLA 3VYTB 1MKMA 2DTRA 3BJOA 2Y0MA 2FSWA 3BC8A 1HDPA 5GAEJ 2Q8KA 2Z2SB 2K27A 1WKMA 2VBXA 2EFOA 3V7SA 2EZKA 3LA7A 1ON2A 4HF0A 4JX4A 2DBBA 2J5PA 3BQYA 2D1VA 5M3MJ 3L00A 1AOYA 4FX0A 1W4MA 2JRTA 4Y13A 4AU7A 2GAUA 3TO7A 1BI1A 2EZIA 5HS8A 1J9IA 5KK1A 3CMEI 2WAQN 2DK5A 3F6OA 3SDGA 1VQNI 2DMUA 2LRDA 1FBUA 3S93A 2KFDA 1I1SA 5DUIA 5HLTA 1R1VA 2CQXA 1W0TA 4Q5SF 4ZDOA 2W00A 1X1AA 2XIGA 3K69A 2ZFWA 3HSFA 4ZYDA 3I55I 2HQ5A 5EGOB 2DT7B 3JREA 1YRNA 2RN7A 1OPCA 1LFBA 1M1EB 1Z3YA 4B44A 5ICEA 2Z9OA 4EGYA 3VODA 4E7JA 3NARA 2Y0SA 5GPAA 2Y9ZA 3WGGA 2W24A 5K5OA 3LSGA 2DN0A 1X1DA 3LQRA 1BW6A 3S1MJ 4WXDA 4XN0A 1Y0NA 4M3FA 3BDDA 4HNUA 2XB5A 1QGPA 3F72A 3AG1H 2PLYA 1GDTA 2F5CA 1MJ9A 3ABTA 5LHGA 4EGZA 1Y0UA 4RA2A 2A5YB 2EFQA 4Z2YA 4P1WA 4CZCA 1HBXG 3OWTA 2QQ8A 3A03A 2IGNA 2CW7A 2NVXJ 4S05A 1KU7A 3WTTC 3HL2A 2W1OA 5LFAA 2A5WA 2CFXA 2FE3A 4XOPA 2H6BA 2OBPA 2VXDA 4LOCA 3U21A 3IC7A 4B3XA 4RAGA 4AIJA 2BE5F 1T39A 5F08A 1GXPA 1HKQA 2XAQA 3KETA 2M7AA 1KGSA 1WJAA 2P0WA 2X0LA 1BIBA 3F6VA 2R5ZB 4UNOA 2QSHX 2HWVA 1CF7B 3CZ6A 1EA3A 4UXNA 2NXNB 4L0ZB 1MJAA 3RTRA 2FU4A 3HOVJ 3CP8A 2NS0A 1E0EA 4ZTFA 4U87A 3S8PA 5JLWA 4M73A 2R7VA 2FA5A 4M3DA 5JLXA 4IHTA 1B8IB 3ZMUA 3ZN1A 3REOA 3JR9A 3H0GJ 2DYRH 1NK2P 3AG4H 5J1RA 1WSUA 1USTA 4G12A 1H9TA 1EJ9A 3LSJA 4J19A 3QOEA 1NK3P 4KIGA 1PVEA 3G6EI 3HEFA 3NQOA 3IKTA 1ZGWA 2KHMA 2F5FA 3OS0A 2X85A 1VZ0A 1JTYA 1LJ9A 4BHPA 3L2VA 1OCOH 4KT5C 4HQMA 1OKRA 1G59A 1YE9A 2KZGA 5CPRB 1TT0A 1JT6A 3LSPA 4A6DA 2HDDA 1GT0C 1KZHA 3E6CC 4BY7J 1H8AC 5IP9J 1YI2I 2XKOA 3CCYA 3QOPA 5DM6F 5E1XA 4L0YB 3H9GA 2ISYA 3E7LA 3QYEA 2H94A 4E7KA 3HJEA 1XS9A 2Y75A 1O4XA 5D5UB 2CQNA 2HXOA 1FSEA 1VF9A 2O03A 3DBHB 1WJEA 4BU2A 5F1JA 4MEXF 3KX2A 3Q9VA 4OIRF 1TTYA 1XX5A 2E35A 3QPLA 3RQ4A 3I4MJ 3H3ZA 3ZMVA 1S7EA 3H9QA 3K1NA 4ZJZA 3BT9A 2JQ7A 3FWEA 5LGNA 2BVLA 5HNHA 3L2CA 2V1DA 2WV1A 2HXIA 1P2FA 1OYIA 3IHUA 2A69F 3MKYB 3A1YA 1QPIA 2KRCA 3MMYB 2OAZA 1T33A 4F92B 5LD2C 2XVCA 3L2WA 3OS1A 3OYFA 4M6VA 1JUSA 5JFRA 2HU9A 3OY9A 2F4OB 1W7PB 1LVKA 1TW2A 3B6AA 1ENHA 1D1AA 3OYAA 2DXIA 2JSPA 2QEXI 5EJCA 1QPMA 1BOBA 1WCMJ 2FF4A 3K10A 4B4CA 4KIFA 4V19K 3K2ZA 4ITVA 2ECBA 2ZMEB 5HS9A 4XQFA 1Z05A 2AS5F 5KVRA 4HV6A 3FMQA 2V6CA 1EH6A 3I53A 2DJNA 1TWCJ 3TBIA 2I5UA 2JK3A 2VJJA 3PNTA 2HPMA 2PJPA 2W7NA 1I5ZA 3QU3A 2VASA 3WE2A 4C2TA 2E2HJ 3VWBA 4OIPF 2COBA 1N75A 2M3AA 5H2FC 4BQQA 2PMZA 4MHGA 5ILUA 3GTPJ 1UMQA 1BM9A 3QRFF 3WHBA 2V7FA 3ZGKA 4IOCF 3A4CA 4OMYA 4NUBA 2EJRA 3PQKA 4A5NA 3G1LA 4XORA 2JPCA 1JTXA 5D4RA 2VQHA 3U1DA 2JRMA 1XCBA 3HGGA 1HA8A 4QPOA 3CCQI 1OQYA 1IG7A 4UUVA 1MDMB 2BY2A 3CCSI 1LNWA 1SANA 4JBAA 1K83J 2R3SA 1PJRA 3RI4A 4MTDA 1S7OA 1TL8A 2KIQA 1JUMA 2LG4A 2XDVA 5DCMB 4B3AA 4UVAA 2HR3A 2ZJRF 2X1DA 4G6QA 2XROA 1UG2A 4HX8A 2VQCA 2FOKA 3IH4A 1X1CA 3M4OJ 1P7IA 1BI3A 3RPUA 5CVJA 1UJ8A 4HDUA 4BDYA 2JN6A 5DV5A 4XKBA 3JTHA 4PSXA 3LFKA 2O61A 1SEUA 2EZHA 1MMAA 2OZ6A 4IKFA 3H1CA 3CJNA 3L9FA 3GZ6A 1G3WA 3DKWA 1LDJA 2R93J 2V1XA 2V9PA 3IP4B 1QZYA 3IKVA 2M45A 3OR1C 3GX4X 3C18A 3KE2A 2O6GE 1YW9A 4KJZA 4RAYA 4CCNA 3W6VA 5M3FJ 4P9UA 2KRFA 3I4NJ 3DU6A 3R60A 2AQFA 3RZOJ 4RB2C 2L2OA 2Y9YA 4Z6YA 3W2WA 4PCQA 1T56A 2DQRA 4IXAA 4JX5A 3GFMA 5LEKA 2EFNA 4UUSA 1L0OC 5TISC 2R0QC 4HBLA 5E18F 1I6HJ 1EH8A 2ZXHA 3ABMH 4NC8A 2QVOA 3UKGA 4HSRA 1IV6A 1RUNA 1Q1HA 4GXOA 2HOSA 3CD6I 2JVGA 1R36A 3DBLB 2BHZA 4ZYAA 2LLKA 3HKZA 5B5EC 3OYKA 4MQ9F 1E3OC 1MJBA 1A36A 2NVUB 2OZUA 3IH2A 4FASD 3LSHA 3Q0UA 4L5JA 1YRNB 1A04A 3LOCA 2WWYA 1V5GA 3J7AO 4HRIA 4L9TA 2Q0OA 1VQ8I 2JUGA 2OU2A 2A07F 1ZELA 1SVOA 2YS9A 1UELB 4IQJA 3OR2C 4KDPA 1ZGAA 4I99C 2F4IA 3BTLA 4H0EA 5KNLA 5FRMA 5GAGJ 5ILSA 1ZG3A 2V4JC 3ASNH 2QBYA 1F43A 2IW5A 2EBIA 1EV7A 2KP6A 3QPHA 5B66C 4ZC3A 2VT2A 2E36A 2BHYA 3F22A 1BN5A 2RNGA 4DBRA 2HPIA 3VSKA 3PSFA 2R7TA 2JVHA 1O7FA 3L09A 5BNGA 2D45A 2YSRA 2Y2ZA 5GTHC 4CYCA 2DOAA 2NS8A 1GXQA 5D5XB 1JKPC 1JXSA 4CHUA 2G9WA 3K70D 1XC5A 1Z91A 3K4KA 2LKXA 4M6XA 1TQIA 2DFEA 4XOTA 3GFLA 2IEKA 1RUOA 2OA4A 1VTNC 3ML6A 2QGUA 1UG0A 1WWXA 4PFPA 5M5YJ 1I1GA 3HBLA 2HVRA 3PO2J 5K1YA 3KIOA 1FX7A 5CQGA 1QU3A 1ZG1A 3JRCA 5IPAA 4CCKA 1YQAA 3DPTA 4NC7A 4UY8I 1VNDA 4A3IJ 4A3DJ 3EUHC 3ZQFA 3KEQA 3G73A 1QNTA 2QSGX 2V9VA 3KP3A 4KUMA 2VL8A 4KFCA 3DKXA 5DM7F 3LQQA 4M74A 2BW3B 5E8GA 2W85A 3M1EA 3FK6A 1B4AA 4FTHA 2PMUA 3SXYA 1Q1VA 3MAJA 1JJ6C 1X4PA 4EM0B 4FQGA 1J7KA 5E1WA 4YIIA 3ZQQA 4A3MJ 1QHHD 4IHWA 5DUKA 4I0AA 1RC9A 4LLLA 4IRIA 3BCBA 1IV8A 2DOEA 2K3FA 1FP2A 2Y69H 2R7FA 1D0YA 4U7BA 2VJIA 4Q47A 4F3QA 4E6KG 3JSOA 3SEQA 1ZN2A 1UHWA 3VYRB 1EKEA 2PMHA 3GTKJ 1OJLA 1A6IA 2P6TA 3LSMA 3M8EA 2A3SA 1ONVA 2DMTA 3ZQGA 3BOQA 1GV2A 5B1AH 1FBQA 4P5OA 3TKYA 1E2XA 2H8WA 4M71A 3ZMZA 3GFIA 2EV5A 1Z9CA 2CG4A 1U3EM 1X19A 1ZGJA 3WG9A 3GTMJ 4UHTA 3TO6A 2FQ3A 3RDIA 3CJQB 3MVPA 3Q3SA 4L5EA 2L02A 4HOBA 3RYRA 4X6AJ 4ABZA 3ECOA 3S1RJ 3JW4A 5IP7J 2GA1A 2VKDA 4G7OF 3DLLF 2X6WA 1G4DA 5A2QK 2MD5A 3RYPA 3LSTA 5BQTA 3CJTB 1J75A 1KU2A 3ZOBA 1I3QJ 2DA1A 4AYBA 1OLTA 4Q4ZF 4LIUA 3H0DA 1EH7A 3LWFA 2R92J 4GCVA 1FYKA 4A69C 3A0BC 4ZDLA 1I3AA 1W36D 3CDIA 1ZRCA 4HA8A 3WGIA 5ICCA 2BEOA 4AUXA 3I58A 4HZFA 5FLXZ 2O9LA 4D5FA 1P6RA 4CSWA 1CQTA 3BROA 1T6SA 4IRGA 2CGPA 1BA5A 3MKLA 1YO5C 3R4KA 1DU0A 4RAFA 2M87A 3M8FA 3MFKA 1T0FC 2BVMA 2LDUA 2D5VA 3HGYA 2GBYA 4IOAF 4YFXF 1RKWA 5EZGA 4IPAA 1BJZA 3E6DA 1FYMA 4F93B 1ULYA 2NNYA 1SFEA 1Z6TA 3C3WA 5FLMJ 2HTJA 2XASA 4D7NA 4I01A 2G0EA 4Q48A 5JHFA 3ABKH 1SVMA 5HOOA 3HHHA 3MZ8A 1FSHA 5DD4A 2VB6A 1OISA 4HEA2 2M8EA 1FOYA 1MBEA 4RGSA 4GDFA 1LKXA 5CVUA 2HYFA 3JRAA 3C2GA 1R71A 4CGZA 3T5XA 1D8KA 1YG2A 3OOPA 1IXRC 2HFHA 2JA5J 1KQ8A 3LFUA 3CC2I 2BY3A 2R7SA 2P81A 4A3JJ 1F1ZA 4R1HA 3BR5A 3Q0WA 1S5LC 2WY8Q 2FNAA 2M5WA 3HC7A 1X4OA 2WY7Q 3NEUA 1T38A 4MNUA 2JMWA 3S2WA 2JWTA 2L3DA 2XKPA 1IN5A 4KMUX 5CVVA 3ZMSA 2EV6A 3LSRA 5ED4A 3CCRI 3F8NA 1VQ9I 5IP6A 3MZHA 2EQRA 2M34A 3A0HC 2F5VA 3G4SI 4L18B 2W4SA 4RGXA 4B8XA 5LRSA 3BTJA 4PUSA 4KT6A 3TDUC 4XSXF 4EJVA 3H3UA 2CYYA 5JR3A 2M1BA 2UWMA 2MSYA 5HLHA 3DQVC 1FT9A 4L9JA 1UB9A 4I0BA 3DBRB 1U6GA 1R00A 1ZTRA 3BZ6A 3MQ0A 3OYBA 2L9RA 2FNPA 3SZTA 4EJOA 4DZPA 3S14J 4OMZA 5EYRA 4B09A 5B1BH 4MTEA 3CMYA 2CRGA 4HG2A 2GIVA 3I0TA 3TOBA 3BP8A 1PDNC 1HSJA 2O0YA 1HF0A 1BC8C 2LOOA 2ZO4A 5DTDA 2A68F 3D5LA 3HOTA 4CUGA 1TNSA 1IC8A 2FXAA 2A05A 2WB1N 1BOAA 1Y8RB 4XRSA 1RR7A 4RGRA 3TDZC 1TZLA 2KIUA 2P5VA 2ZXIA 4Y33A 4PZJA 3RJPA 3MEXA 3MKWB 4P96A 1SFKA 4JK1X 2M0CA 4OWRB 3ZQIA 3OYGA 3IL2A 2RVCA 1B6AA 3V7CA 3J7ZI 2JTVA 2KZVA 3GO5A 4HQEA 4O3MA 3GZ5A 4FCYA 1WRJA 4BKXA 3BPVA 4MEYF 1L3LA 4I6ZA 2QBYB 2QKMB 1KU3A 2STTA 2PN6A 2YR2A 3O8GA 3P9IA 3W6JB 3OIQA 2CUEA 3ERMA 1P4XA 1NH3A 2HOEA 2DDBA 2L7FP 3BJ6A 3DFGA 1AA7A 5CQEA 5FRNA 5F27A 1FIAA 1FNNA 5HVQC 1TLHB 1R22A 4CYCB 2GQQA 1SAUA 1SD6A 3BLYA 2BXZA 4DW6A 4EEFG 2EIMH 1WZ2A 1V5EA 1B72A 4YFKF 4A93J 1Y1VJ 2E71A 1FWZA 3HG9A 1ZREA 2GXGA 2GA2A 2P5KA 3I54A 3CUOA 2RV8A 4BQNA 2CSOA 1MW7A 2Z99A 2R7RA 4M3BA 2CU7A 2LBFA 2BY1A 4BE2A 3ABLH 3F21A 3W2VA 3QQAA 2AXTC 1OCPA 4JYKA 2X9DA 4MO7A 2LYCA 3I56I 2PJRA 2V1UA 2HKOA 4G6TB 4XM3A 2PBIA 4II3A 3S1QJ 5AIPA 3JRGA 3BG3A 2FJ1A 5L3FA 1KA8A 3PUBA 1MBKA 5FROA 4OIOF 1WH7A 3FXLA 5DS9A 2ZKZA 1DPRA 2F2EA 4DGWB 5BMZA 4N4OB 2OV7A 4WK8F 2OQGA 1WI3A 2Y0SN 2DPDA 2DJIA 4ZYGA 4IZZA 3CMMA 3HOWJ 1GV5A 1U5TC 3I5UA 4HNVA 2D2WA 3O3KA 4YRVA 1XMKA 2ELHA 2VBZA 3E3VA 3PUFA 3GUDA 1H88C 4RS8A 4IHYA 1TQMA 1EF4A 3ZXSA 1MMDA 1LVAA 3IUOA 4AC0A 2R4GA 1IUFA 4YIFA 4BBSJ 4RM3A 3BR0A 1X1BA 4UVBA 1JKOC 4YFNF 2P7CB 3WODF 4XR6A 3OIPA 2ZNYA 3V8LA 4E7IA 5F1RA 5L3EA 2CJJA 1O57A 5FKMA 5ICFA 3S15J 3SZPA 2DQLA 2NNNA 4XLPF 4RM2A 1SD7A 3WTSC 2HEOA 4HYEA 5ICGA 3TGNA 4NB5A 5F64A 3GTJJ 1QRYA 2BW3A 3RCOA 1SAXA 3I59A 3ROUA 3AFHA 3OYDA 3KP4A 4XSZF 3V4GA 1V55H 4PJ0C 4AVZA 4PDKA 3RKYA 3HM5A 1O3TA 3COAC 1ZLJA 3G2BA 2EK5A 3Q0VA 5FKOA 3DPLC 2MABA 3E5UA 1JUPA 2R7XA 1KONA 2V6EA 3WHCA 3GTGJ 3ZRGA 2LREA 3S32A 4H4KC 2O5RA 2DW4A 1SD5A 1BIAA 3PIOF 2KDOA 4LIVA 3S2DJ 1YOVB 2DLLA 4ETSA 5LGUA 4FE7A 5CYVA 2K5CA 4BE0A 1ETWA 3HUGA 4UB8C 4XLAA 4U0WA 2EZLA 3RIRA 3J81K 4D0PA 4Y15A 4II2A 3VEPA 2DMPA 3K4MA 2DA6A 1ZRDA 3LA3A 4BJTA 3FXQA 1UCRA 5E3LA 1IRGA 2DI3A 2H09A 2E7WA 1XD7A 1Y6IA 2XPWA 4WF2A 1T2KA 1XSXA 1D5YA 4LGWA 3K2AA 5IT3A 3KP2A 2XPVA 4HX4A 2VJ5A 5FKNA 1JE8A 1K61A 5BOXA 4U0YA 2NRAC 2ME6A 2VC1A 4M6YA 1OR7C 3V8JA 4ASNA 4GYGA 3K1MA 2XGDA 3FXMA 3S3NA 2NVTJ 5J3LA 1TW3A 2MW8A 2FMYA 2A6HF 3GWZA 3KLNA 5L3GA 3HDDA 3F8MA 2PFBA 1HSTA 1TNTA 2AO9A 2HNHA 4PJNA 5FGMA 4S04A 2CH0A 4OAYA 2DT6A 1W5CC 2CUZA 1JHFA 2A6TA 4RB0A 2FBHA 4XLFA 5JVTA 3W3CA 5C44J 4ZZLA 2FX0A 4RB3C 1F9NA 1LQ1A 3SZGA 1IN4A 3EPZA 3R61A 4C2MJ 3ABUA 3HOSA 4MQVA 4BH9A 2E1NA 3B02A 4BJ5C 2VQLA 1LE8A 1FOKA 3JCUC 3DF8A 1R4MB 3VOEA 3QYBA 3OMYA 3BCAA 1KYZA 2DU9A 1LB2A 1Z67A 5L3DA 2EINH 1SFOJ 2W57A 3N05A 3L1PA 1JKQC 1BW5A 2DCEA 2HQRA 5JI6A 2UZKA 4IHXA 3AL0C 4HF2A 5EEGA 1FPQA 4XN3A 4NBQA 1RIOH 1K7AA 2LVSA 2PMZN 3LA2A 2OUMA 2VQGA 5D6EA 3WTXC 3VDXA 2P8TA 2PG4A 3GXOA 5JVGF 2L4AA 1K4TA 3DV8A 2XRNA 3CCEI 3WTWC 2DFHA 2FOWA 1Z3XA 1F5TA 5EG0A 2IA1A 5ERIA 4R79A 2VKVA 1ETQA 1RR8C 2EWNA 2MA3A 4I98B 1RKTA 2UV1A 5LGTA 1DGRM 1MBJA 2OF7A 2WA0A 3SQNA 3K70C 1N25A 1V4RA 3B6CA 4YIRX 1IDYA 1S8NA 3BWGA 2OCCH 2IVMA 3I3LA 3HTSB 2K86A 2YU3A 4PK4A 4M72A 1GUUA 4A3CJ 1WFXA 4MLOA 4ZZDA 2F4MB 2H1LA 2K9NA 1ETYA 1YS7A 4K2EA 3RKWA 4UUTA 1ZR4A 4WXHA 1J2XA 1S29A 1Z6RA 4XLHA 4F55A 2M4GA 5KAFC 3CCUI 1I50J 3WTYC 2ADUA 1I39A 5IYBJ 4HLXA 1TWFJ 4XKVA 3QAHA 2ID3A 4YEJA 4A0YA 1WHUA 5FLVA 5L3CA 4J01A 2ID6A 5D4SA 2ZSIB 4WCGA 1X3ZB 2AHQA 3FXKA 5IYDJ 5GTIC 4XIDA 2XAFA 1X2MA 2F5DA 4QSHA 2XSJC 4DQ2A 2DFFA 4HLYA 2F48A 4UV9A 1OR7A 