2K7LA

Nmr structure of a complex formed by the c-terminal domain of human rap74 and a phosphorylated peptide from the central domain of the fcp1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords centFCP1-T584PO4 peptide
publication title NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2008-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k7lA00
3IL2A 1HSJA 1Z05A 2R7FA 3WODF 2A68F 1Y0UA 1D3YA 1YG2A 3VEPA 1AWCA 4OIQF 2MC3A 1QZZA 2VE9A 5IT9Z 4KFCA 5CLSA 4RB2C 4WK8F 2YR2A 3OOPA 1U5TA 1PP8F 2DPDA 1RUNA 3COAC 2EJRA 3KP5A 4UNOA 1WRJA 2IVMA 3FM5A 3F3XA 1S7AA 4UXNA 2L4MA 3F8BA 1XD7A 1FYLA 1QO0D 2PBIA 4DNCA 3ZP5A 2FE3A 2LF8A 3K69A 2HYFA 2FSWA 2Z99A 2OZUA 2P5KA 5JHUA 3HRUA 2NRAC 3F8CA 2IJLA 5CJ9A 3DXJF 4UV9A 1EV7A 2YPRA 1BN5A 4CDGA 1B6AA 3C18A 3FXQA 4GGGA 1LJ9A 3RDIA 1ZAOA 5JR3A 5BPIA 1U3EM 2HTSA 1MKMA 4HDVA 3LAPA 2E1CA 3L2CA 4HOBA 2XV4S 1TQIA 2EFPA 5D5WB 2FA5A 1U6GA 1J7KA 2F5CA 5H20A 4NB5A 4KT5C 1S3JA 3TO9A 3WTUC 1XSXA 3PQKA 1RUOA 5ICGA 2Q2EA 3P7NA 2EB7A 5DCMB 2UXNA 5CVUA 2ISZA 4G9YA 3ECOA 2ESNA 4BHCA 4A6DA 5HLIA 1SD6A 1JE8A 2A07F 3K2ZA 3LA7A 4KN4X 4UUVA 3CJNA 1G3WA 3R6SA 4MQVA 2DPUA 1FOKA 3T0YA 2DK5A 4LLNA 1Z91A 5J6XA 1JGSA 2LF7A 2VE8A 1P92A 5LEKA 3WTWC 1F1ZA 3DV8A 1O3TA 2DQRA 3CLOA 1HKSA 5ICCA 4AWXB 4PDKA 3LA2A 2WC2A 2UWMA 2GA2A 5LRSA 4S05A 2ELHA 2OAZA 3VOEA 4YFNF 1WKMA 1BI0A 4MHGA 3HOSA 4YIFA 1GXQA 4H0EA 2QBYB 2EV0A 4XSZF 2XKOA 2EWNA 1FP1D 4L9TA 5L3FA 4HLXA 3ROUA 1I6XA 3BJAA 1TQMA 2COMA 1T2KA 4U0YA 2RQPA 2E7WA 3KZYA 3ZN0A 4O3MA 5F6FA 2OQRA 2YX4A 1ZRDA 3WTZA 1U78A 2W57A 1O3RA 1KQ9A 2QLZA 3VFZA 2KKOA 4I98B 1FWZA 1JHFA 1H9GA 3U9GA 2XRNA 2DU9A 2YSRA 5FFXA 5HLHA 1YQAA 3C3WA 2E7XA 1HW5A 3M8EA 2BGCA 1FT9A 1R23A 1DPRA 3JAMK 2PN6A 1L3LA 2FBKA 4G7ZF 4U7BA 2QM3A 3RKYA 4U7DA 3V4GA 2K4BA 5E1WA 3B73A 2Y75A 4EQQA 3QAHA 5HDKA 1HXDA 3RPQA 1Q1HA 2XIGA 3C7JA 3FXRA 1J9IA 1KU3A 2HFHA 2NNNA 3K1PA 1TNTA 3BZ6A 1BC8C 3ZMDA 1MDMB 4UVCA 4LK0F 2QYOA 4WXCA 2RC4A 5K5RA 3J80Z 4YFKF 2EA2A 3FWEA 4RGSA 4N9IA 3MWMA 4ENKA 1BBYA 4LGWA 3E6MA 4G7HF 1UFMA 3IRRA 3CTAA 3G73A 3BPVA 5FLXZ 4KNYA 4GO1A 2FXAA 2D45A 4ENMA 3LFKA 3WU0A 5CVJA 3N4MA 3IKTA 5CVRA 1FLIA 1RNLA 5ILVA 4OIOF 1K7AA 5BPDA 1BI3A 2ZCWA 4OU0A 3E5XA 3K9TA 1IXCA 1OMIA 4BXUA 2RNJA 5AIPA 3PFIA 3JTGA 2XROA 2IT0A 1KQ0A 3F6OA 1JHHA 3HRSA 4GXOA 2JT1A 2IPQX 2O3FA 4MGRA 2QENA 1J75A 3F6VA 3BJOA 4MTEA 2IA0A 4EGYA 2STTA 2J5OA 5F1RA 2F2EA 5ICEA 5FB2A 1CF7A 1AOYA 1ON2A 2QVOA 2WV0A 1BIBA 1IF1A 1USTA 4FX4A 2GXBA 1BOAA 3TGNA 1T98A 5D5UB 2V1XA 3V8JA 2PLYA 2X4HA 2L54A 3ZMTA 1XGNA 4CXFA 1U5TC 2A61A 5KVRA 3V7RA 3FHZA 4M73A 1DUXC 2WTEA 5LBQA 5LGTA 3L09A 3F72A 3KP2A 2CO5A 4O5VA 2K7LA 3MCZA 1YW8A 5E1ZB 3F22A 3P9CA 2HKOA 4WF2A 3HOTA 4YFXF 1R22A 5DV5A 4L9JA 4RGXA 3K1MA 4Y17A 1DP7P 3SXYA 4A2UA 3J7AO 4N9HA 1W7PB 1YW7A 1ZH5A 4Y13A 3KCCA 3L7WA 2L4AA 2VC1A 3NRVA 3RI4A 4EV0A 4CYDA 3WE3A 1OYIA 5LGUA 4PGHA 3LAJA 2QZ8A 2GIVA 3DQVC 4HV6A 4B8XA 1P4AA 4RGRA 2RDPA 3RTRA 2FBHA 3R0AA 4BHPA 1QPMA 4XLNF 1CGPA 1IN7A 4HF0A 1MD0A 5IT9K 2GXGA 4TV7A 3KE2A 3MEXA 1Z1DA 3IRQA 4HX7A 4ZZDA 3DKWA 1YLFA 2L01A 4K2EA 5ERIA 4N0BA 2E1NA 3E6CC 3W6JB 2VT2A 3LSTA 4KMFA 3I4PA 4M6YA 1WI9A 2CWEA 1WWXA 1FNNA 2A5YB 1X3UA 1F9NA 4EM0B 5HLGA 2VT3A 2DFIA 3ULQB 2XAFA 1IW7F 3KETA 4AIKA 1IUYA 3I59A 1K79A 2KJBA 4LB5A 1DDNA 1TBXA 3O3KA 2CGPA 2VONA 3EYIA 1U5TB 5ICFA 1XMAA 1K78A 1HW2A 2ZBKA 2V9VA 3I5UA 3R4KA 2R3SA 1DPUA 1USSA 3QPTA 1W4MA 5IT3A 1D5VA 3GF2A 3E3VA 3WGHA 4KIBA 3Q9SA 3HTSB 2P8TA 5CVIA 3OV8A 1T39A 3D5LA 2DT5A 4YG2F 1YFHA 4MEYF 1P2FA 2YU3A 3WTYC 3GFJA 1BM9A 1Z9CA 1W5SA 3RJPA 4G6QA 1SFUA 3T8TA 2BE5F 1Z6TA 2PFBA 1I27A 3HHHA 1SD5A 4XBFA 1BJAA 2O61A 5ILSA 1ZG3A 3GYHX 2NAZA 4EGZA 1O3QA 3KEQA 3I53A 1I5ZA 3IWZA 3EQLF 2B0LA 3QRFF 4B09A 1FPQA 2GA1A 5FD5A 4M9SA 2G9WA 2F5EA 4ZYDA 4M71A 1J5YA 2PG4A 3NQOA 2HR3A 4RB1A 4XRFA 2P6TA 1HBXG 2GAUA 4HZFA 3BDDA 4Q48A 4DQ2A 4BHBA 4HF1A 2VBYA 2O0YA 4ZZLA 4WCGA 4EMSA 3CO6C 3SFZA 2XAJA 2DTRA 2XAHA 4RB3C 2P5LC 1F5TA 4HAMA 4MNUA 1ZG1A 2L02A 2LNBA 2M87A 1YW9A 3JSPA 2MLKA 2ZNYA 2M8EA 3KP6A 3V7SA 2H6BA 2GQQA 3E6BA 3TKYA 3F8MA 3WTSC 3KP7A 1Z6RA 3H3ZA 1ZLKA 2FMLA 2HYGD 3WTTC 2BYVE 2DLLA 5E8IA 3HSEA 1LB2A 4HF2A 4CICA 5ILUA 4JBAA 3E6DA 1G3TA 2LSOA 3ERED 3AAFA 3T1BA 2RN7A 2XKPA 1LDDA 3GFLA 3WGIA 3WTXC 5HDNA 4EJUA 2J5PA 2A3SA 5A2QZ 4ESFA 2IA2A 2EFWA 2P4WA 1SMYF 2CW0F 1QGPA 4IHTA 3ELKA 1GXPA 1TW2A 1LEBA 4HLYA 2FF4A 4KDPA 3GX4X 3RIRA 1ZYRF 2Z9OA 1B9MA 2CQKA 1PDNC 2HWVA 2QUFA 3CDHA 2XAGA 5JI6A 1YS6A 2P7VB 4MEXF 1UHMA 2VBWA 1BIAA 4EJTA 3T8RA 2D1HA 4HYEA 2A6EF 4ZYHA 2M45A 3HIFA 1FY7A 4ASNA 1OPCA 1XDUA 1ZGAA 4UHTA 3TDZC 3IWFA 3MQ0A 4PCQA 3L9FA 3J80K 1XGMA 2XUBA 3Q5FA 2V1UA 4HX8A 1XN7A 2NYXA 1BI1A 4EJVA 1R7JA 2EFQA 1J59A 3ZMUA 2ZJ2A 5DYMA 2K02A 3M8FA 5KK1A 5LLQA 1IXSB 4P96A 3BJ6A 2Z3YA 1NHAA 5FLXK 3DP7A 3IC7A 3T5XA 1BI2A 2RV8A 4OINF 3FX3A 1XCBA 3I64A 4ETSA 5L3BA 3S2WA 4CGZA 1Z7UA 2W25A 4I09A 1TLHB 3TQNA 2VXZA 2KRFA 3DEUA 2ZMEA 3P9IA 3CUQA 2H6CA 4E70A 1O3SA 3DFGA 2FBIA 5E1XA 4PZJA 1T6SA 4L0YB 1XSVA 2F5FA 1T38A 6PAXA 1SFXA 3MAJA 2QWWA 4HW0A 3R60A 1ON1A 1RIOH 4I02A 1UCRA 3HUGA 1YO5C 2VOOA 1ONVA 4P55A 4HDUA 4EM1A 1GVJA 1T0FA 2GZWA 2ESHA 3LWFA 4MTDA 2DK8A 4L9VA 5BMZA 2HTJA 1XMKA 1G3YA 2CFXA 4ENJA 2XAQA 1IXRC 2DAOA 1CF7B 4JK1X 4M9XA 2X0LA 5HS7A 2C6YA 5K5OA 1LNWA 1XB4A 4GYIA 4M9ZA 1ZGJA 4D0PA 4M74A 3CUOA 3M9AA 2VOPA 2K27A 2Y48A 3BROA 2OD5A 2IP2A 4I0AA 4L5JA 3QP5A 3V8LA 3BP8A 4QLCU 4L9NA 3H3UA 2XASA 5TRDA 2FQ3A 3J81Z 1V3FA 2K4JA 4BQAA 4OMYA 5DUKA 1KU7A 4KN7X 3REOA 4IRIA 3GZ6A 5E18F 2STWA 4Q5SF 5D6FA 4G94A 4R8HA 1J0RA 3I58A 4KMUX 2EA4A 1RI7A 5K5QA 4S04A 2VC0A 3NEUA 5DCFA 3FMQA 3KEOA 2XHKA 1YTYA 4FHTA 3W6KB 1MJAA 5JVTA 1HKQA 4FX0A 4QWQA 2AS5F 5L3DA 3WG9A 1U8RA 1IN6A 4A6EA 2HZTA 3K0LA 4AVPA 5DUIA 2HGCA 4HBLA 2BBYA 1A04A 2P5VA 2PI0A 2V1DA 3KLNA 4BAYA 4ESJA 1SMTA 1LVAA 4MQ9F 3ZQ7A 2ISYA 3GVAA 4LB6B 3M1EA 1F4KA 2DI3A 3RPUA 3GO5A 1B9NA 4ZYGA 2PMHA 4LMYA 1QZYA 2PEXA 4WXHA 4LD5A 2WWYA 3VODA 4GCVA 1ZG5A 5E8GA 1O7LA 3I59B 2L3DA 3HSRA 1SAXA 2O6GE 4Y15A 5H6RA 3CO7C 3ABTA 2BV6A 1EH6A 5FO5A 3KZZA 1BC7C 2IA1A 2W84A 1K78B 1IN8A 3TOBA 3FF5A 2A6HF 4IJAA 5FGMA 3N97A 4R79A 4Q47A 3ABUA 1H9TA 1FC3A 3MFKA 1W7PD 4LG0B 1UHWA 2JZYA 2QQAA 4RS8A 1S6LA 2HEOA 3C1DA 3GWZA 5FFZA 3TDUC 4U88A 1ULYA 2ZKZA 5D5XB 5J8CA 2HQNA 2MA3A 3HHGA 1E2XA 4WX9A 5ED4A 2DBBA 2FU4A 4I01A 2UXXA 1ZRFA 1S7OA 2EK5A 2Q8KA 4LG0A 1IRFA 3JW4A 1OKRA 4LLGF 1J2XA 3R0JA 2ADUA 1YIOA 3M7GA 4WWCA 2DW4A 3WTVC 2CSOA 4KICA 3KLOA 2ZXJA 1C0WA 2HOEA 4EJOA 1TTYA 1XCVA 2JSCA 3ZMVA 3FXUA 4ZH4F 2LKPA 2M1BA 2LDUA 3SZTA 3RKWA 2DQLA 3EDPA 3QU3A 1FYKA 2MH2A 2OZ6A 1U2WA 1XGOA 3SQNA 5H6QA 4ESBA 2OBPA 3HTUA 1B59A 4JQFA 3L00A 3QU6A 2XVCA 5CVVA 5EEHA 1IZ1A 3EUHA 3SZPA 1MJ9A 5J8FA 4AIHA 3TOAA 5D6EA 4PGGA 4WXDA 3BWGA 1TW3A 3PQJA 1EH8A 2MBFA 2Z33A 2JPCA 2P7CB 5DEQA 2XGXA 1R58A 4OOIA 3O2PE 4FT8A 5DDGA 3JTHA 3GZ5A 2Q0OA 2NNYA 2D2WA 5BOXA 5HS8A 5A2QK 2IRFG 3KFWX 2KJCA 2H27A 2EV6A 2VODA 3R61A 4L5IA 2NS0A 3FM3A 1JXSA 2IW5A 1KQ8A 3RYRA 2ACJA 4AD9A 2JTVA 1R00A 3GXOA 2YX7A 1OYWA 1IAWA 1FSEA 3GW2A 3P9KA 4IRHA 2HKXA 3CUQC 1XSDA 3SHFA 2BEOA 1OYYA 1I1SA 2O8XA 4RGUA 3E97A 1KGSA 5E17F 3ZN1A 3LQRA 4ON0A 3IKVA 3H92A 4R1HA 4A0XA 3ZPLA 2MH9A 1FX7A 3O6BB 2CG4A 2O03A 4HX4A 5DD8A 1B4AA 1V4RA 2KIUA 5AONA 3FZVA 1PP7U 3F8NA 5DCMA 4HV5A 2OQGA 5HOOA 5JFRA 3QP6A 4Z2YA 4HA8A 2QQBA 4UV8A 4G7OF 5D8LB 1R1TA 4NHJA 1ZLJA 1I1GA 2VN2A 3FMSA 3ZMZA 4A0YA 5HVQC 1REPC 1QNTA 1IN5A 2KIFA 1R5HA 1P6RA 1OR7A 4IXAA 2FEZA 3QOPA 2Y0MA 1ZRCA 2JPBA 5LHHA 5E20A 5D4RA 4LJZF 4A12A 2RVCA 3E5QA 4KUMA 3ECHA 4EM2A 2K86A 4P9UA 3D0SA 2FMYA 2PJPA 3B02A 3V8KA 2FRHA 1ZHFA 4UVBA 2QBYA 2JRTA 3GEZA 4IPAA 5AIQA 1SD4A 3VB2A 2H09A 1LEAA 5LEJA 2ZMEB 3CUQB 2FNPA 5LGNA 3U1DA 3KP4A 3TO7A 1W5TA 4G6DA 5BQTA 4P9FA 4ENNA 3RKXA 1D8JA 3F23A 1KU2A 4EJWA 3BPXA 3MZYA 2R7DA 1LDJA 2ZFWA 2VBZA 4RAYA 2Z5UA 1PUEE 4KIGA 1LQ1A 3G3ZA 4UVAA 1KA8A 3I54A 3K1NA 4AIJA 4L0ZB 1ZARA 5D5VB 2OA4A 1L0OC 4YIIA 1STZA 2ETHA 1FBUA 2VBXA 1P4XA 1WSUA 3J81K 1O7FA 1MDMA 2PMUA 1ZREA 3LA3A 2MLGA 1IRGA 2EFNA 2HS5A 3Q9VA 3DF8A 1FP2A 1MJBA 2V79A 4LLLA 3JAMZ 4GYGA 1O57A 5FD6A 4U0VA 3MZHA 5D4SA 1ZN2A 1FBQA 3WGGA 1QQIA 2RGVA 5L3GA 2CYYA 4CHUA 4OIRF 3IHUA 3BOQA 5F64A 3HYIA 3V7CA 3ML6A 4Q4ZF 4IVNA 1TQPA 3QPHA 1D8KA 1UB9A 5BS6A 1G6NA 4HQEA 1VTNC 3F21A 4M6XA 1B1BA 4U0WA 1R5GA 1IN4A 2F5DA 2A69F 1ODDA 2HQRA 4CZZA 2EFOA 3LQQA 1S8NA 4KA4A 4IF4A 1KYZA 1FSHA 2RKHA 1SFEA 4O6JA 3WU1B 4A0ZA 3TO6A 2OU2A 1HKTA 2W24A 4G8XA 1P4WA 3HRTA 1FYMA 2EV5A 3BY6A 1RZ4A 4F7ZA 1WQ2A 2G7HA 4BNCA 1HQCA 2AXLA 4A5MA 1HW1A 4LK1F 4EVIA 3F8FA 1E17A 3KP3A 2FOKA 2PQ8A 2G7UA 3U2RA 3HSFA 4ZYEA 1SD7A 4XLPF 3RYPA 4A5NA 1GHCA 1KYWA 4I0BA 1TNSA 5HS9A 4RB0A 5HDGA 3ISPA 2KIMA 1FBSA 3DPTA 1G3SA 5DD4A 2W85A 2HDCA 2FNAA 1R1VA 4XSXF 5K1YA 4M72A 4NQWA 4LFUA 3WE2A 4CO8A 5L3EA 3GUDA 5LHIA 2H94A 1YS7A 2ZNZA 5CYVA 1YYVA 1EH7A 2M5WA 4BYYA 1W7PA 5LRRA 2UZKA 1LDKB 1R36A 5EEGA 4IHSA 5LHGA 2MD5A 4OIPF 2D1VA 4KIFA 3EETA 2V6CA 1R1UA 4BH9A 1K6OA 3HRMA 1MZBA 4P5OA 3EYYA 2P6SA 1HSTA 3GLXA 4OMZA 1S29A 2DO7A 4IRGA 3I0TA 1XDSA 3ZMSA 3GFIA 1MGTA 5L3CA 2GWRA 1KU9A 4I2OA 4I7HA 2TDXA 4KYWA 1XGSA 4HQMA 2QQ9A 1H0MA 1QBJA 1G4DA 5TJJA 3FMRA 3I71A 5D8KB 3GFMA 4RAZA 3E5UA 4L18B 3JSOA 2M30A 1FZPB 3DPLC 2ZO4A
chains in the Genus database with same CATH superfamily
3IL2A 1NK2P 1HSJA 4XLAA 3GTMJ 2LBFA 1CQTA 1Z05A 2DFHA 1LE8B 2R7FA 4KISA 1RPWA 3WODF 1IG7A 5J1YA 1K6YA 2A68F 1Y0UA 1D3YA 1YG2A 4KJZA 4M3FA 3VEPA 1AWCA 4OIQF 2MC3A 1QZZA 1UHSA 2VE9A 2DT6A 1X1CA 2NVYJ 2LY9A 5IT9Z 4BUPA 3G4SI 1UG2A 4KFCA 4FISA 1JUSA 5CLSA 4RB2C 3CCMI 4WK8F 2YR2A 2M0MA 3A0HC 3OOPA 1U5TA 1PP8F 2DPDA 1RUNA 4HG2A 3LSKA 3COAC 2EJRA 3KP5A 3LSHA 4NDLA 4UNOA 1UJ8A 4BS9A 3AG1H 3DU5A 4BU2A 1WRJA 2IVMA 1OR7C 1V5FA 3FM5A 3F3XA 1WHUA 5BNGA 1S7AA 2ZJRF 4UXNA 2L4MA 3F8BA 1LFPA 2ZC2A 1XD7A 1FYLA 1QO0D 2PBIA 4DNCA 3ZP5A 1BR4A 2FE3A 2OCEA 2LF8A 3K69A 2HYFA 2LKXA 2V7FA 2FSWA 2GBYA 2ME6A 2HOAA 2FQ4A 2Z99A 4B48A 2OZUA 2P5KA 3CP8A 3E1SA 4XONA 5JHUA 3HRUA 4HSTA 4XQFA 2NRAC 3F8CA 2IJLA 4UV9A 2DYRH 3DXJF 5CJ9A 1EV7A 2YPRA 1BN5A 2LOOA 4MFEA 1JI8A 4CDGA 1B6AA 2DDAA 4JX5A 3C18A 2E71A 3FXQA 4GGGA 1LJ9A 3RDIA 4BY7J 1ZAOA 5JR3A 1YJWI 3JREA 5BPIA 3UKGA 1U3EM 2HTSA 3MMYB 1LUJB 2Y9ZA 5HNFA 1MKMA 2JA6J 3TBIA 4HDVA 4BACA 4ZDOA 2Y2ZA 3EPZA 3LAPA 2E1CA 5FKMA 3L2CA 4HOBA 5F0CA 2XV4S 1TQIA 4DZPA 2EFPA 5D5WB 2FA5A 2Y0SN 3K7AJ 1U6GA 1J7KA 2F5CA 2X1CA 5H20A 4NB5A 4KT5C 1S3JA 1R4MB 3TO9A 2R0QC 5LD2C 3WG7H 3TW7A 3WTUC 1R71A 1XSXA 3OYKA 1VZ0A 3PQKA 4XR6A 1RUOA 3FDYA 4CH7A 1WJAA 5ICGA 2Q2EA 3S3MA 1MIJA 3P7NA 1YJNI 2EB7A 5DCMB 2JWTA 2UXNA 3JRHA 2IAIA 2IGNA 3PNTA 3S1NJ 3CCVI 5CVUA 2ISZA 4G9YA 3ECOA 2FX0A 2TCTA 2ESNA 4BHCA 1H88C 4A6DA 5HLIA 1SD6A 1HOMA 1JE8A 2A07F 1G2HA 3K2ZA 3LA7A 1MSFC 4KN4X 2MSYA 4RAFA 4UUVA 4BE0A 3M3YJ 1TZLA 3CJNA 4U87A 1G3WA 4LG3A 4CCJA 2LFBA 3R6SA 1B72B 1SANA 4MQVA 2DPUA 1LFBA 1UG0A 2OPTA 1MBEA 2ICWG 3ZCOA 1FOKA 3T0YA 3OYDA 2DK5A 2QKLB 3H0GJ 4LLNA 2VQHA 1Z91A 2R7WA 5J6XA 1JGSA 1I6HJ 2LF7A 5E3OA 3G1LA 2VE8A 2L7FP 1P92A 5LEKA 3WTWC 5KAIC 2CJJA 1G59A 1F1ZA 1SVLA 2QEXI 3DV8A 1O3TA 2DQRA 1AKHB 3CLOA 1IUFA 1HKSA 5ICCA 4RLQA 4AWXB 4PDKA 2K5CA 3LA2A 1WH7A 3HOXJ 2RNGA 2WC2A 2MGQA 1FOYA 2KHMA 1BR2A 2UWMA 2GA2A 5LRSA 4S05A 1VQ8I 2ELHA 2OAZA 3MKLA 3VOEA 3BR0A 3AFHA 2E60A 3BG3A 1ETXA 4YFNF 4V19K 4MLOA 1WKMA 2ELJA 5E3MA 1HC8A 1BI0A 4HPQA 2KPMA 4MHGA 3HOSA 3Q0VA 1GXQA 4YIFA 4H0EA 2QBYB 2EV0A 4XSZF 4B43A 2V4JC 2XKOA 5FJ8J 1XC5A 1U8BA 3TMOA 2LYCA 4BGDA 3AKZA 4IHVA 4LIUA 3RQIA 2EWNA 3HEFA 1FP1D 3DBHB 4L9TA 3G2BA 3QPLA 4CCKA 4A3BJ 5L3FA 3HOVJ 1GVDA 4HLXA 