1YLFA 3OYHA 1WJFA 4F91B 1B72B 3P9CA 4GFBA 2NOGA 1J09A 1BR1A 1H9GA 5HDKA 2KKOA 3KYLA 2LKSA 3FZVA 2XC7A 2XB0X 3KZYA 2ISZA 1UFMA 2K9QA 3TOAA 2KDZA 4A3LJ 4QIWN 2LBFB 2EA2A 1BI2A 3V42A 2HGCA 1KQ9A 4LB5A 2ZJPF 1CGPA 2PJRB 3IWFA 5LHHA 5KCMA 5A2QZ 3HKZN 3RKQA 1R49A 2AXLA 4DBQA 1VQ5I 1LPQA 1WGXA 3CC4I 2COMA 1OYWA 1FOWA 5KAIC 1W0UA 2FMLA 4HAMA 2LTPA 4W1UA 4OIQF 1NG7A 1P4WA 1B59A 4OOIA 2XRLA 3NAUA 3KFWX 1P4AA 3TEDA 4M9ZA 3CLOA 4Y17A 4BQOA 2K9SA 3ZMDA 2VOPA 2E1CA 3CF5F 2IA2A 4ZYHA 2JJ7A 1ETXA 2X51A 3S17J 2QUFA 2DA5A 3KP6A 3CCJI 1IXCA 1WI9A 1STZA 1R9TJ 2XAJA 4KNYA 4BHBA 3F23A 4ENKA 3BZKA 4DZJA 2ZFUA 1SMTA 2CV1A 4QWQA 1XGSA 2Z3YA 3BJAA 2LKPA 2A61A 3KZIC 1LEAA 2QF7A 5E1ZB 1ZRFA 1W36C 1HCRA 2G7UA 4AWXB 2Z16A 1DPUA 3IWZA 1VQ7I 1WH5A 2XPUA 3PNVA 1T8IA 3JRFA 1GLNA 4O5VA 1R1UA 5HLIA 3D5SC 1KYWA 4BHCA 2Y48A 1Y39A 2P7VB 3VFZA 4CO8A 1Z7LA 1YX3A 1G8XA 3TQNA 3FISA 2DK8A 1YW7A 3KYCB 1WJ5A 1XG1A 3FMRA 3I59B 2QA4I 2VPRA 3QPSA 2GXBA 3LL7A 3K7AJ 3H35A 1R4NB 2DMQA 3D5RC 5H20A 2IGKA 3FM5A 4BACA 4N9IA 4ESFA 2H1KA 5J8CA 2NAZA 2DA2A 2JA2A 3GTOJ 3IAM2 5LHIA 1RETA 2DA4A 2LFBA 2ELJA 3I4PA 2X6XA 5ILVA 4MFDA 1RI7A 1FBSA 2EV0A 2KMUA 2VLAA 1Y56A 1MGTA 5E8IA 4EM2A 1TT5B 4U7DA 3HYIA 5EF6A 2IS6A 1D3YA 4DYRA 1AWCA 2BZTA 1D1CA 3J7AY 4UVCA 3F9KA 2IGOA 3GFJA 5M5WJ 4A5MA 4G94A 4I7HA 1UAAA 5D5WB 1B9MA 3HUGB 2JPBA 1MSEC 1TWGJ 3T1BA 1LEBA 1FP1D 3R0JA 2XF7A 4J00A 1YS6A 4IEJA 2WV0A 4HF1A 2KJBA 3DLAA 3DWLE 5E20A 1NTCA 3SFIA 2B0LA 2FBKA 3FMSA 2I10A 5M5XJ 1S9HA 2BXYA 2VE9A 4HW0A 3J7YJ 4PJLA 1FEXA 3HRTA 4CXFA 5LEJA 5K5QA 4KA4A 3JAMZ 3I64A 2DT5A 2TCTA 4G8XA 2QLZA 2GXAA 4IHVA 4BAYA 2ZSHB 2OC6A 3P5JA 2BGCA 3QWLA 3JSPA 1JI8A 2CQ7A 2N8GA 1ON1A 2HZTA 2Y31A 1N78A 1XSDA 1ORKA 1IN7A 3QPTA 2QSFX 4NQWA 3OSFA 4NHJA 1ERDA 4RMNA 1W1WE 2FRHA 4LD5A 2X1EA 4IRHA 1BBYA 2LY9A 2Q2EA 2QZ8A 3FXJA 2MH9A 2RKHA 1I27A 3ULQB 5IYCJ 1E3PA 1V3FA 2F5EA 1LE8B 1LFUP 4BL0B 1J59A 2OPTA 2E7XA 2WBMA 2ZJQF 1MSFC 1XCVA 3EUHA 4BEHA 2BYVE 2ICWG 4E7HA 5D5VB 2DDAA 4U0VA 3H5AA 3EYYA 2LSOA 4FE4A 1WJDA 2EFPA 3RPQA 3S1NJ 3VYSB 4X0GA 3AKZA 1W7PD 2CUJA 4ESBA 1VQLI 3B73A 3QODA 2K7LA 3CTAA 1S3JA 4XNFA 1HDDC 2H27A 3L2RA 4BXXJ 2LF7A 2WAEA 3AG3H 3GTLJ 3PFIA 2DPUA 1JT0A 2MLKA 2HQAA 2K02A 3HOYJ 2L9VA 2JSCA 2Z1DA 3GLXA 2J5OA 3CCLI 1PP7U 3WU0A 4WWCA 5EG0B 1XMXA 4ANJA 3DU5A 2X4HA 3GLLA 4RLFA 4RB1A 3PIPF 2K9MA 2HOTA 3TP3A 2QQ9A 2W82A 1AU7A 1YTYA 1GVJA 4OU0A 3HZJA 2R5YA 3EDPA 1FLIA 1YX5A 2EIJH 3FBIB 4N0BA 2O8XA 3DEEA 3HPGA 1RESA 3DTKA 2UUZA 2Z33A 5BS6A
chains in the Genus database with same CATH topology
2ZBKA 4EQQA 2D1HA 5H6RA 3HSEA 5CVRA 3D0SA 2P6SA 4G6DA 2EA4A 3ECHA 1ZYRF 3JAMK 1ZG5A 2VN2A 5J8FA 3FX3A 2STWA 3MCZA 2ZJ2A 1SFUA 3SHFA 3W6KB 3IRRA 2K4BA 3P9KA 1R5HA 2C6YA 2OQRA 2IT0A 2UXXA 3K0LA 1HW1A 5DCFA 1U2WA 2QENA 3I71A 1REPC 2CO5A 1T0FA 1K79A 5IT9K 1P92A 1YW8A 4P9FA 2OD5A 3F8BA 4HV5A 3Q9SA 1UHMA 1QBJA 3IRQA 4AIHA 3E5XA 1IRFA 4GO1A 1IAWA 2P4WA 3HTUA 4EM1A 1USSA 2DFIA 2W84A 3JTGA 1JHHA 4N9HA 1SD4A 4GYIA 1O7LA 1HQCA 3J81Z 3HRUA 2IJLA 4KYWA 2HKXA 2EFWA 5FB2A 3O6BB 3T8RA 3N97A 2VOOA 1RNLA 4LMYA 2L01A 1IN6A 4MGRA 2O3FA 3F8FA 3AAFA 3P7NA 5TRDA 3WTZA 5HDNA 3GEZA 3EQLF 3E6MA 1Z7UA 5D6FA 1QZZA 3CO6C 4IF4A 2PQ8A 4XLNF 1XN7A 1LDDA 3EETA 1MD0A 2HTSA 2DAOA 2HYGD 4KN4X 2GZWA 2K4JA 2MC3A 2VBYA 1PUEE 3E97A 4A0ZA 1BJAA 2VBWA 1XDUA 1HKTA 4EJUA 5AIQA 5F6FA 1NHAA 4P55A 3BY6A 1YFHA 2A6EF 3WTVC 4FX4A 3U2RA 2NYXA 5LLQA 2MLGA 1U8RA 3M9AA 1D8JA 2LF8A 3U9GA 4A6EA 1QQIA 5DD8A 4I09A 3PQJA 3DP7A 4LJZF 1XGMA 3K9TA 4TV7A 1ZHFA 1K78A 3KZZA 1IW7F 4I02A 1B9NA 3ZPLA 1JGSA 1BC7C 4HDVA 3GYHX 3FF5A 4PGHA 3DEUA 2CWEA 2PI0A 4DNCA 3VB2A 4EMSA 2LNBA 3KLOA 2IPQX 4L9NA 4CICA 3CUQC 1ZARA 1QO0D 1IN8A 4G9YA 5TJJA 1U5TA 2XAHA 3GVAA 4G7HF 4ON0A 4BXUA 3WGHA 1G3SA 4EJTA 3QU6A 2PEXA 3DXJF 1G6NA 4ZH4F 4XRFA 4WXCA 3HRSA 4YG2F 1PP8F 3MZYA 4EJWA 2CQKA 4U88A 2EB7A 5L3BA 5FD6A 6PAXA 2RGVA 5JHUA 4LG0A 3LAPA 4AIKA 5D8LB 3ZQ7A 1J5YA 1ZLKA 2MBFA 3GF2A 2FEZA 2BBYA 2YPRA 4L5IA 3WU1B 1HW5A 2IP2A 2ZCWA 1G3TA 5FD5A 2XUBA 1R7JA 4KIBA 1B1BA 2Z5UA 1T98A 3T8TA 4L9VA 1ZAOA 2ESNA 4I2OA 2XV4S 4M9SA 3L7WA 1DP7P 3EYIA 3T0YA 1XSVA 3ELKA 1U78A 2HS5A 5DDGA 5DEQA 3HRMA 1RZ4A 3FHZA 1E17A 2RC4A 2XAGA 2R7DA 1WQ2A 2ZXJA 1XGNA 2ETHA 2QWWA 2YX7A 4O6JA 3F8CA 1FZPB 4EVIA 3CUQA 1DDNA 5AONA 2VC0A 4M9XA 4ENMA 1X3UA 3RKXA 3G3ZA 5FFXA 2YX4A 5D8KB 5BPDA 3QP5A 1YIOA 3R0AA 4RAZA 3CO7C 1F4KA 3M7GA 2XGXA 2QQBA 3HHGA 2KJCA 4LFUA 5H6QA 3KP7A 2QQAA 5DYMA 4A0XA 5LRRA 2L54A 4LLGF 1HXDA 3KEOA 4IJAA 1ODDA 2QYOA 1KU9A 4ESJA 2VXZA 4QLCU 1W5SA 3K1PA 3ERED 3SFZA 4WX9A 1FY7A 3KP5A 2G7HA 2KIMA 4HX7A 3KCCA 5HDGA 1XDSA 3WTUC 2QM3A 4LB6B 3ZMTA 2JZYA 4CYDA 4EV0A 3N4MA 2DO7A 4BQAA 4E70A 2V79A 4LK1F 1YYVA 2FBIA 3OV8A 2VONA 4ENJA 2UXNA 1IUYA 4AVPA 2W25A 3E5QA 4FHTA 1R5GA 5HS7A 3LAJA 4R8HA 3C1DA 3E6BA 1XGOA 3J80Z 1O3RA 3F3XA 4GGGA 3GW2A 1K78B 2JT1A 1K6OA 4F7ZA 2L4MA 5BPIA 4PGGA 1CF7A 2ZNZA 3HSRA 1XB4A 3ZP5A 2XHKA 3Q5FA 3TO9A 1H0MA 2ESHA 3V7RA 4AD9A 5LBQA 2M30A 1GHCA 1D5VA 4OINF 5EEHA 1MZBA 4LK0F 2GWRA 1U5TB 1G3YA 1SMYF 1I6XA 2WC2A 3C7JA 2HDCA 3BPXA 1HW2A 3V8KA 1OMIA 2WTEA 3CDHA 1IZ1A 4G7ZF 4IHSA 5E17F 2TDXA 1HKSA 2VT3A 1J0RA 5HLGA 5IT9Z 2HQNA 3O2PE 4LLNA 2ACJA 3NRVA 5FO5A 4A2UA 4LG0B 3FXRA 4A12A 3QP6A 4ZYEA 3FXUA 1IF1A 4KICA 4KMFA 4BYYA 4CZZA 1BI0A 5CJ9A 2BV6A 1R23A 1TQPA 2P5LC 4ENNA 2RNJA 3MWMA 4CDGA 2MH2A 1W7PA 1SFXA 2IRFG 3J80K 2CW0F 2VE8A 4XBFA 2ZMEA 1TBXA 3HIFA 3FM3A 1W5TA 1KQ0A 2H6CA 1C0WA 1XMAA 5K5RA 4JQFA 1FC3A 2IA0A 4KN7X 2VODA 1OYYA 2RQPA 3CUQB 4IVNA 1R1TA 1O3QA 1MDMA 5FFZA 2RDPA 1S7AA 1LDKB 5CVIA 1IXSB 4FT8A 5DCMA 1DUXC 1ZH5A 1R58A 3ZN0A 1Z1DA 3H92A 1O3SA 3R6SA 1S6LA 3ISPA 2KIFA 4UV8A 4RGUA 5J6XA 3WE3A 4BNCA 5FLXK 5CLSA 1FYLA 1MKMA 2DTRA 3BJOA 2Y0MA 2FSWA 2Q8KA 2K27A 1WKMA 2VBXA 2EFOA 3V7SA 3LA7A 1ON2A 4HF0A 2DBBA 2J5PA 2D1VA 3L00A 1AOYA 4FX0A 1W4MA 2JRTA 4Y13A 2GAUA 3TO7A 1BI1A 5HS8A 1J9IA 5KK1A 2DK5A 3F6OA 1FBUA 1I1SA 5DUIA 1R1VA 4Q5SF 4ZYDA 2XIGA 3K69A 2ZFWA 3HSFA 2RN7A 1OPCA 5ICEA 2Z9OA 4EGYA 3VODA 3WGGA 2W24A 5K5OA 3LQRA 4WXDA 3BDDA 1QGPA 3F72A 2PLYA 2F5CA 1MJ9A 3ABTA 5LHGA 4EGZA 1Y0UA 2A5YB 2EFQA 4Z2YA 1HBXG 4S05A 1KU7A 3WTTC 2CFXA 2FE3A 2H6BA 2OBPA 3IC7A 4AIJA 2BE5F 1T39A 1GXPA 1HKQA 2XAQA 3KETA 1KGSA 3F6VA 2X0LA 1BIBA 4UNOA 2HWVA 1CF7B 4UXNA 4L0ZB 1MJAA 3RTRA 2FU4A 2NS0A 4M73A 2FA5A 4IHTA 3ZMUA 3ZN1A 3REOA 1WSUA 1USTA 1H9TA 4KIGA 3NQOA 3IKTA 2F5FA 4BHPA 1LJ9A 4KT5C 4HQMA 1OKRA 4A6DA 3E6CC 2XKOA 3QOPA 5E1XA 4L0YB 2ISYA 2H94A 2Y75A 5D5UB 1FSEA 2O03A 4MEXF 3Q9VA 4OIRF 1TTYA 3H3ZA 3ZMVA 3K1NA 3FWEA 5LGNA 3L2CA 2V1DA 1P2FA 1OYIA 3IHUA 2A69F 2OAZA 2XVCA 5JFRA 1W7PB 1TW2A 1QPMA 2FF4A 4KIFA 3K2ZA 2ZMEB 5HS9A 1Z05A 2AS5F 5KVRA 4HV6A 3FMQA 2V6CA 1EH6A 3I53A 2PJPA 1I5ZA 3QU3A 3WE2A 4OIPF 5ILUA 4MHGA 1BM9A 3QRFF 4OMYA 2EJRA 3PQKA 4A5NA 2JPCA 5D4RA 3U1DA 1XCBA 4UUVA 1MDMB 1LNWA 4JBAA 2R3SA 3RI4A 4MTDA 1S7OA 5DCMB 4UVAA 2HR3A 4G6QA 2XROA 4HX8A 2FOKA 1BI3A 3RPUA 5CVJA 4HDUA 5DV5A 3JTHA 3LFKA 2O61A 2OZ6A 3CJNA 3L9FA 3GZ6A 1G3WA 3DKWA 1LDJA 2V1XA 1QZYA 3IKVA 2M45A 3GX4X 3C18A 3KE2A 2O6GE 1YW9A 4RAYA 4P9UA 2KRFA 3R60A 4RB2C 4PCQA 2DQRA 4IXAA 5LEKA 3GFMA 2EFNA 1L0OC 4HBLA 5E18F 1EH8A 2QVOA 1RUNA 1Q1HA 4GXOA 1R36A 4MQ9F 1MJBA 2OZUA 4L5JA 1A04A 2WWYA 3J7AO 4L9TA 2Q0OA 2OU2A 2A07F 4KDPA 1ZGAA 4H0EA 5ILSA 1ZG3A 2QBYA 2IW5A 1EV7A 3QPHA 2VT2A 3F22A 1BN5A 1O7FA 3L09A 2D45A 2YSRA 1GXQA 5D5XB 1JXSA 4CHUA 2G9WA 1Z91A 4M6XA 1TQIA 3GFLA 1RUOA 2OA4A 1VTNC 3ML6A 1WWXA 1I1GA 5K1YA 1FX7A 1ZG1A 1YQAA 3DPTA 3KEQA 3G73A 1QNTA 2V9VA 3KP3A 4KUMA 4KFCA 3LQQA 4M74A 5E8GA 2W85A 3M1EA 1B4AA 2PMUA 3SXYA 3MAJA 4EM0B 1J7KA 5E1WA 4YIIA 5DUKA 4I0AA 4LLLA 4IRIA 1FP2A 2R7FA 4U7BA 4Q47A 3JSOA 1ZN2A 1UHWA 2PMHA 2P6TA 3M8EA 2A3SA 1ONVA 3BOQA 1FBQA 4P5OA 3TKYA 1E2XA 4M71A 3ZMZA 3GFIA 1Z9CA 2EV5A 2CG4A 1U3EM 1ZGJA 3WG9A 4UHTA 3TO6A 2FQ3A 3RDIA 2L02A 4HOBA 3RYRA 3ECOA 3JW4A 2GA1A 4G7OF 1G4DA 5A2QK 2MD5A 3RYPA 3LSTA 5BQTA 1J75A 1KU2A 4Q4ZF 1EH7A 3LWFA 4GCVA 1FYKA 1ZRCA 4HA8A 3WGIA 5ICCA 2BEOA 3I58A 4HZFA 5FLXZ 1P6RA 3BROA 1T6SA 4IRGA 2CGPA 1YO5C 3R4KA 2M87A 3M8FA 3MFKA 2LDUA 4YFXF 4IPAA 3E6DA 1FYMA 1ULYA 2NNYA 1SFEA 1Z6TA 3C3WA 2HTJA 2XASA 4I01A 4Q48A 5HOOA 3HHHA 1FSHA 5DD4A 2M8EA 4RGSA 5CVUA 2HYFA 4CGZA 3T5XA 1D8KA 1YG2A 3OOPA 1IXRC 2HFHA 1KQ8A 1F1ZA 4R1HA 2FNAA 2M5WA 3NEUA 1T38A 4MNUA 3S2WA 2L3DA 2XKPA 1IN5A 4KMUX 5CVVA 3ZMSA 2EV6A 5ED4A 3F8NA 3MZHA 4L18B 4RGXA 4B8XA 5LRSA 3TDUC 4XSXF 4EJVA 3H3UA 2CYYA 5JR3A 2M1BA 2UWMA 5HLHA 3DQVC 1FT9A 4L9JA 1UB9A 4I0BA 1U6GA 1R00A 3BZ6A 3MQ0A 2FNPA 3SZTA 4EJOA 4OMZA 4B09A 4MTEA 3TOBA 2GIVA 3I0TA 3BP8A 1PDNC 1HSJA 2O0YA 1BC8C 2ZO4A 2A68F 3D5LA 3HOTA 1TNSA 2FXAA 1BOAA 4RGRA 3TDZC 2KIUA 2P5VA 4PZJA 3RJPA 3MEXA 4P96A 4JK1X 3IL2A 2RVCA 1B6AA 3V7CA 2JTVA 3GO5A 4HQEA 4O3MA 3GZ5A 1WRJA 3BPVA 4MEYF 1L3LA 2QBYB 1KU3A 2STTA 2PN6A 2YR2A 3P9IA 3W6JB 1P4XA 2HOEA 3BJ6A 3DFGA 1FNNA 5HVQC 1TLHB 1R22A 2GQQA 1SD6A 4YFKF 1FWZA 1ZREA 2GXGA 2GA2A 2P5KA 3I54A 3CUOA 2RV8A 2CSOA 2Z99A 3F21A 2V1UA 2HKOA 2PBIA 5AIPA 5L3FA 1KA8A 4OIOF 2ZKZA 1DPRA 2F2EA 5BMZA 4WK8F 2OQGA 2DPDA 4ZYGA 1U5TC 3I5UA 2D2WA 3O3KA 1XMKA 2ELHA 2VBZA 3E3VA 3GUDA 4RS8A 1TQMA 1LVAA 4YIFA 4UVBA 4YFNF 2P7CB 3WODF 2ZNYA 3V8LA 5F1RA 5L3EA 1O57A 5ICFA 3SZPA 2DQLA 2NNNA 4XLPF 1SD7A 3WTSC 2HEOA 4HYEA 5ICGA 3TGNA 4NB5A 5F64A 1SAXA 3I59A 3ROUA 3KP4A 4XSZF 3V4GA 4PDKA 3RKYA 1O3TA 3COAC 1ZLJA 2EK5A 3DPLC 3E5UA 2DW4A 1SD5A 1BIAA 2DLLA 4ETSA 5LGUA 5CYVA 3HUGA 4U0WA 3RIRA 3J81K 4D0PA 4Y15A 3VEPA 1ZRDA 3LA3A 3FXQA 1UCRA 1IRGA 2DI3A 2H09A 2E7WA 1XD7A 4WF2A 1T2KA 1XSXA 4LGWA 5IT3A 3KP2A 4HX4A 1JE8A 5BOXA 4U0YA 2NRAC 2VC1A 4M6YA 3V8JA 4ASNA 4GYGA 3K1MA 1TW3A 2FMYA 2A6HF 3GWZA 3KLNA 5L3GA 3F8MA 2PFBA 1HSTA 1TNTA 5FGMA 4S04A 4RB0A 1JHFA 2FBHA 5JVTA 4ZZLA 4RB3C 1F9NA 1LQ1A 1IN4A 3R61A 3ABUA 3HOSA 4MQVA 4BH9A 2E1NA 3B02A 1FOKA 3DF8A 3VOEA 1KYZA 2DU9A 1LB2A 5L3DA 2W57A 2HQRA 5JI6A 2UZKA 4HF2A 5EEGA 1FPQA 1RIOH 1K7AA 3LA2A 5D6EA 3WTXC 2P8TA 2PG4A 3GXOA 2L4AA 3DV8A 2XRNA 3WTWC 1F5TA 2IA1A 5ERIA 4R79A 2EWNA 2MA3A 4I98B 5LGTA 3SQNA 1V4RA 1S8NA 3BWGA 2IVMA 3HTSB 2K86A 2YU3A 4M72A 4ZZDA 3RKWA 1YS7A 4K2EA 4WXHA 1J2XA 1S29A 1Z6RA 3WTYC 2ADUA 4HLXA 3QAHA 4A0YA 5L3CA 5D4SA 4WCGA 2XAFA 2F5DA 4DQ2A 4HLYA 4UV9A 1OR7A 1YLFA 3P9CA 1H9GA 5HDKA 2KKOA 3FZVA 3KZYA 2ISZA 1UFMA 3TOAA 2EA2A 1BI2A 2HGCA 1KQ9A 4LB5A 1CGPA 3IWFA 5LHHA 5A2QZ 2AXLA 2COMA 1OYWA 2FMLA 4HAMA 4OIQF 1P4WA 1B59A 4OOIA 3KFWX 1P4AA 4M9ZA 3CLOA 4Y17A 3ZMDA 2VOPA 2E1CA 2IA2A 4ZYHA 2QUFA 3KP6A 1IXCA 1WI9A 1STZA 2XAJA 4KNYA 4BHBA 3F23A 4ENKA 1SMTA 4QWQA 1XGSA 2Z3YA 3BJAA 2LKPA 2A61A 1LEAA 5E1ZB 1ZRFA 2G7UA 4AWXB 1DPUA 3IWZA 4O5VA 1R1UA 5HLIA 1KYWA 4BHCA 2Y48A 2P7VB 3VFZA 4CO8A 3TQNA 2DK8A 1YW7A 3FMRA 3I59B 2GXBA 5H20A 3FM5A 4N9IA 4ESFA 5J8CA 2NAZA 5LHIA 3I4PA 5ILVA 1RI7A 1FBSA 2EV0A 1MGTA 5E8IA 4EM2A 4U7DA 3HYIA 1D3YA 1AWCA 4UVCA 3GFJA 4A5MA 4G94A 4I7HA 5D5WB 1B9MA 2JPBA 3T1BA 1LEBA 1FP1D 3R0JA 1YS6A 2WV0A 4HF1A 2KJBA 5E20A 2B0LA 2FBKA 3FMSA 2VE9A 4HW0A 3HRTA 4CXFA 5LEJA 5K5QA 4KA4A 3JAMZ 3I64A 2DT5A 4G8XA 2QLZA 4BAYA 2BGCA 3JSPA 1ON1A 2HZTA 1XSDA 1IN7A 3QPTA 4NQWA 4NHJA 2FRHA 4LD5A 4IRHA 1BBYA 2Q2EA 2QZ8A 2MH9A 2RKHA 1I27A 3ULQB 1V3FA 2F5EA 1J59A 2E7XA 1XCVA 3EUHA 2BYVE 5D5VB 4U0VA 3EYYA 2LSOA 2EFPA 3RPQA 1W7PD 4ESBA 3B73A 2H27A 2K7LA 3CTAA 1S3JA 2LF7A 3PFIA 2DPUA 2MLKA 2K02A 2JSCA 3GLXA 2J5OA 1PP7U 3WU0A 4WWCA 2X4HA 4RB1A 2QQ9A 1YTYA 1GVJA 4OU0A 3EDPA 1FLIA 4N0BA 2O8XA 2Z33A 5BS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZBK A;  4EQQ A;  2D1H A;  5H6R A;  3HSE A;  5CVR A;  3D0S A;  2P6S A;  4G6D A;  2EA4 A;  3ECH A;  1ZYR F;  3JAM K;  1ZG5 A;  2VN2 A;  5J8F A;  3FX3 A;  2STW A;  3MCZ A;  2ZJ2 A;  1SFU A;  3SHF A;  3W6K B;  3IRR A;  2K4B A;  3P9K A;  1R5H A;  2C6Y A;  2OQR A;  2IT0 A;  2UXX A;  3K0L A;  1HW1 A;  5DCF A;  1U2W A;  2QEN A;  3I71 A;  1REP C;  2CO5 A;  1T0F A;  1K79 A;  5IT9 K;  1P92 A;  1YW8 A;  4P9F A;  2OD5 A;  3F8B A;  4HV5 A;  3Q9S A;  1UHM A;  1QBJ A;  3IRQ A;  4AIH A;  3E5X A;  1IRF A;  4GO1 A;  1IAW A;  2P4W A;  3HTU A;  4EM1 A;  1USS A;  2DFI A;  2W84 A;  3JTG A;  1JHH A;  4N9H A;  1SD4 A;  4GYI A;  1O7L A;  1HQC A;  3J81 Z;  3HRU A;  2IJL A;  4KYW A;  2HKX A;  2EFW A;  5FB2 A;  3O6B B;  3T8R A;  3N97 A;  2VOO A;  1RNL A;  4LMY A;  2L01 A;  1IN6 A;  4MGR A;  2O3F A;  3F8F A;  3AAF A;  3P7N A;  5TRD A;  3WTZ A;  5HDN A;  3GEZ A;  3EQL F;  3E6M A;  1Z7U A;  5D6F A;  1QZZ A;  3CO6 C;  4IF4 A;  2PQ8 A;  4XLN F;  1XN7 A;  1LDD A;  3EET A;  1MD0 A;  2HTS A;  2DAO A;  2HYG D;  4KN4 X;  2GZW A;  2K4J A;  2MC3 A;  2VBY A;  1PUE E;  3E97 A;  4A0Z A;  1BJA A;  2VBW A;  1XDU A;  1HKT A;  4EJU A;  5AIQ A;  5F6F A;  1NHA A;  4P55 A;  3BY6 A;  1YFH A;  2A6E F;  3WTV C;  4FX4 A;  3U2R A;  2NYX A;  5LLQ A;  2MLG A;  1U8R A;  3M9A A;  1D8J A;  2LF8 A;  3U9G A;  4A6E A;  1QQI A;  5DD8 A;  4I09 A;  3PQJ A;  3DP7 A;  4LJZ F;  1XGM A;  3K9T A;  4TV7 A;  1ZHF A;  1K78 A;  3KZZ A;  1IW7 F;  4I02 A;  1B9N A;  3ZPL A;  1JGS A;  1BC7 C;  4HDV A;  3GYH X;  3FF5 A;  4PGH A;  3DEU A;  2CWE A;  2PI0 A;  4DNC A;  3VB2 A;  4EMS A;  2LNB A;  3KLO A;  2IPQ X;  4L9N A;  4CIC A;  3CUQ C;  1ZAR A;  1QO0 D;  1IN8 A;  4G9Y A;  5TJJ A;  1U5T A;  2XAH A;  3GVA A;  4G7H F;  4ON0 A;  4BXU A;  3WGH A;  1G3S A;  4EJT A;  3QU6 A;  2PEX A;  3DXJ F;  1G6N A;  4ZH4 F;  4XRF A;  4WXC A;  3HRS A;  4YG2 F;  1PP8 F;  3MZY A;  4EJW A;  2CQK A;  4U88 A;  2EB7 A;  5L3B A;  5FD6 A;  6PAX A;  2RGV A;  5JHU A;  4LG0 A;  3LAP A;  4AIK A;  5D8L B;  3ZQ7 A;  1J5Y A;  1ZLK A;  2MBF A;  3GF2 A;  2FEZ A;  2BBY A;  2YPR A;  4L5I A;  3WU1 B;  1HW5 A;  2IP2 A;  2ZCW A;  1G3T A;  5FD5 A;  2XUB A;  1R7J A;  4KIB A;  1B1B A;  2Z5U A;  1T98 A;  3T8T A;  4L9V A;  1ZAO A;  2ESN A;  4I2O A;  2XV4 S;  4M9S A;  3L7W A;  1DP7 P;  3EYI A;  3T0Y A;  1XSV A;  3ELK A;  1U78 A;  2HS5 A;  5DDG A;  5DEQ A;  3HRM A;  1RZ4 A;  3FHZ A;  1E17 A;  2RC4 A;  2XAG A;  2R7D A;  1WQ2 A;  2ZXJ A;  1XGN A;  2ETH A;  2QWW A;  2YX7 A;  4O6J A;  3F8C A;  1FZP B;  4EVI A;  3CUQ A;  1DDN A;  5AON A;  2VC0 A;  4M9X A;  4ENM A;  1X3U A;  3RKX A;  3G3Z A;  5FFX A;  2YX4 A;  5D8K B;  5BPD A;  3QP5 A;  1YIO A;  3R0A A;  4RAZ A;  3CO7 C;  1F4K A;  3M7G A;  2XGX A;  2QQB A;  3HHG A;  2KJC A;  4LFU A;  5H6Q A;  3KP7 A;  2QQA A;  5DYM A;  4A0X A;  5LRR A;  2L54 A;  4LLG F;  1HXD A;  3KEO A;  4IJA A;  1ODD A;  2QYO A;  1KU9 A;  4ESJ A;  2VXZ A;  4QLC U;  1W5S A;  3K1P A;  3ERE D;  3SFZ A;  4WX9 A;  1FY7 A;  3KP5 A;  2G7H A;  2KIM A;  4HX7 A;  3KCC A;  5HDG A;  1XDS A;  3WTU C;  2QM3 A;  4LB6 B;  3ZMT A;  2JZY A;  4CYD A;  4EV0 A;  3N4M A;  2DO7 A;  4BQA A;  4E70 A;  2V79 A;  4LK1 F;  1YYV A;  2FBI A;  3OV8 A;  2VON A;  4ENJ A;  2UXN A;  1IUY A;  4AVP A;  2W25 A;  3E5Q A;  4FHT A;  1R5G A;  5HS7 A;  3LAJ A;  4R8H A;  3C1D A;  3E6B A;  1XGO A;  3J80 Z;  1O3R A;  3F3X A;  4GGG A;  3GW2 A;  1K78 B;  2JT1 A;  1K6O A;  4F7Z A;  2L4M A;  5BPI A;  4PGG A;  1CF7 A;  2ZNZ A;  3HSR A;  1XB4 A;  3ZP5 A;  2XHK A;  3Q5F A;  3TO9 A;  1H0M A;  2ESH A;  3V7R A;  4AD9 A;  5LBQ A;  2M30 A;  1GHC A;  1D5V A;  4OIN F;  5EEH A;  1MZB A;  4LK0 F;  2GWR A;  1U5T B;  1G3Y A;  1SMY F;  1I6X A;  2WC2 A;  3C7J A;  2HDC A;  3BPX A;  1HW2 A;  3V8K A;  1OMI A;  2WTE A;  3CDH A;  1IZ1 A;  4G7Z F;  4IHS A;  5E17 F;  2TDX A;  1HKS A;  2VT3 A;  1J0R A;  5HLG A;  5IT9 Z;  2HQN A;  3O2P E;  4LLN A;  2ACJ A;  3NRV A;  5FO5 A;  4A2U A;  4LG0 B;  3FXR A;  4A12 A;  3QP6 A;  4ZYE A;  3FXU A;  1IF1 A;  4KIC A;  4KMF A;  4BYY A;  4CZZ A;  1BI0 A;  5CJ9 A;  2BV6 A;  1R23 A;  1TQP A;  2P5L C;  4ENN A;  2RNJ A;  3MWM A;  4CDG A;  2MH2 A;  1W7P A;  1SFX A;  2IRF G;  3J80 K;  2CW0 F;  2VE8 A;  4XBF A;  2ZME A;  1TBX A;  3HIF A;  3FM3 A;  1W5T A;  1KQ0 A;  2H6C A;  1C0W A;  1XMA A;  5K5R A;  4JQF A;  1FC3 A;  2IA0 A;  4KN7 X;  2VOD A;  1OYY A;  2RQP A;  3CUQ B;  4IVN A;  1R1T A;  1O3Q A;  1MDM A;  5FFZ A;  2RDP A;  1S7A A;  1LDK B;  5CVI A;  1IXS B;  4FT8 A;  5DCM A;  1DUX C;  1ZH5 A;  1R58 A;  3ZN0 A;  1Z1D A;  3H92 A;  1O3S A;  3R6S A;  1S6L A;  3ISP A;  2KIF A;  4UV8 A;  4RGU A;  5J6X A;  3WE3 A;  4BNC A;  5FLX K;  5CLS A;  1FYL A;  1MKM A;  2DTR A;  3BJO A;  2Y0M A;  2FSW A;  2Q8K A;  2K27 A;  1WKM A;  2VBX A;  2EFO A;  3V7S A;  3LA7 A;  1ON2 A;  4HF0 A;  2DBB A;  2J5P A;  2D1V A;  3L00 A;  1AOY A;  4FX0 A;  1W4M A;  2JRT A;  4Y13 A;  2GAU A;  3TO7 A;  1BI1 A;  5HS8 A;  1J9I A;  5KK1 A;  2DK5 A;  3F6O A;  1FBU A;  1I1S A;  5DUI A;  1R1V A;  4Q5S F;  4ZYD A;  2XIG A;  3K69 A;  2ZFW A;  3HSF A;  2RN7 A;  1OPC A;  5ICE A;  2Z9O A;  4EGY A;  3VOD A;  3WGG A;  2W24 A;  5K5O A;  3LQR A;  4WXD A;  3BDD A;  1QGP A;  3F72 A;  2PLY A;  2F5C A;  1MJ9 A;  3ABT A;  5LHG A;  4EGZ A;  1Y0U A;  2A5Y B;  2EFQ A;  4Z2Y A;  1HBX G;  4S05 A;  1KU7 A;  3WTT C;  2CFX A;  2FE3 A;  2H6B A;  2OBP A;  3IC7 A;  4AIJ A;  2BE5 F;  1T39 A;  1GXP A;  1HKQ A;  2XAQ A;  3KET A;  1KGS A;  3F6V A;  2X0L A;  1BIB A;  4UNO A;  2HWV A;  1CF7 B;  4UXN A;  4L0Z B;  1MJA A;  3RTR A;  2FU4 A;  2NS0 A;  4M73 A;  2FA5 A;  4IHT A;  3ZMU A;  3ZN1 A;  3REO A;  1WSU A;  1UST A;  1H9T A;  4KIG A;  3NQO A;  3IKT A;  2F5F A;  4BHP A;  1LJ9 A;  4KT5 C;  4HQM A;  1OKR A;  4A6D A;  3E6C C;  2XKO A;  3QOP A;  5E1X A;  4L0Y B;  2ISY A;  2H94 A;  2Y75 A;  5D5U B;  1FSE A;  2O03 A;  4MEX F;  3Q9V A;  4OIR F;  1TTY A;  3H3Z A;  3ZMV A;  3K1N A;  3FWE A;  5LGN A;  3L2C A;  2V1D A;  1P2F A;  1OYI A;  3IHU A;  2A69 F;  2OAZ A;  2XVC A;  5JFR A;  1W7P B;  1TW2 A;  1QPM A;  2FF4 A;  4KIF A;  3K2Z A;  2ZME B;  5HS9 A;  1Z05 A;  2AS5 F;  5KVR A;  4HV6 A;  3FMQ A;  2V6C A;  1EH6 A;  3I53 A;  2PJP A;  1I5Z A;  3QU3 A;  3WE2 A;  4OIP F;  5ILU A;  4MHG A;  1BM9 A;  3QRF F;  4OMY A;  2EJR A;  3PQK A;  4A5N A;  2JPC A;  5D4R A;  3U1D A;  1XCB A;  4UUV A;  1MDM B;  1LNW A;  4JBA A;  2R3S A;  3RI4 A;  4MTD A;  1S7O A;  5DCM B;  4UVA A;  2HR3 A;  4G6Q A;  2XRO A;  4HX8 A;  2FOK A;  1BI3 A;  3RPU A;  5CVJ A;  4HDU A;  5DV5 A;  3JTH A;  3LFK A;  2O61 A;  2OZ6 A;  3CJN A;  3L9F A;  3GZ6 A;  1G3W A;  3DKW A;  1LDJ A;  2V1X A;  1QZY A;  3IKV A;  2M45 A;  3GX4 X;  3C18 A;  3KE2 A;  2O6G E;  1YW9 A;  4RAY A;  4P9U A;  2KRF A;  3R60 A;  4RB2 C;  4PCQ A;  2DQR A;  4IXA A;  5LEK A;  3GFM A;  2EFN A;  1L0O C;  4HBL A;  5E18 F;  1EH8 A;  2QVO A;  1RUN A;  1Q1H A;  4GXO A;  1R36 A;  4MQ9 F;  1MJB A;  2OZU A;  4L5J A;  1A04 A;  2WWY A;  3J7A O;  4L9T A;  2Q0O A;  2OU2 A;  2A07 F;  4KDP A;  1ZGA A;  4H0E A;  5ILS A;  1ZG3 A;  2QBY A;  2IW5 A;  1EV7 A;  3QPH A;  2VT2 A;  3F22 A;  1BN5 A;  1O7F A;  3L09 A;  2D45 A;  2YSR A;  1GXQ A;  5D5X B;  1JXS A;  4CHU A;  2G9W A;  1Z91 A;  4M6X A;  1TQI A;  3GFL A;  1RUO A;  2OA4 A;  1VTN C;  3ML6 A;  1WWX A;  1I1G A;  5K1Y A;  1FX7 A;  1ZG1 A;  1YQA A;  3DPT A;  3KEQ A;  3G73 A;  1QNT A;  2V9V A;  3KP3 A;  4KUM A;  4KFC A;  3LQQ A;  4M74 A;  5E8G A;  2W85 A;  3M1E A;  1B4A A;  2PMU A;  3SXY A;  3MAJ A;  4EM0 B;  1J7K A;  5E1W A;  4YII A;  5DUK A;  4I0A A;  4LLL A;  4IRI A;  1FP2 