3ROUA 2Y69H 1I6XA 3BJAA 1TQMA 1S72I 2COMA 1QZEA 5GTHC 3HOYJ 4HNVA 1T2KA 4U0YA 3KYLA 3HBLA 2RQPA 9ANTA 5IP9J 3OYNA 1X2NA 2E7WA 3IH3A 3KZYA 3CDLA 3ZN0A 4M3GA 1ETQA 4O3MA 4D5CA 3A0BC 5F6FA 2OQRA 2VJ5A 3IH4A 2YX4A 3QPSA 1ZRDA 3I4NJ 3WTZA 5IOZA 4BQOA 1U78A 5KHDA 3KPHA 1SVMA 2W57A 4YELA 1O3RA 1QRYA 3L1PA 1KQ9A 2QLZA 3VFZA 3VWBA 2KKOA 4I98B 1FWZA 1JHFA 1H9GA 3U9GA 2GIZA 2R4GA 1YHQI 2XRNA 2E35A 3RCOA 2DU9A 2L9NA 2YSRA 5FFXA 5HLHA 3KEYA 3BCBA 1YQAA 3C3WA 1QHGA 2CQ7A 2E7XA 3ABMH 1V5GA 1HW5A 1YITI 1Y39A 3H5RA 3M8EA 2BW3A 1W0UA 3CDIA 4I99C 2XGEA 2BGCA 1FT9A 1R23A 4BDZA 2E36A 2MYSA 3A01B 1MNEA 1DPRA 3JAMK 2PN6A 1L3LA 2FBKA 3GTOJ 5IY5H 3CJTB 3S1MJ 1WVRA 3LSJA 4U7BA 4G7ZF 2EQRA 2QM3A 3RKYA 4U7DA 3V4GA 2R5ZB 2K4BA 5E1WA 2M9HA 2WB1A 3B73A 3H36A 2XPWA 1Z3YA 4XLCA 2Y75A 4EQQA 2MFZA 1FOWA 1VQPI 1EKEA 3QAHA 5HDKA 1HXDA 4W1UA 3RPQA 1Q1HA 2XIGA 3GTQJ 2M7BA 3C7JA 3A4CA 3FXRA 1J9IA 1KU3A 2HFHA 4FTHA 2NNNA 3K1PA 1K61A 1TNTA 1JTXA 1FTZA 3BZ6A 1BC8C 2L9RA 3ZMDA 4BY1J 5DM6F 4IHXA 4DGWB 1MDMB 2DA7A 4IL6C 1PUFB 4UVCA 2Y30A 4BBRJ 1FOXA 4LK0F 2QYOA 4WXCA 1IC8A 2LRDA 1OCPA 3CCYA 2RC4A 3D5SC 5K5RA 3J80Z 4F91B 2CS3A 1LVKA 4B3AA 4A3IJ 3WHCA 4YFKF 2EA2A 5EG0B 3FWEA 2X48A 2M0CA 4RGSA 5M3MJ 4N9IA 2ID6A 3MWMA 4ENKA 1BBYA 4LGWA 2E2JJ 3E6MA 4G7HF 1UFMA 3IRRA 4AYBN 3CTAA 3CC2I 3G73A 4XLEA 3BPVA 5FLXZ 2LTPA 3I55I 4KNYA 4GO1A 2FXAA 3F9KA 2D45A 3U21A 3TP3A 4ENMA 1YIJI 3LFKA 3WU0A 5CVJA 4AUXA 3N4MA 3IKTA 5CVRA 1FLIA 1RNLA 5ILVA 4CUGA 1SVOA 4OIOF 1K7AA 3VYTB 2L7ZA 2VLAA 5BPDA 5TGTA 1VQMI 1BI3A 3SDBA 5B5EC 2ZCWA 4OU0A 3E5XA 2F4MB 3K9TA 4Y7NJ 5CPRB 1IXCA 2GXAA 3S32A 1OMIA 2GOMA 1T8IA 4BXUA 2RNJA 5AIPA 4IHWA 3PFIA 1ZR2A 1WH5A 2AXTC 2XRLA 3JTGA 2XROA 2IT0A 1KQ0A 2EPFA 3JRFA 3F6OA 1JHHA 1MSEC 3HRSA 4GXOA 3JRIA 2JT1A 2IPQX 4XKVA 2O3FA 1HCRA 5EZHA 4MGRA 3K4CA 2YU9J 2QENA 1J75A 3F6VA 4IHYA 3BJOA 4MTEA 2L7MP 2IA0A 2W7NA 4EGYA 2XB5A 2MABA 1MBKA 1H8AC 3OSGA 2STTA 2J5OA 4DOZA 5F1RA 4IKFA 2F2EA 5ICEA 1T33A 5FB2A 1D1CA 1CF7A 1AOYA 3CJRB 3LOCA 4A93J 2L7KA 4Y4RA 1ON2A 1HA8A 4FETA 2QVOA 4X0GA 2WV0A 4C2TA 1BIBA 1IF1A 1USTA 2F48A 4BL0B 4FX4A 2GXBA 2BXZA 2CH0A 2Y9YA 1BOAA 3PNYA 3TGNA 1YRNA 1MBGA 3A2KA 1T98A 4F52A 5D5UB 2V1XA 1DGWY 3V8JA 2PLYA 2X4HA 2L2OA 1ZKGA 4F92B 2L54A 3ZMTA 4C30A 1XGNA 4CXFA 5F0FA 1U5TC 4PK4A 3CC4I 2A61A 5KVRA 3V7RA 3FHZA 1WJFA 2I5UA 3DWLE 3V42A 2HOTA 4M73A 1DUXC 3J7YJ 2NVTJ 2WTEA 5LBQA 5KNLA 5LGTA 1SC7A 3L09A 3F72A 3KP2A 2DMUA 5IYDJ 2CO5A 4O5VA 2K7LA 1LPQA 2AHQA 1WI3A 3MCZA 1MBFA 3ZQIA 3M8JA 1YW8A 3BG5A 3JR9A 3KZIC 5GPCA 5E1ZB 2B63J 5FKNA 1S7EA 3FXKA 4E7HA 3F22A 1T95A 4KT6A 4H4KC 3P9CA 4CYCA 1GDTA 2HKOA 2EIMH 2KZGA 2FUG2 4WF2A 3HOTA 1A36A 4YFXF 4A3JJ 1R22A 2XC7A 2X6XA 5DV5A 2WAFA 1FIPA 4L9JA 4RGXA 3K1MA 4Y17A 2DODA 3JRGA 1RETA 1DP7P 5KCMA 3D5RC 3SXYA 4A2UA 4J01A 2M7AA 3J7AO 3OR2C 1GT0C 4N9HA 1W7PB 2JN6A 5H2FC 1YW7A 3S3NA 1ZH5A 2ZJQF 3PO3J 4Y13A 3KCCA 3L7WA 2XB0X 1ZTRA 2L4AA 2VC1A 2Z2SB 2M3AA 3NRVA 4RA2A 3RI4A 3EUKL 4BXXJ 2BY0A 4EV0A 1OJLA 4CYDA 2CV1A 1R4NB 4AIDA 4BEHA 3WE3A 4DW6A 1OYIA 1WJEA 2CMPA 2CW7A 3OYIA 2VJJA 1D1AA 1P7JA 4PGHA 5LGUA 3LAJA 2QZ8A 2GIVA 4GRIA 4XKBA 3VYSB 3DQVC 3LL7A 4HV6A 3OS2A 4EEFG 4B8XA 1P4AA 4RGRA 2RDPA 4G6TB 2FBHA 3R0AA 3RTRA 2JA7J 3I4MJ 4RDUA 4BHPA 1QPMA 4E7ZA 3CCRI 4XLNF 1CGPA 1IN7A 4HF0A 1MD0A 4JX4A 5IT9K 4XN0A 1ENHA 2GXGA 4TV7A 3KE2A 3FBIB 2COBA 2BOLA 3MEXA 2UUZA 2WAEA 1JKOC 5EEAA 3ZOBA 1Z1DA 3G1OA 3K4LA 2ELKA 2Z16A 3IRQA 4HX7A 4B1RA 4ZZDA 5HLTA 3DKWA 1YLFA 3A1YA 2R7RA 2L01A 2M4KA 1U0JA 1QVTA 4K2EA 4PUSA 5ERIA 2HU9A 4N0BA 2OV7A 4DZJA 3S3OA 4II2A 2E1NA 3OYHA 3E6CC 4PJ0C 1MMAA 3W6JB 4BKXA 4XRMA 2VT2A 3OIOA 2DFEA 2EZIA 2VQCA 3LSTA 4NNJA 2LBFB 4KMFA 3I4PA 3OL3A 1X1BA 2PJRA 4M6YA 3AG4H 1WI9A 5J1RA 2CWEA 1WWXA 1FNNA 2A5YB 1X3UA 3FBNB 1K4SA 1F9NA 4EM0B 5HLGA 5IYBJ 2VT3A 3NWSA 2CUJA 2DFIA 2BVLA 3NWTA 3ULQB 2XAFA 1IW7F 2H8WA 1N75A 1Y0NA 3KETA 2QA4I 4AIKA 1IUYA 1MNMC 3I59A 3OMYA 2FD5A 1K79A 2HPMA 4C2MJ 3H35A 2KJBA 2DA1A 4A3MJ 4LB5A 1QVUA 1DDNA 1TBXA 3O3KA 4BQNA 2CGPA 2VONA 3EYIA 3ZQFA 1U5TB 5ICFA 1XMAA 3HM5A 2VL8A 2EH3A 3BQZA 1K78A 1HW2A 1W36D 2ZBKA 1RC9A 2V9VA 3I5UA 3L2WA 3R4KA 4XOPA 2R3SA 2VKVA 1VFCA 4NC8A 4NBQA 3FKIJ 1DPUA 2ZJPF 1USSA 3QPTA 1W4MA 5IT3A 1D5VA 1SFKA 3BLYA 3GF2A 3E3VA 3WGHA 1X1AA 2DMNA 4KIBA 3TW6A 2QSHX 3Q9SA 3AL0C 2IS6A 5K7FA 2NS8A 2NOJB 4XKWA 3HTSB 2P8TA 5CVIA 3OV8A 4CCMA 3CCUI 3D5LA 5JHFA 2BHYA 1T39A 4AU7A 1JKQC 1R49A 2CU7A 3GBGA 2IS1A 2DT5A 3W2VA 2DXIA 2QF7A 4YG2F 3CC7I 1YFHA 4MEYF 1P2FA 3PFYA 2YU3A 2W82A 3WTYC 3K2AA 3HG9A 3GFJA 2JVHA 1BM9A 3BR5A 1Z9CA 1ETYA 1W5SA 4QIWN 3RJPA 4G6QA 4V2FA 4GFBA 1SFUA 3T8TA 3S8PA 3RSNA 2BE5F 4XIDA 4E7IA 1N77A 3OL4A 1Z6TA 3PL8A 3WHBA 3ABKH 2VJ4A 4OAYA 2PFBA 1I27A 2KQRA 3HHHA 1SD5A 1Z0XA 3RZDJ 1OCTC 5CKTA 2BVMA 4XBFA 4XL9A 4F3QA 1BJAA 2CUFA 3L2VA 2O61A 5ILSA 2OTJI 4UUSA 1ZG3A 3BR6A 3GYHX 2JA8J 3FXJA 2NAZA 4EGZA 1O3QA 1V55H 3KEQA 3I53A 1A35A 3DU6A 1I5ZA 3IWZA 3EQLF 5B1AH 2B0LA 2XSDC 4B09A 3QRFF 1FPQA 1JTYA 2OTLI 2GA1A 3K4NA 5EJCA 2G0EA 5FD5A 5J47A 2VI6A 2BY2A 4M9SA 1P9QC 1W5CC 1OCCH 2G9WA 2F5EA 3QYBA 4ZYDA 3F0CA 4M71A 1J5YA 2PG4A 2V1NA 3NQOA 2HR3A 4RB1A 2DA2A 4ZYAA 4XRFA 3HOWJ 3FXMA 1ETVA 1POGA 2P6TA 4YIRX 1OLTA 5CQEA 1MMDA 2Q2EB 4AC0A 1HBXG 2O9LA 3ZQCA 2GAUA 2JSPA 4HZFA 3BDDA 2BXYA 4Q48A 4BHBA 4DQ2A 4HF1A 2VBYA 2O0YA 4ZZLA 4WCGA 4EMSA 3IAS2 3CO6C 2DYSH 3N05A 3SFZA 2XAJA 4A69C 4HNTA 2CQQA 3GTJJ 1UAAA 2DTRA 3G71I 1DQUA 2XAHA 4RB3C 2P5LC 1K4TA 1F5TA 3VPRA 4HAMA 4DIQA 3OYFA 1MW7A 2XGDA 2WV1A 4MNUA 3H3VK 3PO2J 1ZG1A 2L02A 3L2QA 2HQ5A 4XNFA 2LNBA 2RQQA 3HL2A 4ZTJA 3A02A 2M87A 1YW9A 3K70C 3JSPA 3DTIA 2MLKA 2ZNYA 5EYRA 1IGNA 2M8EA 2XSJC 3CP2A 3HKZA 3KP6A 2HVRA 3V7SA 2H6BA 2GQQA 2JQ7A 3E6BA 4ZJZA 2X6YA 3TKYA 1IDYA 5M5YJ 2R7TA 3F8MA 3WTSC 1IO2A 3KP7A 3OYAA 2E2IJ 1Z6RA 3H3ZA 1ZLKA 1MBJA 2FMLA 3AL0B 2XPVA 2HYGD 1A6QA 3WTTC 1E0EA 4F55A 1JKPC 2BYVE 2BY3A 2DLLA 2MW8A 3FKJA 5E8IA 3HSEA 5C3EJ 5DM7F 4N4NB 1LB2A 2QKMB 4HF2A 3S2HJ 4CICA 1S5LC 5ILUA 4UB8C 2ZXWH 2ZXIA 1I3AA 4JBAA 3E6DA 1G3TA 2HDWA 2F6CA 5M5XJ 2LSOA 3BR1A 2ME0A 3ERED 3AAFA 3T1BA 2RN7A 1JUPA 2XKPA 1LDDA 3E0JB 3GFLA 3WGIA 1Y6IA 1D0YA 3WTXC 2VKDA 4A3FJ 5HDNA 4EJUA 2WBMA 4Y33A 2R92J 3HZJA 3EUAA 2J5PA 2A3SA 5A2QZ 4ESFA 1WFXA 2A5WA 2IA2A 2DMQA 3OYBA 2CW8A 3ZGKA 2JA5J 1WJ5A 2EFWA 2IS2A 1Z3XA 2P4WA 3BG7A 1SMYF 2CW0F 4AM3A 1X4OA 1J09A 1QGPA 4IHTA 2WAQA 1Q1VA 3ELKA 1GXPA 1ETKA 2VKHA 1A6IA 1TW2A 2OF7A 2RREA 1LEBA 4HLYA 1RR8C 2FF4A 4KDPA 3JRAA 4C9YA 5F27A 3GX4X 3RIRA 1ZYRF 2W00A 2Z9OA 4I76A 3FIWA 2CQNA 2X1DA 1B9MA 2M34A 2CQKA 1PDNC 1OCRH 2HWVA 3M07A 4E4HA 1KZHA 2QUFA 2GOXB 3CDHA 2ECBA 2XAGA 1WJBA 5JI6A 2OJED 4E6KG 2Y31A 1YS6A 1I39A 2P7VB 4XICA 3C2GA 4MEXF 4D7NA 1UHMA 2VBWA 1BIAA 4EJTA 3T8RA 2D1HA 3HPHA 4A3DJ 1IRZA 4HYEA 3QODA 3LNQA 1JT6A 3E7LA 2KZVA 5J40A 1VQ7I 3H9JA 2A6EF 3QWLA 4ZYHA 2QSGX 2M45A 1APLC 3HIFA 1FY7A 1YJ9I 4XORA 4ASNA 2BW3B 1OPCA 3OOUA 1XDUA 3Q0WA 1ZGAA 3PUFA 2E2HJ 3VDXA 3D1NI 1TC3C 2V6EA 4UHTA 3TDZC 3IWFA 5J4VA 3MQ0A 3G6EI 4PCQA 3L9FA 3J80K 1XGMA 2XUBA 1WGXA 3JRCA 2CUZA 4BE2A 3MKWB 3Q5FA 2KP6A 1BW5A 2V1UA 4HX8A 3PSFA 1XN7A 2NYXA 1BI1A 4EJVA 3BG9A 1R7JA 4PFPA 2EFQA 1VQKI 1J59A 3ZMUA 3IAM2 1Y1VJ 2ZJ2A 4IX7A 5DYMA 2K02A 4OAZA 1NTCA 2JJ7A 3M8FA 4NC6A 5KK1A 5LLQA 2X6WA 5J3LA 1IXSB 3DTKA 1FTTA 4P96A 4PJMA 3CZ6A 3BJ6A 1TWCJ 2Z3YA 1NHAA 5FLXK 4M6VA 3DP7A 3IC7A 3T5XA 1BI2A 3JRBA 2RV8A 3PM1A 4OINF 3FX3A 1XCBA 4FASD 2BZTA 3I64A 3CMEI 4RM3A 4G12A 4ETSA 3S2WA 5L3BA 1Y8RB 4CGZA 1GLNA 1Z7UA 2W25A 3K4BA 1ETWA 4I09A 4DBRA 3JRDA 2LMDA 5FKOA 1JJ8C 1TLHB 2WY8Q 4BQQA 3TQNA 2HNHA 2VXZA 2KRFA 4IOAF 1PVEA 1ITYA 3RQ4A 3DEUA 2ZMEA 4DYCA 3P9IA 2K9SA 3CUQA 3I3LA 3OIQA 2H6CA 4E70A 1O3SA 3DFGA 2FBIA 5E1XA 3OS0A 1P7IA 3HUGB 4PZJA 1SEUA 2R93J 3K4MA 1H89C 1T6SA 4ZC3A 4L0YB 3KYCB 3JCUC 1XSVA 4A3LJ 2F5FA 3W3CA 1OQYA 1T38A 2KMUA 6PAXA 2A05A 1IDZA 1SFXA 3MAJA 1MMGA 2HVQA 2QWWA 3IUOA 4HW0A 3R60A 1ON1A 2CUEA 1RIOH 2K3FA 4I02A 3K6GA 2M8GX 3K4JA 1UCRA 3DKYA 1X2MA 2LH9A 1UELB 3HUGA 4RM2A 3FK6A 3CCJI 3TEDA 1JJ6C 2HVSA 2DCEA 2JVGA 1YO5C 4UY8I 5GTIC 2VOOA 1ONVA 3VSLA 4P55A 1Z7LA 1K83J 4HDUA 4EM1A 1GVJA 1T0FA 2X6OA 2K3PA 2GZWA 2KISA 4MFDA 2ESHA 3LWFA 4MTDA 1ORKA 2R7OA 2DK8A 2ZSIB 4L9VA 3LSRA 5BMZA 3S17J 1I3QJ 1W36C 2HTJA 1S9HA 1XMKA 1G3YA 2CFXA 2DN0A 1ERDA 1ZGWA 2XF7A 2XAQA 4ENJA 2EIJH 1WJCA 1IXRC 2DAOA 3S1RJ 4JK1X 1CF7B 4M9XA 2X0LA 4Z6YA 4V2GA 1NG6A 2E5ZA 5HS7A 1VNDA 5F1JA 5K5OA 2C6YA 2FJ1A 1LNWA 2E1MC 2XF5A 1VQ6I 1YRNB 1RKTA 1XB4A 4XLFA 5EZGA 4GYIA 4M9ZA 1ZGJA 5F08A 4D0PA 4M74A 3CUOA 3M9AA 2VOPA 4QTRA 1MH4A 1HDPA 2K27A 2Y48A 5FKLA 3BROA 2R7UA 2OD5A 4C3JJ 2IP2A 4I0AA 4RAGA 4L5JA 3QP5A 4XM3A 1U9OA 3V8LA 2E34A 3BP8A 1ACIA 5GPAA 1VQNI 4A3CJ 4E7LA 3J7AY 1DU6A 5FRNA 3I56I 4PSWA 1W1WE 1X4PA 4QLCU 4L9NA 2HXOA 4B47A 3H3UA 2XASA 3AG2H 3FK7A 5TRDA 2FQ3A 3J81Z 5JVGF 1VQ9I 3CCSI 1V3FA 2K4JA 4BQAA 4OMYA 5DUKA 4CYCB 1KU7A 1EF4A 4KN7X 4DYRA 3REOA 4IRIA 3GZ6A 2ID3A 4PJLA 2EIKH 5E18F 2STWA 4Q5SF 2XDVA 5D6FA 4G94A 2VPLA 4R8HA 1J0RA 4JOMA 3I58A 4KMUX 2JUCA 4C3HJ 2EA4A 1RI7A 2MG4A 2IXSA 1X58A 5GADJ 5B66C 5IOYA 5K5QA 3U1KA 4S04A 3ZQHA 2VC0A 1A5JA 2K9MA 2LREA 3NEUA 4Y3OA 5DCFA 5IPAA 2N8GA 3FMQA 3KEOA 4D1QA 2X9DA 2XHKA 4JX6A 1SAUA 2DJIA 3ESWB 1YTYA 1GUUA 4FHTA 3W6KB 3OWTA 4XLHA 1MJAA 2DFFA 4BEHB 3LSGA 1HKQA 4FX0A 3O8HA 4QWQA 5JVTA 5J4YA 2AS5F 5HODA 4LOCA 5L3DA 3WG9A 1U8RA 4M3DA 4F93B 3OYGA 1IN6A 1X3ZB 4A6EA 1WPKA 2HZTA 3K0LA 4AVPA 3ZQGA 1XTAA 5DUIA 1JKRC 1WJDA 2L0KA 1OFCX 2HGCA 3MVPA 3OS1A 3VYUB 2E5NA 4HBLA 2BBYA 1A04A 3ZR8X 2P5VA 1IRXA 1MMSA 3HB9A 5FKKA 2IS4A 4NUBA 2PI0A 5F0HA 2V1DA 3KLNA 3S1QJ 1XX5A 4BAYA 4ESJA 4J19A 1SMTA 1LVAA 2KDOA 4MQ9F 4A3GJ 3BT9A 1M1EB 1GV2A 3ZQ7A 4B44A 1A31A 5KAFC 2ISYA 3GVAA 1N25A 4LB6B 3KYDB 3M1EA 2DI3A 3TP0A 1F4KA 3RPUA 3KX2A 3GO5A 4IOCF 5M3FJ 3HOUJ 2PMZA 2PJRB 1YE9A 1B9NA 4ZYGA 2PMHA 4LMYA 3OY9A 1QZYA 2PEXA 5EGOA 4WXHA 4LD5A 1R6RA 1YX3A 2KDZA 3HDDA 2AQFA 3CLQA 2NVUB 1V54H 2WWYA 2CV2A 1T56A 1TWFJ 3VODA 4GCVA 4ABZA 5FLMJ 1ZG5A 1XMXA 3LMMA 5E8GA 2E1MB 3P5JA 1O7LA 3I59B 2YS9A 2L3DA 3HSRA 1SAXA 2KRCA 3C2HA 2O6GE 1DGRM 1U9NA 2LY1A 4Y15A 5H6RA 3CO7C 5FRMA 2KLOA 3ABTA 2BV6A 1EH6A 2ECCA 5FO5A 3KZZA 1BC7C 2IA1A 2CFOA 3RPUD 3BG6A 2W84A 4E7KA 1K78B 2VPRA 4D5FA 1OISA 1IN8A 3QOEA 3BTCA 3TOBA 2ZXHA 2A6HF 3FF5A 4IJAA 4CZCA 5FGMA 4M3EA 3N97A 4R79A 2EZKA 1MNDA 4Q47A 3ABUA 2DTZA 3MKZA 3CQZJ 5E3LA 1H9TA 4HRIA 1RESA 1FC3A 3MFKA 4MIMA 3L2RA 1W7PD 3CF2A 4LG0B 1UHWA 2JZYA 1XPXA 2QQAA 4XRSA 3MZ8A 4RS8A 3BZCA 1S6LA 1BOBA 2HEOA 1ZK8A 3C1DA 3DEEA 3GWZA 5FFZA 3TDUC 4U88A 1ULYA 2ZKZA 5D5XB 5J8CA 5J1UA 2P81A 3OIPA 2HQNA 2E1OA 2MA3A 1E2XA 3HHGA 4WX9A 5ED4A 2DBBA 2FU4A 4I01A 2WY7Q 2UXXA 2EILH 2JUGA 1ZRFA 1S7OA 3ASOH 2EK5A 2Q8KA 4LG0A 1IRFA 2XGCA 1OKRA 3JW4A 4LLGF 1J2XA 2MD0A 3R0JA 4CSWA 2ADUA 1YIOA 3M7GA 4WWCA 3PIPF 1B8IA 5GAHJ 3J7ZI 2OUMA 1YI2I 2DW4A 1O4XA 4UUSB 3WTVC 3HGGA 4W97A 2CSOA 4Y52J 4KICA 1D5YA 3FXLA 2ZXJA 3KLOA 4J00A 1AA7A 1C0WA 2WA0A 2HOEA 2VB6A 1TTYA 2DA4A 1XCVA 2JSCA 2X51A 3FXUA 3ZMVA 4EJOA 4ZH4F 4UB6C 2LKPA 2M1BA 1YOVB 2LDUA 2DOEA 1LKXA 4IQ4A 1ETOA 1MH3A 4ZDPA 3SZTA 3RKWA 2DQLA 3BTIA 3EDPA 3QU3A 3UNGC 1FYKA 1LE8A 2HDDA 2MH2A 2OZ6A 1U2WA 3SDGA 1XGOA 2VXDA 3SQNA 2R5YB 3KIOA 5H6QA 2OBPA 4ESBA 3HTUA 1B59A 4JQFA 5EDNA 3PSIA 3DKXA 2ZFUA 4QSHA 1NG7A 3L00A 3QU6A 2XVCA 5CVVA 1HLVA 1TT0A 4XRSG 5DS9A 5EEHA 3TL4X 1IZ1A 3EUHA 2QQ8A 3BR3A 3S14J 3W2AA 3SZPA 3GTPJ 4N4OB 2Y0SA 1MJ9A 2R7SA 5J8FA 3M1CA 4AIHA 3TOAA 4PFOA 4QPOA 2Z1DA 5D6EA 2R5YA 2DA5A 4PGGA 4IQJA 4WXDA 3BWGA 1TW3A 4GDFA 2X85A 3PQJA 1EH8A 4D9JA 2MBFA 2FOWA 3GMEA 2Z33A 1OCZH 2JPCA 2P7CB 3CMMA 5DEQA 1X1PA 2XGXA 1R58A 4OOIA 3O2PE 4FE7A 4FT8A 2ZB9A 3PNVA 5DDGA 3JTHA 3DBLB 1D1BA 3GZ5A 4UUTA 4C3IJ 2Q0OA 5GP9A 2NNYA 2D2WA 2NOGA 3CCQI 3QYFA 4PJNA 5BOXA 1RRJA 2DOAA 3DLAA 5HS8A 5A2QK 2IRFG 3DEWA 1UZCA 4JYKA 2EZLA 3KFWX 5CQGA 2KJCA 2H27A 2F5VA 2EV6A 2VODA 3SZGA 3R61A 2KL4A 4L5IA 2NS0A 3FM3A 2AQEA 2M4GA 1X1DA 2O5RA 1JXSA 2IW5A 3BTJA 1KQ8A 3RYRA 1KONA 1X19A 1BA5A 1FIAA 1QU3A 2ACJA 3FHNA 4AD9A 2JTVA 1FEXA 4YEJA 4E7SA 2JMWA 1R00A 3GXOA 2YX7A 1OYWA 3L2UA 1Z67A 1IAWA 2E19A 1FSEA 4BXFA 1QPIA 2ZMEC 3GW2A 3P9KA 4IRHA 2WADA 2HKXA 3CUQC 1DU0A 1XSDA 3SHFA 2BEOA 1OYYA 2GLOA 1I1SA 2O8XA 4RGUA 4B3XA 5DTDA 3E97A 3DBRB 3Q3SA 5F04A 1KGSA 5E17F 3ZN1A 1LFUP 1W0TA 3I9V2 3LQRA 1AHDP 3ONQA 2O8KA 2KFDA 2VJIA 3O8GA 1DP3A 4ON0A 3OYLA 4X1EA 2AO9A 3OYJA 2LVSA 3IKVA 3H92A 4R1HA 4A0XA 3ZPLA 2MH9A 4CCNA 1FX7A 2UV1A 2CG4A 3O6BB 2O03A 1OCOH 3BCAA 1BJZA 2LG4A 1F43A 4HX4A 5DD8A 5JLWA 4HEA2 1B4AA 1V4RA 3G1MA 2KIUA 5AONA 3FZVA 1PP7U 3F8NA 5DCMA 4HV5A 1NK3P 1WZ2A 1V5EA 2OQGA 5HOOA 5JFRA 1R9TJ 1MBHA 3QP6A 4Z2YA 3SYTA 4HA8A 2QQBA 2R7QA 4UV8A 2IGKA 2NS7A 3HKZN 1BL0A 4G7OF 5D8LB 1T0FC 1R1TA 4NHJA 4B4CA 3LFUA 4BBSJ 3CMAI 3ZQLA 1ZLJA 1I1GA 2K9LA 2VN2A 1E3OC 4FE4A 3FMSA 3ZXSA 1EJ9A 2K9QA 3ZMZA 1B72A 3W6VA 1FMWA 3PIOF 1YX5A 4A0YA 2QGUA 5HVQC 1NH3A 4XOTA 1PJRA 2HQAA 3OYCA 1QNTA 1REPC 2A6TA 5C44J 1HF0A 4FQGA 5IP6A 1IN5A 3UR3C 3S2DJ 2KIFA 5B1BH 3GTKJ 4PJJA 3C2BA 2B9SA 2V26A 2VASA 2DOFA 3Q0UA 1R5HA 4NC7A 3ZRGA 1P6RA 2NVQJ 1OR7A 3BZKA 3H5AA 4IXAA 2FEZA 1AKHA 2LKSA 3QOPA 1VF9A 2PX9A 2Y0MA 1ZRCA 2JPBA 3GCMA 5LHHA 5E20A 3H1CA 2K85A 4IO9F 5D4RA 4LJZF 2WAQN 3VYRB 4A12A 2RVCA 3E5QA 4KUMA 5IP7J 3RKQA 3ECHA 2D5VA 4EM2A 1GV5A 2K86A 4P9UA 2HZDA 1TP4A 3D0SA 3OR1C 2FMYA 2PJPA 3B02A 1TWHJ 3V8KA 2FRHA 2H1KA 2TRTA 1ZHFA 4UVBA 4DJAA 2QBYA 2JRTA 3OSFA 1TT5B 2O7OA 3GEZA 1QHHD 4IPAA 5AIQA 3ABLH 2L5QA 1JUMA 1ZR4A 1TWGJ 4RBOA 1QA6A 3CD6I 1SD4A 3VB2A 2H09A 4XK4A 4JP0A 2ZSHB 1LEAA 2GM4A 5LEJA 2NXNB 2ZMEB 1G8XA 2HYJA 3LSIA 3CUQB 3DCFA 4CCOA 3HGYA 3BC8A 2FNPA 5LGNA 4XKCA 5GAGJ 3U1DA 3CJQB 5K7HA 3SFIA 3KP4A 2DMPA 4ZTFA 3CF5F 4BJ6C 3TO7A 5FROA 1W5TA 1BW6A 5HNHA 3MN2A 2X1EA 4G6DA 2DA3A 3S93A 3VSKA 2LK2A 5BQTA 4P9FA 4ENNA 3M4OJ 2HOSA 3RKXA 4FCYA 3WU2C 1MMNA 1D8JA 3F23A 4DYQA 3H5NA 1KU2A 1TWAJ 4EJWA 3CCLI 3BPXA 3BR2A 2W48A 4AYBA 4XMYA 3MZYA 2R7DA 1LDJA 4CA0A 2ZFWA 2VBZA 4II3A 1VQOI 4RAYA 2Z5UA 1PUEE 4KIGA 2YUSA 1LQ1A 3G3ZA 4UVAA 2R7ZJ 1KA8A 3ERMA 3I54A 3K1NA 3SEZA 4AIJA 3ASNH 3A01A 1AU7A 4L0ZB 2CV0A 3HC7A 2W1OA 3BTLA 4IZZA 3DTEA 1ZARA 5D5VB 5M5WJ 2I10A 2OA4A 2R5ZA 2WB1N 1L0OC 4YIIA 1WCMJ 3A03A 1IV8A 5C4XJ 1STZA 2F4IA 2IEKA 2M2EA 1BR1A 4RMNA 1Y8QB 4BE1A 2ETHA 3GTGJ 1D0ZA 1FBUA 2VBXA 2I8DA 3SJMA 1P4XA 2IGOA 2IGMA 1I50J 4LIVA 1WSUA 3J81K 2LR8A 2JA2A 2RAEA 3HPGA 1VQLI 4AVZA 3K70D 1EA3A 5FLVA 1O7FA 2P0WA 5JLXA 1MDMA 2PMUA 3AG3H 5IYCJ 1PUFA 1E3HA 1ZREA 1IJWC 2K9NA 2LP0A 2VIXA 4LITA 1IV6A 3LA3A 2MLGA 3OYMA 1JT0A 1IRGA 2EFNA 2HS5A 3Q9VA 3DF8A 1FP2A 2HI3A 1MJBA 1HDDC 2V79A 4LLLA 3JAMZ 4GYGA 1O57A 3B6CA 3IH2A 5FD6A 2R7XA 4U0VA 1N78A 3MZHA 2EINH 5D4SA 1ZN2A 5EG0A 1FBQA 2QCOA 3WGGA 4BJ5C 1QQIA 2KIQA 2DDBA 2RGVA 1Y56A 2CYYA 5L3GA 4CHUA 2QSFX 2KRHA 3W2WA 4OIRF 3IHUA 3BQYA 5K7ZA 3BOQA 5F64A 3HYIA 3V7CA 4A3EJ 1PYVA 4RLFA 2IBDA 3PJRA 3ML6A 3QYEA 4X6AJ 4M3BA 4Q4ZF 4OWRB 4IVNA 1TQPA 3QPHA 1D8KA 1UB9A 5BS6A 2BY1A 1G6NA 4E7JA 3CCEI 2DA6A 4HQEA 1VTNC 2F4OB 3F21A 2DT7B 1Z77A 4M6XA 3NAUA 1B1BA 4U0WA 2VUMJ 4MO7A 1R5GA 1IN4A 1Z21A 1Y1WJ 2F5DA 3HJEA 3H0DA 2A69F 4D7MA 1ODDA 2HQRA 4CZZA 2EFOA 3LQQA 2VKEA 1S8NA 4KA4A 5EF6A 4IF4A 2LLKA 1KYZA 1FSHA 2BHZA 2RKHA 1RKWA 3SEQA 1JGGA 2L9SA 1SFEA 4O6JA 3WU1B 4IEJA 3DLLF 1ZQ3P 1FJLA 4A0ZA 5TISC 3TO6A 2OU2A 1HKTA 2W24A 4G8XA 3CMYA 1P4WA 3HRTA 1D0XA 1FYMA 2EV5A 3BY6A 2W4SA 1F36A 1UMQA 1RZ4A 4F7ZA 3S15J 1WQ2A 2G7HA 2XF6A 3K10A 2L9VA 4BNCA 1T08B 1ZELA 4HNUA 1HQCA 2AXLA 2XPUA 2OCCH 3MD2A 4XN3A 4P1WA 4A5MA 1HW1A 5LFAA 4ANJA 3IP4B 4LK1F 4EVIA 3F8FA 3OYEA 1E17A 3KP3A 2FOKA 2PQ8A 3HOZJ 2G7UA 3U2RA 3HSFA 4ZYEA 1SD7A 1R5ID 2JRMA 4NQWB 2H1LA 4XLPF 1FMVA 3RYPA 4A5NA 2JK3A 3RZOJ 3B6AA 3EUHC 5B3SH 2V9KA 4EATA 5GAEJ 1GHCA 3H9QA 3IV5A 1KYWA 4I0BA 3LSPA 1TNSA 5E3NA 5HS9A 4RB0A 3FXOA 5HDGA 2EZHA 2B7EA 2VQGA 3ISPA 2KIMA 4CCLA 1XG1A 1FBSA 5EGOB 3DPTA 5E79C 1G3SA 3DPUA 4DBQA 5DD4A 2LC2A 2EBIA 2W85A 2HDCA 1VQ4I 2XAUA 2FNAA 1R1VA 4XSXF 2HXIA 2LD5A 5K1YA 4M72A 2OC6A 4NQWA 4LFUA 3WE2A 4CO8A 5L3EA 2MC4A 1E3PA 3GUDA 5LHIA 2H94A 2LY2A 3FISA 1YS7A 2ZNZA 3NARA 3S16J 3CESA 5CYVA 1XS9A 4PSXA 1YYVA 3ZQQA 1EH7A 4YRVA 2M5WA 3GTLJ 2R7VA 4BYYA 4BDYA 1W7PA 5LRRA 4BJTA 5C4JJ 2UZKA 1LDKB 1R36A 3GLLA 5EEGA 4ZDLA 4IHSA 4C2UA 5LHGA 2MD5A 4OIPF 3K4KA 4ITVA 4L5EA 2VQLA 4S0HB 2D1VA 4KIFA 3EETA 2V6CA 1TL8A 3PUBA 1R1UA 4I6ZA 4BH9A 1K6OA 3HRMA 1MZBA 3GZNB 3LSMA 4QPQA 1RR7A 2DJNA 4P5OA 3EYYA 2K40A 1X3WB 2P6SA 1HSTA 3GLXA 2H8RA 4OMZA 1S29A 4HSRA 2DMTA 1SFOJ 2PMZN 2Q1ZB 2DO7A 4IRGA 3I0TA 1XDSA 3ZMSA 3GFIA 2KT0A 1MGTA 2CQXA 5L3CA 2HPIA 2GWRA 1KU9A 4I2OA 3HXLA 4I7HA 2TDXA 4KYWA 4KITB 1B8IB 1XGSA 4HQMA 2QQ9A 1H0MA 3X2QH 2V9PA 1QBJA 2NVXJ 1G4DA 5TJJA 1VQ5I 3FMRA 3I71A 3QQAA 3GFMA 4RAZA 5D8KB 3E5UA 1VI0A 3H9GA 3MKYB 4L18B 4A3KJ 3JSOA 2CRGA 2M30A 1FZPB 3DPLC 2ZO4A
chains in the Genus database with same CATH topology
3IL2A 1HSJA 1Z05A 2R7FA 3WODF 2A68F 1Y0UA 1D3YA 1YG2A 3VEPA 1AWCA 4OIQF 2MC3A 1QZZA 2VE9A 5IT9Z 4KFCA 5CLSA 4RB2C 4WK8F 2YR2A 3OOPA 1U5TA 1PP8F 2DPDA 1RUNA 3COAC 2EJRA 3KP5A 4UNOA 1WRJA 2IVMA 3FM5A 3F3XA 1S7AA 4UXNA 2L4MA 3F8BA 1XD7A 1FYLA 1QO0D 2PBIA 4DNCA 3ZP5A 2FE3A 2LF8A 3K69A 2HYFA 2FSWA 2Z99A 2OZUA 2P5KA 5JHUA 3HRUA 2NRAC 3F8CA 2IJLA 5CJ9A 3DXJF 4UV9A 1EV7A 2YPRA 1BN5A 4CDGA 1B6AA 3C18A 3FXQA 4GGGA 1LJ9A 3RDIA 1ZAOA 5JR3A 5BPIA 1U3EM 2HTSA 1MKMA 4HDVA 3LAPA 2E1CA 3L2CA 4HOBA 2XV4S 1TQIA 2EFPA 5D5WB 2FA5A 1U6GA 1J7KA 2F5CA 5H20A 4NB5A 4KT5C 1S3JA 3TO9A 3WTUC 1XSXA 3PQKA 1RUOA 5ICGA 2Q2EA 3P7NA 2EB7A 5DCMB 2UXNA 5CVUA 2ISZA 4G9YA 3ECOA 2ESNA 4BHCA 4A6DA 5HLIA 1SD6A 1JE8A 2A07F 3K2ZA 3LA7A 4KN4X 4UUVA 3CJNA 1G3WA 3R6SA 4MQVA 2DPUA 1FOKA 3T0YA 2DK5A 4LLNA 1Z91A 5J6XA 1JGSA 2LF7A 2VE8A 1P92A 5LEKA 3WTWC 1F1ZA 3DV8A 1O3TA 2DQRA 3CLOA 1HKSA 5ICCA 4AWXB 4PDKA 3LA2A 2WC2A 2UWMA 2GA2A 5LRSA 4S05A 2ELHA 2OAZA 3VOEA 4YFNF 1WKMA 1BI0A 4MHGA 3HOSA 4YIFA 1GXQA 4H0EA 2QBYB 2EV0A 4XSZF 2XKOA 2EWNA 1FP1D 4L9TA 5L3FA 4HLXA 3ROUA 1I6XA 3BJAA 1TQMA 2COMA 1T2KA 4U0YA 2RQPA 2E7WA 3KZYA 3ZN0A 4O3MA 5F6FA 2OQRA 2YX4A 1ZRDA 3WTZA 1U78A 2W57A 1O3RA 1KQ9A 2QLZA 3VFZA 2KKOA 4I98B 1FWZA 1JHFA 1H9GA 3U9GA 2XRNA 2DU9A 2YSRA 5FFXA 5HLHA 1YQAA 3C3WA 2E7XA 1HW5A 3M8EA 2BGCA 1FT9A 1R23A 1DPRA 3JAMK 2PN6A 1L3LA 2FBKA 4G7ZF 4U7BA 2QM3A 3RKYA 4U7DA 3V4GA 2K4BA 5E1WA 3B73A 2Y75A 4EQQA 3QAHA 5HDKA 1HXDA 3RPQA 1Q1HA 2XIGA 3C7JA 3FXRA 1J9IA 1KU3A 2HFHA 2NNNA 3K1PA 1TNTA 3BZ6A 1BC8C 3ZMDA 1MDMB 4UVCA 4LK0F 2QYOA 4WXCA 2RC4A 5K5RA 3J80Z 4YFKF 2EA2A 3FWEA 4RGSA 4N9IA 3MWMA 4ENKA 1BBYA 4LGWA 3E6MA 4G7HF 1UFMA 3IRRA 3CTAA 3G73A 3BPVA 5FLXZ 4KNYA 4GO1A 2FXAA 2D45A 4ENMA 3LFKA 3WU0A 5CVJA 3N4MA 3IKTA 5CVRA 1FLIA 1RNLA 5ILVA 4OIOF 1K7AA 5BPDA 1BI3A 2ZCWA 4OU0A 3E5XA 3K9TA 1IXCA 1OMIA 4BXUA 2RNJA 5AIPA 3PFIA 3JTGA 2XROA 2IT0A 1KQ0A 3F6OA 1JHHA 3HRSA 4GXOA 2JT1A 2IPQX 2O3FA 4MGRA 2QENA 1J75A 3F6VA 3BJOA 4MTEA 2IA0A 4EGYA 2STTA 2J5OA 5F1RA 2F2EA 5ICEA 5FB2A 1CF7A 1AOYA 1ON2A 2QVOA 2WV0A 1BIBA 1IF1A 1USTA 4FX4A 2GXBA 1BOAA 3TGNA 1T98A 5D5UB 2V1XA 3V8JA 2PLYA 2X4HA 2L54A 3ZMTA 1XGNA 4CXFA 1U5TC 2A61A 5KVRA 3V7RA 3FHZA 4M73A 1DUXC 2WTEA 5LBQA 5LGTA 3L09A 3F72A 3KP2A 2CO5A 4O5VA 2K7LA 3MCZA 1YW8A 5E1ZB 3F22A 3P9CA 2HKOA 4WF2A 3HOTA 4YFXF 1R22A 5DV5A 4L9JA 4RGXA 3K1MA 4Y17A 1DP7P 3SXYA 4A2UA 3J7AO 4N9HA 1W7PB 1YW7A 1ZH5A 4Y13A 3KCCA 3L7WA 2L4AA 2VC1A 3NRVA 3RI4A 4EV0A 4CYDA 3WE3A 1OYIA 5LGUA 4PGHA 3LAJA 2QZ8A 2GIVA 3DQVC 4HV6A 4B8XA 1P4AA 4RGRA 2RDPA 3RTRA 2FBHA 3R0AA 4BHPA 1QPMA 4XLNF 1CGPA 1IN7A 4HF0A 1MD0A 5IT9K 2GXGA 4TV7A 3KE2A 3MEXA 1Z1DA 3IRQA 4HX7A 4ZZDA 3DKWA 1YLFA 2L01A 4K2EA 5ERIA 4N0BA 2E1NA 3E6CC 3W6JB 2VT2A 3LSTA 4KMFA 3I4PA 4M6YA 1WI9A 2CWEA 1WWXA 1FNNA 2A5YB 1X3UA 1F9NA 4EM0B 5HLGA 2VT3A 2DFIA 3ULQB 2XAFA 1IW7F 3KETA 4AIKA 1IUYA 3I59A 1K79A 2KJBA 4LB5A 1DDNA 1TBXA 3O3KA 2CGPA 2VONA 3EYIA 1U5TB 5ICFA 1XMAA 1K78A 1HW2A 2ZBKA 2V9VA 3I5UA 3R4KA 2R3SA 1DPUA 1USSA 3QPTA 1W4MA 5IT3A 1D5VA 3GF2A 3E3VA 3WGHA 4KIBA 3Q9SA 3HTSB 2P8TA 5CVIA 3OV8A 1T39A 3D5LA 2DT5A 4YG2F 1YFHA 4MEYF 1P2FA 2YU3A 3WTYC 3GFJA 1BM9A 1Z9CA 1W5SA 3RJPA 4G6QA 1SFUA 3T8TA 2BE5F 1Z6TA 2PFBA 1I27A 3HHHA 1SD5A 4XBFA 1BJAA 2O61A 5ILSA 1ZG3A 3GYHX 2NAZA 4EGZA 1O3QA 3KEQA 3I53A 1I5ZA 3IWZA 3EQLF 2B0LA 3QRFF 4B09A 1FPQA 2GA1A 5FD5A 4M9SA 2G9WA 2F5EA 4ZYDA 4M71A 1J5YA 2PG4A 3NQOA 2HR3A 4RB1A 4XRFA 2P6TA 1HBXG 2GAUA 4HZFA 3BDDA 4Q48A 4DQ2A 4BHBA 4HF1A 2VBYA 2O0YA 4ZZLA 4WCGA 4EMSA 3CO6C 3SFZA 2XAJA 2DTRA 2XAHA 4RB3C 2P5LC 1F5TA 4HAMA 4MNUA 1ZG1A 2L02A 2LNBA 2M87A 1YW9A 3JSPA 2MLKA 2ZNYA 2M8EA 3KP6A 3V7SA 2H6BA 2GQQA 3E6BA 3TKYA 3F8MA 3WTSC 3KP7A 1Z6RA 3H3ZA 1ZLKA 2FMLA 2HYGD 3WTTC 2BYVE 2DLLA 5E8IA 3HSEA 1LB2A 4HF2A 4CICA 5ILUA 4JBAA 3E6DA 1G3TA 2LSOA 3ERED 3AAFA 3T1BA 2RN7A 2XKPA 1LDDA 3GFLA 3WGIA 3WTXC 5HDNA 4EJUA 2J5PA 2A3SA 5A2QZ 4ESFA 2IA2A 2EFWA 2P4WA 1SMYF 2CW0F 1QGPA 4IHTA 3ELKA 1GXPA 1TW2A 1LEBA 4HLYA 2FF4A 4KDPA 3GX4X 3RIRA 1ZYRF 2Z9OA 1B9MA 2CQKA 1PDNC 2HWVA 2QUFA 3CDHA 2XAGA 5JI6A 1YS6A 2P7VB 4MEXF 1UHMA 2VBWA 1BIAA 4EJTA 3T8RA 2D1HA 4HYEA 2A6EF 4ZYHA 2M45A 3HIFA 1FY7A 4ASNA 1OPCA 1XDUA 1ZGAA 4UHTA 3TDZC 3IWFA 3MQ0A 4PCQA 3L9FA 3J80K 1XGMA 2XUBA 3Q5FA 2V1UA 4HX8A 1XN7A 2NYXA 1BI1A 4EJVA 1R7JA 2EFQA 1J59A 3ZMUA 2ZJ2A 5DYMA 2K02A 3M8FA 5KK1A 5LLQA 1IXSB 4P96A 3BJ6A 2Z3YA 1NHAA 5FLXK 3DP7A 3IC7A 3T5XA 1BI2A 2RV8A 4OINF 3FX3A 1XCBA 3I64A 4ETSA 5L3BA 3S2WA 4CGZA 1Z7UA 2W25A 4I09A 1TLHB 3TQNA 2VXZA 2KRFA 3DEUA 2ZMEA 3P9IA 3CUQA 2H6CA 4E70A 1O3SA 3DFGA 2FBIA 5E1XA 4PZJA 1T6SA 4L0YB 1XSVA 2F5FA 1T38A 6PAXA 1SFXA 3MAJA 2QWWA 4HW0A 3R60A 1ON1A 1RIOH 4I02A 1UCRA 3HUGA 1YO5C 2VOOA 1ONVA 4P55A 4HDUA 4EM1A 1GVJA 1T0FA 2GZWA 2ESHA 3LWFA 4MTDA 2DK8A 4L9VA 5BMZA 2HTJA 1XMKA 1G3YA 2CFXA 4ENJA 2XAQA 1IXRC 2DAOA 1CF7B 4JK1X 4M9XA 2X0LA 5HS7A 2C6YA 5K5OA 1LNWA 1XB4A 4GYIA 4M9ZA 1ZGJA 4D0PA 4M74A 3CUOA 3M9AA 2VOPA 2K27A 2Y48A 3BROA 2OD5A 2IP2A 4I0AA 4L5JA 3QP5A 3V8LA 3BP8A 4QLCU 4L9NA 3H3UA 2XASA 5TRDA 2FQ3A 3J81Z 1V3FA 2K4JA 4BQAA 4OMYA 5DUKA 1KU7A 4KN7X 3REOA 4IRIA 3GZ6A 5E18F 2STWA 4Q5SF 5D6FA 4G94A 4R8HA 1J0RA 3I58A 4KMUX 2EA4A 1RI7A 5K5QA 4S04A 2VC0A 3NEUA 5DCFA 3FMQA 3KEOA 2XHKA 1YTYA 4FHTA 3W6KB 1MJAA 5JVTA 1HKQA 4FX0A 4QWQA 2AS5F 5L3DA 3WG9A 1U8RA 1IN6A 4A6EA 2HZTA 3K0LA 4AVPA 5DUIA 2HGCA 4HBLA 2BBYA 1A04A 2P5VA 2PI0A 2V1DA 3KLNA 4BAYA 4ESJA 1SMTA 1LVAA 4MQ9F 3ZQ7A 2ISYA 3GVAA 4LB6B 3M1EA 1F4KA 2DI3A 3RPUA 3GO5A 1B9NA 4ZYGA 2PMHA 4LMYA 1QZYA 2PEXA 4WXHA 4LD5A 2WWYA 3VODA 4GCVA 1ZG5A 5E8GA 1O7LA 3I59B 2L3DA 3HSRA 1SAXA 2O6GE 4Y15A 5H6RA 3CO7C 3ABTA 2BV6A 1EH6A 5FO5A 3KZZA 1BC7C 2IA1A 2W84A 1K78B 1IN8A 3TOBA 3FF5A 2A6HF 4IJAA 5FGMA 3N97A 4R79A 4Q47A 3ABUA 1H9TA 1FC3A 3MFKA 1W7PD 4LG0B 1UHWA 2JZYA 2QQAA 4RS8A 1S6LA 2HEOA 3C1DA 3GWZA 5FFZA 3TDUC 4U88A 1ULYA 2ZKZA 5D5XB 5J8CA 2HQNA 2MA3A 3HHGA 1E2XA 4WX9A 5ED4A 2DBBA 2FU4A 4I01A 2UXXA 1ZRFA 1S7OA 2EK5A 2Q8KA 4LG0A 1IRFA 3JW4A 1OKRA 4LLGF 1J2XA 3R0JA 2ADUA 1YIOA 3M7GA 4WWCA 2DW4A 3WTVC 2CSOA 4KICA 3KLOA 2ZXJA 1C0WA 2HOEA 4EJOA 1TTYA 1XCVA 2JSCA 3ZMVA 3FXUA 4ZH4F 2LKPA 2M1BA 2LDUA 3SZTA 3RKWA 2DQLA 3EDPA 3QU3A 1FYKA 2MH2A 2OZ6A 1U2WA 1XGOA 3SQNA 5H6QA 4ESBA 2OBPA 3HTUA 1B59A 4JQFA 3L00A 3QU6A 2XVCA 5CVVA 5EEHA 1IZ1A 3EUHA 3SZPA 