A;  2R7F A;  4U7B A;  4Q47 A;  3JSO A;  1ZN2 A;  1UHW A;  2PMH A;  2P6T A;  3M8E A;  2A3S A;  1ONV A;  3BOQ A;  1FBQ A;  4P5O A;  3TKY A;  1E2X A;  4M71 A;  3ZMZ A;  3GFI A;  1Z9C A;  2EV5 A;  2CG4 A;  1U3E M;  1ZGJ A;  3WG9 A;  4UHT A;  3TO6 A;  2FQ3 A;  3RDI A;  2L02 A;  4HOB A;  3RYR A;  3ECO A;  3JW4 A;  2GA1 A;  4G7O F;  1G4D A;  5A2Q K;  2MD5 A;  3RYP A;  3LST A;  5BQT A;  1J75 A;  1KU2 A;  4Q4Z F;  1EH7 A;  3LWF A;  4GCV A;  1FYK A;  1ZRC A;  4HA8 A;  3WGI A;  5ICC A;  2BEO A;  3I58 A;  4HZF A;  5FLX Z;  1P6R A;  3BRO A;  1T6S A;  4IRG A;  2CGP A;  1YO5 C;  3R4K A;  2M87 A;  3M8F A;  3MFK A;  2LDU A;  4YFX F;  4IPA A;  3E6D A;  1FYM A;  1ULY A;  2NNY A;  1SFE A;  1Z6T A;  3C3W A;  2HTJ A;  2XAS A;  4I01 A;  4Q48 A;  5HOO A;  3HHH A;  1FSH A;  5DD4 A;  2M8E A;  4RGS A;  5CVU A;  2HYF A;  4CGZ A;  3T5X A;  1D8K A;  1YG2 A;  3OOP A;  1IXR C;  2HFH A;  1KQ8 A;  1F1Z A;  4R1H A;  2FNA A;  2M5W A;  3NEU A;  1T38 A;  4MNU A;  3S2W A;  2L3D A;  2XKP A;  1IN5 A;  4KMU X;  5CVV A;  3ZMS A;  2EV6 A;  5ED4 A;  3F8N A;  3MZH A;  4L18 B;  4RGX A;  4B8X A;  5LRS A;  3TDU C;  4XSX F;  4EJV A;  3H3U A;  2CYY A;  5JR3 A;  2M1B A;  2UWM A;  5HLH A;  3DQV C;  1FT9 A;  4L9J A;  1UB9 A;  4I0B A;  1U6G A;  1R00 A;  3BZ6 A;  3MQ0 A;  2FNP A;  3SZT A;  4EJO A;  4OMZ A;  4B09 A;  4MTE A;  3TOB A;  2GIV A;  3I0T A;  3BP8 A;  1PDN C;  1HSJ A;  2O0Y A;  1BC8 C;  2ZO4 A;  2A68 F;  3D5L A;  3HOT A;  1TNS A;  2FXA A;  1BOA A;  4RGR A;  3TDZ C;  2KIU A;  2P5V A;  4PZJ A;  3RJP A;  3MEX A;  4P96 A;  4JK1 X;  3IL2 A;  2RVC A;  1B6A A;  3V7C A;  2JTV A;  3GO5 A;  4HQE A;  4O3M A;  3GZ5 A;  1WRJ A;  3BPV A;  4MEY F;  1L3L A;  2QBY B;  1KU3 A;  2STT A;  2PN6 A;  2YR2 A;  3P9I A;  3W6J B;  1P4X A;  2HOE A;  3BJ6 A;  3DFG A;  1FNN A;  5HVQ C;  1TLH B;  1R22 A;  2GQQ A;  1SD6 A;  4YFK F;  1FWZ A;  1ZRE A;  2GXG A;  2GA2 A;  2P5K A;  3I54 A;  3CUO A;  2RV8 A;  2CSO A;  2Z99 A;  3F21 A;  2V1U A;  2HKO A;  2PBI A;  5AIP A;  5L3F A;  1KA8 A;  4OIO F;  2ZKZ A;  1DPR A;  2F2E A;  5BMZ A;  4WK8 F;  2OQG A;  2DPD A;  4ZYG A;  1U5T C;  3I5U A;  2D2W A;  3O3K A;  1XMK A;  2ELH A;  2VBZ A;  3E3V A;  3GUD A;  4RS8 A;  1TQM A;  1LVA A;  4YIF A;  4UVB A;  4YFN F;  2P7C B;  3WOD F;  2ZNY A;  3V8L A;  5F1R A;  5L3E A;  1O57 A;  5ICF A;  3SZP A;  2DQL A;  2NNN A;  4XLP F;  1SD7 A;  3WTS C;  2HEO A;  4HYE A;  5ICG A;  3TGN A;  4NB5 A;  5F64 A;  1SAX A;  3I59 A;  3ROU A;  3KP4 A;  4XSZ F;  3V4G A;  4PDK A;  3RKY A;  1O3T A;  3COA C;  1ZLJ A;  2EK5 A;  3DPL C;  3E5U A;  2DW4 A;  1SD5 A;  1BIA A;  2DLL A;  4ETS A;  5LGU A;  5CYV A;  3HUG A;  4U0W A;  3RIR A;  3J81 K;  4D0P A;  4Y15 A;  3VEP A;  1ZRD A;  3LA3 A;  3FXQ A;  1UCR A;  1IRG A;  2DI3 A;  2H09 A;  2E7W A;  1XD7 A;  4WF2 A;  1T2K A;  1XSX A;  4LGW A;  5IT3 A;  3KP2 A;  4HX4 A;  1JE8 A;  5BOX A;  4U0Y A;  2NRA C;  2VC1 A;  4M6Y A;  3V8J A;  4ASN A;  4GYG A;  3K1M A;  1TW3 A;  2FMY A;  2A6H F;  3GWZ A;  3KLN A;  5L3G A;  3F8M A;  2PFB A;  1HST A;  1TNT A;  5FGM A;  4S04 A;  4RB0 A;  1JHF A;  2FBH A;  5JVT A;  4ZZL A;  4RB3 C;  1F9N A;  1LQ1 A;  1IN4 A;  3R61 A;  3ABU A;  3HOS A;  4MQV A;  4BH9 A;  2E1N A;  3B02 A;  1FOK A;  3DF8 A;  3VOE A;  1KYZ A;  2DU9 A;  1LB2 A;  5L3D A;  2W57 A;  2HQR A;  5JI6 A;  2UZK A;  4HF2 A;  5EEG A;  1FPQ A;  1RIO H;  1K7A A;  3LA2 A;  5D6E A;  3WTX C;  2P8T A;  2PG4 A;  3GXO A;  2L4A A;  3DV8 A;  2XRN A;  3WTW C;  1F5T A;  2IA1 A;  5ERI A;  4R79 A;  2EWN A;  2MA3 A;  4I98 B;  5LGT A;  3SQN A;  1V4R A;  1S8N A;  3BWG A;  2IVM A;  3HTS B;  2K86 A;  2YU3 A;  4M72 A;  4ZZD A;  3RKW A;  1YS7 A;  4K2E A;  4WXH A;  1J2X A;  1S29 A;  1Z6R A;  3WTY C;  2ADU A;  4HLX A;  3QAH A;  4A0Y A;  5L3C A;  5D4S A;  4WCG A;  2XAF A;  2F5D A;  4DQ2 A;  4HLY A;  4UV9 A;  1OR7 A;  1YLF A;  3P9C A;  1H9G A;  5HDK A;  2KKO A;  3FZV A;  3KZY A;  2ISZ A;  1UFM A;  3TOA A;  2EA2 A;  1BI2 A;  2HGC A;  1KQ9 A;  4LB5 A;  1CGP A;  3IWF A;  5LHH A;  5A2Q Z;  2AXL A;  2COM A;  1OYW A;  2FML A;  4HAM A;  4OIQ F;  1P4W A;  1B59 A;  4OOI A;  3KFW X;  1P4A A;  4M9Z A;  3CLO A;  4Y17 A;  3ZMD A;  2VOP A;  2E1C A;  2IA2 A;  4ZYH A;  2QUF A;  3KP6 A;  1IXC A;  1WI9 A;  1STZ A;  2XAJ A;  4KNY A;  4BHB A;  3F23 A;  4ENK A;  1SMT A;  4QWQ A;  1XGS A;  2Z3Y A;  3BJA A;  2LKP A;  2A61 A;  1LEA A;  5E1Z B;  1ZRF A;  2G7U A;  4AWX B;  1DPU A;  3IWZ A;  4O5V A;  1R1U A;  5HLI A;  1KYW A;  4BHC A;  2Y48 A;  2P7V B;  3VFZ A;  4CO8 A;  3TQN A;  2DK8 A;  1YW7 A;  3FMR A;  3I59 B;  2GXB A;  5H20 A;  3FM5 A;  4N9I A;  4ESF A;  5J8C A;  2NAZ A;  5LHI A;  3I4P A;  5ILV A;  1RI7 A;  1FBS A;  2EV0 A;  1MGT A;  5E8I A;  4EM2 A;  4U7D A;  3HYI A;  1D3Y A;  1AWC A;  4UVC A;  3GFJ A;  4A5M A;  4G94 A;  4I7H A;  5D5W B;  1B9M A;  2JPB A;  3T1B A;  1LEB A;  1FP1 D;  3R0J A;  1YS6 A;  2WV0 A;  4HF1 A;  2KJB A;  5E20 A;  2B0L A;  2FBK A;  3FMS A;  2VE9 A;  4HW0 A;  3HRT A;  4CXF A;  5LEJ A;  5K5Q A;  4KA4 A;  3JAM Z;  3I64 A;  2DT5 A;  4G8X A;  2QLZ A;  4BAY A;  2BGC A;  3JSP A;  1ON1 A;  2HZT A;  1XSD A;  1IN7 A;  3QPT A;  4NQW A;  4NHJ A;  2FRH A;  4LD5 A;  4IRH A;  1BBY A;  2Q2E A;  2QZ8 A;  2MH9 A;  2RKH A;  1I27 A;  3ULQ B;  1V3F A;  2F5E A;  1J59 A;  2E7X A;  1XCV A;  3EUH A;  2BYV E;  5D5V B;  4U0V A;  3EYY A;  2LSO A;  2EFP A;  3RPQ A;  1W7P D;  4ESB A;  3B73 A;  2H27 A;  2K7L A;  3CTA A;  1S3J A;  2LF7 A;  3PFI A;  2DPU A;  2MLK A;  2K02 A;  2JSC A;  3GLX A;  2J5O A;  1PP7 U;  3WU0 A;  4WWC A;  2X4H A;  4RB1 A;  2QQ9 A;  1YTY A;  1GVJ A;  4OU0 A;  3EDP A;  1FLI A;  4N0B A;  2O8X A;  2Z33 A;  5BS6 A; 
#chains in the Genus database with same CATH topology
 2IXS A;  4BUP A;  4LG3 A;  2ZBK A;  2M4K A;  4EQQ A;  2D1H A;  5H6R A;  3HSE A;  2KL4 A;  1VQM I;  5CVR A;  4XRM A;  2X6Y A;  2YUS A;  3GCM A;  3D0S A;  1XPX A;  2P6S A;  1BR2 A;  4G6D A;  2EA4 A;  3ECH A;  1ZYR F;  2L7K A;  3BTC A;  4PFO A;  3K4N A;  1YIT I;  3JAM K;  2BY0 A;  1P7J A;  1ZG5 A;  2IBD A;  2HZD A;  4DYC A;  2VN2 A;  1RPW A;  5J8F A;  3FX3 A;  3D1N I;  2STW A;  3MCZ A;  2ECC A;  2ZJ2 A;  1SFU A;  3RZD J;  3SHF A;  3W6K B;  3IRR A;  2K4B A;  3A01 A;  4KIT B;  3P9K A;  1R5H A;  3BQZ A;  2OQR A;  5GAH J;  1PUF A;  2C6Y A;  2IT0 A;  2IS4 A;  2HVQ A;  2UXX A;  3PFY A;  3K0L A;  4BS9 A;  1VQO I;  3TMO A;  1QA6 A;  9ANT A;  1HW1 A;  3M1C A;  3IAS 2;  5DCF A;  1U2W A;  2QEN A;  2E2J J;  4XON A;  3I71 A;  1REP C;  2CO5 A;  3MKZ A;  2B63 J;  1T0F A;  1K79 A;  5IT9 K;  1OCR H;  3HXL A;  1P92 A;  1YW8 A;  4P9F A;  1F36 A;  3H9J A;  5K7F A;  2QKL B;  2OD5 A;  4E7L A;  3F8B A;  1P9Q C;  4HV5 A;  3Q9S A;  1UHM A;  1QHG A;  4D1Q A;  3BG6 A;  4BE1 A;  1QBJ A;  3IRQ A;  2MGQ A;  4A3F J;  2WAQ A;  4AIH A;  3E5X A;  1IRF A;  4GO1 A;  1IAW A;  3AL0 B;  2P4W A;  3HTU A;  4B47 A;  4NDL A;  4EM1 A;  1OCZ H;  2K9L A;  1UHS A;  3HOX J;  1USS A;  2DFI A;  2W84 A;  1VQ4 I;  3DEW A;  3JTG A;  1JHH A;  4N9H A;  1SD4 A;  4GYI A;  5EEA A;  2E2I J;  1WJB A;  3IV5 A;  2L0K A;  1O7L A;  1HQC A;  2IAI A;  3J81 Z;  3HRU A;  5J4Y A;  2IJL A;  1BL0 A;  4KYW A;  2HKX A;  2EFW A;  1D0X A;  5FB2 A;  3ZR8 X;  3O6B B;  4W97 A;  3T8R A;  1PYV A;  3N97 A;  2LH9 A;  2VOO A;  1RNL A;  4LMY A;  1FJL A;  3BG9 A;  2I8D A;  3I9V 2;  2L01 A;  4A3B J;  1IN6 A;  4MGR A;  1RRJ A;  2O3F A;  3F8F A;  1ZQ3 P;  2VJ4 A;  3AAF A;  3CP2 A;  3PM1 A;  3P7N A;  5TRD A;  5TGT A;  3WTZ A;  4CCO A;  4F52 A;  5HDN A;  3CCV I;  2FQ4 A;  3GEZ A;  3EQL F;  3E6M A;  2NVY J;  2ELK A;  1Z7U A;  2XGC A;  5D6F A;  1QZZ A;  3NWS A;  5HNF A;  3CJR B;  2R7O A;  4CCM A;  4A3G J;  2OTJ I;  1D1B A;  3CO6 C;  4IF4 A;  4A3E J;  2PQ8 A;  4FIS A;  4NNJ A;  2MFZ A;  4S0H B;  3GME A;  1U8B A;  3PJR A;  3OYM A;  4XLN F;  2M8G X;  2WAD A;  1XN7 A;  3ESW B;  1AKH A;  3DTI A;  1LDD A;  4BGD A;  1JKR C;  1NG6 A;  4C2U A;  3VPR A;  4XK4 A;  3EET A;  1MD0 A;  2OTL I;  2HTS A;  2DAO A;  2HYG D;  4KN4 X;  3C2B A;  3M8J A;  2GZW A;  2K4J A;  2MC3 A;  4D5C A;  2VBY A;  3BG7 A;  4XL9 A;  1PUE E;  3E97 A;  4A0Z A;  1BJA A;  4RBO A;  2VBW A;  4Y52 J;  2QCO A;  2DA7 A;  3PO3 J;  1XDU A;  1HKT A;  2WAF A;  4EJU A;  3CQZ J;  5AIQ A;  5F6F A;  3UR3 C;  1NHA A;  4P55 A;  3BY6 A;  1YFH A;  2A6E F;  3U1K A;  2JUC A;  3WTV C;  4FX4 A;  3ZQL A;  3U2R A;  2NYX A;  3K4J A;  5LLQ A;  2MC4 A;  2MLG A;  1U8R A;  2R7Z J;  2ME0 A;  2K3P A;  3UNG C;  2DTZ A;  4AM3 A;  3M9A A;  1D8J A;  2LF8 A;  1IRZ A;  2LK2 A;  3BZC A;  3U9G A;  1WJC A;  2VUM J;  4A6E A;  1X58 A;  1Y8Q B;  1X3W B;  1QQI A;  1QZE A;  5DD8 A;  4I09 A;  1T08 B;  3PQJ A;  1K6Y A;  1V5F A;  4NQW B;  3DP7 A;  1ITY A;  4LJZ F;  1VQP I;  1XGM A;  3K9T A;  5J1Y A;  4TV7 A;  1ZHF A;  2Q2E B;  3LSK A;  5F0F A;  1FTZ A;  2VI6 A;  1K78 A;  3KZZ A;  1IW7 F;  4I02 A;  4N4N B;  1B9N A;  1U9N A;  3ZPL A;  1JGS A;  1BC7 C;  2NS7 A;  4DOZ A;  4HDV A;  1APL C;  4XMY A;  3H36 A;  1MMG A;  3GYH X;  2E1M C;  1DU6 A;  3FF5 A;  4PGH A;  3DEU A;  3G1M A;  4ZTJ A;  2CWE A;  2PI0 A;  1E3H A;  2XAU A;  4DNC A;  1K4S A;  4M3E A;  1TC3 C;  4A3K J;  3LMM A;  3VB2 A;  3OIO A;  2OCE A;  4BEH B;  4RLQ A;  1UZC A;  1POG A;  4EMS A;  3OSG A;  3W2A A;  2LNB A;  3KLO A;  2ZB9 A;  2IPQ X;  1VI0 A;  4L9N A;  4CIC A;  4V2F A;  3CUQ C;  1FIP A;  1ZAR A;  1MMS A;  1HLV A;  2ZC2 A;  1QO0 D;  1DP3 A;  1IN8 A;  4G9Y A;  1G2H A;  4B48 A;  5TJJ A;  1U5T A;  2XAH A;  3BTI A;  3GVA A;  4G7H F;  4M3G A;  3ONQ A;  3OYL A;  4CH7 A;  2DMN A;  4ON0 A;  4BXU A;  3WGH A;  1G3S A;  4EJT A;  2CFO A;  3QU6 A;  2PEX A;  3DXJ F;  1G6N A;  2O8K A;  1OCT C;  2CW8 A;  3CES A;  3DPU A;  4ZH4 F;  1MBF A;  4HPQ A;  1IJW C;  4RDU A;  2X48 A;  4XRF A;  5E3N A;  1JJ8 C;  2R5Y B;  2NOJ B;  3BG5 A;  4WXC A;  3HRS A;  3O8H A;  1IO2 A;  2RRE A;  1IDZ A;  4YG2 F;  1PP8 F;  3MZY A;  4EJW A;  2CQK A;  1MND A;  4U88 A;  2EB7 A;  4EAT A;  5L3B A;  5FD6 A;  3JRH A;  6PAX A;  3H3V K;  2RGV A;  1Z0X A;  5JHU A;  3ASO H;  2M0M A;  1MH3 A;  2EIL H;  4LG0 A;  3LAP A;  2GM4 A;  5J1U A;  4AIK A;  5D8L B;  3ZQ7 A;  2L9S A;  3K4B A;  1J5Y A;  2LD5 A;  4D9J A;  2E19 A;  3OYC A;  1XTA A;  3M07 A;  1ZLK A;  5GP9 A;  2CV0 A;  2MBF A;  4BY1 J;  2DOD A;  3GF2 A;  2FEZ A;  2LY1 A;  2GOM A;  1FTT A;  3GTQ J;  2BBY A;  2YPR A;  1ZR2 A;  4L5I A;  3S2H J;  5KHD A;  3WU1 B;  1HW5 A;  2VKH A;  2IP2 A;  2ZCW A;  4I76 A;  3E1S A;  4X1E A;  4C3J J;  1G3T A;  1MMN A;  5FD5 A;  2HVS A;  2XUB A;  1R7J A;  4KIB A;  1B1B A;  2BOL A;  2Z5U A;  5EDN A;  1T98 A;  2LY2 A;  3JRB A;  3T8T A;  3RPU D;  5EZH A;  3FKI J;  4L9V A;  2LR8 A;  4IL6 C;  2KT0 A;  2MYS A;  4NC6 A;  3A01 B;  3OS2 A;  1PUF B;  3DCF A;  1ZAO A;  2ESN A;  4I2O A;  2XV4 S;  1FMW A;  2E5Z A;  4M9S A;  3TP0 A;  1LUJ B;  1ETO A;  3L7W A;  1DP7 P;  3EYI A;  3T0Y A;  3X2Q H;  2L7M P;  2GLO A;  2R7Q A;  2JA7 J;  1XSV A;  3QYF A;  3M3Y J;  3ELK A;  1U78 A;  2HS5 A;  4AID A;  5J47 A;  5DDG A;  2JA8 J;  3BR2 A;  5DEQ A;  4IX7 A;  3DTE A;  1RZ4 A;  3HRM A;  3FHZ A;  1E17 A;  3SJM A;  2RC4 A;  2XAG A;  2R7D A;  1WQ2 A;  1ETK A;  2ZXJ A;  2E34 A;  1XGN A;  5CKT A;  2ETH A;  3WG7 H;  2EPF A;  2QWW A;  2V9K A;  2F6C A;  2XGE A;  2YX7 A;  4O6J A;  3F8C A;  4XIC A;  4EVI A;  1FZP B;  3CUQ A;  4XKW A;  1QVU A;  2L5Q A;  1DDN A;  5AON A;  5C3E J;  2VC0 A;  2B9S A;  1MBG A;  4KIS A;  4M9X A;  4ENM A;  5K7H A;  1X3U A;  4C9Y A;  1YJ9 I;  3PSI A;  3RKX A;  4DYQ A;  3G3Z A;  5FFX A;  3A2K A;  5J40 A;  2YX4 A;  4DJA A;  5D8K B;  5BPD A;  3QP5 A;  1IGN A;  1YIO A;  1VFC A;  3OYE A;  3R0A A;  4RAZ A;  3CO7 C;  5C4J J;  1F4K A;  4CCJ A;  4JP0 A;  1ACI A;  4QPQ A;  3CDL A;  3HOU J;  4D7M A;  4DIQ A;  2CV2 A;  2M7B A;  2XF6 A;  5J4V A;  1SVL A;  2IGM A;  5IOY A;  3M7G A;  2XGX A;  2LP0 A;  2QQB A;  2W48 A;  3K6G A;  3HHG A;  5K7Z A;  2KJC A;  4LFU A;  5H6Q A;  3KP7 A;  1U0J A;  2QQA A;  5DYM A;  3CCM I;  2GIZ A;  4A0X A;  1A35 A;  3SDB A;  5LRR A;  2L54 A;  3BR3 A;  4JX6 A;  2RAE A;  1H89 C;  2E5N A;  2YU9 J;  4LLG F;  1HXD A;  4IO9 F;  3KEO A;  4HST A;  4IJA A;  1ODD A;  1YJN I;  4MIM A;  2X6O A;  2QYO A;  2CS3 A;  2HI3 A;  2VPL A;  1N77 A;  3KPH A;  1KU9 A;  1AKH B;  4ESJ A;  2VXZ A;  4BXF A;  4QLC U;  4B1R A;  1W5S A;  3K1P A;  1TP4 A;  2VIX A;  3ERE D;  3NWT A;  4Y4R A;  3AG2 H;  3SFZ A;  4BJ6 C;  4WX9 A;  2GOX B;  1FY7 A;  1FOX A;  3KP5 A;  4IQ4 A;  2G7H A;  2KIM A;  4HX7 A;  3KCC A;  5HDG A;  2KPM A;  1XDS A;  5EGO A;  3FK7 A;  2CMP A;  4OAZ A;  3BR1 A;  3VYU B;  3WTU C;  2QM3 A;  3FIW A;  2IS2 A;  4LB6 B;  5IOZ A;  3ZMT A;  2JZY A;  3JRD A;  5FKK A;  4CYD A;  4QTR A;  1AHD P;  4EV0 A;  1TWA J;  1MNM C;  3OL4 A;  1ZKG A;  3N4M A;  2DO7 A;  4BQA A;  1ZK8 A;  1DGW Y;  4E70 A;  2HDW A;  2V79 A;  3JRI A;  4LK1 F;  1YYV A;  2FBI A;  3OV8 A;  2VON A;  4V2G A;  3WU2 C;  1Y1W J;  4ENJ A;  2H8R A;  4UB6 C;  5F0H A;  2UXN A;  1IUY A;  4AVP A;  2O7O A;  3HPH A;  2W25 A;  3E5Q A;  4FHT A;  1T95 A;  1R5G A;  1D0Z A;  5HS7 A;  4E7Z A;  3LAJ A;  3EUK L;  2M2E A;  2V1N A;  4R8H A;  3TL4 X;  3C1D A;  3E6B A;  1XGO A;  3J80 Z;  2ZME C;  1O3R A;  3F3X A;  5GAD J;  4GGG A;  4PSW A;  2EIK H;  3GW2 A;  1SC7 A;  2JT1 A;  1K78 B;  1K6O A;  3A02 A;  4F7Z A;  4E7S A;  4HNT A;  5E3M A;  2L4M A;  2R5Z A;  5BPI A;  3TW6 A;  5C4X J;  4PGG A;  1CF7 A;  2XF5 A;  2ZNZ A;  3HSR A;  1XB4 A;  2L9N A;  5E79 C;  4C3I J;  3ZP5 A;  2CQQ A;  2XSD C;  2XHK A;  3IH3 A;  4XRS G;  3Q5F A;  1WVR A;  3TO9 A;  2LMD A;  3MD2 A;  1VQ6 I;  1R6R A;  1H0M A;  1B8I A;  2FUG 2;  1Z21 A;  2X1C A;  2R7W A;  2ESH A;  3V7R A;  4AD9 A;  5LBQ A;  3H5R A;  2M30 A;  3OOU A;  4FET A;  3GBG A;  1JGG A;  4ZDP A;  1D5V A;  1GHC A;  3FHN A;  4OIN F;  2KQR A;  5EEH A;  4C30 A;  1MZB A;  3CF2 A;  1VQK I;  4CA0 A;  1LFP A;  4LK0 F;  2MG4 A;  2GWR A;  3K4C A;  1U5T B;  3RQI A;  2DYS H;  1G3Y A;  1YJW I;  1A5J A;  1SMY F;  1X1P A;  1I6X A;  4CCL A;  2WC2 A;  1R5I D;  3C7J A;  2HDC A;  2KIS A;  3BPX A;  1HW2 A;  2K40 A;  1WPK A;  1A6Q A;  3HB9 A;  3V8K A;  1OMI A;  2WTE A;  3ZQC A;  3CDH A;  1IZ1 A;  4G7Z F;  3SEZ A;  3PL8 A;  4IHS A;  2TDX A;  5E17 F;  1HKS A;  2VT3 A;  1OCC H;  4AYB N;  2NVQ J;  1J0R A;  5HLG A;  4XLC A;  1YIJ I;  2FD5 A;  3CLQ A;  5IT9 Z;  5IY5 H;  3RSN A;  2HQN A;  3DKY A;  3O2P E;  1ETV A;  4Y3O A;  4LLN A;  2K85 A;  3OL3 A;  2ACJ A;  3NRV A;  1QVT A;  5FO5 A;  4A2U A;  3BR6 A;  1OFC X;  4LG0 B;  3FXR A;  3C2H A;  4A12 A;  3S3M A;  5FKL A;  2KLO A;  3QP6 A;  4ZYE A;  2RQQ A;  4BBR J;  3CC7 I;  4E4H A;  4LIT A;  3FXU A;  1IF1 A;  1X2N A;  4KIC A;  5GPC A;  4GRI A;  4KMF A;  4BYY A;  4CZZ A;  4JOM A;  1BI0 A;  5CJ9 A;  2BV6 A;  1R23 A;  1TQP A;  2P5L C;  4ENN A;  3S3O A;  4C3H J;  2RNJ A;  4BDZ A;  1MH4 A;  2DA3 A;  1TWH J;  3LSI A;  2MH2 A;  3MWM A;  4CDG A;  4Y7N J;  2VKE A;  2PX9 A;  2DOF A;  3L2Q A;  1W7P A;  3FDY A;  3ZCO A;  2EH3 A;  3HOZ J;  2ZXW H;  2L7Z A;  1SFX A;  2Y30 A;  5HOD A;  3VSL A;  3FXO A;  5B3S H;  2IRF G;  1MBH A;  2CW0 F;  3FKJ A;  3J80 K;  2VE8 A;  2Q1Z B;  4XBF A;  2ZME A;  1YHQ I;  1HC8 A;  3EUA A;  3H5N A;  3E0J B;  3OYI A;  2B7E A;  3OYN A;  1TBX A;  3KEY A;  3HIF A;  3FM3 A;  1W5T A;  3MN2 A;  1KQ0 A;  2H6C A;  1C0W A;  1XMA A;  2E1M B;  5F04 A;  1A31 A;  2TRT A;  1HOM A;  3SYT A;  5K5R A;  4JQF A;  1FC3 A;  2OJE D;  2IA0 A;  4KN7 X;  2VOD A;  4B43 A;  1V54 H;  4MFE A;  2HOA A;  3G71 I;  1DQU A;  4PJJ A;  2LC2 A;  1OYY A;  2RQP A;  3GZN B;  3CUQ B;  4IVN A;  3OYJ A;  1MNE A;  1R1T A;  3G1O A;  1O3Q A;  3CMA I;  2AQE A;  3L2U A;  1MDM A;  1IRX A;  5FFZ A;  3LNQ A;  2MD0 A;  3K4L A;  5E3O A;  2RDP A;  1S7A A;  4UUS B;  1LDK B;  2WB1 A;  4PJM A;  5CVI A;  5FJ8 J;  3FBN B;  1IXS B;  3ZQH A;  4FT8 A;  3PNY A;  5DCM A;  1DUX C;  1Z77 A;  1ZH5 A;  4YEL A;  1R58 A;  3ZN0 A;  1Z1D A;  1U9O A;  3H92 A;  3KYD B;  5F0C A;  1O3S A;  3R6S A;  1S72 I;  3S16 J;  1S6L A;  1MIJ A;  2JA6 J;  4XKC A;  2V26 A;  3ISP A;  2KIF A;  2KRH A;  2M9H A;  4UV8 A;  4RGU A;  2E60 A;  2IS1 A;  4XLE A;  2HYJ A;  5J6X A;  3WE3 A;  1FMV A;  1BR4 A;  2CUF A;  4BNC A;  5FLX K;  2E1O A;  5CLS A;  3TW7 A;  2R7U A;  3F0C A;  1GVD A;  1FYL A;  3VYT B;  1MKM A;  2DTR A;  3BJO A;  2Y0M A;  2FSW A;  3BC8 A;  1HDP A;  5GAE J;  2Q8K A;  2Z2S B;  2K27 A;  1WKM A;  2VBX A;  2EFO A;  3V7S A;  2EZK A;  3LA7 A;  1ON2 A;  4HF0 A;  4JX4 A;  2DBB A;  2J5P A;  3BQY A;  2D1V A;  5M3M J;  3L00 A;  1AOY A;  4FX0 A;  1W4M A;  2JRT A;  4Y13 A;  4AU7 A;  2GAU A;  3TO7 A;  1BI1 A;  2EZI A;  5HS8 A;  1J9I A;  5KK1 A;  3CME I;  2WAQ N;  2DK5 A;  3F6O A;  3SDG A;  1VQN I;  2DMU A;  2LRD A;  1FBU A;  3S93 A;  2KFD A;  1I1S A;  5DUI A;  5HLT A;  1R1V A;  2CQX A;  1W0T A;  4Q5S F;  4ZDO A;  2W00 A;  1X1A A;  2XIG A;  3K69 A;  2ZFW A;  3HSF A;  4ZYD A;  3I55 I;  2HQ5 A;  5EGO B;  2DT7 B;  3JRE A;  1YRN A;  2RN7 A;  1OPC A;  1LFB A;  1M1E B;  1Z3Y A;  4B44 A;  5ICE A;  2Z9O A;  4EGY A;  3VOD A;  4E7J A;  3NAR A;  2Y0S A;  5GPA A;  2Y9Z A;  3WGG A;  2W24 A;  5K5O A;  3LSG A;  2DN0 A;  1X1D A;  3LQR A;  1BW6 A;  3S1M J;  4WXD A;  4XN0 A;  1Y0N A;  4M3F A;  3BDD A;  4HNU A;  2XB5 A;  1QGP A;  3F72 A;  3AG1 H;  2PLY A;  1GDT A;  2F5C A;  1MJ9 A;  3ABT A;  5LHG A;  4EGZ A;  1Y0U A;  4RA2 A;  2A5Y B;  2EFQ A;  4Z2Y A;  4P1W A;  4CZC A;  1HBX G;  3OWT A;  2QQ8 A;  3A03 A;  2IGN A;  2CW7 A;  2NVX J;  4S05 A;  1KU7 A;  3WTT C;  3HL2 A;  2W1O A;  5LFA A;  2A5W A;  2CFX A;  2FE3 A;  4XOP A;  2H6B A;  2OBP A;  2VXD A;  4LOC A;  3U21 A;  3IC7 A;  4B3X A;  4RAG A;  4AIJ A;  2BE5 F;  1T39 A;  5F08 A;  1GXP A;  1HKQ A;  2XAQ A;  3KET A;  2M7A A;  1KGS A;  1WJA A;  2P0W A;  2X0L A;  1BIB A;  3F6V A;  2R5Z B;  4UNO A;  2QSH X;  2HWV A;  1CF7 B;  3CZ6 A;  1EA3 A;  4UXN A;  2NXN B;  4L0Z B;  1MJA A;  3RTR A;  2FU4 A;  3HOV J;  3CP8 A;  2NS0 A;  1E0E A;  4ZTF A;  4U87 A;  3S8P A;  5JLW A;  4M73 A;  2R7V A;  2FA5 A;  4M3D A;  5JLX A;  4IHT A;  1B8I B;  3ZMU A;  3ZN1 A;  3REO A;  3JR9 A;  3H0G J;  2DYR H;  1NK2 P;  3AG4 H;  5J1R A;  1WSU A;  1UST A;  4G12 A;  1H9T A;  1EJ9 A;  3LSJ A;  4J19 A;  3QOE A;  1NK3 P;  4KIG A;  1PVE A;  3G6E I;  3HEF A;  3NQO A;  3IKT A;  1ZGW A;  2KHM A;  2F5F A;  3OS0 A;  2X85 A;  1VZ0 A;  1JTY A;  1LJ9 A;  4BHP A;  3L2V A;  1OCO H;  4KT5 C;  4HQM A;  1OKR A;  1G59 A;  1YE9 A;  2KZG A;  5CPR B;  1TT0 A;  1JT6 A;  3LSP A;  4A6D A;  2HDD A;  1GT0 C;  1KZH A;  3E6C C;  4BY7 J;  1H8A C;  5IP9 J;  1YI2 I;  2XKO A;  3CCY A;  3QOP A;  5DM6 F;  5E1X A;  4L0Y B;  3H9G A;  2ISY A;  3E7L A;  3QYE A;  2H94 A;  4E7K A;  3HJE A;  1XS9 A;  2Y75 A;  1O4X A;  5D5U B;  2CQN A;  2HXO A;  1FSE A;  1VF9 A;  2O03 A;  3DBH B;  1WJE A;  4BU2 A;  5F1J A;  4MEX F;  3KX2 A;  3Q9V A;  4OIR F;  1TTY A;  1XX5 A;  2E35 A;  3QPL A;  3RQ4 A;  3I4M J;  3H3Z A;  3ZMV A;  1S7E A;  3H9Q A;  3K1N A;  4ZJZ A;  3BT9 A;  2JQ7 A;  3FWE A;  5LGN A;  2BVL A;  5HNH A;  3L2C A;  2V1D A;  2WV1 A;  2HXI A;  1P2F A;  1OYI A;  3IHU A;  2A69 F;  3MKY