1MJ9A 5J8FA 4AIHA 3TOAA 5D6EA 4PGGA 4WXDA 3BWGA 1TW3A 3PQJA 1EH8A 2MBFA 2Z33A 2JPCA 2P7CB 5DEQA 2XGXA 1R58A 4OOIA 3O2PE 4FT8A 5DDGA 3JTHA 3GZ5A 2Q0OA 2NNYA 2D2WA 5BOXA 5HS8A 5A2QK 2IRFG 3KFWX 2KJCA 2H27A 2EV6A 2VODA 3R61A 4L5IA 2NS0A 3FM3A 1JXSA 2IW5A 1KQ8A 3RYRA 2ACJA 4AD9A 2JTVA 1R00A 3GXOA 2YX7A 1OYWA 1IAWA 1FSEA 3GW2A 3P9KA 4IRHA 2HKXA 3CUQC 1XSDA 3SHFA 2BEOA 1OYYA 1I1SA 2O8XA 4RGUA 3E97A 1KGSA 5E17F 3ZN1A 3LQRA 4ON0A 3IKVA 3H92A 4R1HA 4A0XA 3ZPLA 2MH9A 1FX7A 3O6BB 2CG4A 2O03A 4HX4A 5DD8A 1B4AA 1V4RA 2KIUA 5AONA 3FZVA 1PP7U 3F8NA 5DCMA 4HV5A 2OQGA 5HOOA 5JFRA 3QP6A 4Z2YA 4HA8A 2QQBA 4UV8A 4G7OF 5D8LB 1R1TA 4NHJA 1ZLJA 1I1GA 2VN2A 3FMSA 3ZMZA 4A0YA 5HVQC 1REPC 1QNTA 1IN5A 2KIFA 1R5HA 1P6RA 1OR7A 4IXAA 2FEZA 3QOPA 2Y0MA 1ZRCA 2JPBA 5LHHA 5E20A 5D4RA 4LJZF 4A12A 2RVCA 3E5QA 4KUMA 3ECHA 4EM2A 2K86A 4P9UA 3D0SA 2FMYA 2PJPA 3B02A 3V8KA 2FRHA 1ZHFA 4UVBA 2QBYA 2JRTA 3GEZA 4IPAA 5AIQA 1SD4A 3VB2A 2H09A 1LEAA 5LEJA 2ZMEB 3CUQB 2FNPA 5LGNA 3U1DA 3KP4A 3TO7A 1W5TA 4G6DA 5BQTA 4P9FA 4ENNA 3RKXA 1D8JA 3F23A 1KU2A 4EJWA 3BPXA 3MZYA 2R7DA 1LDJA 2ZFWA 2VBZA 4RAYA 2Z5UA 1PUEE 4KIGA 1LQ1A 3G3ZA 4UVAA 1KA8A 3I54A 3K1NA 4AIJA 4L0ZB 1ZARA 5D5VB 2OA4A 1L0OC 4YIIA 1STZA 2ETHA 1FBUA 2VBXA 1P4XA 1WSUA 3J81K 1O7FA 1MDMA 2PMUA 1ZREA 3LA3A 2MLGA 1IRGA 2EFNA 2HS5A 3Q9VA 3DF8A 1FP2A 1MJBA 2V79A 4LLLA 3JAMZ 4GYGA 1O57A 5FD6A 4U0VA 3MZHA 5D4SA 1ZN2A 1FBQA 3WGGA 1QQIA 2RGVA 5L3GA 2CYYA 4CHUA 4OIRF 3IHUA 3BOQA 5F64A 3HYIA 3V7CA 3ML6A 4Q4ZF 4IVNA 1TQPA 3QPHA 1D8KA 1UB9A 5BS6A 1G6NA 4HQEA 1VTNC 3F21A 4M6XA 1B1BA 4U0WA 1R5GA 1IN4A 2F5DA 2A69F 1ODDA 2HQRA 4CZZA 2EFOA 3LQQA 1S8NA 4KA4A 4IF4A 1KYZA 1FSHA 2RKHA 1SFEA 4O6JA 3WU1B 4A0ZA 3TO6A 2OU2A 1HKTA 2W24A 4G8XA 1P4WA 3HRTA 1FYMA 2EV5A 3BY6A 1RZ4A 4F7ZA 1WQ2A 2G7HA 4BNCA 1HQCA 2AXLA 4A5MA 1HW1A 4LK1F 4EVIA 3F8FA 1E17A 3KP3A 2FOKA 2PQ8A 2G7UA 3U2RA 3HSFA 4ZYEA 1SD7A 4XLPF 3RYPA 4A5NA 1GHCA 1KYWA 4I0BA 1TNSA 5HS9A 4RB0A 5HDGA 3ISPA 2KIMA 1FBSA 3DPTA 1G3SA 5DD4A 2W85A 2HDCA 2FNAA 1R1VA 4XSXF 5K1YA 4M72A 4NQWA 4LFUA 3WE2A 4CO8A 5L3EA 3GUDA 5LHIA 2H94A 1YS7A 2ZNZA 5CYVA 1YYVA 1EH7A 2M5WA 4BYYA 1W7PA 5LRRA 2UZKA 1LDKB 1R36A 5EEGA 4IHSA 5LHGA 2MD5A 4OIPF 2D1VA 4KIFA 3EETA 2V6CA 1R1UA 4BH9A 1K6OA 3HRMA 1MZBA 4P5OA 3EYYA 2P6SA 1HSTA 3GLXA 4OMZA 1S29A 2DO7A 4IRGA 3I0TA 1XDSA 3ZMSA 3GFIA 1MGTA 5L3CA 2GWRA 1KU9A 4I2OA 4I7HA 2TDXA 4KYWA 1XGSA 4HQMA 2QQ9A 1H0MA 1QBJA 1G4DA 5TJJA 3FMRA 3I71A 5D8KB 3GFMA 4RAZA 3E5UA 4L18B 3JSOA 2M30A 1FZPB 3DPLC 2ZO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IL2 A;  1HSJ A;  1Z05 A;  2R7F A;  3WOD F;  2A68 F;  1Y0U A;  1D3Y A;  1YG2 A;  3VEP A;  1AWC A;  4OIQ F;  2MC3 A;  1QZZ A;  2VE9 A;  5IT9 Z;  4KFC A;  5CLS A;  4RB2 C;  4WK8 F;  2YR2 A;  3OOP A;  1U5T A;  1PP8 F;  2DPD A;  1RUN A;  3COA C;  2EJR A;  3KP5 A;  4UNO A;  1WRJ A;  2IVM A;  3FM5 A;  3F3X A;  1S7A A;  4UXN A;  2L4M A;  3F8B A;  1XD7 A;  1FYL A;  1QO0 D;  2PBI A;  4DNC A;  3ZP5 A;  2FE3 A;  2LF8 A;  3K69 A;  2HYF A;  2FSW A;  2Z99 A;  2OZU A;  2P5K A;  5JHU A;  3HRU A;  2NRA C;  3F8C A;  2IJL A;  5CJ9 A;  3DXJ F;  4UV9 A;  1EV7 A;  2YPR A;  1BN5 A;  4CDG A;  1B6A A;  3C18 A;  3FXQ A;  4GGG A;  1LJ9 A;  3RDI A;  1ZAO A;  5JR3 A;  5BPI A;  1U3E M;  2HTS A;  1MKM A;  4HDV A;  3LAP A;  2E1C A;  3L2C A;  4HOB A;  2XV4 S;  1TQI A;  2EFP A;  5D5W B;  2FA5 A;  1U6G A;  1J7K A;  2F5C A;  5H20 A;  4NB5 A;  4KT5 C;  1S3J A;  3TO9 A;  3WTU C;  1XSX A;  3PQK A;  1RUO A;  5ICG A;  2Q2E A;  3P7N A;  2EB7 A;  5DCM B;  2UXN A;  5CVU A;  2ISZ A;  4G9Y A;  3ECO A;  2ESN A;  4BHC A;  4A6D A;  5HLI A;  1SD6 A;  1JE8 A;  2A07 F;  3K2Z A;  3LA7 A;  4KN4 X;  4UUV A;  3CJN A;  1G3W A;  3R6S A;  4MQV A;  2DPU A;  1FOK A;  3T0Y A;  2DK5 A;  4LLN A;  1Z91 A;  5J6X A;  1JGS A;  2LF7 A;  2VE8 A;  1P92 A;  5LEK A;  3WTW C;  1F1Z A;  3DV8 A;  1O3T A;  2DQR A;  3CLO A;  1HKS A;  5ICC A;  4AWX B;  4PDK A;  3LA2 A;  2WC2 A;  2UWM A;  2GA2 A;  5LRS A;  4S05 A;  2ELH A;  2OAZ A;  3VOE A;  4YFN F;  1WKM A;  1BI0 A;  4MHG A;  3HOS A;  4YIF A;  1GXQ A;  4H0E A;  2QBY B;  2EV0 A;  4XSZ F;  2XKO A;  2EWN A;  1FP1 D;  4L9T A;  5L3F A;  4HLX A;  3ROU A;  1I6X A;  3BJA A;  1TQM A;  2COM A;  1T2K A;  4U0Y A;  2RQP A;  2E7W A;  3KZY A;  3ZN0 A;  4O3M A;  5F6F A;  2OQR A;  2YX4 A;  1ZRD A;  3WTZ A;  1U78 A;  2W57 A;  1O3R A;  1KQ9 A;  2QLZ A;  3VFZ A;  2KKO A;  4I98 B;  1FWZ A;  1JHF A;  1H9G A;  3U9G A;  2XRN A;  2DU9 A;  2YSR A;  5FFX A;  5HLH A;  1YQA A;  3C3W A;  2E7X A;  1HW5 A;  3M8E A;  2BGC A;  1FT9 A;  1R23 A;  1DPR A;  3JAM K;  2PN6 A;  1L3L A;  2FBK A;  4G7Z F;  4U7B A;  2QM3 A;  3RKY A;  4U7D A;  3V4G A;  2K4B A;  5E1W A;  3B73 A;  2Y75 A;  4EQQ A;  3QAH A;  5HDK A;  1HXD A;  3RPQ A;  1Q1H A;  2XIG A;  3C7J A;  3FXR A;  1J9I A;  1KU3 A;  2HFH A;  2NNN A;  3K1P A;  1TNT A;  3BZ6 A;  1BC8 C;  3ZMD A;  1MDM B;  4UVC A;  4LK0 F;  2QYO A;  4WXC A;  2RC4 A;  5K5R A;  3J80 Z;  4YFK F;  2EA2 A;  3FWE A;  4RGS A;  4N9I A;  3MWM A;  4ENK A;  1BBY A;  4LGW A;  3E6M A;  4G7H F;  1UFM A;  3IRR A;  3CTA A;  3G73 A;  3BPV A;  5FLX Z;  4KNY A;  4GO1 A;  2FXA A;  2D45 A;  4ENM A;  3LFK A;  3WU0 A;  5CVJ A;  3N4M A;  3IKT A;  5CVR A;  1FLI A;  1RNL A;  5ILV A;  4OIO F;  1K7A A;  5BPD A;  1BI3 A;  2ZCW A;  4OU0 A;  3E5X A;  3K9T A;  1IXC A;  1OMI A;  4BXU A;  2RNJ A;  5AIP A;  3PFI A;  3JTG A;  2XRO A;  2IT0 A;  1KQ0 A;  3F6O A;  1JHH A;  3HRS A;  4GXO A;  2JT1 A;  2IPQ X;  2O3F A;  4MGR A;  2QEN A;  1J75 A;  3F6V A;  3BJO A;  4MTE A;  2IA0 A;  4EGY A;  2STT A;  2J5O A;  5F1R A;  2F2E A;  5ICE A;  5FB2 A;  1CF7 A;  1AOY A;  1ON2 A;  2QVO A;  2WV0 A;  1BIB A;  1IF1 A;  1UST A;  4FX4 A;  2GXB A;  1BOA A;  3TGN A;  1T98 A;  5D5U B;  2V1X A;  3V8J A;  2PLY A;  2X4H A;  2L54 A;  3ZMT A;  1XGN A;  4CXF A;  1U5T C;  2A61 A;  5KVR A;  3V7R A;  3FHZ A;  4M73 A;  1DUX C;  2WTE A;  5LBQ A;  5LGT A;  3L09 A;  3F72 A;  3KP2 A;  2CO5 A;  4O5V A;  2K7L A;  3MCZ A;  1YW8 A;  5E1Z B;  3F22 A;  3P9C A;  2HKO A;  4WF2 A;  3HOT A;  4YFX F;  1R22 A;  5DV5 A;  4L9J A;  4RGX A;  3K1M A;  4Y17 A;  1DP7 P;  3SXY A;  4A2U A;  3J7A O;  4N9H A;  1W7P B;  1YW7 A;  1ZH5 A;  4Y13 A;  3KCC A;  3L7W A;  2L4A A;  2VC1 A;  3NRV A;  3RI4 A;  4EV0 A;  4CYD A;  3WE3 A;  1OYI A;  5LGU A;  4PGH A;  3LAJ A;  2QZ8 A;  2GIV A;  3DQV C;  4HV6 A;  4B8X A;  1P4A A;  4RGR A;  2RDP A;  3RTR A;  2FBH A;  3R0A A;  4BHP A;  1QPM A;  4XLN F;  1CGP A;  1IN7 A;  4HF0 A;  1MD0 A;  5IT9 K;  2GXG A;  4TV7 A;  3KE2 A;  3MEX A;  1Z1D A;  3IRQ A;  4HX7 A;  4ZZD A;  3DKW A;  1YLF A;  2L01 A;  4K2E A;  5ERI A;  4N0B A;  2E1N A;  3E6C C;  3W6J B;  2VT2 A;  3LST A;  4KMF A;  3I4P A;  4M6Y A;  1WI9 A;  2CWE A;  1WWX A;  1FNN A;  2A5Y B;  1X3U A;  1F9N A;  4EM0 B;  5HLG A;  2VT3 A;  2DFI A;  3ULQ B;  2XAF A;  1IW7 F;  3KET A;  4AIK A;  1IUY A;  3I59 A;  1K79 A;  2KJB A;  4LB5 A;  1DDN A;  1TBX A;  3O3K A;  2CGP A;  2VON A;  3EYI A;  1U5T B;  5ICF A;  1XMA A;  1K78 A;  1HW2 A;  2ZBK A;  2V9V A;  3I5U A;  3R4K A;  2R3S A;  1DPU A;  1USS A;  3QPT A;  1W4M A;  5IT3 A;  1D5V A;  3GF2 A;  3E3V A;  3WGH A;  4KIB A;  3Q9S A;  3HTS B;  2P8T A;  5CVI A;  3OV8 A;  1T39 A;  3D5L A;  2DT5 A;  4YG2 F;  1YFH A;  4MEY F;  1P2F A;  2YU3 A;  3WTY C;  3GFJ A;  1BM9 A;  1Z9C A;  1W5S A;  3RJP A;  4G6Q A;  1SFU A;  3T8T A;  2BE5 F;  1Z6T A;  2PFB A;  1I27 A;  3HHH A;  1SD5 A;  4XBF A;  1BJA A;  2O61 A;  5ILS A;  1ZG3 A;  3GYH X;  2NAZ A;  4EGZ A;  1O3Q A;  3KEQ A;  3I53 A;  1I5Z A;  3IWZ A;  3EQL F;  2B0L A;  3QRF F;  4B09 A;  1FPQ A;  2GA1 A;  5FD5 A;  4M9S A;  2G9W A;  2F5E A;  4ZYD A;  4M71 A;  1J5Y A;  2PG4 A;  3NQO A;  2HR3 A;  4RB1 A;  4XRF A;  2P6T A;  1HBX G;  2GAU A;  4HZF A;  3BDD A;  4Q48 A;  4DQ2 A;  4BHB A;  4HF1 A;  2VBY A;  2O0Y A;  4ZZL A;  4WCG A;  4EMS A;  3CO6 C;  3SFZ A;  2XAJ A;  2DTR A;  2XAH A;  4RB3 C;  2P5L C;  1F5T A;  4HAM A;  4MNU A;  1ZG1 A;  2L02 A;  2LNB A;  2M87 A;  1YW9 A;  3JSP A;  2MLK A;  2ZNY A;  2M8E A;  3KP6 A;  3V7S A;  2H6B A;  2GQQ A;  3E6B A;  3TKY A;  3F8M A;  3WTS C;  3KP7 A;  1Z6R A;  3H3Z A;  1ZLK A;  2FML A;  2HYG D;  3WTT C;  2BYV E;  2DLL A;  5E8I A;  3HSE A;  1LB2 A;  4HF2 A;  4CIC A;  5ILU A;  4JBA A;  3E6D A;  1G3T A;  2LSO A;  3ERE D;  3AAF A;  3T1B A;  2RN7 A;  2XKP A;  1LDD A;  3GFL A;  3WGI A;  3WTX C;  5HDN A;  4EJU A;  2J5P A;  2A3S A;  5A2Q Z;  4ESF A;  2IA2 A;  2EFW A;  2P4W A;  1SMY F;  2CW0 F;  1QGP A;  4IHT A;  3ELK A;  1GXP A;  1TW2 A;  1LEB A;  4HLY A;  2FF4 A;  4KDP A;  3GX4 X;  3RIR A;  1ZYR F;  2Z9O A;  1B9M A;  2CQK A;  1PDN C;  2HWV A;  2QUF A;  3CDH A;  2XAG A;  5JI6 A;  1YS6 A;  2P7V B;  4MEX F;  1UHM A;  2VBW A;  1BIA A;  4EJT A;  3T8R A;  2D1H A;  4HYE A;  2A6E F;  4ZYH A;  2M45 A;  3HIF A;  1FY7 A;  4ASN A;  1OPC A;  1XDU A;  1ZGA A;  4UHT A;  3TDZ C;  3IWF A;  3MQ0 A;  4PCQ A;  3L9F A;  3J80 K;  1XGM A;  2XUB A;  3Q5F A;  2V1U A;  4HX8 A;  1XN7 A;  2NYX A;  1BI1 A;  4EJV A;  1R7J A;  2EFQ A;  1J59 A;  3ZMU A;  2ZJ2 A;  5DYM A;  2K02 A;  3M8F A;  5KK1 A;  5LLQ A;  1IXS B;  4P96 A;  3BJ6 A;  2Z3Y A;  1NHA A;  5FLX K;  3DP7 A;  3IC7 A;  3T5X A;  1BI2 A;  2RV8 A;  4OIN F;  3FX3 A;  1XCB A;  3I64 A;  4ETS A;  5L3B A;  3S2W A;  4CGZ A;  1Z7U A;  2W25 A;  4I09 A;  1TLH B;  3TQN A;  2VXZ A;  2KRF A;  3DEU A;  2ZME A;  3P9I A;  3CUQ A;  2H6C A;  4E70 A;  1O3S A;  3DFG A;  2FBI A;  5E1X A;  4PZJ A;  1T6S A;  4L0Y B;  1XSV A;  2F5F A;  1T38 A;  6PAX A;  1SFX A;  3MAJ A;  2QWW A;  4HW0 A;  3R60 A;  1ON1 A;  1RIO H;  4I02 A;  1UCR A;  3HUG A;  1YO5 C;  2VOO A;  1ONV A;  4P55 A;  4HDU A;  4EM1 A;  1GVJ A;  1T0F A;  2GZW A;  2ESH A;  3LWF A;  4MTD A;  2DK8 A;  4L9V A;  5BMZ A;  2HTJ A;  1XMK A;  1G3Y A;  2CFX A;  4ENJ A;  2XAQ A;  1IXR C;  2DAO A;  1CF7 B;  4JK1 X;  4M9X A;  2X0L A;  5HS7 A;  2C6Y A;  5K5O A;  1LNW A;  1XB4 A;  4GYI A;  4M9Z A;  1ZGJ A;  4D0P A;  4M74 A;  3CUO A;  3M9A A;  2VOP A;  2K27 A;  2Y48 A;  3BRO A;  2OD5 A;  2IP2 A;  4I0A A;  4L5J A;  3QP5 A;  3V8L A;  3BP8 A;  4QLC U;  4L9N A;  3H3U A;  2XAS A;  5TRD A;  2FQ3 A;  3J81 Z;  1V3F A;  2K4J A;  4BQA A;  4OMY A;  5DUK A;  1KU7 A;  4KN7 X;  3REO A;  4IRI A;  3GZ6 A;  5E18 F;  2STW A;  4Q5S F;  5D6F A;  4G94 A;  4R8H A;  1J0R A;  3I58 A;  4KMU X;  2EA4 A;  1RI7 A;  5K5Q A;  4S04 A;  2VC0 A;  3NEU A;  5DCF A;  3FMQ A;  3KEO A;  2XHK A;  1YTY A;  4FHT A;  3W6K B;  1MJA A;  5JVT A;  1HKQ A;  4FX0 A;  4QWQ A;  2AS5 F;  5L3D A;  3WG9 A;  1U8R A;  1IN6 A;  4A6E A;  2HZT A;  3K0L A;  4AVP A;  5DUI A;  2HGC A;  4HBL A;  2BBY A;  1A04 A;  2P5V A;  2PI0 A;  2V1D A;  3KLN A;  4BAY A;  4ESJ A;  1SMT A;  1LVA A;  4MQ9 F;  3ZQ7 A;  2ISY A;  3GVA A;  4LB6 B;  3M1E A;  1F4K A;  2DI3 A;  3RPU A;  3GO5 A;  1B9N A;  4ZYG A;  2PMH A;  4LMY A;  1QZY A;  2PEX A;  4WXH A;  4LD5 A;  2WWY A;  3VOD A;  4GCV A;  1ZG5 A;  5E8G A;  1O7L A;  3I59 B;  2L3D A;  3HSR A;  1SAX A;  2O6G E;  4Y15 A;  5H6R A;  3CO7 C;  3ABT A;  2BV6 A;  1EH6 A;  5FO5 A;  3KZZ A;  1BC7 C;  2IA1 A;  2W84 A;  1K78 B;  1IN8 A;  3TOB A;  3FF5 A;  2A6H F;  4IJA A;  5FGM A;  3N97 A;  4R79 A;  4Q47 A;  3ABU A;  1H9T A;  1FC3 A;  3MFK A;  1W7P D;  4LG0 B;  1UHW A;  2JZY A;  2QQA A;  4RS8 A;  1S6L A;  2HEO A;  3C1D A;  3GWZ A;  5FFZ A;  3TDU C;  4U88 A;  1ULY A;  2ZKZ A;  5D5X B;  5J8C A;  2HQN A;  2MA3 A;  3HHG A;  1E2X A;  4WX9 A;  5ED4 A;  2DBB A;  2FU4 A;  4I01 A;  2UXX A;  1ZRF A;  1S7O A;  2EK5 A;  2Q8K A;  4LG0 A;  1IRF