B;  3A1Y A;  1QPI A;  2KRC A;  3MMY B;  2OAZ A;  1T33 A;  4F92 B;  5LD2 C;  2XVC A;  3L2W A;  3OS1 A;  3OYF A;  4M6V A;  1JUS A;  5JFR A;  2HU9 A;  3OY9 A;  2F4O B;  1W7P B;  1LVK A;  1TW2 A;  3B6A A;  1ENH A;  1D1A A;  3OYA A;  2DXI A;  2JSP A;  2QEX I;  5EJC A;  1QPM A;  1BOB A;  1WCM J;  2FF4 A;  3K10 A;  4B4C A;  4KIF A;  4V19 K;  3K2Z A;  4ITV A;  2ECB A;  2ZME B;  5HS9 A;  4XQF A;  1Z05 A;  2AS5 F;  5KVR A;  4HV6 A;  3FMQ A;  2V6C A;  1EH6 A;  3I53 A;  2DJN A;  1TWC J;  3TBI A;  2I5U A;  2JK3 A;  2VJJ A;  3PNT A;  2HPM A;  2PJP A;  2W7N A;  1I5Z A;  3QU3 A;  2VAS A;  3WE2 A;  4C2T A;  2E2H J;  3VWB A;  4OIP F;  2COB A;  1N75 A;  2M3A A;  5H2F C;  4BQQ A;  2PMZ A;  4MHG A;  5ILU A;  3GTP J;  1UMQ A;  1BM9 A;  3QRF F;  3WHB A;  2V7F A;  3ZGK A;  4IOC F;  3A4C A;  4OMY A;  4NUB A;  2EJR A;  3PQK A;  4A5N A;  3G1L A;  4XOR A;  2JPC A;  1JTX A;  5D4R A;  2VQH A;  3U1D A;  2JRM A;  1XCB A;  3HGG A;  1HA8 A;  4QPO A;  3CCQ I;  1OQY A;  1IG7 A;  4UUV A;  1MDM B;  2BY2 A;  3CCS I;  1LNW A;  1SAN A;  4JBA A;  1K83 J;  2R3S A;  1PJR A;  3RI4 A;  4MTD A;  1S7O A;  1TL8 A;  2KIQ A;  1JUM A;  2LG4 A;  2XDV A;  5DCM B;  4B3A A;  4UVA A;  2HR3 A;  2ZJR F;  2X1D A;  4G6Q A;  2XRO A;  1UG2 A;  4HX8 A;  2VQC A;  2FOK A;  3IH4 A;  1X1C A;  3M4O J;  1P7I A;  1BI3 A;  3RPU A;  5CVJ A;  1UJ8 A;  4HDU A;  4BDY A;  2JN6 A;  5DV5 A;  4XKB A;  3JTH A;  4PSX A;  3LFK A;  2O61 A;  1SEU A;  2EZH A;  1MMA A;  2OZ6 A;  4IKF A;  3H1C A;  3CJN A;  3L9F A;  3GZ6 A;  1G3W A;  3DKW A;  1LDJ A;  2R93 J;  2V1X A;  2V9P A;  3IP4 B;  1QZY A;  3IKV A;  2M45 A;  3OR1 C;  3GX4 X;  3C18 A;  3KE2 A;  2O6G E;  1YW9 A;  4KJZ A;  4RAY A;  4CCN A;  3W6V A;  5M3F J;  4P9U A;  2KRF A;  3I4N J;  3DU6 A;  3R60 A;  2AQF A;  3RZO J;  4RB2 C;  2L2O A;  2Y9Y A;  4Z6Y A;  3W2W A;  4PCQ A;  1T56 A;  2DQR A;  4IXA A;  4JX5 A;  3GFM A;  5LEK A;  2EFN A;  4UUS A;  1L0O C;  5TIS C;  2R0Q C;  4HBL A;  5E18 F;  1I6H J;  1EH8 A;  2ZXH A;  3ABM H;  4NC8 A;  2QVO A;  3UKG A;  4HSR A;  1IV6 A;  1RUN A;  1Q1H A;  4GXO A;  2HOS A;  3CD6 I;  2JVG A;  1R36 A;  3DBL B;  2BHZ A;  4ZYA A;  2LLK A;  3HKZ A;  5B5E C;  3OYK A;  4MQ9 F;  1E3O C;  1MJB A;  1A36 A;  2NVU B;  2OZU A;  3IH2 A;  4FAS D;  3LSH A;  3Q0U A;  4L5J A;  1YRN B;  1A04 A;  3LOC A;  2WWY A;  1V5G A;  3J7A O;  4HRI A;  4L9T A;  2Q0O A;  1VQ8 I;  2JUG A;  2OU2 A;  2A07 F;  1ZEL A;  1SVO A;  2YS9 A;  1UEL B;  4IQJ A;  3OR2 C;  4KDP A;  1ZGA A;  4I99 C;  2F4I A;  3BTL A;  4H0E A;  5KNL A;  5FRM A;  5GAG J;  5ILS A;  1ZG3 A;  2V4J C;  3ASN H;  2QBY A;  1F43 A;  2IW5 A;  2EBI A;  1EV7 A;  2KP6 A;  3QPH A;  5B66 C;  4ZC3 A;  2VT2 A;  2E36 A;  2BHY A;  3F22 A;  1BN5 A;  2RNG A;  4DBR A;  2HPI A;  3VSK A;  3PSF A;  2R7T A;  2JVH A;  1O7F A;  3L09 A;  5BNG A;  2D45 A;  2YSR A;  2Y2Z A;  5GTH C;  4CYC A;  2DOA A;  2NS8 A;  1GXQ A;  5D5X B;  1JKP C;  1JXS A;  4CHU A;  2G9W A;  3K70 D;  1XC5 A;  1Z91 A;  3K4K A;  2LKX A;  4M6X A;  1TQI A;  2DFE A;  4XOT A;  3GFL A;  2IEK A;  1RUO A;  2OA4 A;  1VTN C;  3ML6 A;  2QGU A;  1UG0 A;  1WWX A;  4PFP A;  5M5Y J;  1I1G A;  3HBL A;  2HVR A;  3PO2 J;  5K1Y A;  3KIO A;  1FX7 A;  5CQG A;  1QU3 A;  1ZG1 A;  3JRC A;  5IPA A;  4CCK A;  1YQA A;  3DPT A;  4NC7 A;  4UY8 I;  1VND A;  4A3I J;  4A3D J;  3EUH C;  3ZQF A;  3KEQ A;  3G73 A;  1QNT A;  2QSG X;  2V9V A;  3KP3 A;  4KUM A;  2VL8 A;  4KFC A;  3DKX A;  5DM7 F;  3LQQ A;  4M74 A;  2BW3 B;  5E8G A;  2W85 A;  3M1E A;  3FK6 A;  1B4A A;  4FTH A;  2PMU A;  3SXY A;  1Q1V A;  3MAJ A;  1JJ6 C;  1X4P A;  4EM0 B;  4FQG A;  1J7K A;  5E1W A;  4YII A;  3ZQQ A;  4A3M J;  1QHH D;  4IHW A;  5DUK A;  4I0A A;  1RC9 A;  4LLL A;  4IRI A;  3BCB A;  1IV8 A;  2DOE A;  2K3F A;  1FP2 A;  2Y69 H;  2R7F A;  1D0Y A;  4U7B A;  2VJI A;  4Q47 A;  4F3Q A;  4E6K G;  3JSO A;  3SEQ A;  1ZN2 A;  1UHW A;  3VYR B;  1EKE A;  2PMH A;  3GTK J;  1OJL A;  1A6I A;  2P6T A;  3LSM A;  3M8E A;  2A3S A;  1ONV A;  2DMT A;  3ZQG A;  3BOQ A;  1GV2 A;  5B1A H;  1FBQ A;  4P5O A;  3TKY A;  1E2X A;  2H8W A;  4M71 A;  3ZMZ A;  3GFI A;  2EV5 A;  1Z9C A;  2CG4 A;  1U3E M;  1X19 A;  1ZGJ A;  3WG9 A;  3GTM J;  4UHT A;  3TO6 A;  2FQ3 A;  3RDI A;  3CJQ B;  3MVP A;  3Q3S A;  4L5E A;  2L02 A;  4HOB A;  3RYR A;  4X6A J;  4ABZ A;  3ECO A;  3S1R J;  3JW4 A;  5IP7 J;  2GA1 A;  2VKD A;  4G7O F;  3DLL F;  2X6W A;  1G4D A;  5A2Q K;  2MD5 A;  3RYP A;  3LST A;  5BQT A;  3CJT B;  1J75 A;  1KU2 A;  3ZOB A;  1I3Q J;  2DA1 A;  4AYB A;  1OLT A;  4Q4Z F;  4LIU A;  3H0D A;  1EH7 A;  3LWF A;  2R92 J;  4GCV A;  1FYK A;  4A69 C;  3A0B C;  4ZDL A;  1I3A A;  1W36 D;  3CDI A;  1ZRC A;  4HA8 A;  3WGI A;  5ICC A;  2BEO A;  4AUX A;  3I58 A;  4HZF A;  5FLX Z;  2O9L A;  4D5F A;  1P6R A;  4CSW A;  1CQT A;  3BRO A;  1T6S A;  4IRG A;  2CGP A;  1BA5 A;  3MKL A;  1YO5 C;  3R4K A;  1DU0 A;  4RAF A;  2M87 A;  3M8F A;  3MFK A;  1T0F C;  2BVM A;  2LDU A;  2D5V A;  3HGY A;  2GBY A;  4IOA F;  4YFX F;  1RKW A;  5EZG A;  4IPA A;  1BJZ A;  3E6D A;  1FYM A;  4F93 B;  1ULY A;  2NNY A;  1SFE A;  1Z6T A;  3C3W A;  5FLM J;  2HTJ A;  2XAS A;  4D7N A;  4I01 A;  2G0E A;  4Q48 A;  5JHF A;  3ABK H;  1SVM A;  5HOO A;  3HHH A;  3MZ8 A;  1FSH A;  5DD4 A;  2VB6 A;  1OIS A;  4HEA 2;  2M8E A;  1FOY A;  1MBE A;  4RGS A;  4GDF A;  1LKX A;  5CVU A;  2HYF A;  3JRA A;  3C2G A;  1R71 A;  4CGZ A;  3T5X A;  1D8K A;  1YG2 A;  3OOP A;  1IXR C;  2HFH A;  2JA5 J;  1KQ8 A;  3LFU A;  3CC2 I;  2BY3 A;  2R7S A;  2P81 A;  4A3J J;  1F1Z A;  4R1H A;  3BR5 A;  3Q0W A;  1S5L C;  2WY8 Q;  2FNA A;  2M5W A;  3HC7 A;  1X4O A;  2WY7 Q;  3NEU A;  1T38 A;  4MNU A;  2JMW A;  3S2W A;  2JWT A;  2L3D A;  2XKP A;  1IN5 A;  4KMU X;  5CVV A;  3ZMS A;  2EV6 A;  3LSR A;  5ED4 A;  3CCR I;  3F8N A;  1VQ9 I;  5IP6 A;  3MZH A;  2EQR A;  2M34 A;  3A0H C;  2F5V A;  3G4S I;  4L18 B;  2W4S A;  4RGX A;  4B8X A;  5LRS A;  3BTJ A;  4PUS A;  4KT6 A;  3TDU C;  4XSX F;  4EJV A;  3H3U A;  2CYY A;  5JR3 A;  2M1B A;  2UWM A;  2MSY A;  5HLH A;  3DQV C;  1FT9 A;  4L9J A;  1UB9 A;  4I0B A;  3DBR B;  1U6G A;  1R00 A;  1ZTR A;  3BZ6 A;  3MQ0 A;  3OYB A;  2L9R A;  2FNP A;  3SZT A;  4EJO A;  4DZP A;  3S14 J;  4OMZ A;  5EYR A;  4B09 A;  5B1B H;  4MTE A;  3CMY A;  2CRG A;  4HG2 A;  2GIV A;  3I0T A;  3TOB A;  3BP8 A;  1PDN C;  1HSJ A;  2O0Y A;  1HF0 A;  1BC8 C;  2LOO A;  2ZO4 A;  5DTD A;  2A68 F;  3D5L A;  3HOT A;  4CUG A;  1TNS A;  1IC8 A;  2FXA A;  2A05 A;  2WB1 N;  1BOA A;  1Y8R B;  4XRS A;  1RR7 A;  4RGR A;  3TDZ C;  1TZL A;  2KIU A;  2P5V A;  2ZXI A;  4Y33 A;  4PZJ A;  3RJP A;  3MEX A;  3MKW B;  4P96 A;  1SFK A;  4JK1 X;  2M0C A;  4OWR B;  3ZQI A;  3OYG A;  3IL2 A;  2RVC A;  1B6A A;  3V7C A;  3J7Z I;  2JTV A;  2KZV A;  3GO5 A;  4HQE A;  4O3M A;  3GZ5 A;  4FCY A;  1WRJ A;  4BKX A;  3BPV A;  4MEY F;  1L3L A;  4I6Z A;  2QBY B;  2QKM B;  1KU3 A;  2STT A;  2PN6 A;  2YR2 A;  3O8G A;  3P9I A;  3W6J B;  3OIQ A;  2CUE A;  3ERM A;  1P4X A;  1NH3 A;  2HOE A;  2DDB A;  2L7F P;  3BJ6 A;  3DFG A;  1AA7 A;  5CQE A;  5FRN A;  5F27 A;  1FIA A;  1FNN A;  5HVQ C;  1TLH B;  1R22 A;  4CYC B;  2GQQ A;  1SAU A;  1SD6 A;  3BLY A;  2BXZ A;  4DW6 A;  4EEF G;  2EIM H;  1WZ2 A;  1V5E A;  1B72 A;  4YFK F;  4A93 J;  1Y1V J;  2E71 A;  1FWZ A;  3HG9 A;  1ZRE A;  2GXG A;  2GA2 A;  2P5K A;  3I54 A;  3CUO A;  2RV8 A;  4BQN A;  2CSO A;  1MW7 A;  2Z99 A;  2R7R A;  4M3B A;  2CU7 A;  2LBF A;  2BY1 A;  4BE2 A;  3ABL H;  3F21 A;  3W2V A;  3QQA A;  2AXT C;  1OCP A;  4JYK A;  2X9D A;  4MO7 A;  2LYC A;  3I56 I;  2PJR A;  2V1U A;  2HKO A;  4G6T B;  4XM3 A;  2PBI A;  4II3 A;  3S1Q J;  5AIP A;  3JRG A;  3BG3 A;  2FJ1 A;  5L3F A;  1KA8 A;  3PUB A;  1MBK A;  5FRO A;  4OIO F;  1WH7 A;  3FXL A;  5DS9 A;  2ZKZ A;  1DPR A;  2F2E A;  4DGW B;  5BMZ A;  4N4O B;  2OV7 A;  4WK8 F;  2OQG A;  1WI3 A;  2Y0S N;  2DPD A;  2DJI A;  4ZYG A;  4IZZ A;  3CMM A;  3HOW J;  1GV5 A;  1U5T C;  3I5U A;  4HNV A;  2D2W A;  3O3K A;  4YRV A;  1XMK A;  2ELH A;  2VBZ A;  3E3V A;  3PUF A;  3GUD A;  1H88 C;  4RS8 A;  4IHY A;  1TQM A;  1EF4 A;  3ZXS A;  1MMD A;  1LVA A;  3IUO A;  4AC0 A;  2R4G A;  1IUF A;  4YIF A;  4BBS J;  4RM3 A;  3BR0 A;  1X1B A;  4UVB A;  1JKO C;  4YFN F;  2P7C B;  3WOD F;  4XR6 A;  3OIP A;  2ZNY A;  3V8L A;  4E7I A;  5F1R A;  5L3E A;  2CJJ A;  1O57 A;  5FKM A;  5ICF A;  3S15 J;  3SZP A;  2DQL A;  2NNN A;  4XLP F;  4RM2 A;  1SD7 A;  3WTS C;  2HEO A;  4HYE A;  5ICG A;  3TGN A;  4NB5 A;  5F64 A;  3GTJ J;  1QRY A;  2BW3 A;  3RCO A;  1SAX A;  3I59 A;  3ROU A;  3AFH A;  3OYD A;  3KP4 A;  4XSZ F;  3V4G A;  1V55 H;  4PJ0 C;  4AVZ A;  4PDK A;  3RKY A;  3HM5 A;  1O3T A;  3COA C;  1ZLJ A;  3G2B A;  2EK5 A;  3Q0V A;  5FKO A;  3DPL C;  2MAB A;  3E5U A;  1JUP A;  2R7X A;  1KON A;  2V6E A;  3WHC A;  3GTG J;  3ZRG A;  2LRE A;  3S32 A;  4H4K C;  2O5R A;  2DW4 A;  1SD5 A;  1BIA A;  3PIO F;  2KDO A;  4LIV A;  3S2D J;  1YOV B;  2DLL A;  4ETS A;  5LGU A;  4FE7 A;  5CYV A;  2K5C A;  4BE0 A;  1ETW A;  3HUG A;  4UB8 C;  4XLA A;  4U0W A;  2EZL A;  3RIR A;  3J81 K;  4D0P A;  4Y15 A;  4II2 A;  3VEP A;  2DMP A;  3K4M A;  2DA6 A;  1ZRD A;  3LA3 A;  4BJT A;  3FXQ A;  1UCR A;  5E3L A;  1IRG A;  2DI3 A;  2H09 A;  2E7W A;  1XD7 A;  1Y6I A;  2XPW A;  4WF2 A;  1T2K A;  1XSX A;  1D5Y A;  4LGW A;  3K2A A;  5IT3 A;  3KP2 A;  2XPV A;  4HX4 A;  2VJ5 A;  5FKN A;  1JE8 A;  1K61 A;  5BOX A;  4U0Y A;  2NRA C;  2ME6 A;  2VC1 A;  4M6Y A;  1OR7 C;  3V8J A;  4ASN A;  4GYG A;  3K1M A;  2XGD A;  3FXM A;  3S3N A;  2NVT J;  5J3L A;  1TW3 A;  2MW8 A;  2FMY A;  2A6H F;  3GWZ A;  3KLN A;  5L3G A;  3HDD A;  3F8M A;  2PFB A;  1HST A;  1TNT A;  2AO9 A;  2HNH A;  4PJN A;  5FGM A;  4S04 A;  2CH0 A;  4OAY A;  2DT6 A;  1W5C C;  2CUZ A;  1JHF A;  2A6T A;  4RB0 A;  2FBH A;  4XLF A;  5JVT A;  3W3C A;  5C44 J;  4ZZL A;  2FX0 A;  4RB3 C;  1F9N A;  1LQ1 A;  3SZG A;  1IN4 A;  3EPZ A;  3R61 A;  4C2M J;  3ABU A;  3HOS A;  4MQV A;  4BH9 A;  2E1N A;  3B02 A;  4BJ5 C;  2VQL A;  1LE8 A;  1FOK A;  3JCU C;  3DF8 A;  1R4M B;  3VOE A;  3QYB A;  3OMY A;  3BCA A;  1KYZ A;  2DU9 A;  1LB2 A;  1Z67 A;  5L3D A;  2EIN H;  1SFO J;  2W57 A;  3N05 A;  3L1P A;  1JKQ C;  1BW5 A;  2DCE A;  2HQR A;  5JI6 A;  2UZK A;  4IHX A;  3AL0 C;  4HF2 A;  5EEG A;  1FPQ A;  4XN3 A;  4NBQ A;  1RIO H;  1K7A A;  2LVS A;  2PMZ N;  3LA2 A;  2OUM A;  2VQG A;  5D6E A;  3WTX C;  3VDX A;  2P8T A;  2PG4 A;  3GXO A;  5JVG F;  2L4A A;  1K4T A;  3DV8 A;  2XRN A;  3CCE I;  3WTW C;  2DFH A;  2FOW A;  1Z3X A;  1F5T A;  5EG0 A;  2IA1 A;  5ERI A;  4R79 A;  2VKV A;  1ETQ A;  1RR8 C;  2EWN A;  2MA3 A;  4I98 B;  1RKT A;  2UV1 A;  5LGT A;  1DGR M;  1MBJ A;  2OF7 A;  2WA0 A;  3SQN A;  3K70 C;  1N25 A;  1V4R A;  3B6C A;  4YIR X;  1IDY A;  1S8N A;  3BWG A;  2OCC H;  2IVM A;  3I3L A;  3HTS B;  2K86 A;  2YU3 A;  4PK4 A;  4M72 A;  1GUU A;  4A3C J;  1WFX A;  4MLO A;  4ZZD A;  2F4M B;  2H1L A;  2K9N A;  1ETY A;  1YS7 A;  4K2E A;  3RKW A;  4UUT A;  1ZR4 A;  4WXH A;  1J2X A;  1S29 A;  1Z6R A;  4XLH A;  4F55 A;  2M4G A;  5KAF C;  3CCU I;  1I50 J;  3WTY C;  2ADU A;  1I39 A;  5IYB J;  4HLX A;  1TWF J;  4XKV A;  3QAH A;  2ID3 A;  4YEJ A;  4A0Y A;  1WHU A;  5FLV A;  5L3C A;  4J01 A;  2ID6 A;  5D4S A;  2ZSI B;  4WCG A;  1X3Z B;  2AHQ A;  3FXK A;  5IYD J;  5GTI C;  4XID A;  2XAF A;  1X2M A;  2F5D A;  4QSH A;  2XSJ C;  4DQ2 A;  2DFF A;  4HLY A;  2F48 A;  4UV9 A;  1OR7 A;  1YLF A;  3OYH A;  1WJF A;  4F91 B;  1B72 B;  3P9C A;  4GFB A;  2NOG A;  1J09 A;  1BR1 A;  1H9G A;  5HDK A;  2KKO A;  3KYL A;  2LKS A;  3FZV A;  2XC7 A;  2XB0 X;  3KZY A;  2ISZ A;  1UFM A;  2K9Q A;  3TOA A;  2KDZ A;  4A3L J;  4QIW N;  2LBF B;  2EA2 A;  1BI2 A;  3V42 A;  2HGC A;  1KQ9 A;  4LB5 A;  2ZJP F;  1CGP A;  2PJR B;  3IWF A;  5LHH A;  5KCM A;  5A2Q Z;  3HKZ N;  3RKQ A;  1R49 A;  2AXL A;  4DBQ A;  1VQ5 I;  1LPQ A;  1WGX A;  3CC4 I;  2COM A;  1OYW A;  1FOW A;  5KAI C;  1W0U A;  2FML A;  4HAM A;  2LTP A;  4W1U A;  4OIQ F;  1NG7 A;  1P4W A;  1B59 A;  4OOI A;  2XRL A;  3NAU A;  3KFW X;  1P4A A;  3TED A;  4M9Z A;  3CLO A;  4Y17 A;  4BQO A;  2K9S A;  3ZMD A;  2VOP A;  2E1C A;  3CF5 F;  2IA2 A;  4ZYH A;  2JJ7 A;  1ETX A;  2X51 A;  3S17 J;  2QUF A;  2DA5 A;  3KP6 A;  3CCJ I;  1IXC A;  1WI9 A;  1STZ A;  1R9T J;  2XAJ A;  4KNY A;  4BHB A;  3F23 A;  4ENK A;  3BZK A;  4DZJ A;  2ZFU A;  1SMT A;  2CV1 A;  4QWQ A;  1XGS A;  2Z3Y A;  3BJA A;  2LKP A;  2A61 A;  3KZI C;  1LEA A;  2QF7 A;  5E1Z B;  1ZRF A;  1W36 C;  1HCR A;  2G7U A;  4AWX B;  2Z16 A;  1DPU A;  3IWZ A;  1VQ7 I;  1WH5 A;  2XPU A;  3PNV A;  1T8I A;  3JRF A;  1GLN A;  4O5V A;  1R1U A;  5HLI A;  3D5S C;  1KYW A;  4BHC A;  2Y48 A;  1Y39 A;  2P7V B;  3VFZ A;  4CO8 A;  1Z7L A;  1YX3 A;  1G8X A;  3TQN A;  3FIS A;  2DK8 A;  1YW7 A;  3KYC B;  1WJ5 A;  1XG1 A;  3FMR A;  3I59 B;  2QA4 I;  2VPR A;  3QPS A;  2GXB A;  3LL7 A;  3K7A J;  3H35 A;  1R4N B;  2DMQ A;  3D5R C;  5H20 A;  2IGK A;  3FM5 A;  4BAC A;  4N9I A;  4ESF A;  2H1K A;  5J8C A;  2NAZ A;  2DA2 A;  2JA2 A;  3GTO J;  3IAM 2;  5LHI A;  1RET A;  2DA4 A;  2LFB A;  2ELJ A;  3I4P A;  2X6X A;  5ILV A;  4MFD A;  1RI7 A;  1FBS A;  2EV0 A;  2KMU A;  2VLA A;  1Y56 A;  1MGT A;  5E8I A;  4EM2 A;  1TT5 B;  4U7D A;  3HYI A;  5EF6 A;  2IS6 A;  1D3Y A;  4DYR A;  1AWC A;  2BZT A;  1D1C A;  3J7A Y;  4UVC A;  3F9K A;  2IGO A;  3GFJ A;  5M5W J;  4A5M A;  4G94 A;  4I7H A;  1UAA A;  5D5W B;  1B9M A;  3HUG B;  2JPB A;  1MSE C;  1TWG J;  3T1B A;  1LEB A;  1FP1 D;  3R0J A;  2XF7 A;  4J00 A;  1YS6 A;  4IEJ A;  2WV0 A;  4HF1 A;  2KJB A;  3DLA A;  3DWL E;  5E20 A;  1NTC A;  3SFI A;  2B0L A;  2FBK A;  3FMS A;  2I10 A;  5M5X J;  1S9H A;  2BXY A;  2VE9 A;  4HW0 A;  3J7Y J;  4PJL A;  1FEX A;  3HRT A;  4CXF A;  5LEJ A;  5K5Q A;  4KA4 A;  3JAM Z;  3I64 A;  2DT5 A;  2TCT A;  4G8X A;  2QLZ A;  2GXA A;  4IHV A;  4BAY A;  2ZSH B;  2OC6 A;  3P5J A;  2BGC A;  3QWL A;  3JSP A;  1JI8 A;  2CQ7 A;  2N8G A;  1ON1 A;  2HZT A;  2Y31 A;  1N78 A;  1XSD A;  1ORK A;  1IN7 A;  3QPT A;  2QSF X;  4NQW A;  3OSF A;  4NHJ A;  1ERD A;  4RMN A;  1W1W E;  2FRH A;  4LD5 A;  2X1E A;  4IRH A;  1BBY A;  2LY9 A;  2Q2E A;  2QZ8 A;  3FXJ A;  2MH9 A;  2RKH A;  1I27 A;  3ULQ B;  5IYC J;  1E3P A;  1V3F A;  2F5E A;  1LE8 B;  1LFU P;  4BL0 B;  1J59 A;  2OPT A;  2E7X A;  2WBM A;  2ZJQ F;  1MSF C;  1XCV A;  3EUH A;  4BEH A;  2BYV E;  2ICW G;  4E7H A;  5D5V B;  2DDA A;  4U0V A;  3H5A A;  3EYY A;  2LSO A;  4FE4 A;  1WJD A;  2EFP A;  3RPQ A;  3S1N J;  3VYS B;  4X0G A;  3AKZ A;  1W7P D;  2CUJ A;  4ESB A;  1VQL I;  3B73 A;  3QOD A;  2K7L A;  3CTA A;  1S3J A;  4XNF A;  1HDD C;  2H27 A;  3L2R A;  4BXX J;  2LF7 A;  2WAE A;  3AG3 H;  3GTL J;  3PFI A;  2DPU A;  1JT0 A;  2MLK A;  2HQA A;  2K02 A;  3HOY J;  2L9V A;  2JSC A;  2Z1D A;  3GLX A;  2J5O A;  3CCL I;  1PP7 U;  3WU0 A;  4WWC A;  5EG0 B;  1XMX A;  4ANJ A;  3DU5 A;  2X4H A;  3GLL A;  4RLF A;  4RB1 A;  3PIP F;  2K9M A;  2HOT A;  3TP3 A;  2QQ9 A;  2W82 A;  1AU7 A;  1YTY A;  1GVJ A;  4OU0 A;  3HZJ A;  2R5Y A;  3EDP A;  1FLI A;  1YX5 A;  2EIJ H;  3FBI B;  4N0B A;  2O8X A;  3DEE A;  3HPG A;  1RES A;  3DTK A;  2UUZ A;  2Z33 A;  5BS6 A; 
#chains in the Genus database with same CATH homology
 2ZBK A;  4EQQ A;  2D1H A;  5H6R A;  3HSE A;  5CVR A;  3D0S A;  2P6S A;  4G6D A;  2EA4 A;  3ECH A;  1ZYR F;  3JAM K;  1ZG5 A;  2VN2 A;  5J8F A;  3FX3 A;  2STW A;  3MCZ A;  2ZJ2 A;  1SFU A;  3SHF A;  3W6K B;  3IRR A;  2K4B A;  3P9K A;  1R5H A;  2C6Y A;  2OQR A;  2IT0 A;  2UXX A;  3K0L A;  1HW1 A;  5DCF A;  1U2W A;  2QEN A;  3I71 A;  1REP C;  2CO5 A;  1T0F A;  1K79 A;  5IT9 K;  1P92 A;  1YW8 A;  4P9F A;  2OD5 A;  3F8B A;  4HV5 A;  3Q9S A;  1UHM A;  1QBJ A;  3IRQ A;  4AIH A;  3E5X A;  1IRF A;  4GO1 A;  1IAW A;  2P4W A;  3HTU A;  4EM1 A;  1USS A;  2DFI A;  2W84 A;  3JTG A;  1JHH A;  4N9H A;  1SD4 A;  4GYI A;  1O7L A;  1HQC A;  3J81 Z;  3HRU A;  2IJL A;  4KYW A;  2HKX A;  2EFW A;  5FB2 A;  3O6B B;  3T8R A;  3N97 A;  2VOO A;  1RNL A;  4LMY A;  2L01 A;  1IN6 A;  4MGR A;  2O3F A;  3F8F A;  3AAF A;  3P7N A;  5TRD A;  3WTZ A;  5HDN A;  3GEZ A;  3EQL F;  3E6M A;  1Z7U A;  5D6F A;  1QZZ A;  3CO6 C;  4IF4 A;  2PQ8 A;  4XLN F;  1XN7 A;  1LDD A;  3EET A;  1MD0 A;  2HTS A;  2DAO A;  2HYG D;  4KN4 X;  2GZW A;  2K4J A;  2MC3 A;  2VBY A;  1PUE E;  3E97 A;  4A0Z A;  1BJA A;  2VBW A;  1XDU A;  1HKT A;  4EJU A;  5AIQ A;  5F6F A;  1NHA A;  4P55 A;  3BY6 A;  1YFH A;  2A6E F;  3WTV C;  4FX4 A;  3U2R A;  2NYX A;  5LLQ A;  2MLG A;  1U8R A;  3M9A A;  1D8J A;  2LF8 A;  3U9G A;  4A6E A;  1QQI A;  5DD8 A;  4I09 A;  3PQJ A;  3DP7 A;  4LJZ F;  1XGM A;  3K9T A;  4TV7 A;  1ZHF A;  1K78 A;  3KZZ A;  1IW7 F;  4I02 A;  1B9N A;  3ZPL A;  1JGS A;  1BC7 C;  4HDV A;  3GYH X;  3FF5 A;  4PGH A;  3DEU A;  2CWE A;  2PI0 A;  4DNC A;  3VB2 A;  4EMS A;  2LNB A;  3KLO A;  2IPQ X;  4L9N A;  4CIC A;  3CUQ C;  1ZAR A;  1QO0 D;  1IN8 A;  4G9Y A;  5TJJ A;  1U5T A;  2XAH A;  3GVA A;  4G7H F;  4ON0 A;  4BXU A;  3WGH A;  1G3S A;  4EJT A;  3QU6 A;  2PEX A;  3DXJ F;  1G6N A;  4ZH4 F;  4XRF A;  4WXC A;  3HRS A;  4YG2 F;  1PP8 F;  3MZY A;  4EJW A;  2CQK A;  4U88 A;  2EB7 A;  5L3B A;  5FD6 A;  6PAX A;  2RGV A;  5JHU A;  4LG0 A;  3LAP A;  4AIK A;  5D8L B;  3ZQ7 A;  1J5Y A;  1ZLK A;  2MBF A;  3GF2 A;  2FEZ A;  2BBY A;  2YPR A;  4L5I A;  3WU1 B;  1HW5 A;  2IP2 A;  2ZCW A;  1G3T A;  5FD5 A;  2XUB A;  1R7J A;  4KIB A;  1B1B A;  2Z5U A;  1T98 A;  3T8T A;  4L9V A;  1ZAO A;  2ESN A;  4I2O A;  2XV4 S;  4M9S A;  3L7W A;  1DP7 P;  3EYI A;  3T0Y A;  1XSV A;  3ELK A;  1U78 A;  2HS5 A;  5DDG A;  5DEQ A;  3HRM A;  1RZ4 A;  3FHZ A;  1E17 A;  2RC4 A;  2XAG A;  2R7D A;  1WQ2 A;  2ZXJ A;  1XGN A;  2ETH A;  2QWW A;  2YX7 A;  4O6J A;  3F8C A;  1FZP B;  4EVI A;  3CUQ A;  1DDN A;  5AON A;  2VC0 A;  4M9X A;  4ENM A;  1X3U A;  3RKX A;  3G3Z A;  5FFX A;  2YX4 A;  5D8K B;  5BPD A;  3QP5 A;  1YIO A;  3R0A A;  4RAZ A;  3CO7 C;  1F4K A;  3M7G A;  2XGX A;  2QQB A;  3HHG A;  2KJC A;  4LFU A;  5H6Q A;  3KP7 A;  2QQA A;  5DYM A;  4A0X A;  5LRR A;  2L54 A;  4LLG F;  1HXD A;  3KEO A;  4IJA A;  1ODD A;  2QYO A;  1KU9 A;  4ESJ A;  2VXZ A;  4QLC U;  1W5S A;  3K1P A;  3ERE D;  3SFZ A;  4WX9 A;  1FY7 A;  3KP5 A;  2G7H A;  2KIM A;  4HX7 A;  3KCC A;  5HDG A;  1XDS A;  3WTU C;  2QM3 A;  4LB6 B;  3ZMT A;  2JZY A;  4CYD A;  4EV0 A;  3N4M A;  2DO7 A;  4BQA A;  4E70 A;  2V79 A;  4LK1 F;  1YYV A;  2FBI A;  3OV8 A;  2VON A;  4ENJ A;  2UXN A;  1IUY A;  4AVP A;  2W25 A;  3E5Q A;  4FHT A;  1R5G A;  5HS7 A;  3LAJ A;  4R8H A;  3C1D A;  3E6B A;  1XGO A;  3J80 Z;  1O3R A;  3F3X A;  4GGG A;  3GW2 A;  1K78 B;  2JT1 A;  1K6O A;  4F7Z A;  2L4M A;  5BPI A;  4PGG A;  1CF7 A;  2ZNZ A;  3HSR A;  1XB4 A;  3ZP5 A;  2XHK A;  3Q5F A;  3TO9 A;  1H0M A;  2ESH A;  3V7R A;  4AD9 A;  5LBQ A;  2M30 A;  1GHC A;  1D5V A;  4OIN F;  5EEH A;  1MZB A;  4LK0 F;  2GWR A;  1U5T B;  1G3Y A;  1SMY F;  1I6X A;  2WC2 A;  3C7J A;  2HDC A;  3BPX A;  1HW2 A;  3V8K A;  1OMI A;  2WTE A;  