A;  3JW4 A;  1OKR A;  4LLG F;  1J2X A;  3R0J A;  2ADU A;  1YIO A;  3M7G A;  4WWC A;  2DW4 A;  3WTV C;  2CSO A;  4KIC A;  3KLO A;  2ZXJ A;  1C0W A;  2HOE A;  4EJO A;  1TTY A;  1XCV A;  2JSC A;  3ZMV A;  3FXU A;  4ZH4 F;  2LKP A;  2M1B A;  2LDU A;  3SZT A;  3RKW A;  2DQL A;  3EDP A;  3QU3 A;  1FYK A;  2MH2 A;  2OZ6 A;  1U2W A;  1XGO A;  3SQN A;  5H6Q A;  4ESB A;  2OBP A;  3HTU A;  1B59 A;  4JQF A;  3L00 A;  3QU6 A;  2XVC A;  5CVV A;  5EEH A;  1IZ1 A;  3EUH A;  3SZP A;  1MJ9 A;  5J8F A;  4AIH A;  3TOA A;  5D6E A;  4PGG A;  4WXD A;  3BWG A;  1TW3 A;  3PQJ A;  1EH8 A;  2MBF A;  2Z33 A;  2JPC A;  2P7C B;  5DEQ A;  2XGX A;  1R58 A;  4OOI A;  3O2P E;  4FT8 A;  5DDG A;  3JTH A;  3GZ5 A;  2Q0O A;  2NNY A;  2D2W A;  5BOX A;  5HS8 A;  5A2Q K;  2IRF G;  3KFW X;  2KJC A;  2H27 A;  2EV6 A;  2VOD A;  3R61 A;  4L5I A;  2NS0 A;  3FM3 A;  1JXS A;  2IW5 A;  1KQ8 A;  3RYR A;  2ACJ A;  4AD9 A;  2JTV A;  1R00 A;  3GXO A;  2YX7 A;  1OYW A;  1IAW A;  1FSE A;  3GW2 A;  3P9K A;  4IRH A;  2HKX A;  3CUQ C;  1XSD A;  3SHF A;  2BEO A;  1OYY A;  1I1S A;  2O8X A;  4RGU A;  3E97 A;  1KGS A;  5E17 F;  3ZN1 A;  3LQR A;  4ON0 A;  3IKV A;  3H92 A;  4R1H A;  4A0X A;  3ZPL A;  2MH9 A;  1FX7 A;  3O6B B;  2CG4 A;  2O03 A;  4HX4 A;  5DD8 A;  1B4A A;  1V4R A;  2KIU A;  5AON A;  3FZV A;  1PP7 U;  3F8N A;  5DCM A;  4HV5 A;  2OQG A;  5HOO A;  5JFR A;  3QP6 A;  4Z2Y A;  4HA8 A;  2QQB A;  4UV8 A;  4G7O F;  5D8L B;  1R1T A;  4NHJ A;  1ZLJ A;  1I1G A;  2VN2 A;  3FMS A;  3ZMZ A;  4A0Y A;  5HVQ C;  1REP C;  1QNT A;  1IN5 A;  2KIF A;  1R5H A;  1P6R A;  1OR7 A;  4IXA A;  2FEZ A;  3QOP A;  2Y0M A;  1ZRC A;  2JPB A;  5LHH A;  5E20 A;  5D4R A;  4LJZ F;  4A12 A;  2RVC A;  3E5Q A;  4KUM A;  3ECH A;  4EM2 A;  2K86 A;  4P9U A;  3D0S A;  2FMY A;  2PJP A;  3B02 A;  3V8K A;  2FRH A;  1ZHF A;  4UVB A;  2QBY A;  2JRT A;  3GEZ A;  4IPA A;  5AIQ A;  1SD4 A;  3VB2 A;  2H09 A;  1LEA A;  5LEJ A;  2ZME B;  3CUQ B;  2FNP A;  5LGN A;  3U1D A;  3KP4 A;  3TO7 A;  1W5T A;  4G6D A;  5BQT A;  4P9F A;  4ENN A;  3RKX A;  1D8J A;  3F23 A;  1KU2 A;  4EJW A;  3BPX A;  3MZY A;  2R7D A;  1LDJ A;  2ZFW A;  2VBZ A;  4RAY A;  2Z5U A;  1PUE E;  4KIG A;  1LQ1 A;  3G3Z A;  4UVA A;  1KA8 A;  3I54 A;  3K1N A;  4AIJ A;  4L0Z B;  1ZAR A;  5D5V B;  2OA4 A;  1L0O C;  4YII A;  1STZ A;  2ETH A;  1FBU A;  2VBX A;  1P4X A;  1WSU A;  3J81 K;  1O7F A;  1MDM A;  2PMU A;  1ZRE A;  3LA3 A;  2MLG A;  1IRG A;  2EFN A;  2HS5 A;  3Q9V A;  3DF8 A;  1FP2 A;  1MJB A;  2V79 A;  4LLL A;  3JAM Z;  4GYG A;  1O57 A;  5FD6 A;  4U0V A;  3MZH A;  5D4S A;  1ZN2 A;  1FBQ A;  3WGG A;  1QQI A;  2RGV A;  5L3G A;  2CYY A;  4CHU A;  4OIR F;  3IHU A;  3BOQ A;  5F64 A;  3HYI A;  3V7C A;  3ML6 A;  4Q4Z F;  4IVN A;  1TQP A;  3QPH A;  1D8K A;  1UB9 A;  5BS6 A;  1G6N A;  4HQE A;  1VTN C;  3F21 A;  4M6X A;  1B1B A;  4U0W A;  1R5G A;  1IN4 A;  2F5D A;  2A69 F;  1ODD A;  2HQR A;  4CZZ A;  2EFO A;  3LQQ A;  1S8N A;  4KA4 A;  4IF4 A;  1KYZ A;  1FSH A;  2RKH A;  1SFE A;  4O6J A;  3WU1 B;  4A0Z A;  3TO6 A;  2OU2 A;  1HKT A;  2W24 A;  4G8X A;  1P4W A;  3HRT A;  1FYM A;  2EV5 A;  3BY6 A;  1RZ4 A;  4F7Z A;  1WQ2 A;  2G7H A;  4BNC A;  1HQC A;  2AXL A;  4A5M A;  1HW1 A;  4LK1 F;  4EVI A;  3F8F A;  1E17 A;  3KP3 A;  2FOK A;  2PQ8 A;  2G7U A;  3U2R A;  3HSF A;  4ZYE A;  1SD7 A;  4XLP F;  3RYP A;  4A5N A;  1GHC A;  1KYW A;  4I0B A;  1TNS A;  5HS9 A;  4RB0 A;  5HDG A;  3ISP A;  2KIM A;  1FBS A;  3DPT A;  1G3S A;  5DD4 A;  2W85 A;  2HDC A;  2FNA A;  1R1V A;  4XSX F;  5K1Y A;  4M72 A;  4NQW A;  4LFU A;  3WE2 A;  4CO8 A;  5L3E A;  3GUD A;  5LHI A;  2H94 A;  1YS7 A;  2ZNZ A;  5CYV A;  1YYV A;  1EH7 A;  2M5W A;  4BYY A;  1W7P A;  5LRR A;  2UZK A;  1LDK B;  1R36 A;  5EEG A;  4IHS A;  5LHG A;  2MD5 A;  4OIP F;  2D1V A;  4KIF A;  3EET A;  2V6C A;  1R1U A;  4BH9 A;  1K6O A;  3HRM A;  1MZB A;  4P5O A;  3EYY A;  2P6S A;  1HST A;  3GLX A;  4OMZ A;  1S29 A;  2DO7 A;  4IRG A;  3I0T A;  1XDS A;  3ZMS A;  3GFI A;  1MGT A;  5L3C A;  2GWR A;  1KU9 A;  4I2O A;  4I7H A;  2TDX A;  4KYW A;  1XGS A;  4HQM A;  2QQ9 A;  1H0M A;  1QBJ A;  1G4D A;  5TJJ A;  3FMR A;  3I71 A;  5D8K B;  3GFM A;  4RAZ A;  3E5U A;  4L18 B;  3JSO A;  2M30 A;  1FZP B;  3DPL C;  2ZO4 A; 
#chains in the Genus database with same CATH topology
 3IL2 A;  1NK2 P;  1HSJ A;  4XLA A;  3GTM J;  2LBF A;  1CQT A;  1Z05 A;  2DFH A;  1LE8 B;  2R7F A;  4KIS A;  1RPW A;  3WOD F;  1IG7 A;  5J1Y A;  1K6Y A;  2A68 F;  1Y0U A;  1D3Y A;  1YG2 A;  4KJZ A;  4M3F A;  3VEP A;  1AWC A;  4OIQ F;  2MC3 A;  1QZZ A;  1UHS A;  2VE9 A;  2DT6 A;  1X1C A;  2NVY J;  2LY9 A;  5IT9 Z;  4BUP A;  3G4S I;  1UG2 A;  4KFC A;  4FIS A;  1JUS A;  5CLS A;  4RB2 C;  3CCM I;  4WK8 F;  2YR2 A;  2M0M A;  3A0H C;  3OOP A;  1U5T A;  1PP8 F;  2DPD A;  1RUN A;  4HG2 A;  3LSK A;  3COA C;  2EJR A;  3KP5 A;  3LSH A;  4NDL A;  4UNO A;  1UJ8 A;  4BS9 A;  3AG1 H;  3DU5 A;  4BU2 A;  1WRJ A;  2IVM A;  1OR7 C;  1V5F A;  3FM5 A;  3F3X A;  1WHU A;  5BNG A;  1S7A A;  2ZJR F;  4UXN A;  2L4M A;  3F8B A;  1LFP A;  2ZC2 A;  1XD7 A;  1FYL A;  1QO0 D;  2PBI A;  4DNC A;  3ZP5 A;  1BR4 A;  2FE3 A;  2OCE A;  2LF8 A;  3K69 A;  2HYF A;  2LKX A;  2V7F A;  2FSW A;  2GBY A;  2ME6 A;  2HOA A;  2FQ4 A;  2Z99 A;  4B48 A;  2OZU A;  2P5K A;  3CP8 A;  3E1S A;  4XON A;  5JHU A;  3HRU A;  4HST A;  4XQF A;  2NRA C;  3F8C A;  2IJL A;  4UV9 A;  2DYR H;  3DXJ F;  5CJ9 A;  1EV7 A;  2YPR A;  1BN5 A;  2LOO A;  4MFE A;  1JI8 A;  4CDG A;  1B6A A;  2DDA A;  4JX5 A;  3C18 A;  2E71 A;  3FXQ A;  4GGG A;  1LJ9 A;  3RDI A;  4BY7 J;  1ZAO A;  5JR3 A;  1YJW I;  3JRE A;  5BPI A;  3UKG A;  1U3E M;  2HTS A;  3MMY B;  1LUJ B;  2Y9Z A;  5HNF A;  1MKM A;  2JA6 J;  3TBI A;  4HDV A;  4BAC A;  4ZDO A;  2Y2Z A;  3EPZ A;  3LAP A;  2E1C A;  5FKM A;  3L2C A;  4HOB A;  5F0C A;  2XV4 S;  1TQI A;  4DZP A;  2EFP A;  5D5W B;  2FA5 A;  2Y0S N;  3K7A J;  1U6G A;  1J7K A;  2F5C A;  2X1C A;  5H20 A;  4NB5 A;  4KT5 C;  1S3J A;  1R4M B;  3TO9 A;  2R0Q C;  5LD2 C;  3WG7 H;  3TW7 A;  3WTU C;  1R71 A;  1XSX A;  3OYK A;  1VZ0 A;  3PQK A;  4XR6 A;  1RUO A;  3FDY A;  4CH7 A;  1WJA A;  5ICG A;  2Q2E A;  3S3M A;  1MIJ A;  3P7N A;  1YJN I;  2EB7 A;  5DCM B;  2JWT A;  2UXN A;  3JRH A;  2IAI A;  2IGN A;  3PNT A;  3S1N J;  3CCV I;  5CVU A;  2ISZ A;  4G9Y A;  3ECO A;  2FX0 A;  2TCT A;  2ESN A;  4BHC A;  1H88 C;  4A6D A;  5HLI A;  1SD6 A;  1HOM A;  1JE8 A;  2A07 F;  1G2H A;  3K2Z A;  3LA7 A;  1MSF C;  4KN4 X;  2MSY A;  4RAF A;  4UUV A;  4BE0 A;  3M3Y J;  1TZL A;  3CJN A;  4U87 A;  1G3W A;  4LG3 A;  4CCJ A;  2LFB A;  3R6S A;  1B72 B;  1SAN A;  4MQV A;  2DPU A;  1LFB A;  1UG0 A;  2OPT A;  1MBE A;  2ICW G;  3ZCO A;  1FOK A;  3T0Y A;  3OYD A;  2DK5 A;  2QKL B;  3H0G J;  4LLN A;  2VQH A;  1Z91 A;  2R7W A;  5J6X A;  1JGS A;  1I6H J;  2LF7 A;  5E3O A;  3G1L A;  2VE8 A;  2L7F P;  1P92 A;  5LEK A;  3WTW C;  5KAI C;  2CJJ A;  1G59 A;  1F1Z A;  1SVL A;  2QEX I;  3DV8 A;  1O3T A;  2DQR A;  1AKH B;  3CLO A;  1IUF A;  1HKS A;  5ICC A;  4RLQ A;  4AWX B;  4PDK A;  2K5C A;  3LA2 A;  1WH7 A;  3HOX J;  2RNG A;  2WC2 A;  2MGQ A;  1FOY A;  2KHM A;  1BR2 A;  2UWM A;  2GA2 A;  5LRS A;  4S05 A;  1VQ8 I;  2ELH A;  2OAZ A;  3MKL A;  3VOE A;  3BR0 A;  3AFH A;  2E60 A;  3BG3 A;  1ETX A;  4YFN F;  4V19 K;  4MLO A;  1WKM A;  2ELJ A;  5E3M A;  1HC8 A;  1BI0 A;  4HPQ A;  2KPM A;  4MHG A;  3HOS A;  3Q0V A;  1GXQ A;  4YIF A;  4H0E A;  2QBY B;  2EV0 A;  4XSZ F;  4B43 A;  2V4J C;  2XKO A;  5FJ8 J;  1XC5 A;  1U8B A;  3TMO A;  2LYC A;  4BGD A;  3AKZ A;  4IHV A;  4LIU A;  3RQI A;  2EWN A;  3HEF A;  1FP1 D;  3DBH B;  4L9T A;  3G2B A;  3QPL A;  4CCK A;  4A3B J;  5L3F A;  3HOV J;  1GVD A;  4HLX A;  3ROU A;  2Y69 H;  1I6X A;  3BJA A;  1TQM A;  1S72 I;  2COM A;  1QZE A;  5GTH C;  3HOY J;  4HNV A;  1T2K A;  4U0Y A;  3KYL A;  3HBL A;  2RQP A;  9ANT A;  5IP9 J;  3OYN A;  1X2N A;  2E7W A;  3IH3 A;  3KZY A;  3CDL A;  3ZN0 A;  4M3G A;  1ETQ A;  4O3M A;  4D5C A;  3A0B C;  5F6F A;  2OQR A;  2VJ5 A;  3IH4 A;  2YX4 A;  3QPS A;  1ZRD A;  3I4N J;  3WTZ A;  5IOZ A;  4BQO A;  1U78 A;  5KHD A;  3KPH A;  1SVM A;  2W57 A;  4YEL A;  1O3R A;  1QRY A;  3L1P A;  1KQ9 A;  2QLZ A;  3VFZ A;  3VWB A;  2KKO A;  4I98 B;  1FWZ A;  1JHF A;  1H9G A;  3U9G A;  2GIZ A;  2R4G A;  1YHQ I;  2XRN A;  2E35 A;  3RCO A;  2DU9 A;  2L9N A;  2YSR A;  5FFX A;  5HLH A;  3KEY A;  3BCB A;  1YQA A;  3C3W A;  1QHG A;  2CQ7 A;  2E7X A;  3ABM H;  1V5G A;  1HW5 A;  1YIT I;  1Y39 A;  3H5R A;  3M8E A;  2BW3 A;  1W0U A;  3CDI A;  4I99 C;  2XGE A;  2BGC A;  1FT9 A;  1R23 A;  4BDZ A;  2E36 A;  2MYS A;  3A01 B;  1MNE A;  1DPR A;  3JAM K;  2PN6 A;  1L3L A;  2FBK A;  3GTO J;  5IY5 H;  3CJT B;  3S1M J;  1WVR A;  3LSJ A;  4U7B A;  4G7Z F;  2EQR A;  2QM3 A;  3RKY A;  4U7D A;  3V4G A;  2R5Z B;  2K4B A;  5E1W A;  2M9H A;  2WB1 A;  3B73 A;  3H36 A;  2XPW A;  1Z3Y A;  4XLC A;  2Y75 A;  4EQQ A;  2MFZ A;  1FOW A;  1VQP I;  1EKE A;  3QAH A;  5HDK A;  1HXD A;  4W1U A;  3RPQ A;  1Q1H A;  2XIG A;  3GTQ J;  2M7B A;  3C7J A;  3A4C A;  3FXR A;  1J9I A;  1KU3 A;  2HFH A;  4FTH A;  2NNN A;  3K1P A;  1K61 A;  1TNT A;  1JTX A;  1FTZ A;  3BZ6 A;  1BC8 C;  2L9R A;  3ZMD A;  4BY1 J;  5DM6 F;  4IHX A;  4DGW B;  1MDM B;  2DA7 A;  4IL6 C;  1PUF B;  4UVC A;  2Y30 A;  4BBR J;  1FOX A;  4LK0 F;  2QYO A;  4WXC A;  1IC8 A;  2LRD A;  1OCP A;  3CCY A;  2RC4 A;  3D5S C;  5K5R A;  3J80 Z;  4F91 B;  2CS3 A;  1LVK A;  4B3A A;  4A3I J;  3WHC A;  4YFK F;  2EA2 A;  5EG0 B;  3FWE A;  2X48 A;  2M0C A;  4RGS A;  5M3M J;  4N9I A;  2ID6 A;  3MWM A;  4ENK A;  1BBY A;  4LGW A;  2E2J J;  3E6M A;  4G7H F;  1UFM A;  3IRR A;  4AYB N;  3CTA A;  3CC2 I;  3G73 A;  4XLE A;  3BPV A;  5FLX Z;  2LTP A;  3I55 I;  4KNY A;  4GO1 A;  2FXA A;  3F9K A;  2D45 A;  3U21 A;  3TP3 A;  4ENM A;  1YIJ I;  3LFK A;  3WU0 A;  5CVJ A;  4AUX A;  3N4M A;  3IKT A;  5CVR A;  1FLI A;  1RNL A;  5ILV A;  4CUG A;  1SVO A;  4OIO F;  1K7A A;  3VYT B;  2L7Z A;  2VLA A;  5BPD A;  5TGT A;  1VQM I;  1BI3 A;  3SDB A;  5B5E C;  2ZCW A;  4OU0 A;  3E5X A;  2F4M B;  3K9T A;  4Y7N J;  5CPR B;  1IXC A;  2GXA A;  3S32 A;  1OMI A;  2GOM A;  1T8I A;  4BXU A;  2RNJ A;  5AIP A;  4IHW A;  3PFI A;  1ZR2 A;  1WH5 A;  2AXT C;  2XRL A;  3JTG A;  2XRO A;  2IT0 A;  1KQ0 A;  2EPF A;  3JRF A;  3F6O A;  1JHH A;  1MSE C;  3HRS A;  4GXO A;  3JRI A;  2JT1 A;  2IPQ X;  4XKV A;  2O3F A;  1HCR A;  5EZH A;  4MGR A;  3K4C A;  2YU9 J;  2QEN A;  1J75 A;  3F6V A;  4IHY A;  3BJO A;  4MTE A;  2L7M P;  2IA0 A;  2W7N A;  4EGY A;  2XB5 A;  2MAB A;  1MBK A;  1H8A C;  3OSG A;  2STT A;  2J5O A;  4DOZ A;  5F1R A;  4IKF A;  2F2E A;  5ICE A;  1T33 A;  5FB2 A;  1D1C A;  1CF7 A;  1AOY A;  3CJR B;  3LOC A;  4A93 J;  2L7K A;  4Y4R A;  1ON2 A;  1HA8 A;  4FET A;  2QVO A;  4X0G A;  2WV0 A;  4C2T A;  1BIB A;  1IF1 A;  1UST A;  2F48 A;  4BL0 B;  4FX4 A;  2GXB A;  2BXZ A;  2CH0 A;  2Y9Y A;  1BOA A;  3PNY A;  3TGN A;  1YRN A;  1MBG A;  3A2K A;  1T98 A;  4F52 A;  5D5U B;  2V1X A;  1DGW Y;  3V8J A;  2PLY A;  2X4H A;  2L2O A;  1ZKG A;  4F92 B;  2L54 A;  3ZMT A;  4C30 A;  1XGN A;  4CXF A;  5F0F A;  1U5T C;  4PK4 A;  3CC4 I;  2A61 A;  5KVR A;  3V7R A;  3FHZ A;  1WJF A;  2I5U A;  3DWL E;  3V42 A;  2HOT A;  4M73 A;  1DUX C;  3J7Y J;  2NVT J;  2WTE A;  5LBQ A;  5KNL A;  5LGT A;  1SC7 A;  3L09 A;  3F72 A;  3KP2 A;  2DMU A;  5IYD J;  2CO5 A;  4O5V A;  2K7L A;  1LPQ A;  2AHQ A;  1WI3 A;  3MCZ A;  1MBF A;  3ZQI A;  3M8J A;  1YW8 A;  3BG5 A;  3JR9 A;  3KZI C;  5GPC A;  5E1Z B;  2B63 J;  5FKN A;  1S7E A;  3FXK A;  4E7H A;  3F22 A;  1T95 A;  4KT6 A;  4H4K C;  3P9C A;  4CYC A;  1GDT A;  2HKO A;  2EIM H;  2KZG A;  2FUG 2;  4WF2 A;  3HOT A;  1A36 A;  4YFX F;  4A3J J;  1R22 A;  2XC7 A;  2X6X A;  5DV5 A;  2WAF A;  1FIP A;  4L9J A;  4RGX A;  3K1M A;  4Y17 A;  2DOD A;  3JRG A;  1RET A;  1DP7 P;  5KCM A;  3D5R C;  3SXY A;  4A2U A;  4J01 A;  2M7A A;  3J7A O;  3OR2 C;  1GT0 C;  4N9H A;  1W7P B;  2JN6 A;  5H2F C;  1YW7 A;  3S3N A;  1ZH5 A;  2ZJQ F;  3PO3 J;  4Y13 A;  3KCC A;  3L7W A;  2XB0 X;  1ZTR A;  2L4A A;  2VC1 A;  2Z2S B;  2M3A A;  3NRV A;  4RA2 A;  3RI4 A;  3EUK L;  4BXX J;  2BY0 A;  4EV0 A;  1OJL A;  4CYD A;  2CV1 A;  1R4N B;  4AID A;  4BEH A;  3WE3 A;  4DW6 A;  1OYI A;  1WJE A;  2CMP A;  2CW7 A;  3OYI A;  2VJJ A;  1D1A A;  1P7J A;  4PGH A;  5LGU A;  3LAJ A;  2QZ8 A;  2GIV A;  4GRI A;  4XKB A;  3VYS B;  3DQV C;  3LL7 A;  4HV6 A;  3OS2 A;  4EEF G;  4B8X A;  1P4A A;  4RGR A;  2RDP A;  4G6T B;  2FBH A;  3R0A A;  3RTR A;  2JA7 J;  3I4M J;  4RDU A;  4BHP A;  1QPM A;  4E7Z A;  3CCR I;  4XLN F;  1CGP A;  1IN7 A;  4HF0 A;  1MD0 A;  4JX4 A;  5IT9 K;  4XN0 A;  1ENH A;  2GXG A;  4TV7 A;  3KE2 A;  3FBI B;  2COB A;  2BOL A;  3MEX A;  2UUZ A;  2WAE A;  1JKO C;  5EEA A;  3ZOB A;  1Z1D A;  3G1O A;  3K4L A;  2ELK A;  2Z16 A;  3IRQ A;  4HX7 A;  4B1R A;  4ZZD A;  5HLT A;  3DKW A;  1YLF A;  3A1Y A;  2R7R A;  2L01 A;  2M4K A;  1U0J A;  1QVT A;  4K2E A;  4PUS A;  5ERI A;  2HU9 A;  4N0B A;  2OV7 A;  4DZJ A;  3S3O A;  4II2 A;  2E1N A;  3OYH A;  3E6C C;  4PJ0 C;  1MMA A;  3W6J B;  4BKX A;  4XRM A;  2VT2 A;  3OIO A;  2DFE A;  2EZI A;  2VQC A;  3LST A;  4NNJ A;  2LBF B;  4KMF A;  3I4P A;  3OL3 A;  1X1B A;  2PJR A;  4M6Y A;  3AG4 H;  1WI9 A;  5J1R A;  2CWE A;  1WWX A;  1FNN A;  2A5Y B;  1X3U A;  3FBN B;  1K4S A;  1F9N A;  4EM0 B;  5HLG A;  5IYB J;  2VT3 A;  3NWS A;  2CUJ A;  2DFI A;  2BVL A;  3NWT A;  3ULQ B;  2XAF A;  1IW7 F;  2H8W A;  1N75 A;  1Y0N A;  3KET A;  2QA4 I;  4AIK A;  1IUY A;  1MNM C;  3I59 A;  3OMY A;  2FD5 A;  1K79 A;  2HPM A;  4C2M J;  3H35 A;  2KJB A;  2DA1 A;  4A3M J;  4LB5 A;  1QVU A;  1DDN A;  1TBX A;  3O3K A;  4BQN A;  2CGP A;  2VON A;  3EYI A;  3ZQF A;  1U5T B;  5ICF A;  1XMA A;  3HM5 A;  2VL8 A;  2EH3 A;  3BQZ A;  1K78 A;  1HW2 A;  1W36 D;  2ZBK A;  1RC9 A;  2V9V A;  3I5U A;  3L2W A;  3R4K A;  4XOP A;  2R3S A;  2VKV A;  1VFC A;  4NC8 A;  4NBQ A;  3FKI J;  1DPU A;  2ZJP F;  1USS A;  3QPT A;  1W4M A;  5IT3 A;  1D5V A;  1SFK A;  3BLY A;  3GF2 A;  3E3V A;  3WGH A;  1X1A A;  2DMN A;  4KIB A;  3TW6 A;  2QSH X;  3Q9S A;  3AL0 C;  2IS6 A;  5K7F A;  2NS8 A;  2NOJ B;  4XKW A;  3HTS B;  2P8T A;  5CVI A;  3OV8 A;  4CCM A;  3CCU I;  3D5L A;  5JHF A;  2BHY A;  1T39 A;  4AU7 A;  1JKQ C;  1R49 A;  2CU7 A;  3GBG A;  2IS1 A;  2DT5 A;  3W2V A;  2DXI A;  2QF7 A;  4YG2 F;  3CC7 I;  1YFH A;  4MEY F;  1P2F A;  3PFY A;  2YU3 A;  2W82 A;  3WTY C;  3K2A A;  3HG9 A;  3GFJ A;  2JVH A;  1BM9 A;  3BR5 A;  1Z9C A;  1ETY A;  1W5S A;  4QIW N;  3RJP A;  4G6Q A;  4V2F A;  4GFB A;  1SFU A;  3T8T A;  3S8P A;  3RSN A;  2BE5 F;  4XID A;  4E7I A;  1N77 A;  3OL4 A;  1Z6T A;  3PL8 A;  3WHB A;  3ABK H;  2VJ4 A;  4OAY A;  2PFB A;  1I27 A;  2KQR A;  3HHH A;  1SD5 A;  1Z0X A;  3RZD J;  1OCT C;  5CKT A;  2BVM A;  4XBF A;  4XL9 A;  4F3Q A;  1BJA A;  2CUF A;  3L2V A;  2O61 A;  5ILS A;  2OTJ I;  4UUS A;  1ZG3 A;  3BR6 A;  3GYH X;  2JA8 J;  3FXJ A;  2NAZ A;  4EGZ A;  1O3Q A;  1V55 H;  3KEQ A;  3I53 A;  1A35 A;  3DU6 A;  1I5Z A;  3IWZ A;  3EQL F;  5B1A H;  2B0L A;  2XSD C;  4B09 A;  3QRF F;  1FPQ A;  1JTY A;  2OTL I;  2GA1 A;  3K4N A;  5EJC A;  2G0E A;  5FD5 A;  5J47 A;  2VI6 A;  2BY2 A;  4M9S A;  1P9Q C;  1W5C C;  1OCC H;  2G9W A;  2F5E A;  3QYB A;  4ZYD A;  3F0C A;  4M71 A;  1J5Y A;  2PG4 A;  2V1N A;  3NQO A;  2HR3 A;  4RB1 A;  2DA2 A;  4ZYA A;  4XRF A;  3HOW J;  3FXM A;  1ETV A;  1POG A;  2P6T A;  4YIR X;  1OLT A;  5CQE A;  1MMD A;  2Q2E B;  4AC0 A;  1HBX G;  2O9L A;  3ZQC A;  2GAU A;  2JSP A;  4HZF A;  3BDD A;  2BXY A;  4Q48 A;  4BHB A;  4DQ2 A;  4HF1 A;  2VBY A;  2O0Y A;  4ZZL A;  4WCG A;  4EMS A;  3IAS 2;  3CO6 C;  2DYS H;  3N05 A;  3SFZ A;  2XAJ A;  4A69 C;  4HNT A;  2CQQ A;  3GTJ J;  1UAA A;  2DTR A;  3G71 I;  1DQU A;  2XAH A;  4RB3 C;  2P5L C;  1K4T A;  1F5T A;  3VPR A;  4HAM A;  4DIQ A;  3OYF A;  1MW7 A;  2XGD A;  2WV1 A;  4MNU A;  3H3V K;  3PO2 J;  1ZG1 A;  2L02 A;  3L2Q A;  2HQ5 A;  4XNF A;  2LNB A;  2RQQ A;  3HL2 A;  4ZTJ A;  3A02 A;  2M87 A;  1YW9 A;  3K70 C;  3JSP A;  3DTI A;  2MLK A;  2ZNY A;  5EYR A;  1IGN A;  2M8E A;  2XSJ C;  3CP2 A;  3HKZ A;  3KP6 A;  2HVR A;  3V7S A;  2H6B A;  2GQQ A;  2JQ7 A;  3E6B A;  4ZJZ A;  2X6Y A;  3TKY A;  1IDY A;  5M5Y J;  2R7T A;  3F8M A;  3WTS C;  1IO2 A;  3KP7 A;  3OYA A;  2E2I J;  1Z6R A;  3H3Z A;  1ZLK A;  1MBJ A;  2FML A;  3AL0 B;  2XPV A;  2HYG D;  1A6Q A;  3WTT C;  1E0E A;  4F55 A;  1JKP C;  2BYV E;  2BY3 A;  2DLL A;  2MW8 A;  3FKJ A;  5E8I A;  3HSE A;  5C3E J;  5DM7 F;  4N4N B;  1LB2 A;  2QKM B;  4HF2 A;  3S2H J;  4CIC A;  1S5L C;  5ILU A;  4UB8 C;  2ZXW H;  2ZXI A;  1I3A A;  4JBA A;  3E6D A;  1G3T A;  2HDW A;  2F6C A;  5M5X J;  2LSO A;  3BR1 A;  2ME0 A;  3ERE D;  3AAF A;  3T1B A;  2RN7 A;  1JUP A;  2XKP A;  1LDD A;  3E0J B;  3GFL A;  3WGI A;  1Y6I A;  1D0Y A;  3WTX C;  2VKD A;  4A3F J;  5HDN A;  4EJU A;  2WBM A;  4Y33 A;  2R92 J;  3HZJ A;  3EUA A;  2J5P A;  2A3S A;  5A2Q Z;  4ESF A;  1WFX A;  2A5W A;  2IA2 A;  2DMQ A;  3OYB A;  2CW8 A;  3ZGK A;  2JA5 J;  1WJ5 A;  2EFW A;  2IS2 A;  1Z3X A;  2P4W A;  3BG7 A;  1SMY F;  2CW0 F;  4AM3 A;  1X4O A;  1J09 A;  1QGP A;  4IHT A;  2WAQ A;  1Q1V A;  3ELK A;  1GXP A;  1ETK A;  2VKH A;  1A6I A;  1TW2 A;  2OF7 A;  2RRE A;  1LEB A;  4HLY A;  1RR8 C;  2FF4 A;  4KDP A;  3JRA A;  4C9Y A;  5F27 A;  3GX4 X;  3RIR A;  1ZYR F;  2W00 A;  2Z9O A;  4I76 A;  3FIW A;  2CQN A;  2X1D A;  1B9M A;  2M34 A;  2CQK A;  1PDN C;  1OCR H;  2HWV A;  3M07 A;  4E4H A;  1KZH A;  2QUF A;  2GOX B;  3CDH A;  2ECB A;  2XAG A;  1WJB A;  5JI6 A;  2OJE D;  4E6K G;  2Y31 A;  1YS6 A;  1I39 A;  2P7V B;  4XIC A;  3C2G A;  4MEX F;  4D7N A;  1UHM A;  2VBW A;  1BIA A;  4EJT A;  3T8R A;  2D1H A;  3HPH A;  4A3D J;  1IRZ A;  4HYE A;  3QOD A;  3LNQ A;  1JT6 A;  3E7L A;  2KZV A;  5J40 A;  1VQ7 I;  3H9J A;  2A6E F;  3QWL A;  4ZYH A;  2QSG X;  2M45 A;  1APL C;  3HIF A;  1FY7 A;  1YJ9 I;  4XOR A;  4ASN A;  2BW3 B;  1OPC A;  3OOU A;  1XDU A;  3Q0W A;  1ZGA A;  3PUF A;  2E2H J;  3VDX A;  3D1N I;  1TC3 C;  2V6E A;  4UHT A;  3TDZ C;  3IWF A;  5J4V A;  3MQ0 A;  3G6E I;  4PCQ A;  3L9F A;  3J80 K;  1XGM A;  2XUB A;  1WGX A;  3JRC A;  2CUZ A;  4BE2 A;  3MKW B;  3Q5F A;  2KP6 A;  1BW5 A;  2V1U A;  4HX8 A;  3PSF A;  1XN7 A;  2NYX A;  1BI1 A;  4EJV A;  3BG9 A;  1R7J A;  4PFP A;  2EFQ A;  1VQK I;  1J59 A;  3ZMU A;  3IAM 2;  1Y1V J;  2ZJ2 A;  4IX7 A;  5DYM A;  2K02 A;  4OAZ A;  1NTC A;  2JJ7 A;  3M8F A;  4NC6 A;  5KK1 A;  5LLQ A;  2X6W A;  5J3L A;  1IXS B;  3DTK A;  1FTT A;  4P96 A;  4PJM A;  3CZ6 A;  3BJ6 A;  1TWC J;  2Z3Y A;  1NHA A;  5FLX K;  4M6V A;  3DP7 A;  3IC7 A;  3T5X A;  1BI2 A;  3JRB A;  2RV8 A;  3PM1 A;  4OIN F;  3FX3 A;  1XCB A;  4FAS D;  2BZT A;  3I64 A;  3CME I;  4RM3 A;  4G12 A;  4ETS A;  3S2W A;  5L3B A;  1Y8R B;  4CGZ A;  1GLN A;  1Z7U A;  2W25 A;  3K4B A;  1ETW A;  4I09 A;  4DBR A;  3JRD A;  2LMD A;  5FKO A;  1JJ8 C;  1TLH B;  2WY8 Q;  4BQQ A;  3TQN A;  2HNH A;  2VXZ A;  2KRF A;  4IOA F;  1PVE A;  1ITY A;  3RQ4 A;  3DEU A;  2ZME A;  4DYC A;  3P9I A;  2K9S A;  3CUQ A;  3I3L A;  3OIQ A;  2H6C A;  4E70 A;  1O3S A;  3DFG A;  2FBI A;  5E1X A;  3OS0 A;  1P7I A;  3HUG B;  4PZJ A;  1SEU A;  2R93 J;  3K4M A;  1H89 C;  1T6S A;  4ZC3 A;  4L0Y B;  3KYC B;  3JCU C;  1XSV A;  4A3L J;  2F5F A;  3W3C A;  1OQY A;  1T38 A;  2KMU A;  6PAX A;  2A05 A;  1IDZ A;  1SFX A;  3MAJ A;  1MMG A;  2HVQ A;  2QWW A;  3IUO A;  4HW0 A;  3R60 A;  1ON1 A;  2CUE A;  1RIO H;  2K3F A;  4I02 A;  3K6G A;  2M8G X;  3K4J A;  1UCR A;  3DKY A;  1X2M A;  2LH9 A;  1UEL B;  3HUG A;  4RM2 A;  3FK6 A;  3CCJ I;  3TED A;  1JJ6 C;  2HVS A;  2DCE A;  2JVG A;  1YO5 C;  4UY8 I;  5GTI C;  2VOO A;  1ONV A;  3VSL A;  4P55 A;  1Z7L A;  1K83 J;  4HDU A;  4EM1 A;  1GVJ A;  1T0F A;  2X6O A;  2K3P A;  2GZW A;  2KIS A;  4MFD A;  2ESH A;  3LWF A;  4MTD A;  1ORK A;  2R7O A;  2DK8 A;  2ZSI B;  4L9V A;  3LSR A;  5BMZ A;  3S17 J;  1I3Q J;  1W36 C;  2HTJ A;  1S9H A;  1XMK A;  1G3Y A;  2CFX A;  2DN0 A;  1ERD A;  1ZGW A;  2XF7 A;  2XAQ A;  4ENJ A;  2EIJ H;  1WJC A;  1IXR C;  2DAO A;  3S1R J;  4JK1 X;  1CF7 B;  4M9X A;  2X0L A;  4Z6Y A;  4V2G A;  1NG6 A;  2E5Z A;  5HS7 A;  1VND A;  5F1J A;  5K5O A;  2C6Y A;  2FJ1 A;  1LNW A;  2E1M C;  2XF5 A;  1VQ6 I;  1YRN B;  1RKT A;  1XB4 A;  4XLF A;  5EZG A;  4GYI A;  4M9Z A;  1ZGJ A;  5F08 A;  4D0P A;  4M74 A;  3CUO A;  3M9A A;  2VOP A;  4QTR A;  1MH4 A;  1HDP A;  2K27 A;  2Y48 A;  5FKL A;  3BRO A;  2R7U A;  2OD5 A;  4C3J J;  2IP2 A;  4I0A A;  4RAG A;  4L5J A;  3QP5 A;  4XM3 A;  1U9O A;  3V8L A;  2E34 A;  3BP8 A;  1ACI A;  5GPA A;  1VQN I;  4A3C J;  4E7L A;  3J7A Y;  1DU6 A;  5FRN A;  3I56 I;  4PSW A;  1W1W E;  1X4P A;  4QLC U;  4L9N A;  2HXO A;  4B47 A;  3H3U A;  2XAS A;  3AG2 H;  3FK7 A;  5TRD A;  2FQ3 A;  3J81 Z;  5JVG F;  1VQ9 I;  3CCS I;  1V3F A;  2K4J A;  4BQA A;  4OMY A;  5DUK A;  4CYC B;  1KU7 A;  1EF4 A;  4KN7 X;  4DYR A;  3REO A;  4IRI A;  3GZ6 A;  2ID3 A;  4PJL A;  2EIK H;  5E18 F;  2STW A;  4Q5S F;  2XDV A;  5D6F A;  4G94 A;  2VPL A;  4R8H A;  1J0R A;  4JOM A;  3I58 A;  4KMU X;  2JUC A;  4C3H J;  2EA4 A;  1RI7 A;  2MG4 A;  2IXS A;  1X58 A;  5GAD J;  5B66 C;  5IOY A;  5K5Q A;  3U1K A;  4S04 A;  3ZQH A;  2VC0 A;  1A5J A;  2K9M A;  2LRE A;  3NEU A;  4Y3O A;  5DCF A;  5IPA A;  2N8G A;  3FMQ A;  3KEO A;  4D1Q A;  2X9D A;  2XHK A;  4JX6 A;  1SAU A;  2DJI A;  3ESW B;  1YTY A;  1GUU A;  4FHT A;  3W6K B;  3OWT A;  4XLH A;  1MJA A;  2DFF A;  4BEH B;  3LSG A;  1HKQ A;  4FX0 A;  3O8H A;  4QWQ A;  5JVT A;  5J4Y A;  2AS5 F;  5HOD A;  4LOC A;  5L3D A;  3WG9 A;  1U8R A;  4M3D A;  4F93 B;  3OYG A;  1IN6 A;  1X3Z B;  4A6E A;  1WPK A;  2HZT A;  3K0L A;  4AVP A;  3ZQG A;  1XTA A;  5DUI A;  1JKR C;  1WJD A;  2L0K A;  1OFC X;  2HGC A;  3MVP A;  3OS1 A;  3VYU B;  2E5N A;  4HBL A;  2BBY A;  1A04 A;  3ZR8 X;  2P5V A;  1IRX A;  1MMS A;  3HB9 A;  5FKK A;  2IS4 A;  4NUB A;  2PI0 A;  5F0H A;  2V1D A;  3KLN A;  3S1Q J;  1XX5 A;  4BAY A;  4ESJ A;  4J19 A;  1SMT A;  1LVA A;  2KDO A;  4MQ9 F;  4A3G J;  3BT9 A;  1M1E B;  1GV2 A;  3ZQ7 A;  4B44 A;  1A31 A;  5KAF C;  2ISY A;  3GVA A;  1N25 A;  4LB6 B;  3KYD B;  3M1E A;  2DI3 A;  3TP0 A;  1F4K A;  3RPU A;  3KX2 A;  3GO5 A;  4IOC F;  5M3F J;  3HOU J;  2PMZ A;  2PJR B;  1YE9 A;  1B9N A;  4ZYG A;  2PMH A;  4LMY A;  3OY9 A;  1QZY A;  2PEX A;  5EGO A;  4WXH A;  4LD5 A;  1R6R A;  1YX3 A;  2KDZ A;  3HDD A;  2AQF A;  3CLQ A;  2NVU B;  1V54 H;  2WWY A;  2CV2 A;  1T56 A;  1TWF J;  3VOD A;  4GCV A;  4ABZ A;  5FLM J;  1ZG5 A;  1XMX A;  3LMM A;  5E8G A;  2E1M B;  3P5J A;  1O7L A;  3I59 B;  2YS9 A;  2L3D A;  3HSR A;  1SAX A;  2KRC A;  3C2H A;  2O6G E;  1DGR M;  1U9N A;  2LY1 A;  4Y15 A;  5H6R A;  3CO7 C;  5FRM A;  2KLO A;  3ABT A;  2BV6 A;  1EH6 A;  2ECC A;  5FO5 A;  3KZZ A;  1BC7 C;  2IA1 A;  2CFO A;  3RPU D;  3BG6 A;  2W84 A;  4E7K A;  1K78 B;  2VPR A;  4D5F A;  1OIS A;  1IN8 A;  3QOE A;  3BTC A;  3TOB A;  2ZXH A;  2A6H F;  3FF5 A;  4IJA A;  4CZC A;  