3CDH A;  1IZ1 A;  4G7Z F;  4IHS A;  5E17 F;  2TDX A;  1HKS A;  2VT3 A;  1J0R A;  5HLG A;  5IT9 Z;  2HQN A;  3O2P E;  4LLN A;  2ACJ A;  3NRV A;  5FO5 A;  4A2U A;  4LG0 B;  3FXR A;  4A12 A;  3QP6 A;  4ZYE A;  3FXU A;  1IF1 A;  4KIC A;  4KMF A;  4BYY A;  4CZZ A;  1BI0 A;  5CJ9 A;  2BV6 A;  1R23 A;  1TQP A;  2P5L C;  4ENN A;  2RNJ A;  3MWM A;  4CDG A;  2MH2 A;  1W7P A;  1SFX A;  2IRF G;  3J80 K;  2CW0 F;  2VE8 A;  4XBF A;  2ZME A;  1TBX A;  3HIF A;  3FM3 A;  1W5T A;  1KQ0 A;  2H6C A;  1C0W A;  1XMA A;  5K5R A;  4JQF A;  1FC3 A;  2IA0 A;  4KN7 X;  2VOD A;  1OYY A;  2RQP A;  3CUQ B;  4IVN A;  1R1T A;  1O3Q A;  1MDM A;  5FFZ A;  2RDP A;  1S7A A;  1LDK B;  5CVI A;  1IXS B;  4FT8 A;  5DCM A;  1DUX C;  1ZH5 A;  1R58 A;  3ZN0 A;  1Z1D A;  3H92 A;  1O3S A;  3R6S A;  1S6L A;  3ISP A;  2KIF A;  4UV8 A;  4RGU A;  5J6X A;  3WE3 A;  4BNC A;  5FLX K;  5CLS A;  1FYL A;  1MKM A;  2DTR A;  3BJO A;  2Y0M A;  2FSW A;  2Q8K A;  2K27 A;  1WKM A;  2VBX A;  2EFO A;  3V7S A;  3LA7 A;  1ON2 A;  4HF0 A;  2DBB A;  2J5P A;  2D1V A;  3L00 A;  1AOY A;  4FX0 A;  1W4M A;  2JRT A;  4Y13 A;  2GAU A;  3TO7 A;  1BI1 A;  5HS8 A;  1J9I A;  5KK1 A;  2DK5 A;  3F6O A;  1FBU A;  1I1S A;  5DUI A;  1R1V A;  4Q5S F;  4ZYD A;  2XIG A;  3K69 A;  2ZFW A;  3HSF A;  2RN7 A;  1OPC A;  5ICE A;  2Z9O A;  4EGY A;  3VOD A;  3WGG A;  2W24 A;  5K5O A;  3LQR A;  4WXD A;  3BDD A;  1QGP A;  3F72 A;  2PLY A;  2F5C A;  1MJ9 A;  3ABT A;  5LHG A;  4EGZ A;  1Y0U A;  2A5Y B;  2EFQ A;  4Z2Y A;  1HBX G;  4S05 A;  1KU7 A;  3WTT C;  2CFX A;  2FE3 A;  2H6B A;  2OBP A;  3IC7 A;  4AIJ A;  2BE5 F;  1T39 A;  1GXP A;  1HKQ A;  2XAQ A;  3KET A;  1KGS A;  3F6V A;  2X0L A;  1BIB A;  4UNO A;  2HWV A;  1CF7 B;  4UXN A;  4L0Z B;  1MJA A;  3RTR A;  2FU4 A;  2NS0 A;  4M73 A;  2FA5 A;  4IHT A;  3ZMU A;  3ZN1 A;  3REO A;  1WSU A;  1UST A;  1H9T A;  4KIG A;  3NQO A;  3IKT A;  2F5F A;  4BHP A;  1LJ9 A;  4KT5 C;  4HQM A;  1OKR A;  4A6D A;  3E6C C;  2XKO A;  3QOP A;  5E1X A;  4L0Y B;  2ISY A;  2H94 A;  2Y75 A;  5D5U B;  1FSE A;  2O03 A;  4MEX F;  3Q9V A;  4OIR F;  1TTY A;  3H3Z A;  3ZMV A;  3K1N A;  3FWE A;  5LGN A;  3L2C A;  2V1D A;  1P2F A;  1OYI A;  3IHU A;  2A69 F;  2OAZ A;  2XVC A;  5JFR A;  1W7P B;  1TW2 A;  1QPM A;  2FF4 A;  4KIF A;  3K2Z A;  2ZME B;  5HS9 A;  1Z05 A;  2AS5 F;  5KVR A;  4HV6 A;  3FMQ A;  2V6C A;  1EH6 A;  3I53 A;  2PJP A;  1I5Z A;  3QU3 A;  3WE2 A;  4OIP F;  5ILU A;  4MHG A;  1BM9 A;  3QRF F;  4OMY A;  2EJR A;  3PQK A;  4A5N A;  2JPC A;  5D4R A;  3U1D A;  1XCB A;  4UUV A;  1MDM B;  1LNW A;  4JBA A;  2R3S A;  3RI4 A;  4MTD A;  1S7O A;  5DCM B;  4UVA A;  2HR3 A;  4G6Q A;  2XRO A;  4HX8 A;  2FOK A;  1BI3 A;  3RPU A;  5CVJ A;  4HDU A;  5DV5 A;  3JTH A;  3LFK A;  2O61 A;  2OZ6 A;  3CJN A;  3L9F A;  3GZ6 A;  1G3W A;  3DKW A;  1LDJ A;  2V1X A;  1QZY A;  3IKV A;  2M45 A;  3GX4 X;  3C18 A;  3KE2 A;  2O6G E;  1YW9 A;  4RAY A;  4P9U A;  2KRF A;  3R60 A;  4RB2 C;  4PCQ A;  2DQR A;  4IXA A;  5LEK A;  3GFM A;  2EFN A;  1L0O C;  4HBL A;  5E18 F;  1EH8 A;  2QVO A;  1RUN A;  1Q1H A;  4GXO A;  1R36 A;  4MQ9 F;  1MJB A;  2OZU A;  4L5J A;  1A04 A;  2WWY A;  3J7A O;  4L9T A;  2Q0O A;  2OU2 A;  2A07 F;  4KDP A;  1ZGA A;  4H0E A;  5ILS A;  1ZG3 A;  2QBY A;  2IW5 A;  1EV7 A;  3QPH A;  2VT2 A;  3F22 A;  1BN5 A;  1O7F A;  3L09 A;  2D45 A;  2YSR A;  1GXQ A;  5D5X B;  1JXS A;  4CHU A;  2G9W A;  1Z91 A;  4M6X A;  1TQI A;  3GFL A;  1RUO A;  2OA4 A;  1VTN C;  3ML6 A;  1WWX A;  1I1G A;  5K1Y A;  1FX7 A;  1ZG1 A;  1YQA A;  3DPT A;  3KEQ A;  3G73 A;  1QNT A;  2V9V A;  3KP3 A;  4KUM A;  4KFC A;  3LQQ A;  4M74 A;  5E8G A;  2W85 A;  3M1E A;  1B4A A;  2PMU A;  3SXY A;  3MAJ A;  4EM0 B;  1J7K A;  5E1W A;  4YII A;  5DUK A;  4I0A A;  4LLL A;  4IRI A;  1FP2 A;  2R7F A;  4U7B A;  4Q47 A;  3JSO A;  1ZN2 A;  1UHW A;  2PMH A;  2P6T A;  3M8E A;  2A3S A;  1ONV A;  3BOQ A;  1FBQ A;  4P5O A;  3TKY A;  1E2X A;  4M71 A;  3ZMZ A;  3GFI A;  1Z9C A;  2EV5 A;  2CG4 A;  1U3E M;  1ZGJ A;  3WG9 A;  4UHT A;  3TO6 A;  2FQ3 A;  3RDI A;  2L02 A;  4HOB A;  3RYR A;  3ECO A;  3JW4 A;  2GA1 A;  4G7O F;  1G4D A;  5A2Q K;  2MD5 A;  3RYP A;  3LST A;  5BQT A;  1J75 A;  1KU2 A;  4Q4Z F;  1EH7 A;  3LWF A;  4GCV A;  1FYK A;  1ZRC A;  4HA8 A;  3WGI A;  5ICC A;  2BEO A;  3I58 A;  4HZF A;  5FLX Z;  1P6R A;  3BRO A;  1T6S A;  4IRG A;  2CGP A;  1YO5 C;  3R4K A;  2M87 A;  3M8F A;  3MFK A;  2LDU A;  4YFX F;  4IPA A;  3E6D A;  1FYM A;  1ULY A;  2NNY A;  1SFE A;  1Z6T A;  3C3W A;  2HTJ A;  2XAS A;  4I01 A;  4Q48 A;  5HOO A;  3HHH A;  1FSH A;  5DD4 A;  2M8E A;  4RGS A;  5CVU A;  2HYF A;  4CGZ A;  3T5X A;  1D8K A;  1YG2 A;  3OOP A;  1IXR C;  2HFH A;  1KQ8 A;  1F1Z A;  4R1H A;  2FNA A;  2M5W A;  3NEU A;  1T38 A;  4MNU A;  3S2W A;  2L3D A;  2XKP A;  1IN5 A;  4KMU X;  5CVV A;  3ZMS A;  2EV6 A;  5ED4 A;  3F8N A;  3MZH A;  4L18 B;  4RGX A;  4B8X A;  5LRS A;  3TDU C;  4XSX F;  4EJV A;  3H3U A;  2CYY A;  5JR3 A;  2M1B A;  2UWM A;  5HLH A;  3DQV C;  1FT9 A;  4L9J A;  1UB9 A;  4I0B A;  1U6G A;  1R00 A;  3BZ6 A;  3MQ0 A;  2FNP A;  3SZT A;  4EJO A;  4OMZ A;  4B09 A;  4MTE A;  3TOB A;  2GIV A;  3I0T A;  3BP8 A;  1PDN C;  1HSJ A;  2O0Y A;  1BC8 C;  2ZO4 A;  2A68 F;  3D5L A;  3HOT A;  1TNS A;  2FXA A;  1BOA A;  4RGR A;  3TDZ C;  2KIU A;  2P5V A;  4PZJ A;  3RJP A;  3MEX A;  4P96 A;  4JK1 X;  3IL2 A;  2RVC A;  1B6A A;  3V7C A;  2JTV A;  3GO5 A;  4HQE A;  4O3M A;  3GZ5 A;  1WRJ A;  3BPV A;  4MEY F;  1L3L A;  2QBY B;  1KU3 A;  2STT A;  2PN6 A;  2YR2 A;  3P9I A;  3W6J B;  1P4X A;  2HOE A;  3BJ6 A;  3DFG A;  1FNN A;  5HVQ C;  1TLH B;  1R22 A;  2GQQ A;  1SD6 A;  4YFK F;  1FWZ A;  1ZRE A;  2GXG A;  2GA2 A;  2P5K A;  3I54 A;  3CUO A;  2RV8 A;  2CSO A;  2Z99 A;  3F21 A;  2V1U A;  2HKO A;  2PBI A;  5AIP A;  5L3F A;  1KA8 A;  4OIO F;  2ZKZ A;  1DPR A;  2F2E A;  5BMZ A;  4WK8 F;  2OQG A;  2DPD A;  4ZYG A;  1U5T C;  3I5U A;  2D2W A;  3O3K A;  1XMK A;  2ELH A;  2VBZ A;  3E3V A;  3GUD A;  4RS8 A;  1TQM A;  1LVA A;  4YIF A;  4UVB A;  4YFN F;  2P7C B;  3WOD F;  2ZNY A;  3V8L A;  5F1R A;  5L3E A;  1O57 A;  5ICF A;  3SZP A;  2DQL A;  2NNN A;  4XLP F;  1SD7 A;  3WTS C;  2HEO A;  4HYE A;  5ICG A;  3TGN A;  4NB5 A;  5F64 A;  1SAX A;  3I59 A;  3ROU A;  3KP4 A;  4XSZ F;  3V4G A;  4PDK A;  3RKY A;  1O3T A;  3COA C;  1ZLJ A;  2EK5 A;  3DPL C;  3E5U A;  2DW4 A;  1SD5 A;  1BIA A;  2DLL A;  4ETS A;  5LGU A;  5CYV A;  3HUG A;  4U0W A;  3RIR A;  3J81 K;  4D0P A;  4Y15 A;  3VEP A;  1ZRD A;  3LA3 A;  3FXQ A;  1UCR A;  1IRG A;  2DI3 A;  2H09 A;  2E7W A;  1XD7 A;  4WF2 A;  1T2K A;  1XSX A;  4LGW A;  5IT3 A;  3KP2 A;  4HX4 A;  1JE8 A;  5BOX A;  4U0Y A;  2NRA C;  2VC1 A;  4M6Y A;  3V8J A;  4ASN A;  4GYG A;  3K1M A;  1TW3 A;  2FMY A;  2A6H F;  3GWZ A;  3KLN A;  5L3G A;  3F8M A;  2PFB A;  1HST A;  1TNT A;  5FGM A;  4S04 A;  4RB0 A;  1JHF A;  2FBH A;  5JVT A;  4ZZL A;  4RB3 C;  1F9N A;  1LQ1 A;  1IN4 A;  3R61 A;  3ABU A;  3HOS A;  4MQV A;  4BH9 A;  2E1N A;  3B02 A;  1FOK A;  3DF8 A;  3VOE A;  1KYZ A;  2DU9 A;  1LB2 A;  5L3D A;  2W57 A;  2HQR A;  5JI6 A;  2UZK A;  4HF2 A;  5EEG A;  1FPQ A;  1RIO H;  1K7A A;  3LA2 A;  5D6E A;  3WTX C;  2P8T A;  2PG4 A;  3GXO A;  2L4A A;  3DV8 A;  2XRN A;  3WTW C;  1F5T A;  2IA1 A;  5ERI A;  4R79 A;  2EWN A;  2MA3 A;  4I98 B;  5LGT A;  3SQN A;  1V4R A;  1S8N A;  3BWG A;  2IVM A;  3HTS B;  2K86 A;  2YU3 A;  4M72 A;  4ZZD A;  3RKW A;  1YS7 A;  4K2E A;  4WXH A;  1J2X A;  1S29 A;  1Z6R A;  3WTY C;  2ADU A;  4HLX A;  3QAH A;  4A0Y A;  5L3C A;  5D4S A;  4WCG A;  2XAF A;  2F5D A;  4DQ2 A;  4HLY A;  4UV9 A;  1OR7 A;  1YLF A;  3P9C A;  1H9G A;  5HDK A;  2KKO A;  3FZV A;  3KZY A;  2ISZ A;  1UFM A;  3TOA A;  2EA2 A;  1BI2 A;  2HGC A;  1KQ9 A;  4LB5 A;  1CGP A;  3IWF A;  5LHH A;  5A2Q Z;  2AXL A;  2COM A;  1OYW A;  2FML A;  4HAM A;  4OIQ F;  1P4W A;  1B59 A;  4OOI A;  3KFW X;  1P4A A;  4M9Z A;  3CLO A;  4Y17 A;  3ZMD A;  2VOP A;  2E1C A;  2IA2 A;  4ZYH A;  2QUF A;  3KP6 A;  1IXC A;  1WI9 A;  1STZ A;  2XAJ A;  4KNY A;  4BHB A;  3F23 A;  4ENK A;  1SMT A;  4QWQ A;  1XGS A;  2Z3Y A;  3BJA A;  2LKP A;  2A61 A;  1LEA A;  5E1Z B;  1ZRF A;  2G7U A;  4AWX B;  1DPU A;  3IWZ A;  4O5V A;  1R1U A;  5HLI A;  1KYW A;  4BHC A;  2Y48 A;  2P7V B;  3VFZ A;  4CO8 A;  3TQN A;  2DK8 A;  1YW7 A;  3FMR A;  3I59 B;  2GXB A;  5H20 A;  3FM5 A;  4N9I A;  4ESF A;  5J8C A;  2NAZ A;  5LHI A;  3I4P A;  5ILV A;  1RI7 A;  1FBS A;  2EV0 A;  1MGT A;  5E8I A;  4EM2 A;  4U7D A;  3HYI A;  1D3Y A;  1AWC A;  4UVC A;  3GFJ A;  4A5M A;  4G94 A;  4I7H A;  5D5W B;  1B9M A;  2JPB A;  3T1B A;  1LEB A;  1FP1 D;  3R0J A;  1YS6 A;  2WV0 A;  4HF1 A;  2KJB A;  5E20 A;  2B0L A;  2FBK A;  3FMS A;  2VE9 A;  4HW0 A;  3HRT A;  4CXF A;  5LEJ A;  5K5Q A;  4KA4 A;  3JAM Z;  3I64 A;  2DT5 A;  4G8X A;  2QLZ A;  4BAY A;  2BGC A;  3JSP A;  1ON1 A;  2HZT A;  1XSD A;  1IN7 A;  3QPT A;  4NQW A;  4NHJ A;  2FRH A;  4LD5 A;  4IRH A;  1BBY A;  2Q2E A;  2QZ8 A;  2MH9 A;  2RKH A;  1I27 A;  3ULQ B;  1V3F A;  2F5E A;  1J59 A;  2E7X A;  1XCV A;  3EUH A;  2BYV E;  5D5V B;  4U0V A;  3EYY A;  2LSO A;  2EFP A;  3RPQ A;  1W7P D;  4ESB A;  3B73 A;  2H27 A;  2K7L A;  3CTA A;  1S3J A;  2LF7 A;  3PFI A;  2DPU A;  2MLK A;  2K02 A;  2JSC A;  3GLX A;  2J5O A;  1PP7 U;  3WU0 A;  4WWC A;  2X4H A;  4RB1 A;  2QQ9 A;  1YTY A;  1GVJ A;  4OU0 A;  3EDP A;  1FLI A;  4N0B A;  2O8X A;  2Z33 A;  5BS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...