5FGM A;  4M3E A;  3N97 A;  4R79 A;  2EZK A;  1MND A;  4Q47 A;  3ABU A;  2DTZ A;  3MKZ A;  3CQZ J;  5E3L A;  1H9T A;  4HRI A;  1RES A;  1FC3 A;  3MFK A;  4MIM A;  3L2R A;  1W7P D;  3CF2 A;  4LG0 B;  1UHW A;  2JZY A;  1XPX A;  2QQA A;  4XRS A;  3MZ8 A;  4RS8 A;  3BZC A;  1S6L A;  1BOB A;  2HEO A;  1ZK8 A;  3C1D A;  3DEE A;  3GWZ A;  5FFZ A;  3TDU C;  4U88 A;  1ULY A;  2ZKZ A;  5D5X B;  5J8C A;  5J1U A;  2P81 A;  3OIP A;  2HQN A;  2E1O A;  2MA3 A;  1E2X A;  3HHG A;  4WX9 A;  5ED4 A;  2DBB A;  2FU4 A;  4I01 A;  2WY7 Q;  2UXX A;  2EIL H;  2JUG A;  1ZRF A;  1S7O A;  3ASO H;  2EK5 A;  2Q8K A;  4LG0 A;  1IRF A;  2XGC A;  1OKR A;  3JW4 A;  4LLG F;  1J2X A;  2MD0 A;  3R0J A;  4CSW A;  2ADU A;  1YIO A;  3M7G A;  4WWC A;  3PIP F;  1B8I A;  5GAH J;  3J7Z I;  2OUM A;  1YI2 I;  2DW4 A;  1O4X A;  4UUS B;  3WTV C;  3HGG A;  4W97 A;  2CSO A;  4Y52 J;  4KIC A;  1D5Y A;  3FXL A;  2ZXJ A;  3KLO A;  4J00 A;  1AA7 A;  1C0W A;  2WA0 A;  2HOE A;  2VB6 A;  1TTY A;  2DA4 A;  1XCV A;  2JSC A;  2X51 A;  3FXU A;  3ZMV A;  4EJO A;  4ZH4 F;  4UB6 C;  2LKP A;  2M1B A;  1YOV B;  2LDU A;  2DOE A;  1LKX A;  4IQ4 A;  1ETO A;  1MH3 A;  4ZDP A;  3SZT A;  3RKW A;  2DQL A;  3BTI A;  3EDP A;  3QU3 A;  3UNG C;  1FYK A;  1LE8 A;  2HDD A;  2MH2 A;  2OZ6 A;  1U2W A;  3SDG A;  1XGO A;  2VXD A;  3SQN A;  2R5Y B;  3KIO A;  5H6Q A;  2OBP A;  4ESB A;  3HTU A;  1B59 A;  4JQF A;  5EDN A;  3PSI A;  3DKX A;  2ZFU A;  4QSH A;  1NG7 A;  3L00 A;  3QU6 A;  2XVC A;  5CVV A;  1HLV A;  1TT0 A;  4XRS G;  5DS9 A;  5EEH A;  3TL4 X;  1IZ1 A;  3EUH A;  2QQ8 A;  3BR3 A;  3S14 J;  3W2A A;  3SZP A;  3GTP J;  4N4O B;  2Y0S A;  1MJ9 A;  2R7S A;  5J8F A;  3M1C A;  4AIH A;  3TOA A;  4PFO A;  4QPO A;  2Z1D A;  5D6E A;  2R5Y A;  2DA5 A;  4PGG A;  4IQJ A;  4WXD A;  3BWG A;  1TW3 A;  4GDF A;  2X85 A;  3PQJ A;  1EH8 A;  4D9J A;  2MBF A;  2FOW A;  3GME A;  2Z33 A;  1OCZ H;  2JPC A;  2P7C B;  3CMM A;  5DEQ A;  1X1P A;  2XGX A;  1R58 A;  4OOI A;  3O2P E;  4FE7 A;  4FT8 A;  2ZB9 A;  3PNV A;  5DDG A;  3JTH A;  3DBL B;  1D1B A;  3GZ5 A;  4UUT A;  4C3I J;  2Q0O A;  5GP9 A;  2NNY A;  2D2W A;  2NOG A;  3CCQ I;  3QYF A;  4PJN A;  5BOX A;  1RRJ A;  2DOA A;  3DLA A;  5HS8 A;  5A2Q K;  2IRF G;  3DEW A;  1UZC A;  4JYK A;  2EZL A;  3KFW X;  5CQG A;  2KJC A;  2H27 A;  2F5V A;  2EV6 A;  2VOD A;  3SZG A;  3R61 A;  2KL4 A;  4L5I A;  2NS0 A;  3FM3 A;  2AQE A;  2M4G A;  1X1D A;  2O5R A;  1JXS A;  2IW5 A;  3BTJ A;  1KQ8 A;  3RYR A;  1KON A;  1X19 A;  1BA5 A;  1FIA A;  1QU3 A;  2ACJ A;  3FHN A;  4AD9 A;  2JTV A;  1FEX A;  4YEJ A;  4E7S A;  2JMW A;  1R00 A;  3GXO A;  2YX7 A;  1OYW A;  3L2U A;  1Z67 A;  1IAW A;  2E19 A;  1FSE A;  4BXF A;  1QPI A;  2ZME C;  3GW2 A;  3P9K A;  4IRH A;  2WAD A;  2HKX A;  3CUQ C;  1DU0 A;  1XSD A;  3SHF A;  2BEO A;  1OYY A;  2GLO A;  1I1S A;  2O8X A;  4RGU A;  4B3X A;  5DTD A;  3E97 A;  3DBR B;  3Q3S A;  5F04 A;  1KGS A;  5E17 F;  3ZN1 A;  1LFU P;  1W0T A;  3I9V 2;  3LQR A;  1AHD P;  3ONQ A;  2O8K A;  2KFD A;  2VJI A;  3O8G A;  1DP3 A;  4ON0 A;  3OYL A;  4X1E A;  2AO9 A;  3OYJ A;  2LVS A;  3IKV A;  3H92 A;  4R1H A;  4A0X A;  3ZPL A;  2MH9 A;  4CCN A;  1FX7 A;  2UV1 A;  2CG4 A;  3O6B B;  2O03 A;  1OCO H;  3BCA A;  1BJZ A;  2LG4 A;  1F43 A;  4HX4 A;  5DD8 A;  5JLW A;  4HEA 2;  1B4A A;  1V4R A;  3G1M A;  2KIU A;  5AON A;  3FZV A;  1PP7 U;  3F8N A;  5DCM A;  4HV5 A;  1NK3 P;  1WZ2 A;  1V5E A;  2OQG A;  5HOO A;  5JFR A;  1R9T J;  1MBH A;  3QP6 A;  4Z2Y A;  3SYT A;  4HA8 A;  2QQB A;  2R7Q A;  4UV8 A;  2IGK A;  2NS7 A;  3HKZ N;  1BL0 A;  4G7O F;  5D8L B;  1T0F C;  1R1T A;  4NHJ A;  4B4C A;  3LFU A;  4BBS J;  3CMA I;  3ZQL A;  1ZLJ A;  1I1G A;  2K9L A;  2VN2 A;  1E3O C;  4FE4 A;  3FMS A;  3ZXS A;  1EJ9 A;  2K9Q A;  3ZMZ A;  1B72 A;  3W6V A;  1FMW A;  3PIO F;  1YX5 A;  4A0Y A;  2QGU A;  5HVQ C;  1NH3 A;  4XOT A;  1PJR A;  2HQA A;  3OYC A;  1QNT A;  1REP C;  2A6T A;  5C44 J;  1HF0 A;  4FQG A;  5IP6 A;  1IN5 A;  3UR3 C;  3S2D J;  2KIF A;  5B1B H;  3GTK J;  4PJJ A;  3C2B A;  2B9S A;  2V26 A;  2VAS A;  2DOF A;  3Q0U A;  1R5H A;  4NC7 A;  3ZRG A;  1P6R A;  2NVQ J;  1OR7 A;  3BZK A;  3H5A A;  4IXA A;  2FEZ A;  1AKH A;  2LKS A;  3QOP A;  1VF9 A;  2PX9 A;  2Y0M A;  1ZRC A;  2JPB A;  3GCM A;  5LHH A;  5E20 A;  3H1C A;  2K85 A;  4IO9 F;  5D4R A;  4LJZ F;  2WAQ N;  3VYR B;  4A12 A;  2RVC A;  3E5Q A;  4KUM A;  5IP7 J;  3RKQ A;  3ECH A;  2D5V A;  4EM2 A;  1GV5 A;  2K86 A;  4P9U A;  2HZD A;  1TP4 A;  3D0S A;  3OR1 C;  2FMY A;  2PJP A;  3B02 A;  1TWH J;  3V8K A;  2FRH A;  2H1K A;  2TRT A;  1ZHF A;  4UVB A;  4DJA A;  2QBY A;  2JRT A;  3OSF A;  1TT5 B;  2O7O A;  3GEZ A;  1QHH D;  4IPA A;  5AIQ A;  3ABL H;  2L5Q A;  1JUM A;  1ZR4 A;  1TWG J;  4RBO A;  1QA6 A;  3CD6 I;  1SD4 A;  3VB2 A;  2H09 A;  4XK4 A;  4JP0 A;  2ZSH B;  1LEA A;  2GM4 A;  5LEJ A;  2NXN B;  2ZME B;  1G8X A;  2HYJ A;  3LSI A;  3CUQ B;  3DCF A;  4CCO A;  3HGY A;  3BC8 A;  2FNP A;  5LGN A;  4XKC A;  5GAG J;  3U1D A;  3CJQ B;  5K7H A;  3SFI A;  3KP4 A;  2DMP A;  4ZTF A;  3CF5 F;  4BJ6 C;  3TO7 A;  5FRO A;  1W5T A;  1BW6 A;  5HNH A;  3MN2 A;  2X1E A;  4G6D A;  2DA3 A;  3S93 A;  3VSK A;  2LK2 A;  5BQT A;  4P9F A;  4ENN A;  3M4O J;  2HOS A;  3RKX A;  4FCY A;  3WU2 C;  1MMN A;  1D8J A;  3F23 A;  4DYQ A;  3H5N A;  1KU2 A;  1TWA J;  4EJW A;  3CCL I;  3BPX A;  3BR2 A;  2W48 A;  4AYB A;  4XMY A;  3MZY A;  2R7D A;  1LDJ A;  4CA0 A;  2ZFW A;  2VBZ A;  4II3 A;  1VQO I;  4RAY A;  2Z5U A;  1PUE E;  4KIG A;  2YUS A;  1LQ1 A;  3G3Z A;  4UVA A;  2R7Z J;  1KA8 A;  3ERM A;  3I54 A;  3K1N A;  3SEZ A;  4AIJ A;  3ASN H;  3A01 A;  1AU7 A;  4L0Z B;  2CV0 A;  3HC7 A;  2W1O A;  3BTL A;  4IZZ A;  3DTE A;  1ZAR A;  5D5V B;  5M5W J;  2I10 A;  2OA4 A;  2R5Z A;  2WB1 N;  1L0O C;  4YII A;  1WCM J;  3A03 A;  1IV8 A;  5C4X J;  1STZ A;  2F4I A;  2IEK A;  2M2E A;  1BR1 A;  4RMN A;  1Y8Q B;  4BE1 A;  2ETH A;  3GTG J;  1D0Z A;  1FBU A;  2VBX A;  2I8D A;  3SJM A;  1P4X A;  2IGO A;  2IGM A;  1I50 J;  4LIV A;  1WSU A;  3J81 K;  2LR8 A;  2JA2 A;  2RAE A;  3HPG A;  1VQL I;  4AVZ A;  3K70 D;  1EA3 A;  5FLV A;  1O7F A;  2P0W A;  5JLX A;  1MDM A;  2PMU A;  3AG3 H;  5IYC J;  1PUF A;  1E3H A;  1ZRE A;  1IJW C;  2K9N A;  2LP0 A;  2VIX A;  4LIT A;  1IV6 A;  3LA3 A;  2MLG A;  3OYM A;  1JT0 A;  1IRG A;  2EFN A;  2HS5 A;  3Q9V A;  3DF8 A;  1FP2 A;  2HI3 A;  1MJB A;  1HDD C;  2V79 A;  4LLL A;  3JAM Z;  4GYG A;  1O57 A;  3B6C A;  3IH2 A;  5FD6 A;  2R7X A;  4U0V A;  1N78 A;  3MZH A;  2EIN H;  5D4S A;  1ZN2 A;  5EG0 A;  1FBQ A;  2QCO A;  3WGG A;  4BJ5 C;  1QQI A;  2KIQ A;  2DDB A;  2RGV A;  1Y56 A;  2CYY A;  5L3G A;  4CHU A;  2QSF X;  2KRH A;  3W2W A;  4OIR F;  3IHU A;  3BQY A;  5K7Z A;  3BOQ A;  5F64 A;  3HYI A;  3V7C A;  4A3E J;  1PYV A;  4RLF A;  2IBD A;  3PJR A;  3ML6 A;  3QYE A;  4X6A J;  4M3B A;  4Q4Z F;  4OWR B;  4IVN A;  1TQP A;  3QPH A;  1D8K A;  1UB9 A;  5BS6 A;  2BY1 A;  1G6N A;  4E7J A;  3CCE I;  2DA6 A;  4HQE A;  1VTN C;  2F4O B;  3F21 A;  2DT7 B;  1Z77 A;  4M6X A;  3NAU A;  1B1B A;  4U0W A;  2VUM J;  4MO7 A;  1R5G A;  1IN4 A;  1Z21 A;  1Y1W J;  2F5D A;  3HJE A;  3H0D A;  2A69 F;  4D7M A;  1ODD A;  2HQR A;  4CZZ A;  2EFO A;  3LQQ A;  2VKE A;  1S8N A;  4KA4 A;  5EF6 A;  4IF4 A;  2LLK A;  1KYZ A;  1FSH A;  2BHZ A;  2RKH A;  1RKW A;  3SEQ A;  1JGG A;  2L9S A;  1SFE A;  4O6J A;  3WU1 B;  4IEJ A;  3DLL F;  1ZQ3 P;  1FJL A;  4A0Z A;  5TIS C;  3TO6 A;  2OU2 A;  1HKT A;  2W24 A;  4G8X A;  3CMY A;  1P4W A;  3HRT A;  1D0X A;  1FYM A;  2EV5 A;  3BY6 A;  2W4S A;  1F36 A;  1UMQ A;  1RZ4 A;  4F7Z A;  3S15 J;  1WQ2 A;  2G7H A;  2XF6 A;  3K10 A;  2L9V A;  4BNC A;  1T08 B;  1ZEL A;  4HNU A;  1HQC A;  2AXL A;  2XPU A;  2OCC H;  3MD2 A;  4XN3 A;  4P1W A;  4A5M A;  1HW1 A;  5LFA A;  4ANJ A;  3IP4 B;  4LK1 F;  4EVI A;  3F8F A;  3OYE A;  1E17 A;  3KP3 A;  2FOK A;  2PQ8 A;  3HOZ J;  2G7U A;  3U2R A;  3HSF A;  4ZYE A;  1SD7 A;  1R5I D;  2JRM A;  4NQW B;  2H1L A;  4XLP F;  1FMV A;  3RYP A;  4A5N A;  2JK3 A;  3RZO J;  3B6A A;  3EUH C;  5B3S H;  2V9K A;  4EAT A;  5GAE J;  1GHC A;  3H9Q A;  3IV5 A;  1KYW A;  4I0B A;  3LSP A;  1TNS A;  5E3N A;  5HS9 A;  4RB0 A;  3FXO A;  5HDG A;  2EZH A;  2B7E A;  2VQG A;  3ISP A;  2KIM A;  4CCL A;  1XG1 A;  1FBS A;  5EGO B;  3DPT A;  5E79 C;  1G3S A;  3DPU A;  4DBQ A;  5DD4 A;  2LC2 A;  2EBI A;  2W85 A;  2HDC A;  1VQ4 I;  2XAU A;  2FNA A;  1R1V A;  4XSX F;  2HXI A;  2LD5 A;  5K1Y A;  4M72 A;  2OC6 A;  4NQW A;  4LFU A;  3WE2 A;  4CO8 A;  5L3E A;  2MC4 A;  1E3P A;  3GUD A;  5LHI A;  2H94 A;  2LY2 A;  3FIS A;  1YS7 A;  2ZNZ A;  3NAR A;  3S16 J;  3CES A;  5CYV A;  1XS9 A;  4PSX A;  1YYV A;  3ZQQ A;  1EH7 A;  4YRV A;  2M5W A;  3GTL J;  2R7V A;  4BYY A;  4BDY A;  1W7P A;  5LRR A;  4BJT A;  5C4J J;  2UZK A;  1LDK B;  1R36 A;  3GLL A;  5EEG A;  4ZDL A;  4IHS A;  4C2U A;  5LHG A;  2MD5 A;  4OIP F;  3K4K A;  4ITV A;  4L5E A;  2VQL A;  4S0H B;  2D1V A;  4KIF A;  3EET A;  2V6C A;  1TL8 A;  3PUB A;  1R1U A;  4I6Z A;  4BH9 A;  1K6O A;  3HRM A;  1MZB A;  3GZN B;  3LSM A;  4QPQ A;  1RR7 A;  2DJN A;  4P5O A;  3EYY A;  2K40 A;  1X3W B;  2P6S A;  1HST A;  3GLX A;  2H8R A;  4OMZ A;  1S29 A;  4HSR A;  2DMT A;  1SFO J;  2PMZ N;  2Q1Z B;  2DO7 A;  4IRG A;  3I0T A;  1XDS A;  3ZMS A;  3GFI A;  2KT0 A;  1MGT A;  2CQX A;  5L3C A;  2HPI A;  2GWR A;  1KU9 A;  4I2O A;  3HXL A;  4I7H A;  2TDX A;  4KYW A;  4KIT B;  1B8I B;  1XGS A;  4HQM A;  2QQ9 A;  1H0M A;  3X2Q H;  2V9P A;  1QBJ A;  2NVX J;  1G4D A;  5TJJ A;  1VQ5 I;  3FMR A;  3I71 A;  3QQA A;  3GFM A;  4RAZ A;  5D8K B;  3E5U A;  1VI0 A;  3H9G A;  3MKY B;  4L18 B;  4A3K J;  3JSO A;  2CRG A;  2M30 A;  1FZP B;  3DPL C;  2ZO4 A; 
#chains in the Genus database with same CATH homology
 3IL2 A;  1HSJ A;  1Z05 A;  2R7F A;  3WOD F;  2A68 F;  1Y0U A;  1D3Y A;  1YG2 A;  3VEP A;  1AWC A;  4OIQ F;  2MC3 A;  1QZZ A;  2VE9 A;  5IT9 Z;  4KFC A;  5CLS A;  4RB2 C;  4WK8 F;  2YR2 A;  3OOP A;  1U5T A;  1PP8 F;  2DPD A;  1RUN A;  3COA C;  2EJR A;  3KP5 A;  4UNO A;  1WRJ A;  2IVM A;  3FM5 A;  3F3X A;  1S7A A;  4UXN A;  2L4M A;  3F8B A;  1XD7 A;  1FYL A;  1QO0 D;  2PBI A;  4DNC A;  3ZP5 A;  2FE3 A;  2LF8 A;  3K69 A;  2HYF A;  2FSW A;  2Z99 A;  2OZU A;  2P5K A;  5JHU A;  3HRU A;  2NRA C;  3F8C A;  2IJL A;  5CJ9 A;  3DXJ F;  4UV9 A;  1EV7 A;  2YPR A;  1BN5 A;  4CDG A;  1B6A A;  3C18 A;  3FXQ A;  4GGG A;  1LJ9 A;  3RDI A;  1ZAO A;  5JR3 A;  5BPI A;  1U3E M;  2HTS A;  1MKM A;  4HDV A;  3LAP A;  2E1C A;  3L2C A;  4HOB A;  2XV4 S;  1TQI A;  2EFP A;  5D5W B;  2FA5 A;  1U6G A;  1J7K A;  2F5C A;  5H20 A;  4NB5 A;  4KT5 C;  1S3J A;  3TO9 A;  3WTU C;  1XSX A;  3PQK A;  1RUO A;  5ICG A;  2Q2E A;  3P7N A;  2EB7 A;  5DCM B;  2UXN A;  5CVU A;  2ISZ A;  4G9Y A;  3ECO A;  2ESN A;  4BHC A;  4A6D A;  5HLI A;  1SD6 A;  1JE8 A;  2A07 F;  3K2Z A;  3LA7 A;  4KN4 X;  4UUV A;  3CJN A;  1G3W A;  3R6S A;  4MQV A;  2DPU A;  1FOK A;  3T0Y A;  2DK5 A;  4LLN A;  1Z91 A;  5J6X A;  1JGS A;  2LF7 A;  2VE8 A;  1P92 A;  5LEK A;  3WTW C;  1F1Z A;  3DV8 A;  1O3T A;  2DQR A;  3CLO A;  1HKS A;  5ICC A;  4AWX B;  4PDK A;  3LA2 A;  2WC2 A;  2UWM A;  2GA2 A;  5LRS A;  4S05 A;  2ELH A;  2OAZ A;  3VOE A;  4YFN F;  1WKM A;  1BI0 A;  4MHG A;  3HOS A;  4YIF A;  1GXQ A;  4H0E A;  2QBY B;  2EV0 A;  4XSZ F;  2XKO A;  2EWN A;  1FP1 D;  4L9T A;  5L3F A;  4HLX A;  3ROU A;  1I6X A;  3BJA A;  1TQM A;  2COM A;  1T2K A;  4U0Y A;  2RQP A;  2E7W A;  3KZY A;  3ZN0 A;  4O3M A;  5F6F A;  2OQR A;  2YX4 A;  1ZRD A;  3WTZ A;  1U78 A;  2W57 A;  1O3R A;  1KQ9 A;  2QLZ A;  3VFZ A;  2KKO A;  4I98 B;  1FWZ A;  1JHF A;  1H9G A;  3U9G A;  2XRN A;  2DU9 A;  2YSR A;  5FFX A;  5HLH A;  1YQA A;  3C3W A;  2E7X A;  1HW5 A;  3M8E A;  2BGC A;  1FT9 A;  1R23 A;  1DPR A;  3JAM K;  2PN6 A;  1L3L A;  2FBK A;  4G7Z F;  4U7B A;  2QM3 A;  3RKY A;  4U7D A;  3V4G A;  2K4B A;  5E1W A;  3B73 A;  2Y75 A;  4EQQ A;  3QAH A;  5HDK A;  1HXD A;  3RPQ A;  1Q1H A;  2XIG A;  3C7J A;  3FXR A;  1J9I A;  1KU3 A;  2HFH A;  2NNN A;  3K1P A;  1TNT A;  3BZ6 A;  1BC8 C;  3ZMD A;  1MDM B;  4UVC A;  4LK0 F;  2QYO A;  4WXC A;  2RC4 A;  5K5R A;  3J80 Z;  4YFK F;  2EA2 A;  3FWE A;  4RGS A;  4N9I A;  3MWM A;  4ENK A;  1BBY A;  4LGW A;  3E6M A;  4G7H F;  1UFM A;  3IRR A;  3CTA A;  3G73 A;  3BPV A;  5FLX Z;  4KNY A;  4GO1 A;  2FXA A;  2D45 A;  4ENM A;  3LFK A;  3WU0 A;  5CVJ A;  3N4M A;  3IKT A;  5CVR A;  1FLI A;  1RNL A;  5ILV A;  4OIO F;  1K7A A;  5BPD A;  1BI3 A;  2ZCW A;  4OU0 A;  3E5X A;  3K9T A;  1IXC A;  1OMI A;  4BXU A;  2RNJ A;  5AIP A;  3PFI A;  3JTG A;  2XRO A;  2IT0 A;  1KQ0 A;  3F6O A;  1JHH A;  3HRS A;  4GXO A;  2JT1 A;  2IPQ X;  2O3F A;  4MGR A;  2QEN A;  1J75 A;  3F6V A;  3BJO A;  4MTE A;  2IA0 A;  4EGY A;  2STT A;  2J5O A;  5F1R A;  2F2E A;  5ICE A;  5FB2 A;  1CF7 A;  1AOY A;  1ON2 A;  2QVO A;  2WV0 A;  1BIB A;  1IF1 A;  1UST A;  4FX4 A;  2GXB A;  1BOA A;  3TGN A;  1T98 A;  5D5U B;  2V1X A;  3V8J A;  2PLY A;  2X4H A;  2L54 A;  3ZMT A;  1XGN A;  4CXF A;  1U5T C;  2A61 A;  5KVR A;  3V7R A;  3FHZ A;  4M73 A;  1DUX C;  2WTE A;  5LBQ A;  5LGT A;  3L09 A;  3F72 A;  3KP2 A;  2CO5 A;  4O5V A;  2K7L A;  3MCZ A;  1YW8 A;  5E1Z B;  3F22 A;  3P9C A;  2HKO A;  4WF2 A;  3HOT A;  4YFX F;  1R22 A;  5DV5 A;  4L9J A;  4RGX A;  3K1M A;  4Y17 A;  1DP7 P;  3SXY A;  4A2U A;  3J7A O;  4N9H A;  1W7P B;  1YW7 A;  1ZH5 A;  4Y13 A;  3KCC A;  3L7W A;  2L4A A;  2VC1 A;  3NRV A;  3RI4 A;  4EV0 A;  4CYD A;  3WE3 A;  1OYI A;  5LGU A;  4PGH A;  3LAJ A;  2QZ8 A;  2GIV A;  3DQV C;  4HV6 A;  4B8X A;  1P4A A;  4RGR A;  2RDP A;  3RTR A;  2FBH A;  3R0A A;  4BHP A;  1QPM A;  4XLN F;  1CGP A;  1IN7 A;  4HF0 A;  1MD0 A;  5IT9 K;  2GXG A;  4TV7 A;  3KE2 A;  3MEX A;  1Z1D A;  3IRQ A;  4HX7 A;  4ZZD A;  3DKW A;  1YLF A;  2L01 A;  4K2E A;  5ERI A;  4N0B A;  2E1N A;  3E6C C;  3W6J B;  2VT2 A;  3LST A;  4KMF A;  3I4P A;  4M6Y A;  1WI9 A;  2CWE A;  1WWX A;  1FNN A;  2A5Y B;  1X3U A;  1F9N A;  4EM0 B;  5HLG A;  2VT3 A;  2DFI A;  3ULQ B;  2XAF A;  1IW7 F;  3KET A;  4AIK A;  1IUY A;  3I59 A;  1K79 A;  2KJB A;  4LB5 A;  1DDN A;  1TBX A;  3O3K A;  2CGP A;  2VON A;  3EYI A;  1U5T B;  5ICF A;  1XMA A;  1K78 A;  1HW2 A;  2ZBK A;  2V9V A;  3I5U A;  3R4K A;  2R3S A;  1DPU A;  1USS A;  3QPT A;  1W4M A;  5IT3 A;  1D5V A;  3GF2 A;  3E3V A;  3WGH A;  4KIB A;  3Q9S A;  3HTS B;  2P8T A;  5CVI A;  3OV8 A;  1T39 A;  3D5L A;  2DT5 A;  4YG2 F;  1YFH A;  4MEY F;  1P2F A;  2YU3 A;  3WTY C;  3GFJ A;  1BM9 A;  1Z9C A;  1W5S A;  3RJP A;  4G6Q A;  1SFU A;  3T8T A;  2BE5 F;  1Z6T A;  2PFB A;  1I27 A;  3HHH A;  1SD5 A;  4XBF A;  1BJA A;  2O61 A;  5ILS A;  1ZG3 A;  3GYH X;  2NAZ A;  4EGZ A;  1O3Q A;  3KEQ A;  3I53 A;  1I5Z A;  3IWZ A;  3EQL F;  2B0L A;  3QRF F;  4B09 A;  1FPQ A;  2GA1 A;  5FD5 A;  4M9S A;  2G9W A;  2F5E A;  4ZYD A;  4M71 A;  1J5Y A;  2PG4 A;  3NQO A;  2HR3 A;  4RB1 A;  4XRF A;  2P6T A;  1HBX G;  2GAU A;  4HZF A;  3BDD A;  4Q48 A;  4DQ2 A;  4BHB A;  4HF1 A;  2VBY A;  2O0Y A;  4ZZL A;  4WCG A;  4EMS A;  3CO6 C;  3SFZ A;  2XAJ A;  2DTR A;  2XAH A;  4RB3 C;  2P5L C;  1F5T A;  4HAM A;  4MNU A;  1ZG1 A;  2L02 A;  2LNB A;  2M87 A;  1YW9 A;  3JSP A;  2MLK A;  2ZNY A;  2M8E A;  3KP6 A;  3V7S A;  2H6B A;  2GQQ A;  3E6B A;  3TKY A;  3F8M A;  3WTS C;  3KP7 A;  1Z6R A;  3H3Z A;  1ZLK A;  2FML A;  2HYG D;  3WTT C;  2BYV E;  2DLL A;  5E8I A;  3HSE A;  1LB2 A;  4HF2 A;  4CIC A;  5ILU A;  4JBA A;  3E6D A;  1G3T A;  2LSO A;  3ERE D;  3AAF A;  3T1B A;  2RN7 A;  2XKP A;  1LDD A;  3GFL A;  3WGI A;  3WTX C;  5HDN A;  4EJU A;  2J5P A;  2A3S A;  5A2Q Z;  4ESF A;  2IA2 A;  2EFW A;  2P4W A;  1SMY F;  2CW0 F;  1QGP A;  4IHT A;  3ELK A;  1GXP A;  1TW2 A;  1LEB A;  4HLY A;  2FF4 A;  4KDP A;  3GX4 X;  3RIR A;  1ZYR F;  2Z9O A;  1B9M A;  2CQK A;  1PDN C;  2HWV A;  2QUF A;  3CDH A;  2XAG A;  5JI6 A;  1YS6 A;  2P7V B;  4MEX F;  1UHM A;  2VBW A;  1BIA A;  4EJT A;  3T8R A;  2D1H A;  4HYE A;  2A6E F;  4ZYH A;  2M45 A;  3HIF A;  1FY7 A;  4ASN A;  1OPC A;  1XDU A;  1ZGA A;  4UHT A;  3TDZ C;  3IWF A;  3MQ0 A;  4PCQ A;  3L9F A;  3J80 K;  1XGM A;  2XUB A;  3Q5F A;  2V1U A;  4HX8 A;  1XN7 A;  2NYX A;  1BI1 A;  4EJV A;  1R7J A;  2EFQ A;  1J59 A;  3ZMU A;  2ZJ2 A;  5DYM A;  2K02 A;  3M8F A;  5KK1 A;  5LLQ A;  1IXS B;  4P96 A;  3BJ6 A;  2Z3Y A;  1NHA A;  5FLX K;  3DP7 A;  3IC7 A;  3T5X A;  1BI2 A;  2RV8 A;  4OIN F;  3FX3 A;  1XCB A;  3I64 A;  4ETS A;  5L3B A;  3S2W A;  4CGZ A;  1Z7U A;  2W25 A;  4I09 A;  1TLH B;  3TQN A;  2VXZ A;  2KRF A;  3DEU A;  2ZME A;  3P9I A;  3CUQ A;  2H6C A;  4E70 A;  1O3S A;  3DFG A;  2FBI A;  5E1X A;  4PZJ A;  1T6S A;  4L0Y B;  1XSV A;  2F5F A;  1T38 A;  6PAX A;  1SFX A;  3MAJ A;  2QWW A;  4HW0 A;  3R60 A;  1ON1 A;  1RIO H;  4I02 A;  1UCR A;  3HUG A;  1YO5 C;  2VOO A;  1ONV A;  4P55 A;  4HDU A;  4EM1 A;  1GVJ A;  1T0F A;  2GZW A;  2ESH A;  3LWF A;  4MTD A;  2DK8 A;  4L9V A;  5BMZ A;  2HTJ A;  1XMK A;  1G3Y A;  2CFX A;  4ENJ A;  2XAQ A;  1IXR C;  2DAO A;  1CF7 B;  4JK1 X;  4M9X A;  2X0L A;  5HS7 A;  2C6Y A;  5K5O A;  1LNW A;  1XB4 A;  4GYI A;  4M9Z A;  1ZGJ A;  4D0P A;  4M74 A;  3CUO A;  3M9A A;  2VOP A;  2K27 A;  2Y48 A;  3BRO A;  2OD5 A;  2IP2 A;  4I0A A;  4L5J A;  3QP5 A;  3V8L A;  3BP8 A;  4QLC U;  4L9N A;  3H3U A;  2XAS A;  5TRD A;  2FQ3 A;  3J81 Z;  1V3F A;  2K4J A;  4BQA A;  4OMY A;  5DUK A;  1KU7 A;  4KN7 X;  3REO A;  4IRI A;  3GZ6 A;  5E18 F;  2STW A;  4Q5S F;  5D6F A;  4G94 A;  4R8H A;  1J0R A;  3I58 A;  4KMU X;  2EA4 A;  1RI7 A;  5K5Q A;  4S04 A;  2VC0 A;  3NEU A;  5DCF A;  3FMQ A;  3KEO A;  2XHK A;  1YTY A;  4FHT A;  3W6K B;  1MJA A;  5JVT A;  1HKQ A;  4FX0 A;  4QWQ A;  2AS5 F;  5L3D A;  3WG9 A;  1U8R A;  1IN6 A;  4A6E A;  2HZT A;  3K0L A;  4AVP A;  5DUI A;  2HGC A;  4HBL A;  2BBY A;  1A04 A;  2P5V A;  2PI0 A;  2V1D A;  3KLN A;  4BAY A;  4ESJ A;  1SMT A;  1LVA A;  4MQ9 F;  3ZQ7 A;  2ISY A;  3GVA A;  4LB6 B;  3M1E A;  1F4K A;  2DI3 A;  3RPU A;  3GO5 A;  1B9N A;  4ZYG A;  2PMH A;  4LMY A;  1QZY A;  2PEX A;  4WXH A;  4LD5 A;  2WWY A;  3VOD A;  4GCV A;  1ZG5 A;  5E8G A;  1O7L A;  3I59 B;  2L3D A;  3HSR A;  1SAX A;  2O6G E;  4Y15 A;  5H6R A;  3CO7 C;  3ABT A;  2BV6 A;  1EH6 A;  5FO5 A;  3KZZ A;  1BC7 C;  2IA1 A;  2W84 A;  1K78 B;  1IN8 A;  3TOB A;  3FF5 A;  2A6H F;  4IJA A;  5FGM A;  3N97 A;  4R79 A;  4Q47 A;  3ABU A;  1H9T A;  1FC3 A;  3MFK A;  1W7P D;  4LG0 B;  1UHW A;  2JZY A;  2QQA A;  4RS8 A;  1S6L A;  2HEO A;  3C1D A;  3GWZ A;  5FFZ A;  3TDU C;  4U88 A;  1ULY A;  2ZKZ A;  5D5X B;  5J8C A;  2HQN A;  2MA3 A;  3HHG A;  1E2X A;  4WX9 A;  5ED4 A;  2DBB A;  2FU4 A;  4I01 A;  2UXX A;  1ZRF A;  1S7O A;  2EK5 A;  2Q8K A;  4LG0 A;  1IRF A;  3JW4 A;  1OKR A;  4LLG F;  1J2X A;  3R0J A;  2ADU A;  1YIO A;  3M7G A;  4WWC A;  2DW4 A;  3WTV C;  2CSO A;  4KIC A;  3KLO A;  2ZXJ A;  1C0W A;  2HOE A;  4EJO A;  1TTY A;  1XCV A;  2JSC A;  3ZMV A;  3FXU A;  4ZH4 F;  2LKP A;  2M1B A;  2LDU A;  3SZT A;  3RKW A;  2DQL A;  3EDP A;  3QU3 A;  1FYK A;  2MH2 A;  2OZ6 A;  1U2W A;  1XGO A;  3SQN A;  5H6Q A;  4ESB A;  2OBP A;  3HTU A;  1B59 A;  4JQF A;  3L00 A;  3QU6 A;  2XVC A;  5CVV A;  5EEH A;  1IZ1 A;  3EUH A;  3SZP A;  1MJ9 A;  5J8F A;  4AIH A;  3TOA A;  5D6E A;  4PGG A;  4WXD A;  3BWG A;  1TW3 A;  3PQJ A;  1EH8 A;  2MBF A;  2Z33 A;  2JPC A;  2P7C B;  5DEQ A;  2XGX A;  1R58 A;  4OOI A;  3O2P E;  4FT8 A;  5DDG A;  3JTH A;  3GZ5 A;  2Q0O A;  2NNY A;  2D2W A;  5BOX A;  5HS8 A;  5A2Q K;  2IRF G;  3KFW X;  2KJC A;  2H27 A;  2EV6 A;  2VOD A;  3R61 A;  4L5I A;  2NS0 A;  3FM3 A;  1JXS A;  2IW5 A;  1KQ8 A;  3RYR A;  2ACJ A;  4AD9 A;  2JTV A;  1R00 A;  3GXO A;  2YX7 A;  1OYW A;  1IAW A;  1FSE A;  3GW2 A;  3P9K A;  4IRH A;  2HKX A;  3CUQ C;  1XSD A;  3SHF A;  2BEO A;  1OYY A;  1I1S A;  2O8X A;  4RGU A;  3E97 A;  1KGS A;  5E17 F;  3ZN1 A;  3LQR A;  4ON0 A;  3IKV A;  3H92 A;  4R1H A;  4A0X A;  3ZPL A;  2MH9 A;  1FX7 A;  3O6B B;  2CG4 A;  2O03 A;  4HX4 A;  5DD8 A;  1B4A A;  1V4R A;  2KIU A;  5AON A;  3FZV A;  1PP7 U;  3F8N A;  5DCM A;  4HV5 A;  2OQG A;  5HOO A;  5JFR A;  3QP6 A;  4Z2Y A;  4HA8 A;  2QQB A;  4UV8 A;  4G7O F;  5D8L B;  1R1T A;  4NHJ A;  1ZLJ A;  1I1G A;  2VN2 A;  3FMS A;  3ZMZ A;  4A0Y A;  5HVQ C;  1REP C;  1QNT A;  1IN5 A;  2KIF A;  1R5H A;  1P6R A;  1OR7 A;  4IXA A;  2FEZ A;  3QOP A;  2Y0M A;  1ZRC A;  2JPB A;  5LHH A;  5E20 A;  5D4R A;  4LJZ F;  4A12 A;  2RVC A;  3E5Q A;  4KUM A;  3ECH A;  4EM2 A;  2K86 A;  4P9U A;  3D0S A;  2FMY A;  2PJP A;  3B02 A;  3V8K A;  2FRH A;  1ZHF A;  4UVB A;  2QBY A;  2JRT A;  3GEZ A;  4IPA A;  5AIQ A;  1SD4 A;  3VB2 A;  2H09 A;  1LEA A;  5LEJ A;  2ZME B;  3CUQ B;  2FNP A;  5LGN A;  3U1D A;  3KP4 A;  3TO7 A;  1W5T A;  4G6D A;  5BQT A;  4P9F A;  4ENN A;  3RKX A;  1D8J A;  3F23 A;  1KU2 A;  4EJW A;  3BPX A;  3MZY A;  2R7D A;  1LDJ A;  2ZFW A;  2VBZ A;  4RAY A;  2Z5U A;  1PUE E;  4KIG A;  1LQ1 A;  3G3Z A;  4UVA A;  1KA8 A;  3I54 A;  3K1N A;  4AIJ A;  4L0Z B;  1ZAR A;  5D5V B;  2OA4 A;  1L0O C;  4YII A;  1STZ A;  2ETH A;  1FBU A;  2VBX A;  1P4X A;  1WSU A;  3J81 K;  1O7F A;  1MDM A;  2PMU A;  1ZRE A;  3LA3 A;  2MLG A;  1IRG A;  2EFN A;  2HS5 A;  3Q9V A;  3DF8 A;  1FP2 A;  1MJB A;  2V79 A;  4LLL A;  3JAM Z;  4GYG A;  1O57 A;  5FD6 A;  4U0V A;  3MZH A;  5D4S A;  1ZN2 A;  1FBQ A;  3WGG A;  1QQI A;  2RGV A;  5L3G A;  2CYY A;  4CHU A;  4OIR F;  3IHU A;  3BOQ A;  5F64 A;  3HYI A;  3V7C A;  3ML6 A;  4Q4Z F;  4IVN A;  1TQP A;  3QPH A;  1D8K A;  1UB9 A;  5BS6 A;  1G6N A;  4HQE A;  1VTN C;  3F21 A;  4M6X A;  1B1B A;  4U0W A;  1R5G A;  1IN4 A;  2F5D A;  2A69 F;  1ODD A;  2HQR A;  4CZZ A;  2EFO A;  3LQQ A;  1S8N A;  4KA4 A;  4IF4 A;  1KYZ A;  1FSH A;  2RKH A;  1SFE A;  4O6J A;  3WU1 B;  4A0Z A;  3TO6 A;  2OU2 A;  1HKT A;  2W24 A;  4G8X A;  1P4W A;  3HRT A;  1FYM A;  2EV5 A;  3BY6 A;  1RZ4 A;  4F7Z A;  1WQ2 A;  2G7H A;  4BNC A;  1HQC A;  2AXL A;  4A5M A;  1HW1 A;  4LK1 F;  4EVI A;  3F8F A;  1E17 A;  3KP3 A;  2FOK A;  2PQ8 A;  2G7U A;  3U2R A;  3HSF A;  4ZYE A;  1SD7 A;  4XLP F;  3RYP A;  4A5N A;  1GHC A;  1KYW A;  4I0B A;  1TNS A;  5HS9 A;  4RB0 A;  5HDG A;  3ISP A;  2KIM A;  1FBS A;  3DPT A;  1G3S A;  5DD4 A;  2W85 A;  2HDC A;  2FNA A;  1R1V A;  4XSX F;  5K1Y A;  4M72 A;  4NQW A;  4LFU A;  3WE2 A;  4CO8 A;  5L3E A;  3GUD A;  5LHI A;  2H94 A;  1YS7 A;  2ZNZ A;  5CYV A;  1YYV A;  1EH7 A;  2M5W A;  4BYY A;  1W7P A;  5LRR A;  2UZK A;  1LDK B;  1R36 A;  5EEG A;  4IHS A;  5LHG A;  2MD5 A;  4OIP F;  2D1V A;  4KIF A;  3EET A;  2V6C A;  1R1U A;  4BH9 A;  1K6O A;  3HRM A;  1MZB A;  4P5O A;  3EYY A;  2P6S A;  1HST A;  3GLX A;  4OMZ A;  1S29 A;  2DO7 A;  4IRG A;  3I0T A;  1XDS A;  3ZMS A;  3GFI A;  1MGT A;  5L3C A;  2GWR A;  1KU9 A;  4I2O A;  4I7H A;  2TDX A;  4KYW A;  1XGS A;  4HQM A;  2QQ9 A;  1H0M A;  1QBJ A;  1G4D A;  5TJJ A;  3FMR A;  3I71 A;  5D8K B;  3GFM A;  4RAZ A;  3E5U A;  4L18 B;  3JSO A;  2M30 A;  1FZP B;  3DPL C;  2ZO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...